WorldWideScience

Sample records for berkelium 248

  1. Chemistry of berkelium: a review

    International Nuclear Information System (INIS)

    Hobart, D.E.; Peterson, J.R.

    1985-01-01

    Element 97 was first produced in December 1949, by the bombardment of americium-241 with accelerated alpha particles. This new element was named berkelium (Bk) after Berkeley, California, the city of its discovery [Thompson, Ghiorso, and Seaborg, Phys. Rev. 77, 838 (1950); 80, 781 (1950)]. In the 36 years since the discovery of Bk, a substantial amount of knowledge concerning the physicochemical properties of this relatively scarce transplutonium element has been acquired. All of the Bk isotopes of mass numbers 240 and 242 through 251 are presently known, but only berkelium-249 (β - decay, 0.125 MeV, t/sub 1/2/ = 325 days) is available in sufficient quantities for bulk chemical studies. About 0.7 gram of this isotope has been isolated at the HFIR/TRU Complex in Oak Ridge, Tennessee in the last 18 years. Over the same time period, the scale of experimental work using berkelium-249 has increased from the tracer level to bulk studies at the microgram level to solution and solid state investigations with milligram quantities. Extended knowledge of the physicochemical behavior of berkelium is important in its own right, because Bk is the first member of the second half of the actinide series. In addition, such information should enable more accurate extrapolations to the predicted behavior of heavier elements for which experimental studies are severely limited by lack of material and/or by intense radioactivity

  2. Citric complexes of trivalent cerium and berkelium

    International Nuclear Information System (INIS)

    Boulhassa, S.

    1977-01-01

    The extraction by thenoyltrifluoroacetone (TTA) in benzene of trivalent cerium, berkelium and californium, at the indicator scale, hydrolysis and complexation by citric acid of these cations are studied. The radionuclides used were 144 Ce, 249 Bk and 249 Cf respectively γ, β and α emitters. The solvent extraction technique of the elements by TTA in benzene from a perchloric medium at the ionic stength 0.1 was employed. The distribution coefficients D were measured by the γ, β or α radiometry. Cerium and berkelium, which have a comparable redox behavior, show in solution a relatively stable valency IV. Therefore the study by solvent extraction of their trivalent form required the standing up of complete reducing conditions of these elements and their stabilization in solution at the valency III. The thermodynamic data obtained for berkelium and californium contribute to understand the chemistry of these elements and permit to complete the third 'tetrad branch' of 5f elements from Cm 3+ to Es 3+ . This tetrad effect is a manifestation of thermodynamic consequence of the 'nephelauxetic effect'. As for Ce(III), the data confirm the pronounced acid property and may be show no neglected ligand effect for f 1 configuration [fr

  3. Berkelium (4) and cerium (4) extraction with tertiary amines

    International Nuclear Information System (INIS)

    Milyukova, M.S.; Malikov, D.A.; Myasoedov, B.V.

    1978-01-01

    Oxidation of indicator quantities of berkelium and cerium by a mixture of silver nitrate and ammonium persulfate in the solutions of nitric and sulfuric acid has been examined. The stability of the elements in a tetravalent state and their extraction by the solutions of ternary amines have been investigated. It has been established that berkelium and cerium oxidation under these conditions occurs under the effect of ions of divalent silver which is formed owing to oxidation of monovalent silver by peroxide sulfate ions. The following supposition has been put forward: a difference in the behaviour of tetravalent berkelium and cerium during their extraction by ternary amines is explained by their different stability in this state, but not by the formation of complex compounds with nitrate ions

  4. Chelation and stabilization of berkelium in oxidation state +IV

    Science.gov (United States)

    Deblonde, Gauthier J.-P.; Sturzbecher-Hoehne, Manuel; Rupert, Peter B.; An, Dahlia D.; Illy, Marie-Claire; Ralston, Corie Y.; Brabec, Jiri; de Jong, Wibe A.; Strong, Roland K.; Abergel, Rebecca J.

    2017-09-01

    Berkelium (Bk) has been predicted to be the only transplutonium element able to exhibit both +III and +IV oxidation states in solution, but evidence of a stable oxidized Bk chelate has so far remained elusive. Here we describe the stabilization of the heaviest 4+ ion of the periodic table, under mild aqueous conditions, using a siderophore derivative. The resulting Bk(IV) complex exhibits luminescence via sensitization through an intramolecular antenna effect. This neutral Bk(IV) coordination compound is not sequestered by the protein siderocalin—a mammalian metal transporter—in contrast to the negatively charged species obtained with neighbouring trivalent actinides americium, curium and californium (Cf). The corresponding Cf(III)-ligand-protein ternary adduct was characterized by X-ray diffraction analysis. Combined with theoretical predictions, these data add significant insight to the field of transplutonium chemistry, and may lead to innovative Bk separation and purification processes.

  5. 17 CFR 248.103-248.119 - [Reserved

    Science.gov (United States)

    2010-04-01

    ... 17 Commodity and Securities Exchanges 3 2010-04-01 2010-04-01 false [Reserved] 248.103-248.119 Section 248.103-248.119 Commodity and Securities Exchanges SECURITIES AND EXCHANGE COMMISSION (CONTINUED) REGULATIONS S-P AND S-AM Regulation S-AM: Limitations on Affiliate Marketing §§ 248.103-248.119 [Reserved] ...

  6. Possible stabilization of the tetravalent oxidation state of berkelium and californium in acetonitrile with triphenylarsine oxide

    International Nuclear Information System (INIS)

    Payne, G.F.; Peterson, J.R.

    1987-01-01

    It appears that we may have prepared Bk(IV) nitrate.nTPAs0 and Bk(IV) perchlorate.nTPAs0 complexes which formed the corresponding Cf(IV) complexes through the beta decay of Bk-249. Definitive proof should come from similar experiments with quantities of Bk-249 large enough to allow spectrophotometric detection of the characteristic f→f transitions in these berkelium and californium species. It is clear, however, that TPAs0 and acetonitrile can play a pivotal role in the stabilization of lanact(IV) species

  7. Peaceful berkelium

    Science.gov (United States)

    Trabesinger, Andreas

    2017-09-01

    The first new element produced after the Second World War has led a rather peaceful life since entering the period table -- until it became the target of those producing superheavy elements, as Andreas Trabesinger describes.

  8. Actinide production in the reaction of heavy ions with curium-248

    International Nuclear Information System (INIS)

    Moody, K.J.

    1983-07-01

    Chemical experiments were performed to examine the usefulness of heavy ion transfer reactions in producing new, neutron-rich actinide nuclides. A general quasi-elastic to deep-inelastic mechanism is proposed, and the utility of this method as opposed to other methods (e.g. complete fusion) is discussed. The relative merits of various techniques of actinide target synthesis are discussed. A description is given of a target system designed to remove the large amounts of heat generated by the passage of a heavy ion beam through matter, thereby maximizing the beam intensity which can be safely used in an experiment. Also described is a general separation scheme for the actinide elements from protactinium (Z=91) to mendelevium (Z=101), and fast specific procedures for plutonium, americium and berkelium. The cross sections for the production of several nuclides from the bombardment of 248 Cm with 18 O, 86 Kr and 136 Xe projectiles at several energies near and below the Coulomb barrier were determined. The results are compared with yields from 48 Ca and 238 U bombardments of 248 Cm. Simple extrapolation of the product yields into unknown regions of charge and mass indicates that the use of heavy ion transfer reactions to produce new, neutron-rich above-target species is limited. The substantial production of neutron-rich below-target species, however, indicates that with very heavy ions like 136 Xe and 238 U the new species 248 Am, 249 Am and 247 Pu should be produced with large cross sections from a 248 Cm target. A preliminary, unsuccessful attempt to isolate 247 Pu is outlined. The failure is probably due to the half life of the decay, which is calculated to be less than 3 minutes. The absolute gamma ray intensities from 251 Bk decay, necessary for calculating the 251 Bk cross section, are also determined

  9. 25 CFR 248.6 - Structures.

    Science.gov (United States)

    2010-04-01

    ... 25 Indians 1 2010-04-01 2010-04-01 false Structures. 248.6 Section 248.6 Indians BUREAU OF INDIAN AFFAIRS, DEPARTMENT OF THE INTERIOR FISH AND WILDLIFE USE OF COLUMBIA RIVER INDIAN IN-LIEU FISHING SITES § 248.6 Structures. Dwellings, camping facilities, and other structures such as fish drying facilities...

  10. 7 CFR 248.3 - Administration.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 4 2010-01-01 2010-01-01 false Administration. 248.3 Section 248.3 Agriculture... CHILD NUTRITION PROGRAMS WIC FARMERS' MARKET NUTRITION PROGRAM (FMNP) General § 248.3 Administration. (a) Delegation to FNS. Within the Department, FNS shall act on behalf of the Department in the administration of...

  11. 17 CFR 248.102 - Examples.

    Science.gov (United States)

    2010-04-01

    ... 17 Commodity and Securities Exchanges 3 2010-04-01 2010-04-01 false Examples. 248.102 Section 248... AND S-AM Regulation S-AM: Limitations on Affiliate Marketing § 248.102 Examples. The examples in this subpart are not exclusive. The examples in this subpart provide guidance concerning the rules' application...

  12. 7 CFR 248.9 - Nutrition education.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 4 2010-01-01 2010-01-01 false Nutrition education. 248.9 Section 248.9 Agriculture... Nutrition education. (a) Goals. Nutrition education shall emphasize the relationship of proper nutrition to.... (b) Requirement. The State agency shall integrate nutrition education into FMNP operations and may...

  13. 7 CFR 248.13 - FMNP income.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 4 2010-01-01 2010-01-01 false FMNP income. 248.13 Section 248.13 Agriculture... FMNP income. Program income means gross income the State agency earns from grant supported activities... property. The State agency shall retain Program income earned during the agreement period and use it for...

  14. Reference: 248 [Arabidopsis Phenome Database[Archive

    Lifescience Database Archive (English)

    Full Text Available 248 http://metadb.riken.jp/db/SciNetS_ria224i/cria224u4ria224u16045474i Singh Sunil Kumar... the animal exostosins. 3 384-97 16045474 2005 Aug The Plant journal Eland Cathlene|Harholt Jesper|Marchant Alan|Scheller Henrik Vibe|Singh Sunil Kumar

  15. 17 CFR 248.120 - Definitions.

    Science.gov (United States)

    2010-04-01

    ... S-P AND S-AM Regulation S-AM: Limitations on Affiliate Marketing § 248.120 Definitions. As used in... Securities and Exchange Commission. (e) Company means any corporation, limited liability company, business... company means the power to exercise a controlling influence over the management or policies of a company...

  16. 7 CFR 248.1 - General purpose and scope.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 4 2010-01-01 2010-01-01 false General purpose and scope. 248.1 Section 248.1... AGRICULTURE CHILD NUTRITION PROGRAMS WIC FARMERS' MARKET NUTRITION PROGRAM (FMNP) General § 248.1 General purpose and scope. This part announces regulations under which the Secretary of Agriculture shall carry...

  17. 7 CFR 248.11 - Financial management system.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 4 2010-01-01 2010-01-01 false Financial management system. 248.11 Section 248.11... § 248.11 Financial management system. (a) Disclosure of expenditures. The State agency shall maintain a financial management system which provides accurate, current and complete disclosure of the financial status...

  18. 7 CFR 58.248 - Nonfat dry milk.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 3 2010-01-01 2010-01-01 false Nonfat dry milk. 58.248 Section 58.248 Agriculture... Products Bearing Usda Official Identification § 58.248 Nonfat dry milk. (a) Nonfat dry milk in commercial....S. Standard Grade. (b) Regular nonfat dry milk in consumer size packages which bears an official...

  19. 14 CFR 248.2 - Filing of audit reports.

    Science.gov (United States)

    2010-01-01

    ... 14 Aeronautics and Space 4 2010-01-01 2010-01-01 false Filing of audit reports. 248.2 Section 248...) ECONOMIC REGULATIONS SUBMISSION OF AUDIT REPORTS § 248.2 Filing of audit reports. (a) Whenever any air... Information, in duplicate, a special report consisting of a true and complete copy of the audit report...

  20. R248Q mutation--Beyond p53-DNA binding.

    Science.gov (United States)

    Ng, Jeremy W K; Lama, Dilraj; Lukman, Suryani; Lane, David P; Verma, Chandra S; Sim, Adelene Y L

    2015-12-01

    R248 in the DNA binding domain (DBD) of p53 interacts directly with the minor groove of DNA. Earlier nuclear magnetic resonance (NMR) studies indicated that the R248Q mutation resulted in conformation changes in parts of DBD far from the mutation site. However, how information propagates from the mutation site to the rest of the DBD is still not well understood. We performed a series of all-atom molecular dynamics (MD) simulations to dissect sterics and charge effects of R248 on p53-DBD conformation: (i) wild-type p53 DBD; (ii) p53 DBD with an electrically neutral arginine side-chain; (iii) p53 DBD with R248A; (iv) p53 DBD with R248W; and (v) p53 DBD with R248Q. Our results agree well with experimental observations of global conformational changes induced by the R248Q mutation. Our simulations suggest that both charge- and sterics are important in the dynamics of the loop (L3) where the mutation resides. We show that helix 2 (H2) dynamics is altered as a result of a change in the hydrogen bonding partner of D281. In turn, neighboring L1 dynamics is altered: in mutants, L1 predominantly adopts the recessed conformation and is unable to interact with the major groove of DNA. We focused our attention the R248Q mutant that is commonly found in a wide range of cancer and observed changes at the zinc-binding pocket that might account for the dominant negative effects of R248Q. Furthermore, in our simulations, the S6/S7 turn was more frequently solvent exposed in R248Q, suggesting that there is a greater tendency of R248Q to partially unfold and possibly lead to an increased aggregation propensity. Finally, based on the observations made in our simulations, we propose strategies for the rescue of R248Q mutants. © 2015 Wiley Periodicals, Inc.

  1. 7 CFR 248.21 - Procurement and property management.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 4 2010-01-01 2010-01-01 false Procurement and property management. 248.21 Section... Provisions § 248.21 Procurement and property management. (a) Requirements. State agencies shall comply with the requirements of 7 CFR part 3016 for procurement of supplies, equipment and other services with...

  2. 31 CFR 248.4 - Undertaking of indemnity.

    Science.gov (United States)

    2010-07-01

    ... 31 Money and Finance: Treasury 2 2010-07-01 2010-07-01 false Undertaking of indemnity. 248.4 Section 248.4 Money and Finance: Treasury Regulations Relating to Money and Finance (Continued) FISCAL... in the circumstances set forth below, a corporate surety authorized by the Secretary of the Treasury...

  3. 24 CFR 248.173 - Resident homeownership program.

    Science.gov (United States)

    2010-04-01

    ..., consistent with paragraph (f) of this section; (x) How the marketing of currently vacant units and units... 50 percent of such proceeds shall be returned to the Commissioner for use under §§ 248.157 and 248... homeowner under the homeownership program approved under this section shall be paid to the HOME Investment...

  4. 17 CFR 248.18 - Effective date; transition rule.

    Science.gov (United States)

    2010-04-01

    ... Safeguarding Personal Information Relation to Other Laws; Effective Date § 248.18 Effective date; transition... customers on the compliance date. By July 1, 2001, you must have provided an initial notice, as required by § 248.4, to consumers who are your customers on July 1, 2001. (2) Example. You provide an initial notice...

  5. 24 CFR 248.223 - Alternative State strategy.

    Science.gov (United States)

    2010-04-01

    ... 24 Housing and Urban Development 2 2010-04-01 2010-04-01 false Alternative State strategy. 248.223... Preservation Act of 1987 § 248.223 Alternative State strategy. (a) The Commissioner may approve a State strategy providing for State approval of plans of action that involve termination of low income...

  6. 31 CFR 248.6 - Recovery of original check.

    Science.gov (United States)

    2010-07-01

    ... 31 Money and Finance: Treasury 2 2010-07-01 2010-07-01 false Recovery of original check. 248.6... § 248.6 Recovery of original check. (a) If the claimant recovers an original check after he has... or agency concerned regarding the negotiability of such original check. (b) In the event the...

  7. 42 CFR 403.248 - Administrative review of CMS determinations.

    Science.gov (United States)

    2010-10-01

    ... 42 Public Health 2 2010-10-01 2010-10-01 false Administrative review of CMS determinations. 403... Certification Program: General Provisions § 403.248 Administrative review of CMS determinations. (a) This section provides for administrative review if CMS determines— (1) Not to certify a policy; or (2) That a...

  8. 17 CFR 248.101 - Purpose and scope.

    Science.gov (United States)

    2010-04-01

    ...) REGULATIONS S-P AND S-AM Regulation S-AM: Limitations on Affiliate Marketing § 248.101 Purpose and scope. (a...”), regulates the use of consumer information received from an affiliate to make marketing solicitations. (b) Scope. This subpart applies to any broker or dealer other than a notice-registered broker or dealer, to...

  9. 48 CFR 52.248-1 - Value Engineering.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 2 2010-10-01 2010-10-01 false Value Engineering. 52.248... Value Engineering. As prescribed in 48.201, insert the following clause: Value Engineering (OCT 2010) (a) General. The Contractor is encouraged to develop, prepare, and submit value engineering change proposals...

  10. 17 CFR 248.127 - Renewal of opt out elections.

    Science.gov (United States)

    2010-04-01

    ... (CONTINUED) REGULATIONS S-P AND S-AM Regulation S-AM: Limitations on Affiliate Marketing § 248.127 Renewal of... expires, you may not make marketing solicitations to a consumer who previously opted out, unless: (i) The....122(b). (3) Affiliates who may provide the notice. The notice required by this paragraph must be...

  11. 17 CFR 248.126 - Delivery of opt out notices.

    Science.gov (United States)

    2010-04-01

    ... (CONTINUED) REGULATIONS S-P AND S-AM Regulation S-AM: Limitations on Affiliate Marketing § 248.126 Delivery... Internet Web site at which the consumer obtained a product or service electronically and requires the... by e-mail from the affiliate providing the notice; or (3) Posts the notice on an Internet Web site...

  12. 17 CFR 248.16 - Protection of Fair Credit Reporting Act.

    Science.gov (United States)

    2010-04-01

    ... Reporting Act. 248.16 Section 248.16 Commodity and Securities Exchanges SECURITIES AND EXCHANGE COMMISSION (CONTINUED) REGULATIONS S-P AND S-AM Regulation S-P: Privacy of Consumer Financial Information and Safeguarding Personal Information Relation to Other Laws; Effective Date § 248.16 Protection of Fair Credit...

  13. 17 CFR 248.5 - Annual privacy notice to customers required.

    Science.gov (United States)

    2010-04-01

    ... customers required. 248.5 Section 248.5 Commodity and Securities Exchanges SECURITIES AND EXCHANGE... Safeguarding Personal Information Privacy and Opt Out Notices § 248.5 Annual privacy notice to customers required. (a)(1) General rule. You must provide a clear and conspicuous notice to customers that accurately...

  14. 17 CFR 248.13 - Exception to opt out requirements for service providers and joint marketing.

    Science.gov (United States)

    2010-04-01

    ... include marketing of your own products or services or marketing of financial products or services offered... requirements for service providers and joint marketing. 248.13 Section 248.13 Commodity and Securities... Consumer Financial Information and Safeguarding Personal Information Exceptions § 248.13 Exception to opt...

  15. Actinide production from xenon bombardments of curium-248

    International Nuclear Information System (INIS)

    Welch, R.B.

    1985-01-01

    Production cross sections for many actinide nuclides formed in the reaction of 129 Xe and 132 Xe with 248 Cm at bombarding energies slightly above the coulomb barrier were determined using radiochemical techniques to isolate these products. These results are compared with cross sections from a 136 Xe + 248 Cm reaction at a similar energy. When compared to the reaction with 136 Xe, the maxima in the production cross section distributions from the more neutron deficient projectiles are shifted to smaller mass numbers, and the total cross section increases for the production of elements with atomic numbers greater than that of the target, and decreases for lighter elements. These results can be explained by use of a potential energy surface (PES) which illustrates the effect of the available energy on the transfer of nucleons and describes the evolution of the di-nuclear complex, an essential feature of deep-inelastic reactions (DIR), during the interaction. The other principal reaction mechanism is the quasi-elastic transfer (QE). Analysis of data from a similar set of reactions, 129 Xe, 132 Xe, and 136 Xe with 197 Au, aids in explaining the features of the Xe + Cm product distributions, which are additionally affected by the depletion of actinide product yields due to deexcitation by fission. The PES is shown to be a useful tool to predict the general features of product distributions from heavy ion reactions

  16. Role of CD248 as a potential severity marker in idiopathic pulmonary fibrosis.

    Science.gov (United States)

    Bartis, Domokos; Crowley, Louise E; D'Souza, Vijay K; Borthwick, Lee; Fisher, Andrew J; Croft, Adam P; Pongrácz, Judit E; Thompson, Richard; Langman, Gerald; Buckley, Christopher D; Thickett, David R

    2016-04-14

    CD248 or Endosialin is a transmembrane molecule expressed in stromal cells binding to extracellular matrix (ECM) components. It has been previously implicated in kidney fibrosis, rheumatoid arthritis as well as in tumour-stromal interactions. This study investigates the role of CD248 in the pathogenesis of fibrotic diseases in Idiopathic Pulmonary Fibrosis (IPF). CD248 quantitative immunohistochemistry (IHC) was performed on lung samples from 22 IPF patients and its expression was assayed in cultured pulmonary fibroblasts and epithelial cells. Effects of CD248 silencing was evaluated on fibroblast proliferation and myofibroblast differentiation. IHC revealed strong CD248 expression in mesenchymal cells of normal lung structures such as pleura and adventitia but not in epithelium. Fibrotic areas showed markedly stronger staining than unaffected lung tissue. The extent of CD248 staining showed a significant negative correlation to lung function parameters FEV1, FVC, TLC, and TLCO (r2 > 0 · 35, p < 0 · 01). CD248 protein levels were significantly greater in IPF-derived lung fibroblasts vs normal lung fibroblasts (p < 0 · 01) and CD248 silencing significantly reduced the proliferation of lung fibroblasts, but did not affected myofibroblast differentiation. We conclude that CD248 overexpression is possibly involved in the pathogenesis of IPF and it has potential as a disease severity marker. Given that CD248 ligands are collagen type I, IV and fibronectin, we hypothesise that CD248 signalling represents a novel matrix-fibroblast interaction that may be a potential therapeutic target in IPF.

  17. Bk and Cf chromatographic separation and 249Bk/248Cm and 249Cf/248Cm elemental ratios determination by inductively coupled plasma quadrupole mass spectrometry

    International Nuclear Information System (INIS)

    Gourgiotis, A.; Isnard, H.; Nonell, A.; Aubert, M.; Stadelmann, G.; Dupont, E.; AlMahamid, I.; Tiang, G.; Rao, L.; Lukens, W.; Cassette, P.; Panebianco, S.; Letourneau, A.; Chartier, F.

    2013-01-01

    The French Atomic Energy Commission has carried out several experiments for the study of minor-actinide transmutation processes in high intensity thermal neutron flux. In this context a Cm sample enriched in 248 Cm (97%) was irradiated in a thermal neutron flux at the High Flux Reactor (HFR) of the Laue-Langevin Institute (ILL). The precise and accurate determination of Cf isotope ratios and of 249 Bk/ 248 Cm and 249 Cf/ 248 Cm elemental ratios in the 248 Cm irradiated sample is crucial for the calculation of actinide neutron capture cross-sections.This work describes an analytical procedure for the separation and the isotope ratio measurement of Bk and Cf in the irradiated sample.The Bk and Cf separation is based on a lanthanides separation protocol previously developed by the laboratory. Well-defined retention times for Bk and Cf were obtained by coupling the Ionic Chromatography (IC) with an ICP-QMS. All conditions of element separation by IC and the different steps of the analytical protocol in order to obtain the isotopic and elemental ratios are presented. Relative uncertainties of Cf isotopic ratios range from 0.3% to 0.5% and the uncertainty of the 249 Bk/ 248 Cm and 249 Cf/ 248 Cm elemental ratios are respectively 6.1% and 3.2%.This level of uncertainty for both isotopic and elemental ratios is in perfect agreement with the requirement for transmutation studies. (authors)

  18. 17 CFR 248.4 - Initial privacy notice to consumers required.

    Science.gov (United States)

    2010-04-01

    ... later than when you establish a customer relationship, except as provided in paragraph (e) of this... by §§ 248.14 and 248.15; and (2) You do not have a customer relationship with the consumer. (c) When you establish a customer relationship—(1) General rule. You establish a customer relationship when you...

  19. 17 CFR 248.12 - Limits on sharing account number information for marketing purposes.

    Science.gov (United States)

    2010-04-01

    ... account number information for marketing purposes. (a) General prohibition on disclosure of account... 17 Commodity and Securities Exchanges 3 2010-04-01 2010-04-01 false Limits on sharing account number information for marketing purposes. 248.12 Section 248.12 Commodity and Securities Exchanges...

  20. Photolysis of butenedial at 193, 248, 280, 308, 351, 400, and 450 nm

    Science.gov (United States)

    Tang, Yongxin; Zhu, Lei

    2005-06-01

    We have studied the photolysis of butenedial at 193, 248, 280, 308, 351, 400, and 450 nm by using laser photolysis combined with cavity ring-down spectroscopy. The HCO radical is a photodissociation product at 193 and 248 nm. The corresponding HCO quantum yields are 0.55 ± 0.07 and 0.12 ± 0.01, independent of butenedial pressure and nitrogen buffer gas pressure. Absorption cross-sections of butenedial are (6.88 ± 0.39) × 10 -18 and (3.62 ± 0.69) × 10 -19 cm 2 at 193 and 248 nm. The end-products from the photolysis of butenedial at 193, 248, 308, and 351 nm were measured by FTIR. Acrolein and 3H-furan-2-one were observed and their yields have been estimated.

  1. Evaluation of neutron cross sections for 244Cm, 246Cm, and 248Cm

    International Nuclear Information System (INIS)

    Benjamin, R.W.; McCrosson, F.J.; Gettys, W.E.

    1977-01-01

    An evaluation of neutron cross sections for 244 246 248 Cm using the ENDF/B format is presented. Primary data input included differential measurements, integral measurements, nuclear model calculations, and reactor production experience

  2. Kr and Xe isotopes from spontaneous fission of 248Cm and 250Cf

    International Nuclear Information System (INIS)

    Srinivasan, B.

    1980-01-01

    Relative yields of Kr and Xe isotopes from the spontaneous fission of 248 Cm and 250 Cf have been determined mass spectrometrically. The yields are as follows: 83 Kr/ 84 Kr/ 85 Kr/ 86 Kr = 0.223/0.458/0.596/ identical 1.00 and 0.306/0.582/0.793/ identical 1.00; 131 Xe/ 134 Xe/ 136 Xe = 0.486/0.819/1.075 identical 1.00 and 0.343/0.506/0.851/ identical 1.00 from 248 Cm and 250 Cf, respectively. The Xe yields from 248 Cm agree with an earlier determination by Leich et al. Neither of these yield patterns matches that of fissiogenic Kr and Xe in carbonaceous chondrites and hence 248 Cm and 250 Cf are ruled out as progenitors of the meteoritic Kr and Xe. In general, none of the spontaneously fissioning nuclides of actinide elements can be identified as a possible progenitor. Even the mixtures of actinides, including a combination of 248 Cm and 250 Cm, are unsuitable. The origin of anomalous Kr and Xe in carbonaceous chondrites must then be traced either to the spontaneous fission of a superheavy element or to peculiarities in specific nucleosynthetic reactions. (orig.)

  3. 48 CFR 52.248-2 - Value Engineering-Architect-Engineer.

    Science.gov (United States)

    2010-10-01

    ... cycle cost consistent with required performance, reliability, quality, and safety. Value engineering... 48 Federal Acquisition Regulations System 2 2010-10-01 2010-10-01 false Value Engineering... Clauses 52.248-2 Value Engineering—Architect-Engineer. As prescribed in 48.201(f), insert the following...

  4. 17 CFR 248.128 - Effective date, compliance date, and prospective application.

    Science.gov (United States)

    2010-04-01

    ... Affiliate Marketing § 248.128 Effective date, compliance date, and prospective application. (a) Effective date. This subpart is effective September 10, 2009. (b) Mandatory compliance date. Compliance with this... 17 Commodity and Securities Exchanges 3 2010-04-01 2010-04-01 false Effective date, compliance...

  5. 17 CFR 248.123 - Contents of opt out notice; consolidated and equivalent notices.

    Science.gov (United States)

    2010-04-01

    ... EXCHANGE COMMISSION (CONTINUED) REGULATIONS S-P AND S-AM Regulation S-AM: Limitations on Affiliate Marketing § 248.123 Contents of opt out notice; consolidated and equivalent notices. (a) Contents of opt out...) The name of the affiliate(s) providing the notice. If the notice is provided jointly by multiple...

  6. 17 CFR 248.11 - Limits on redisclosure and reuse of information.

    Science.gov (United States)

    2010-04-01

    ... Safeguarding Personal Information Limits on Disclosures § 248.11 Limits on redisclosure and reuse of... customer list from a nonaffiliated financial institution in order to provide account-processing services.... (2) Example. If you obtain a customer list from a nonaffiliated financial institution outside of the...

  7. 17 CFR 248.122 - Scope and duration of opt out.

    Science.gov (United States)

    2010-04-01

    ... (CONTINUED) REGULATIONS S-P AND S-AM Regulation S-AM: Limitations on Affiliate Marketing § 248.122 Scope and... information received from another affiliate as described in the notice to make marketing solicitations to the consumer. (2) Continuing relationship—(i) In general. If the consumer establishes a continuing relationship...

  8. 17 CFR 248.121 - Affiliate marketing opt out and exceptions.

    Science.gov (United States)

    2010-04-01

    ... business relationship with the consumer. (b) Making marketing solicitations—(1) In general. For purposes of... 17 Commodity and Securities Exchanges 3 2010-04-01 2010-04-01 false Affiliate marketing opt out... COMMISSION (CONTINUED) REGULATIONS S-P AND S-AM Regulation S-AM: Limitations on Affiliate Marketing § 248.121...

  9. 17 CFR 248.125 - Reasonable and simple methods of opting out.

    Science.gov (United States)

    2010-04-01

    ... COMMISSION (CONTINUED) REGULATIONS S-P AND S-AM Regulation S-AM: Limitations on Affiliate Marketing § 248.125... consumer that you receive from an affiliate to make a marketing solicitation to the consumer about your... electronically mailed or processed at an Internet Web site, if the consumer agrees to the electronic delivery of...

  10. Single-mode 37-core fiber with a cladding diameter of 248 μm

    DEFF Research Database (Denmark)

    Sasaki, Y.; Takenaga, K.; Aikawa, K.

    2017-01-01

    A heterogeneous single-mode 37-core fiber with a cladding diameter of 248 μm is designed and fabricated. The fiber provides the highest core count and low total-crosstalk less than −20 dB/1000 km in C+L band....

  11. Organic nanostructures on silicon, created with semitransparent polystyrene spheres and 248 nm laser pulses

    International Nuclear Information System (INIS)

    Rothe, Erhard W; Manke, Charles W; Piparia, Reema; Baird, Ronald J

    2008-01-01

    Arrays of nanostructures are made starting with a template of close-packed, polystyrene spheres on a silicon surface. The spheres are either 1.091 or 2.99 μm in diameter (d) and are of polystyrene (PS). They are irradiated with a pulse of either 308 or 248 nm light to which they are transparent and semitransparent, respectively. A transparent sphere with d = 1.091 μm diameter concentrates incident light onto a small substrate area. As has been previously reported, that creates silicon nanobumps that rise from circular craters. At 248 nm and d = 2.99 μm, the light energy is mainly absorbed, destroys the sphere, and leaves a shrunken mass (typically about 500 nm wide and 100 nm high) of organic material that is probably polystyrene and its thermal degradation products. At 248 nm and d = 1.091 μm, the residual organic structures are on the order of 300 nm wide and 100 nm high. A distinctive feature is that these organic structures are connected by filaments that are on the order of 50 nm wide and 10 nm high. Filaments form because the close-packed PS spheres expand into each other during the early part of the laser pulse, and then, as the main structures shrink, their viscoelasticity leads to threads between them. Our results with 248 nm and d = 1.091 μm differ from those described by Huang et al with 248 nm and d = 1.0 μm. Future studies might include the further effect of wavelength and fluence upon the process as well the use of other materials and the replacement of nanospheres by other focusing shapes, such as ellipsoids or rods

  12. PCR-RFLP to Detect Codon 248 Mutation in Exon 7 of "p53" Tumor Suppressor Gene

    Science.gov (United States)

    Ouyang, Liming; Ge, Chongtao; Wu, Haizhen; Li, Suxia; Zhang, Huizhan

    2009-01-01

    Individual genome DNA was extracted fast from oral swab and followed up with PCR specific for codon 248 of "p53" tumor suppressor gene. "Msp"I restriction mapping showed the G-C mutation in codon 248, which closely relates to cancer susceptibility. Students learn the concepts, detection techniques, and research significance of point mutations or…

  13. 17 CFR 248.30 - Procedures to safeguard customer records and information; disposal of consumer report information.

    Science.gov (United States)

    2010-04-01

    ... customer records and information; disposal of consumer report information. 248.30 Section 248.30 Commodity... of consumer report information. (a) Every broker, dealer, and investment company, and every... any customer. (b) Disposal of consumer report information and records—(1) Definitions (i) Consumer...

  14. 30 CFR 250.248 - What solid and liquid wastes and discharges information and cooling water intake information must...

    Science.gov (United States)

    2010-07-01

    ... following solid and liquid wastes and discharges information and cooling water intake information must... 30 Mineral Resources 2 2010-07-01 2010-07-01 false What solid and liquid wastes and discharges information and cooling water intake information must accompany the DPP or DOCD? 250.248 Section 250.248...

  15. Polymorphism N248S in the Human Toll-Like Receptor 1 Gene Is Related to Leprosy and Leprosy Reactions

    NARCIS (Netherlands)

    Schuring, Ron P.; Hamann, Lutz; Faber, William R.; Pahan, David; Richardus, Jan Hendrik; Schumann, Ralf R.; Oskam, Linda

    2009-01-01

    We investigated the association between a polymorphism of a key innate immunity receptor, Toll-like receptor 1 (TLR1) N248S, and susceptibility to leprosy and its clinical presentation. TLR1 N248S has been shown elsewhere to diminish TLR1 signaling and subsequent leprosy disease. The homozygous

  16. Stable formation of ultrahigh power-density 248 nm channels in Xe cluster targets

    Energy Technology Data Exchange (ETDEWEB)

    Borisov, Alex B.; Racz, Ervin; Khan, Shahab F.; Poopalasingam, Sankar; McCorkindale, John C.; Boguta, John; Longworth, James W.; Rhodes, Charles K. [Laboratory for X-ray Microimaging and Bioinformatics, Department of Physics, University of Illinois at Chicago, Chicago, IL 60607-7059 (United States); KFKI Research Institute for Particle and Nuclear Physics, EURATOM Association, P.O. Box 49, 1525 Budapest (Hungary)

    2012-07-11

    The optimization of relativistic and ponderomotive self-channeling of ultra-powerful 248 nm laser pulses launched in underdense plasmas with an appropriate longitudinal gradient in the electron density profile located at the initial stage of the self-channeling leads to (1) stable channel formation and (2) highly efficient power compression producing power densities in the 10{sup 19}-10{sup 20} W/cm{sup 3} range. The comparison of theoretical studies with experimental results involving the correlation of (a) Thomson images of the electron density with (b) x-ray images of the channel morphology demonstrates that more than 90% of the incident 248 nm power can be trapped in stable channels and that this stable propagation can be extended to power levels significantly exceeding the critical power of the self-channeling process.

  17. 29 CFR 779.248 - Purchase or receive “goods for resale.”

    Science.gov (United States)

    2010-07-01

    ... section 3(s)(1) of the prior Act if they are purchased or received with the intention of being resold... purchased or received by the enterprise with the intention of reselling them in the same form or after... 29 Labor 3 2010-07-01 2010-07-01 false Purchase or receive âgoods for resale.â 779.248 Section 779...

  18. Phase-shifted Bragg grating inscription in PMMA microstructured POF using 248 nm UV radiation

    OpenAIRE

    Pereira, L.; Pospori, A.; Antunes, Paulo; Domingues, Maria Fatima; Marques, S.; Bang, Ole; Webb, David J.; Marques, Carlos A.F.

    2017-01-01

    In this work we experimentally validate and characterize the first phase-shifted polymer optical fiber Bragg gratings (PS-POFBGs) produced using a single pulse from a 248 nm krypton fluoride laser. A single-mode poly (methyl methacrylate) optical fiber with a core doped with benzyl dimethyl ketal for photosensitivity improvement was used. A uniform phase mask customized for 850 nm grating inscription was used to inscribe these Bragg structures. The phase shift defect was created directly duri...

  19. SULFUR- AND SILICON-BEARING MOLECULES IN PLANETARY NEBULAE: THE CASE OF M2-48

    Energy Technology Data Exchange (ETDEWEB)

    Edwards, J. L.; Ziurys, L. M., E-mail: lziurys@email.arizona.edu [Department of Chemistry, The University of Arizona, P.O. Box 210041, Tucson, AZ 85721 (United States)

    2014-10-20

    Molecular-line observations of the bipolar planetary nebula (PN) M2-48 have been conducted using the Sub-Millimeter Telescope and the 12 m antenna of the Arizona Radio Observatory at 1, 2, and 3 mm. M2-48 is estimated to be ∼4800 yr old, midway through the PN evolutionary track. SiO and SO{sub 2} were detected in this source—the first identification of either molecule in a PN. CN, HCN, HNC, CS, SO, HCO{sup +}, N{sub 2}H{sup +}, and several {sup 13}C isotopologues such as {sup 13}CN, H{sup 13}CN, and H{sup 13}CO{sup +} were also observed toward this object. A radiative transfer analysis of multiple SiO transitions indicates a gas kinetic temperature of T {sub K} ∼ 55 K and a density of n(H{sub 2}) ∼ 9 × 10{sup 5} cm{sup –3} in M2-48, in agreement with previous CS and CO modeling. After CO, CN, and SO were found to be the most prevalent molecules in this nebula, with fractional abundances, relative to H{sub 2}, of f ∼ 3.8 × 10{sup –7} and 2.4 × 10{sup –7}, respectively. SO{sub 2} and HCN are also abundant, with f ∼ 1.2 × 10{sup –7}, indicating an [SO]/[SO{sub 2}] ratio of ∼2. Relatively high ion abundances were measured in M2-48 as well, with f ∼ 10{sup –7} for both HCO{sup +} and N{sub 2}H{sup +}. An [HCN]/[HNC] ratio of ∼2 was determined, as typically observed in other PNe, independent of age. The high abundances of SO and SO{sub 2}, along with the presence of SiO with f ∼ 2.9 × 10{sup –8}, suggest O/C > 1 in this source; furthermore, the prevalence of CN and N{sub 2}H{sup +} indicates nitrogen enrichment. The {sup 12}C/{sup 13}C ratio of ∼3 in the nebula was also established. These factors indicate hot-bottom burning occurred in the progenitor star of M2-48, suggesting an initial mass > 4 M {sub ☉}.

  20. Evidence for stepwise dissociation dynamics in acetone at 248 and 193 nm

    Science.gov (United States)

    North, Simon W.; Blank, David A.; Gezelter, J. Daniel; Longfellow, Cheryl A.; Lee, Yuan T.

    1995-03-01

    The technique of molecular beam photofragment translational spectroscopy has been used to study the dissociation of acetone following S1←S0 (248 nm) and S2←S0 (193 nm) excitation. Excitation at 248 nm resulted in the production of CH3 and CH3CO with 14.2±1.0 kcal/mole on average of the available energy appearing as translation of the photofragments. Comparison of the measured with values reported at 266 nm suggest that the energy partitioning is dominated by the exit barrier caused by an avoided crossing on the potential energy surface. A substantial fraction (30±4%) of the nascent acetyl radicals from the primary dissociation contain sufficient energy to undergo spontaneous secondary decomposition. From the onset of the truncation of the CH3CO P(ET) a threshold of 17.8±3.0 kcal/mole for the dissociation of the acetyl radical has been determined in agreement with recent results on the photodissociation of acetyl chloride. The translational energy release in the dissociation of CH3CO closely matches the experimentally determined exit barrier. At 193 nm the only observed dissociation pathway was the formation of two methyl radicals and carbon monoxide. On average ˜38% of the available energy is found in product translation suggesting that significant internal energy resides in the nascent CH3 fragments consistent with the results of Hall et al. [J. Chem. Phys. 94, 4182 (1991)]. We conclude that the dynamics and energy partitioning for dissociation at 193 nm is similar to that at 248 nm.

  1. Search for superheavy elements in the bombardment of 248Cm with 48Ca

    International Nuclear Information System (INIS)

    Hulet, E.K.; Lougheed, R.W.; Wild, J.F.; Landrum, J.H.; Stevenson, P.C.; Ghiorso, A.; Nitschke, J.M.; Otto, R.J.; Morrissey, D.J.; Baisden, P.A.; Gavin, B.F.; Lee, D.; Silva, R.J.; Fowler, M.M.; Seaborg, G.T.

    1977-01-01

    We have searched for superheavy elements 110 to 116 with half-lives between 10 4 and 10 8 s in fractions chemically separated after each of a series of bombardments of 248 Cm made with 267-MeV 48 Ca ions. After 6 months of α and spontaneous-fission counting, our results provide no persuasive evidence for the presence of super-heavy elements. The most plausible explanation for not finding the superheavy elements is that they have either short half-lives or very small formation cross sections

  2. Damage thresholds of thin film materials and high reflectors at 248 nm

    International Nuclear Information System (INIS)

    Rainer, F.; Lowdermilk, W.H.; Milam, D.; Carniglia, C.K.; Hart, T.T.; Lichtenstein, T.L.

    1982-01-01

    Twenty-ns, 248-nm KrF laser pulses were used to measure laser damage thresholds for halfwave-thick layers of 15 oxide and fluoride coating materials, and for high reflectance coatings made with 13 combinations of these materials. The damage thresholds of the reflectors and single-layer films were compared to measurements of several properties of the halfwave-thick films to determine whether measurements of these properties of single-layer films to determine whether measurements of these properties of single-layer films were useful for identifying materials for fabrication of damage resistant coatings

  3. Confirmed results of the 248Cm(48Ca,4n)292116 experiment

    International Nuclear Information System (INIS)

    Patin, J B; Moody, K J; Stoyer, M A; Wild, J F; Shaughnessy, D A; Stoyer, N J

    2003-01-01

    The results of a detailed analysis performed on the data obtained in the 248 Cm( 48 Ca,4n) 292 116 reaction is presented. This analysis is independent of the original data analysis performed in Dubna in which three separate decay chains were found. Each decay chain began with an evaporation residue followed by three α decays and ended in a spontaneous fission event, all correlated in time and position. The analysis presented confirms that the three events are present in the data. A summary of the three events will be given as well as a description of the analysis performed

  4. Phase-shifted Bragg grating inscription in PMMA microstructured POF using 248 nm UV radiation

    DEFF Research Database (Denmark)

    Pereira, L.; Pospori, A.; Antunes, Paulo

    2017-01-01

    In this work we experimentally validate and characterize the first phase-shifted polymer optical fiber Bragg gratings (PS-POFBGs) produced using a single pulse from a 248 nm krypton fluoride laser. A single-mode poly (methyl methacrylate) optical fiber with a core doped with benzyl dimethyl ketal...... for photosensitivity improvement was used. A uniform phase mask customized for 850 nm grating inscription was used to inscribe these Bragg structures. The phase shift defect was created directly during the grating inscription process by placing a narrow blocking aperture in the center of the UV beam. The produced high...

  5. A systematic study of actinide production from the interactions of heavy ions with sup 248 Cm

    Energy Technology Data Exchange (ETDEWEB)

    Leyba, J.D.

    1990-09-07

    Production cross sections for heavy actinides produced from the interactions of {sup 12}C, {sup 31}P, {sup 40}Ar, and {sup 44}Ca ions with {sup 248}Cm were measured at energies ranging from 0.98 to 1.35 X Coulomb barrier. The recoiling reaction products were collected in copper or gold catcher foils located near the {sup 248}Cm target. Separate fractions of Bk, Cf, Es, Fm, and Md were obtained from a radiochemical separation procedure. For the {sup 12}C system, a He/KCl jet was used to transport the recoiling No activities of interest to a rotating wheel system. The isotopic distributions of the actinide products were found to be essentially symmetric about the maximum with full-widths-at-half-maximum of approximately 2.5 mass units. Isotopic distributions of the {sup 12}C, {sup 31}P, {sup 40}Ar, and {sup 44}Ca systems were found to be very similar to the {sup 40,48}Ca systems studied previously. The maxima of the isotopic distributions generally occurred for those reaction channels which involved the exchange of the fewest number of nucleons between the target and projectile for which the calculated excitation energy was a positive quantity. Additionally, the maxima of the excitation functions occurred at those projectile energies which were consistent with the calculated reaction barriers based upon a binary reaction mechanism. The experimental data from the four systems investigated were compared to several models of heavy ion interactions including a damped reaction mechanism, compound nucleus formation and subsequent particle evaporation, and classical partial wave calculations for binary systems.

  6. Separation of 248Cm (III) from 252Cf (III) and its use in time resolved fluorescence spectroscopic (TRFS) studies

    International Nuclear Information System (INIS)

    Murali, M.S.; Nair, A.G.C.; Gujar, R.B.; Jain, A.; Tomar, B.S.; Godbole, S.V.; Reddy, A.V.R.; Manchanda, V.K.

    2008-07-01

    The present report gives a description of the methodology for the separation of 248 Cm(III) from decayed 252 Cf (III) waste solution. The waste solution was first assayed for 252 Cf content by neutron counting using a neutron well coincidence counter. The sample was subjected to the chemical separation of 248 Cm (III) from 252 Cf (III) following anion and cation exchange chromatography. The alpha spectrum of the separated curium fraction showed peaks due to 246 Cm and 248 Cm while the corresponding alpha spectrum of californium fraction showed 249,250,251,252 Cf. The gamma ray abundances of 249 Cf were determined with respect to its gamma rays of 387 keV and the data agreed well with that in literature. Separated Cm(III) was further characterized by recording its time resolved fluorescence spectrum (TRFS) in aqueous medium. (author)

  7. 77 FR 26824 - Agency Information Collection; Activity Under OMB Review; Submission of Audit Reports-Part 248

    Science.gov (United States)

    2012-05-07

    ... RITA 2008-0002] Agency Information Collection; Activity Under OMB Review; Submission of Audit Reports.... SUPPLEMENTARY INFORMATION: OMB Approval No. 2138-0004. Title: Submission of Audit Reports--Part 248. Form No...: BTS collects independent audited financial reports from U.S. certificated air carriers. Carriers not...

  8. A bright-rimmed cloud sculpted by the H ii region Sh2-48

    Science.gov (United States)

    Ortega, M. E.; Paron, S.; Giacani, E.; Rubio, M.; Dubner, G.

    2013-08-01

    Aims: We characterize a bright-rimmed cloud embedded in the H ii region Sh2-48 while searching for evidence of triggered star formation. Methods: We carried out observations towards a region of 2' × 2' centered at RA = 18h22m11.39s, Dec = -14°35'24.81''(J2000) using the Atacama Submillimeter Telescope Experiment (ASTE; Chile) in the 12CO J = 3-2, 13CO J = 3-2, HCO+J = 4-3, and CS J = 7-6 lines with an angular resolution of about 22''. We also present radio continuum observations at 5 GHz carried out with the Jansky Very Large Array (JVLA; EEUU) interferometer with a synthetized beam of 7'' × 5''. The molecular transitions were used to study the distribution and kinematics of the molecular gas of the bright-rimmed cloud. The radio continuum data was used to characterize the ionized gas located on the illuminated border of this molecular condensation. Combining these observations with infrared public data allowed us to build up a comprehensive picture of the current state of star formation within this cloud. Results: The analysis of our molecular observations reveals a relatively dense clump with n(H2) ~ 3 × 103cm-3, located in projection onto the interior of the H ii region Sh2-48. The emission distribution of the four observed molecular transitions has, at VLSR ~ 38 km s-1, morphological anticorrelation with the bright-rimmed cloud as seen in the optical emission. From the new radio continuum observations, we identify a thin layer of ionized gas located on the border of the clump that is facing the ionizing star. The ionized gas has an electron density of about 73 cm-3, which is a factor three higher than the typical critical density (nc ~ 25 cm-3), above which an ionized boundary layer can be formed and maintained. This supports the hypothesis that the clump is being photoionized by the nearby O9.5V star, BD-14 5014. From the evaluation of the pressure balance between the ionized and molecular gas, we conclude that the clump would be in a prepressure balance

  9. A COMPACT GROUP OF GALAXIES AT Z = 2.48 HOSTING AN AGN-DRIVEN OUTFLOW

    Energy Technology Data Exchange (ETDEWEB)

    Shih, Hsin-Yi [Gemini Observatory, 670 N Aohoku Place, Hilo, HI 96720 (United States); Stockton, Alan, E-mail: jshih@gemini.edu, E-mail: stockton@ifa.hawaii.edu [Institute for Astronomy, University of Hawaii, 2680 Woodlawn Drive, Honolulu, HI 96822 (United States)

    2015-12-10

    We present observations of a remarkable compact group of galaxies at z = 2.48. Four galaxies, all within 40 kpc of each other, surround a powerful high-redshift radio source. This group comprises two compact red passive galaxies and a pair of merging galaxies. One of the red galaxies, with an apparent stellar mass of 3.6 × 10{sup 11}M{sub ⊙} and an effective radius of 470 pc, is one of the most extreme examples of a massive quiescent compact galaxy found so far. One of the pair of merging galaxies hosts the active galactic nucleus (AGN) producing the large powerful radio structure. The merger is massive and enriched, consistent with the mass–metallicity relation expected at this redshift. Close to the merging nuclei, the emission lines exhibit broad and asymmetric profiles that suggest outflows powered either by a very young expanding radio jet or by AGN radiation. At ≳50 kpc from the system, we found a fainter extended-emission region that may be a part of a radio-jet-driven outflow.

  10. Cold valleys in the radioactive decay of 248-254Cf isotopes

    International Nuclear Information System (INIS)

    Biju, R.K.; Sahadevan, Sabina; Santhosh, K.P.; Joseph, Antony

    2008-01-01

    Based on the concept of cold valley in cold fission and fusion, we have investigated the cluster decay process in 248-254 Cf isotopes. In addition to alpha particle minima, other deep minima occur for S, Ar and Ca clusters. It is found that inclusion of proximity potential does not change the position of minima but minima become deeper. Taking Coulomb and proximity potential as interacting barrier for post-scission region, we computed half-lives and other characteristics for various clusters from these parents. Our study reveals that these parents are stable against light clusters and unstable against heavy clusters. Computed half-lives for alpha decay agree with experimental values within two orders of magnitude. The most probable clusters from these parents are predicted to be 46 Ar, 48,50 Ca which indicate the role of doubly or near doubly magic clusters in cluster radioactivity. Odd A clusters are found to be favorable for emission from odd A parents. Cluster decay model is extended to symmetric region and it is found that symmetric fission is also probable which stresses the role of doubly or near doubly magic 132 Sn nuclei. Geiger-Nuttal plots were studied for various clusters and are found to be linear with varying slopes and intercepts. (author)

  11. First calorimetric determination of heat of extraction of 248Cm in a bi-phasic system

    International Nuclear Information System (INIS)

    Martin, Leigh R.; Zalupski, Peter R.

    2011-01-01

    This report presents a summary of the work performed to meet FCR and D level 2 milestone M21SW050201, 'Complete the first calorimetric determination of heat of extraction of 248Cm in a bi-phasic system'. This work was carried out under the auspices of the Thermodynamics and Kinetics FCR and D work package. To complement previous work undertaken under this work package we have extended out heat of extraction studies by di-2-ethyl-hexyl-phosphoric acid to curium. This report also details the heat of extraction of samarium in the same system. This work was performed to not only test the methodology but also to check for consistency with the heats of extraction obtained with those in the prior literature. The heat of extraction for samarium that was obtained in this study was -9.6 kJ mol-1, which is in reasonable agreement with the previously obtained value of -10.9 kJ mol-1. The curium heat of extraction was performed under two sets of conditions and the obtained heats of extraction were in reasonable agreement with each other at -16.0 ± 1.1 and -16.8 ± 1.5 kJ mol-1.

  12. Laser-damage thresholds of thin-film optical coatings at 248 nm

    International Nuclear Information System (INIS)

    Milam, D.; Rainer, F.; Lowdermilk, W.H.

    1981-01-01

    We have measured the laser-induced damage thresholds for 248 nm wavelength light of over 100 optical coatings from commercial vendors and research institutions. All samples were irradiated once per damage site with temporally multi-lobed, 20-ns pulses generated by a KrF laser. The survey included high, partial, and dichroic reflectors, anti-reflective coatings, and single layer films. The samples were supplied by ten vendors. The majority of samples tested were high reflectors and antireflective coatings. The highest damage thresholds were 8.5 to 9.4 J/cm 2 , respectively. Although these represent extremes of what has been tested so far, several vendors have produced coatings of both types with thresholds which consistently exceed 6 J/cm 2 . Repeated irradiations of some sites were made on a few samples. These yielded no degradation in threshold, but in fact some improvement in damage resistance. These same samples also exhibited no change in threshold after being retested seven months later

  13. A laser photofragmentation time-of-flight mass spectrometric study of acetophenone at 193 and 248 nm

    Science.gov (United States)

    Zhao, H.-Q.; Cheung, Y.-S.; Liao, C.-L.; Liao, C.-X.; Ng, C. Y.; Li, Wai-Kee

    1997-11-01

    The photodissociation of acetophenone (C6H5COCH3) at 193 and 248 nm has been studied using the time-of-flight mass spectrometric technique. For hν=193 nm, two major primary channels, C6H5COCH3+hν→C6H5CO+CH3 [channel (1)] and C6H5+CH3CO [channel (2)], are observed with comparable cross sections. Data analysis shows that ≈30%-50% of primary C6H5CO and CH3CO radicals further decomposes, yielding secondary products C6H5+CO and CH3+CO, respectively. The translational energy release measurements indicate that for both channels (1) and (2) at 193 nm, ≈25%-30% of the available energy is channeled into kinetic energies of the primary photofragments. Measurements at hν=248 nm reveal that the branching ratio of channel (2) to channel (1) is ≈0.01. For channel (1) at hν=248 nm, ≈42% of the available energy is directed as the kinetic energy of the photofragments. The observed maximum kinetic energy release for channel (1) at 248 nm yields a value of 85.0±2.2 kcal/mol for the C6H5CO-CH3 bond dissociation energy at 0 K (D0). The photofragment angular distributions are found to be isotropic for both channels (1) and (2) at hν=193 nm and for channel (1) at hν=248 nm. A minor photodissociation channel C6H5COCH3+hν→C6H5CH3+CO is identified at both hν=193 and 248 nm. The energetics for the dissociation reactions of acetophenone have also been investigated using ab initio Gaussian-2-type procedures. The heats of formation at 0 K (ΔfH°0) for C6H5CO and C6H5 calculated using the isodesmic reaction scheme are 33.9±1.3 and 87.6±1.0 kcal/mol, respectively. These results suggest that the literature ΔfH°0 values for C6H5CO and C6H5 are likely to be low by 3-4 kcal/mol. These theoretical ΔfH° values for C6H5CO and C6H5 yield a theoretical D0(C6H5CO-CH3) value of 85.1±1.4 kcal/mol, which is in excellent accord with the experimental results obtained in the present study.

  14. Photodissociation of dibromoethanes at 248 nm: an ignored channel of Br2 elimination.

    Science.gov (United States)

    Lee, Hsin-Lung; Lee, Ping-Chen; Tsai, Po-Yu; Lin, King-Chuen; Kuo, H H; Chen, P H; Chang, A H H

    2009-05-14

    Br(2) molecular elimination is probed in the photodissociation of 1,1- and 1,2-C(2)H(4)Br(2) isomeric forms at 248 nm by using cavity ring-down absorption spectroscopy. Their photodissociation processes differ markedly from each other. The quantum yield of the Br(2) fragment in 1,2-dibromoethane is 0.36+/-0.18, in contrast to a value of 0.05+/-0.03 in 1,1-dibromoethane. The vibrational population ratios of Br(2)(v=1)/Br(2)(v=0) are 0.8+/-0.1 and 0.5+/-0.2 for 1,2- and 1,1-dibromoethanes, respectively. The Br(2) yield densities are found to increase by a factor of 35% and 190% for 1,2- and 1,1-dibromoethanes within the same temperature increment. In the ab initio potential energy calculations, the transition state (TS) along the adiabatic ground state surface may correlate to the Br(2) products. The TS energy for 1,2-dibromoethane is well below the excitation energy at 483 kJ/mol, whereas that for 1,1-dibromoethane is slightly above. Such a small TS energy barrier impedes the photodissociation of the ground state 1,1-dibromoethane such that the production yield of Br(2) may become relatively low, but rise rapidly with the temperature. The TS structure shows a larger bond distance of Br-Br in 1,2-dibromoethane than that in 1,1-dibromoethane. That explains why the former isomer may result in hotter vibrational population of the Br(2) fragments.

  15. Human endothelial precursor cells express tumor endothelial marker 1/endosialin/CD248.

    Science.gov (United States)

    Bagley, Rebecca G; Rouleau, Cecile; St Martin, Thia; Boutin, Paula; Weber, William; Ruzek, Melanie; Honma, Nakayuki; Nacht, Mariana; Shankara, Srinivas; Kataoka, Shiro; Ishida, Isao; Roberts, Bruce L; Teicher, Beverly A

    2008-08-01

    Angiogenesis occurs during normal physiologic processes as well as under pathologic conditions such as tumor growth. Serial analysis of gene expression profiling revealed genes [tumor endothelial markers (TEM)] that are overexpressed in tumor endothelial cells compared with normal adult endothelial cells. Because blood vessel development of malignant tumors under certain conditions may include endothelial precursor cells (EPC) recruited from bone marrow, we investigated TEM expression in EPC. The expression of TEM1 or endosialin (CD248) and other TEM has been discovered in a population of vascular endothelial growth factor receptor 2+/CD31+/CD45-/VE-cadherin+ EPC derived from human CD133+/CD34+ cells. EPC share some properties with fully differentiated endothelial cells from normal tissue, yet reverse transcription-PCR and flow cytometry reveal that EPC express higher levels of endosialin at the molecular and protein levels. The elevated expression of endosialin in EPC versus mature endothelial cells suggests that endosialin is involved in the earlier stages of tumor angiogenesis. Anti-endosialin antibodies inhibited EPC migration and tube formation in vitro. In vivo, immunohistochemistry indicated that human EPC continued to express endosialin protein in a Matrigel plug angiogenesis assay established in nude mice. Anti-endosialin antibodies delivered systemically at 25 mg/kg were also able to inhibit circulating murine EPC in nude mice bearing s.c. SKNAS tumors. EPC and bone marrow-derived cells have been shown previously to incorporate into malignant blood vessels in some instances, yet they remain controversial in the field. The data presented here on endothelial genes that are up-regulated in tumor vasculature and in EPC support the hypothesis that the angiogenesis process in cancer can involve EPC.

  16. Joint Institute for Nuclear Research Data Analysis Guide - Berkelium Edition

    International Nuclear Information System (INIS)

    Henderson, R.A.

    2009-01-01

    This is a data analysis guide to the JINR system developed by Roger Henderson. It is intended as a complete guide to the data format and the calibration parameters utilized for the analysis of the data. This guide will provide the basic structure of the data files, the description of the individual data items, and the basic equations developed for the calculation of the results. Currently (7/17/2009), calculation of the calibration parameters is not a covered topic. It is intended that this will be covered in a future update

  17. Chelation and stabilization of berkelium in oxidation state +IV

    Czech Academy of Sciences Publication Activity Database

    Deblonde, G. J.-P.; Sturzbecher-Hoehne, M.; Rupert, P. B.; An, D. D.; Illy, M.-C.; Ralston, C. Y.; Brabec, Jiří; de Jong, W. A.; Strong, R. K.; Abergel, R. J.

    2017-01-01

    Roč. 9, č. 9 (2017), s. 843-849 ISSN 1755-4330 Institutional support: RVO:61388955 Keywords : bioorganic chemistry * chemical bonding * mass spectrometry Subject RIV: CF - Physical ; Theoretical Chemistry OBOR OECD: Physical chemistry Impact factor: 25.870, year: 2016

  18. Fast and stable gratings inscription in POFs made of different materials with pulsed 248 nm KrF laser

    DEFF Research Database (Denmark)

    Marques, C. A.F.; Min, R.; Leal, A.

    2018-01-01

    This paper presents fiber Bragg grating (FBG) inscription with a pulsed 248 nm UV KrF laser in polymer optical fibers (POFs) made of different polymers, namely polymethyl methacrylate (PMMA), cyclic-olefin polymer and co-polymer, and Polycarbonate. The inscribed gratings and the corresponding...... inscription parameters are compared with grating inscribed in POFs made of the aforementioned materials but with the hitherto most used laser for inscription, which is a continuous wave 325 nm UV HeCd laser. Results show a reduction of the inscription time of at least 16 times. The maximum time reduction...... is more than 130 times. In addition, a reflectivity and a bandwidth close to or higher than the ones with the 325 nm laser were obtained. The polymer optical fiber Bragg gratings (POFBGs) inscribed with the 248 nm laser setup present high stability with small variations in their central wavelength...

  19. Formation of copper tin sulfide films by pulsed laser deposition at 248 and 355 nm

    DEFF Research Database (Denmark)

    Ettlinger, Rebecca Bolt; Crovetto, Andrea; Canulescu, Stela

    2016-01-01

    The influence of the laser wavelength on the deposition of copper tin sulfide (CTS) and SnS-rich CTS with a 248-nm KrF excimer laser (pulse length τ = 20 ns) and a 355-nm frequency-tripled Nd:YAG laser (τ = 6 ns) was investigated. A comparative study of the two UV wavelengths shows that the CTS...... film growth rate per pulse was three to four times lower with the 248-nm laser than the 355-nm laser. SnS-rich CTS is more efficiently ablated than pure CTS. Films deposited at high fluence have submicron and micrometer size droplets, and the size and area density of the droplets do not vary significantly...

  20. Spectroscopy of neutron-rich nuclei populated in the spontaneous fission of 252Cf and 248Cm

    International Nuclear Information System (INIS)

    Smith, A. G.; Simpson, G. S.; Billowes, J.; Durell, J. L.; Phillips, W. R.; Dagnall, P. J.; Freeman, S. J.; Leddy, M.; Roach, A. A.; Smith, J. F.

    1999-01-01

    In this paper we present research that has been carried out using the Euroball and Eurogam arrays to detect γ rays emitted from spontaneously fissioning 248 Cm and 252 Cf. The paper focuses on three sub-areas of current activity, namely, the measurement of yields of secondary fragment pairs, the measurement of state lifetimes at around spin 10, and recent measurements of g-factors of excited states in fission fragments. (c) 1999 American Institute of Physics

  1. Photosensitivity of the Er/Yb-Codoped Schott IOG1 Phosphate Glass Using 248 nm, Femtosecond, and Picosecond Laser Radiation

    International Nuclear Information System (INIS)

    Pissadakis, S.; Michelakaki, I.

    2009-01-01

    The effect of 248 nm laser radiation, with pulse duration of 5 picoseconds, 500 femtosecond, and 120 femtosecond, on the optical properties and the Knoop hardness of a commercial Er/Yb-codoped phosphate glass is presented here. Refractive index changes of the order of few parts of 10-4 are correlated with optical absorption centers induced in the glass volume, using Kramers-Kroning relationship. Accordingly, substantially lower refractive index changes are measured in volume Bragg gratings inscribed in the glass, indicating that, in addition to the optical density changes, volume dilation changes of negative sign may also be associated with the 248 nm ultrafast irradiation. The Knoop hardness experimental results reveal that the glass matrix undergoes an observable initial hardening and then a reversing softening and volume dilation process for modest accumulated energy doses, where the Knoop hardness follows a nonmonotonic trend. Comparative results on the Knoop hardness trend are also presented for the case of 193 nm excimer laser radiation. The above findings denote that the positive or negative evolution of refractive index changes induced by the 248 0nm ultrafast radiation in the glass is dominated by the counteraction of the color center formation and the volume modification effects.

  2. A Compact Group of Galaxies at z = 2.48 Hosting an AGN-driven Outflow

    Science.gov (United States)

    Shih, Hsin-Yi; Stockton, Alan

    2015-12-01

    We present observations of a remarkable compact group of galaxies at z = 2.48. Four galaxies, all within 40 kpc of each other, surround a powerful high-redshift radio source. This group comprises two compact red passive galaxies and a pair of merging galaxies. One of the red galaxies, with an apparent stellar mass of 3.6 × 1011M⊙ and an effective radius of 470 pc, is one of the most extreme examples of a massive quiescent compact galaxy found so far. One of the pair of merging galaxies hosts the active galactic nucleus (AGN) producing the large powerful radio structure. The merger is massive and enriched, consistent with the mass-metallicity relation expected at this redshift. Close to the merging nuclei, the emission lines exhibit broad and asymmetric profiles that suggest outflows powered either by a very young expanding radio jet or by AGN radiation. At ≳50 kpc from the system, we found a fainter extended-emission region that may be a part of a radio-jet-driven outflow. Some of the data presented herein were obtained at the W. M. Keck Observatory, which is operated as a scientific partnership among the California Institute of Technology, the University of California, and the National Aeronautics and Space Administration. The Observatory was made possible by the generous financial support of the W. M. Keck Foundation. The work is also based, in part, on data collected at the Subaru Telescope, which is operated by the National Astronomical Observatory of Japan, and on observations obtained at the Gemini Observatory, which is operated by the Association of Universities for Research in Astronomy, Inc., under a cooperative agreement with the NSF on behalf of the Gemini partnership: the National Science Foundation (United States), the National Research Council (Canada), CONICYT (Chile), the Australian Research Council (Australia), Ministério da Ciência, Tecnologia e Inovação (Brazil), and Ministerio de Ciencia, Tecnología e Innovación Productiva (Argentina).

  3. 248-NM Laser Photolysis of CHBr3/O-Atom Mixtures: Kinetic Evidence for UV CO(A)-Chemiluminescence in the Reaction of Methylidyne Radicals With Atomic Oxygen

    National Research Council Canada - National Science Library

    Vaghjiani, Ghanshyam L

    2005-01-01

    4TH Positive and Cameron band emissions from electronically excited CO have been observed for the first time in 248-nm pulsed laser photolysis of a trace amount of CHBr3 vapor in an excess of O-atoms...

  4. Phosphorylation of serine 248 of C/EBPα is dispensable for myelopoiesis but its disruption leads to a low penetrant myeloid disorder with long latency.

    Directory of Open Access Journals (Sweden)

    Marie S Hasemann

    Full Text Available BACKGROUND: Transcription factors play a key role in lineage commitment and differentiation of stem cells into distinct mature cells. In hematopoiesis, they regulate lineage-specific gene expression in a stage-specific manner through various physical and functional interactions with regulatory proteins that are simultanously recruited and activated to ensure timely gene expression. The transcription factor CCAAT/enhancer binding protein α (C/EBPα is such a factor and is essential for the development of granulocytic/monocytic cells. The activity of C/EBPα is regulated on several levels including gene expression, alternative translation, protein interactions and posttranslational modifications, such as phosphorylation. In particular, the phosphorylation of serine 248 of the transactivation domain has been shown to be of crucial importance for granulocytic differentiation of 32Dcl3 cells in vitro. METHODOLOGY/PRINCIPAL FINDINGS: Here, we use mouse genetics to investigate the significance of C/EBPα serine 248 in vivo through the construction and analysis of Cebpa(S248A/S248A knock-in mice. Surprisingly, 8-week old Cebpa(S248A/S248A mice display normal steady-state hematopoiesis including unaltered development of mature myeloid cells. However, over time some of the animals develop a hematopoietic disorder with accumulation of multipotent, megakaryocytic and erythroid progenitor cells and a mild impairment of differentiation along the granulocytic-monocytic lineage. Furthermore, BM cells from Cebpa(S248A/S248A animals display a competitive advantage compared to wild type cells in a transplantation assay. CONCLUSIONS/SIGNIFICANCE: Taken together, our data shows that the substitution of C/EBPα serine 248 to alanine favors the selection of the megakaryocytic/erythroid lineage over the monocytic/granulocytic compartment in old mice and suggests that S248 phosphorylation may be required to maintain proper hematopoietic homeostasis in response to

  5. Phosphorylation of serine 248 of C/EBPα is dispensable for myelopoiesis but its disruption leads to a low penetrant myeloid disorder with long latency.

    Science.gov (United States)

    Hasemann, Marie S; Schuster, Mikkel B; Frank, Anne-Katrine; Theilgaard-Mönch, Kim; Pedersen, Thomas Å; Nerlov, Claus; Porse, Bo T

    2012-01-01

    Transcription factors play a key role in lineage commitment and differentiation of stem cells into distinct mature cells. In hematopoiesis, they regulate lineage-specific gene expression in a stage-specific manner through various physical and functional interactions with regulatory proteins that are simultanously recruited and activated to ensure timely gene expression. The transcription factor CCAAT/enhancer binding protein α (C/EBPα) is such a factor and is essential for the development of granulocytic/monocytic cells. The activity of C/EBPα is regulated on several levels including gene expression, alternative translation, protein interactions and posttranslational modifications, such as phosphorylation. In particular, the phosphorylation of serine 248 of the transactivation domain has been shown to be of crucial importance for granulocytic differentiation of 32Dcl3 cells in vitro. Here, we use mouse genetics to investigate the significance of C/EBPα serine 248 in vivo through the construction and analysis of Cebpa(S248A/S248A) knock-in mice. Surprisingly, 8-week old Cebpa(S248A/S248A) mice display normal steady-state hematopoiesis including unaltered development of mature myeloid cells. However, over time some of the animals develop a hematopoietic disorder with accumulation of multipotent, megakaryocytic and erythroid progenitor cells and a mild impairment of differentiation along the granulocytic-monocytic lineage. Furthermore, BM cells from Cebpa(S248A/S248A) animals display a competitive advantage compared to wild type cells in a transplantation assay. Taken together, our data shows that the substitution of C/EBPα serine 248 to alanine favors the selection of the megakaryocytic/erythroid lineage over the monocytic/granulocytic compartment in old mice and suggests that S248 phosphorylation may be required to maintain proper hematopoietic homeostasis in response to changes in the wiring of cellular signalling networks. More broadly, the marked differences

  6. Search for surviving actinides and superheavy nuclei in damped collisions of 238U with 238U and 248Cm

    International Nuclear Information System (INIS)

    Kratz, J.V.

    1980-03-01

    In the present talk aspects of the reaction mechanism related to the survival probability of the heaviest fragments in 238 U + 238 U collisions are discussed first. This is followed by a description of the experiments that have been performed to search for surviving superheavy fragments in the 238 U + 238 U reaction and by a presentation of the results obtained so far. In a third section our recent first attempts with the 238 U + 248 Cm reaction are described and preliminary results are discussed. (orig.)

  7. Dynamics of Db isotopes formed in reactions induced by 238U, 248Cm, and 249Bk across the Coulomb barrier

    Science.gov (United States)

    Kaur, Gurjit; Sandhu, Kirandeep; Kaur, Amandeep; Sharma, Manoj K.

    2018-05-01

    The dynamical cluster decay model is employed to investigate the decay of *265Db and *267Db nuclei, formed in the 27Al+238U , 18O+249Bk , and 19F+248Cm hot fusion reactions at energies around the Coulomb barrier. First, the fission dynamics of the 27Al+238U reaction is explored by investigating the fragmentation and preformation yield of the reaction. The symmetric mass distribution of the fission fragments is observed for *265Db nucleus, when static β2 i deformations are used within hot optimum orientation approach. However, the mass split gets broaden for the use of β2 i-dynamical hot configuration of the fragments and becomes clearly asymmetric for the cold-static-deformed approach. Within the application of cold orientations of fragments, a new fission channel is observed at mass asymmetry η =0.29 . In addition to 238U-induced reaction, the work is carried out to address the fission and neutron evaporation cross sections of *267Db nucleus formed via 19F+248Cm and 18O+249Bk reactions, besides a comprehensive analysis of fusion and capture processes. Higher fusion cross sections and compound nucleus formation probabilities (PCN) are obtained for the 18O+249Bk reaction, as larger mass asymmetry in the entrance channel leads to reduced Coulomb factor. Finally, the role of sticking (IS) and nonsticking (INS) moments of inertia is analyzed for the 4 n and 5 n channels of *267Db nuclear system.

  8. Photodissociation dynamics of the methyl perthiyl radical at 248 and 193 nm using fast-beam photofragment translational spectroscopy

    Energy Technology Data Exchange (ETDEWEB)

    Harrison, Aaron W.; Ryazanov, Mikhail; Sullivan, Erin N.; Neumark, Daniel M., E-mail: dneumark@berkeley.edu [Department of Chemistry, University of California, Berkeley, California 94720, USA and Chemical Sciences Division, Lawrence Berkeley National Laboratory, Berkeley, California 94720 (United States)

    2016-07-14

    The photodissociation dynamics of the methyl perthiyl radical (CH{sub 3}SS) have been investigated using fast-beam coincidence translational spectroscopy. Methyl perthiyl radicals were produced by photodetachment of the CH{sub 3}SS{sup −} anion followed by photodissociation at 248 nm (5.0 eV) and 193 nm (6.4 eV). Photofragment mass distributions and translational energy distributions were measured at each dissociation wavelength. Experimental results show S atom loss as the dominant (96%) dissociation channel at 248 nm with a near parallel, anisotropic angular distribution and translational energy peaking near the maximal energy available to ground state CH{sub 3}S and S fragments, indicating that the dissociation occurs along a repulsive excited state. At 193 nm, S atom loss remains the major fragmentation channel, although S{sub 2} loss becomes more competitive and constitutes 32% of the fragmentation. The translational energy distributions for both channels are very broad at this wavelength, suggesting the formation of the S{sub 2} and S atom products in several excited electronic states.

  9. A Peptide Derived from the HIV-1 gp120 Coreceptor-Binding Region Promotes Formation of PAP248-286 Amyloid Fibrils to Enhance HIV-1 Infection.

    Directory of Open Access Journals (Sweden)

    Jinquan Chen

    Full Text Available Semen is a major vehicle for HIV transmission. Prostatic acid phosphatase (PAP fragments, such as PAP248-286, in human semen can form amyloid fibrils to enhance HIV infection. Other endogenous or exogenous factors present during sexual intercourse have also been reported to promote the formation of seminal amyloid fibrils.Here, we demonstrated that a synthetic 15-residue peptide derived from the HIV-1 gp120 coreceptor-binding region, designated enhancing peptide 2 (EP2, can rapidly self-assemble into nanofibers. These EP2-derivated nanofibers promptly accelerated the formation of semen amyloid fibrils by PAP248-286, as shown by Thioflavin T (ThT and Congo red assays. The amyloid fibrils presented similar morphology, assessed via transmission electron microscopy (TEM, in the presence or absence of EP2. Circular dichroism (CD spectroscopy revealed that EP2 accelerates PAP248-286 amyloid fibril formation by promoting the structural transition of PAP248-286 from a random coil into a cross-β-sheet. Newly formed semen amyloid fibrils effectively enhanced HIV-1 infection in TZM-bl cells and U87 cells by promoting the binding of HIV-1 virions to target cells.Nanofibers composed of EP2 promote the formation of PAP248-286 amyloid fibrils and enhance HIV-1 infection.

  10. Operational tests of the BNL 24.8 kW, 3.80K helium refrigerator

    International Nuclear Information System (INIS)

    Brown, D.P.; Farah, Y.; Gibbs, R.J.; Schlafke, A.P.; Sondericker, J.H.

    1986-01-01

    The BNL 24.8 kW refrigeration system is completely installed and major portions of the acceptance tests have been completed. So far, the equipment tested has performed at or above design levels. The room temperature helium compressor station has been completely tested and accepted. The two-stage oil injected screw compressor system exhibited an isothermal efficiency of 57% while delivering a helium flow in excess of 4400 g/s. Data on the performance of the make-up gas cryogenic purifier is also given. The refrigerator turbomachinery, 13 expanders and three cold compressors, has been tested at room temperature for mechanical integrity and control stability. The first cooldown to operating temperature will be attempted in late August, 1985

  11. The Implementation of a 2/4/8 Antennas Configurable Diversity OFDM Receiver for Mobile HDTV Application

    Directory of Open Access Journals (Sweden)

    Jing Gao

    2009-01-01

    Full Text Available Two pre-FFT adaptive array (AA antenna combiners and a post-FFT carrier diversity (CD combiner are integrated with a Japan Terrestrial digital TV (ISDB-T OFDM receiver using 90 nm 7M1P CMOS process. A 2/4/8-antenna diversity receiver can be configured and a low-cost 4 antenna diversity reception system can be realized in one LSI by making use of the AA-CD two-stage diversity combining method. Mobile reception performance is increased by 1.63 times using a denoise filter circuit and SPLINE interpolator under urban 6-path Rayleigh fading (TU6 model with 2-antenna post-FFT carrier diversity (2CD combing mode. The die area is 49 mm2 and the power consumption is 310 mW.

  12. Operational tests of the BNL 24.8 kW, 3.8 K helium refrigerator

    International Nuclear Information System (INIS)

    Brown, D.P.; Farah, Y.; Gibbs, R.J.

    1985-01-01

    The BNL 24.8 kW refrigeration system is completely installed and major portions of the acceptance tests have been completed. So far, the equipment tested has performed at or above design levels. The room temperature helium compressor station has been completely tested and accepted. The two-stage oil injected screw compressor system exhibited an isothermal efficiency of 57% while delivering a helium flow in excess of 4400 g/s. Data on the performance of the make-up gas cryogenic purifier is given. The refrigerator turbomachinery, 13 expanders and three cold compressors, has been tested at room temperature for mechanical integrity and control stability. The first cooldown to operating temperature will be attempted in late August, 1985. 2 refs., 5 figs

  13. Photodissociation dynamics of the simplest alkyl peroxy radicals, CH3OO and C2H5OO, at 248 nm

    Science.gov (United States)

    Sullivan, Erin N.; Nichols, Bethan; Neumark, Daniel M.

    2018-01-01

    The photodissociation dynamics of the simplest alkyl peroxy radicals, methyl peroxy (CH3OO) and ethyl peroxy (C2H5OO), are investigated using fast beam photofragment translational spectroscopy. A fast beam of CH3OO- or C2H5OO- anions is photodetached to generate neutral radicals that are subsequently dissociated using 248 nm photons. The coincident detection of the photofragment positions and arrival times allows for the determination of mass, translational energy, and angular distributions for both two-body and three-body dissociation events. CH3OO exhibits repulsive O loss resulting in the formation of O(1D) + CH3O with high translational energy release. Minor two-body channels leading to OH + CH2O and CH3O + O(3P) formation are also detected. In addition, small amounts of H + O(3P) + CH2O are observed and attributed to O loss followed by CH3O dissociation. C2H5OO exhibits more complex dissociation dynamics, in which O loss and OH loss occur in roughly equivalent amounts with O(1D) formed as the dominant O atom electronic state via dissociation on a repulsive surface. Minor two-body channels leading to the formation of O2 + C2H5 and HO2 + C2H4 are also observed and attributed to a ground state dissociation pathway following internal conversion. Additionally, C2H5OO dissociation yields a three-body product channel, CH3 + O(3P) + CH2O, for which the proposed mechanism is repulsive O loss followed by the dissociation of C2H5O over a barrier. These results are compared to a recent study of tert-butyl peroxy (t-BuOO) in which 248 nm excitation results in three-body dissociation and ground state two-body dissociation but no O(1D) production.

  14. Experimental Cross Sections for Reactions of Heavy Ions and 208Pb, 209Bi, 238U, and 248Cm Targets

    International Nuclear Information System (INIS)

    Patin, Joshua B.

    2002-01-01

    The study of the reactions between heavy ions and 208 Pb, 209 Bi, 238 U, and 248 Cm targets was performed to look at the differences between the cross sections of hot and cold fusion reactions. Experimental cross sections were compared with predictions from statistical computer codes to evaluate the effectiveness of the computer code in predicting production cross sections. Hot fusion reactions were studied with the MG system, catcher foil techniques and the Berkeley Gas-filled Separator (BGS). 3n- and 4n-exit channel production cross sections were obtained for the 238 U( 18 O,xn) 256-x Fm, 238 U( 22 Ne,xn) 260-x No, and 248 Cm( 15 N,xn) 263-x Lr reactions and are similar to previous experimental results. The experimental cross sections were accurately modeled by the predictions of the HIVAP code using the Reisdorf and Schaedel parameters and are consistent with the existing systematics of 4n exit channel reaction products. Cold fusion reactions were examined using the BGS. The 208 Pb( 48 Ca,xn) 256-x No, 208 Pb( 50 Ti,xn) 258-x Rf, 208 Pb( 51 V,xn) 259-x Db, 209 Bi( 50 Ti,xn) 259-x Db, and 209 Bi( 51 V,xn) 260-x Sg reactions were studied. The experimental production cross sections are in agreement with the results observed in previous experiments. It was necessary to slightly alter the Reisdorf and Schaedel parameters for use in the HIVAP code in order to more accurately model the experimental data. The cold fusion experimental results are in agreement with current 1n- and 2n-exit channel systematics

  15. Laser induced transient absorptions of the excited triplet state of 9,10-anthraquinone-2-sulfonate. A further study by 248 nm laser photolysis

    International Nuclear Information System (INIS)

    Ma Jianhua; Lin Weizheng; Wang Wenfen; Yao Side; Lin Nianyun

    1999-01-01

    Transient absorption spectrum of triplet state of 9,10-anthraquinone-2-sulfonate (AQS) in aqueous solution has been investigated using 248 nm (KrF) laser photolysis. A whole transient absorption spectrum with absorption maxim at 380 nm and 580 nm has been assigned to triple AQS from detailed kinetic analysis of decay of 380 nm and 580 nm signals, which is the neat characteristic absorption of triplet AQS reported for the first time. In addition, the difference in feature of the spectrum of triplet AQS in H 2 O and that in CH 3 CN was eliminated by further study using 248 nm laser pulses

  16. L-shell emission from high-Z solid targets by intense (10{sup 19}W/cm{sup 2}) irradiation with a 248nm laser

    Energy Technology Data Exchange (ETDEWEB)

    Nelson, T. R.; Borisov, A. B.; Boyer, K.; Schroeder, W. A.; Santoro, J.; Van Tassle, A. J.; Rhodes, C. K.; Luk, T. S.; Cameron, S.; Longworth, J. W.; McPherson, A.

    1999-11-22

    Efficient (1.2% yield) multikilovolt x-ray emission from Ba(L) (2.4--2.8{angstrom}) and Gd(L) (1.7--2.1{angstrom}) is produced by ultraviolet (248nm) laser-excited BaF{sub 2} and Gd solids. The high efficiency is attributed to an inner shell-selective collisional electron ejection.

  17. High throughput virtual screening and in silico ADMET analysis for rapid and efficient identification of potential PAP248-286 aggregation inhibitors as anti-HIV agents

    Science.gov (United States)

    Malik, Ruchi; Bunkar, Devendra; Choudhary, Bhanwar Singh; Srivastava, Shubham; Mehta, Pakhuri; Sharma, Manish

    2016-10-01

    Human semen is principal vehicle for transmission of HIV-1 and other enveloped viruses. Several endogenous peptides present in semen, including a 39-amino acid fragments of prostatic acid phosphatase (PAP248-286) assemble into amyloid fibrils named as semen-derived enhancer of viral infection (SEVI) that promote virion attachment to target cells which dramatically enhance HIV virus infection by up to 105-fold. Epigallocatechin-3-gallate (EGCG), a polyphenolic compound, is the major catechin found in green tea which disaggregates existing SEVI fibers, and inhibits the formation of SEVI fibers. The aim of this study was to screen a number of relevant polyphenols to develop a rational approach for designing PAP248-286 aggregation inhibitors as potential anti-HIV agents. The molecular docking based virtual screening results showed that polyphenolic compounds 2-6 possessed good docking score and interacted well with the active site residues of PAP248-286. Amino acid residues of binding site namely; Lys255, Ser256, Leu258 and Asn265 are involved in binding of these compounds. In silico ADMET prediction studies on these hits were also found to be promising. Polyphenolic compounds 2-6 identified as hits may act as novel leads for inhibiting aggregation of PAP248-286 into SEVI.

  18. Advances on Polymer Optical Fiber Gratings Using a KrF Pulsed Laser System Operating at 248 nm

    Directory of Open Access Journals (Sweden)

    Carlos A. F. Marques

    2018-03-01

    Full Text Available This paper presents the achievements and progress made on the polymer optical fiber (POF gratings inscription in different types of Fiber Bragg Gratings (FBGs and long period gratings (LPGs. Since the first demonstration of POFBGs in 1999, significant progress has been made where the inscription times that were higher than 1 h have been reduced to 15 ns with the application of the krypton fluoride (KrF pulsed laser operating at 248 nm and thermal treatments such as the pre-annealing of fibers. In addition, the application of dopants such as benzyl dimethyl ketal (BDK has provided a significant decrease of the fiber inscription time. Furthermore, such improvements lead to the possibility of inscribing POF gratings in 850 nm and 600 nm, instead of only the 1550 nm region. The progress on the inscription of different types of polymer optical fiber Bragg gratings (POFBGs such as chirped POFBGs and phase-shifted POFBGs are also reported in this review.

  19. Cervical foraminal steroid injections under CT guidance: retrospective study of in situ contrast aspects in a serial of 248 cases

    Energy Technology Data Exchange (ETDEWEB)

    Pottecher, Pierre; Krause, Denis; Di Marco, Lucy; Loffroy, Romaric; Estivalet, Louis [CHU Dijon Bocage Central, Departement de Radiologie et Imagerie Diagnostique et Interventionnelle, Dijon (France); Duhal, Romain; Demondion, Xavier [CHRU de Lille, Service de Radiologie Musculosquelettique, CCIAL, Laboratoire d' Anatomie, Faculte de Medecine de Lille, Hopital Roger Salengro, Lille (France)

    2015-01-15

    To describe all the CT findings after in situ contrast injection just before steroid injection and to recognize the abnormal aspects associated with intravascular contamination. We retrospectively evaluated 248 cervical transforaminal steroid injections done at the university hospital in Dijon, France, in 2008-2012, to treat cervicobrachial neuralgia inadequately improved by optimal medical treatment for at least 3 weeks. Features describing the opacification patterns were recorded. Five main nonvascular opacification patterns were identified: clumps of contrast agent outside the foramen (16 %), a crab claw pattern surrounding the ganglion (13 %), a ''French'' circumflex accent pattern (15 %), reflux along the needle (7 %), and facet joint capsule opacification (22 %). Concerning the situations requiring a change in needle position, intravenous injection occurred in 26 % of the patients, with a crab claw pattern in half the cases and a clump pattern in half the cases. Intraarteriolar injection was noted in two patients. CT after in situ contrast injection ensures proper needle positioning outside the blood vessels before steroid injection. Penetration of the needle tip into a vein is very common, whereas arteriolar puncture is extremely rare. (orig.)

  20. Pages 242 - 248.pmd

    African Journals Online (AJOL)

    Administrator

    Department of Paediatrics and Child Health Makerere University, Kampala, Uganda. 2. Department of ... several times each day, often during meals, and in ..... Figure 2: The smaller patient has Nodding syndrome and is the same age as the taller adolescent who is of the ... Onchocerca volvulus in the CSF confirms our lack.

  1. Measurement of intensity-dependent rates of above-threshold ionization (ATI) of atomic hydrogen at 248 nm

    International Nuclear Information System (INIS)

    Nichols, T.D.

    1991-04-01

    Measured rates of multiphoton ionization (MPI) from the ground state of atomic hydrogen by a linearly polarized, subpicosecond KrF laser pulse at 248 nm wavelength are compared to predictions of lowest-order perturbation theory, Floquet theory, and Keldysh-Faisal-Reiss (KFR) theory with and without Coulomb correction for peak irradiance of 3 x 10 12 W/cm 2 to 2 x 10 14 W/cm 2 . The Coulomb-corrected Keldysh model falls closest to the measured rates, the others being much higher or much lower. At 5 x 10 13 W/cm 2 , the number of ATI electrons decreased by a factor of approximately 40 with each additional photon absorbed. ATI of the molecular hydrogen background and of atoms from photodissociation of the molecules were also observed. The experiment employed a crossed-beam technique at ultrahigh vacuum with an rf-discharge atomic hydrogen source and a magnetic-bottle type electron time-of-flight spectrometer to count the electrons in the different ATI channels separately. The apparatus was calibrated to allow comparison of absolute as well as relative ionization rates to the theoretical predictions. This calibration involved measuring the distribution of irradiance in a focal volume that moved randomly and changed its size from time to time. A data collection system under computer control divided the time-of-flight spectra into bins according to the energy of each laser pulse. This is the first measurement of absolute rates of ATI in atomic hydrogen, and the first measurement of absolute test of MPI in atomic hydrogen without a large factor to account for multiple modes in the laser field. As such, the results of this work are important to the development of ATI theories, which presently differ by orders of magnitude in their prediction of the ionization rates. They are also important to recent calculations of temperatures in laser-heated plasmas, many of which incorporate KFR theory

  2. Laser ablation of ceramic Al{sub 2}O{sub 3} at 193 nm and 248 nm: The importance of single-photon ionization processes

    Energy Technology Data Exchange (ETDEWEB)

    Pelaez, R. J.; Afonso, C. N. [Laser Processing Group, Instituto de Optica, CSIC, Serrano 121, Madrid 28006 (Spain); Bator, M.; Lippert, T. [General Energy Research Department, Paul Scherrer Institut, CH-5232 Villigen PSI (Switzerland)

    2013-06-14

    The aim of this work is to demonstrate that single-photon photoionization processes make a significant difference in the expansion and temperature of the plasma produced by laser ablation of ceramic Al{sub 2}O{sub 3} in vacuum as well as to show their consequences in the kinetic energy distribution of the species that eventually will impact on the film properties produced by pulsed laser deposition. This work compares results obtained by mass spectrometry and optical spectroscopy on the composition and features of the plasma produced by laser ablation at 193 nm and 248 nm, i.e., photon energies that are, respectively, above and below the ionization potential of Al, and for fluences between threshold for visible plasma and up to Almost-Equal-To 2 times higher. The results show that the ionic composition and excitation of the plasma as well as the ion kinetic energies are much higher at 193 nm than at 248 nm and, in the latter case, the population of excited ions is even negligible. The comparison of Maxwell-Boltzmann temperature, electron temperatures, and densities of the plasmas produced with the two laser wavelengths suggests that the expansion of the plasma produced at 248 nm is dominated by a single population. Instead, the one produced at 193 nm is consistent with the existence of two populations of cold and hot species, the latter associated to Al{sup +} ions that travel at the forefront and produced by single photon ionization as well as Al neutrals and double ionized ions produced by electron-ion impact. The results also show that the most energetic Al neutrals in the plasma produced at the two studied wavelengths are in the ground state.

  3. Laser ablation of ceramic Al2O3 at 193 nm and 248 nm: The importance of single-photon ionization processes

    Science.gov (United States)

    Peláez, R. J.; Afonso, C. N.; Bator, M.; Lippert, T.

    2013-06-01

    The aim of this work is to demonstrate that single-photon photoionization processes make a significant difference in the expansion and temperature of the plasma produced by laser ablation of ceramic Al2O3 in vacuum as well as to show their consequences in the kinetic energy distribution of the species that eventually will impact on the film properties produced by pulsed laser deposition. This work compares results obtained by mass spectrometry and optical spectroscopy on the composition and features of the plasma produced by laser ablation at 193 nm and 248 nm, i.e., photon energies that are, respectively, above and below the ionization potential of Al, and for fluences between threshold for visible plasma and up to ≈2 times higher. The results show that the ionic composition and excitation of the plasma as well as the ion kinetic energies are much higher at 193 nm than at 248 nm and, in the latter case, the population of excited ions is even negligible. The comparison of Maxwell-Boltzmann temperature, electron temperatures, and densities of the plasmas produced with the two laser wavelengths suggests that the expansion of the plasma produced at 248 nm is dominated by a single population. Instead, the one produced at 193 nm is consistent with the existence of two populations of cold and hot species, the latter associated to Al+ ions that travel at the forefront and produced by single photon ionization as well as Al neutrals and double ionized ions produced by electron-ion impact. The results also show that the most energetic Al neutrals in the plasma produced at the two studied wavelengths are in the ground state.

  4. Photolysis of CH3CHO at 248 nm: Evidence of triple fragmentation from primary quantum yield of CH3 and HCO radicals and H atoms

    Science.gov (United States)

    Morajkar, Pranay; Bossolasco, Adriana; Schoemaecker, Coralie; Fittschen, Christa

    2014-06-01

    Radical quantum yields have been measured following the 248 nm photolysis of acetaldehyde, CH3CHO. HCO radical and H atom yields have been quantified by time resolved continuous wave Cavity Ring Down Spectroscopy in the near infrared following their conversion to HO2 radicals by reaction with O2. The CH3 radical yield has been determined using the same technique following their conversion into CH3O2. Absolute yields have been deduced for HCO radicals and H atoms through fitting of time resolved HO2 profiles, obtained under various O2 concentrations, to a complex model, while the CH3 yield has been determined relative to the CH3 yield from 248 nm photolysis of CH3I. Time resolved HO2 profiles under very low O2 concentrations suggest that another unknown HO2 forming reaction path exists in this reaction system besides the conversion of HCO radicals and H atoms by reaction with O2. HO2 profiles can be well reproduced under a large range of experimental conditions with the following quantum yields: CH3CHO + hν248nm → CH3CHO*, CH3CHO* → CH3 + HCO ϕ1a = 0.125 ± 0.03, CH3CHO* → CH3 + H + CO ϕ1e = 0.205 ± 0.04, CH3CHO*{to 2pc{rArrfill}}limits^{o2}CH3CO + HO2 ϕ1f = 0.07 ± 0.01. The CH3O2 quantum yield has been determined in separate experiments as φ_{CH3} = 0.33 ± 0.03 and is in excellent agreement with the CH3 yields derived from the HO2 measurements considering that the triple fragmentation (R1e) is an important reaction path in the 248 nm photolysis of CH3CHO. From arithmetic considerations taking into account the HO2 and CH3 measurements we deduce a remaining quantum yield for the molecular pathway: CH3CHO* → CH4 + CO ϕ1b = 0.6. All experiments can be consistently explained with absence of the formerly considered pathway: CH3CHO* → CH3CO + H ϕ1c = 0.

  5. Photolysis of CH₃CHO at 248 nm: evidence of triple fragmentation from primary quantum yield of CH₃ and HCO radicals and H atoms.

    Science.gov (United States)

    Morajkar, Pranay; Bossolasco, Adriana; Schoemaecker, Coralie; Fittschen, Christa

    2014-06-07

    Radical quantum yields have been measured following the 248 nm photolysis of acetaldehyde, CH3CHO. HCO radical and H atom yields have been quantified by time resolved continuous wave Cavity Ring Down Spectroscopy in the near infrared following their conversion to HO2 radicals by reaction with O2. The CH3 radical yield has been determined using the same technique following their conversion into CH3O2. Absolute yields have been deduced for HCO radicals and H atoms through fitting of time resolved HO2 profiles, obtained under various O2 concentrations, to a complex model, while the CH3 yield has been determined relative to the CH3 yield from 248 nm photolysis of CH3I. Time resolved HO2 profiles under very low O2 concentrations suggest that another unknown HO2 forming reaction path exists in this reaction system besides the conversion of HCO radicals and H atoms by reaction with O2. HO2 profiles can be well reproduced under a large range of experimental conditions with the following quantum yields: CH3CHO + hν(248nm) → CH3CHO*, CH3CHO* → CH3 + HCO ϕ(1a) = 0.125 ± 0.03, CH3CHO* → CH3 + H + CO ϕ(1e) = 0.205 ± 0.04, CH3CHO*[Formula: see text]CH3CO + HO2 ϕ(1f) = 0.07 ± 0.01. The CH3O2 quantum yield has been determined in separate experiments as ϕ(CH₃) = 0.33 ± 0.03 and is in excellent agreement with the CH3 yields derived from the HO2 measurements considering that the triple fragmentation (R1e) is an important reaction path in the 248 nm photolysis of CH3CHO. From arithmetic considerations taking into account the HO2 and CH3 measurements we deduce a remaining quantum yield for the molecular pathway: CH3CHO* → CH4 + CO ϕ(1b) = 0.6. All experiments can be consistently explained with absence of the formerly considered pathway: CH3CHO* → CH3CO + H ϕ(1c) = 0.

  6. Coinheritance of High Oxygen Affinity Hb Helsinki [HBB: c.248A>T; β82(EF6)Lys→Met] with Hb H Disease.

    Science.gov (United States)

    Lee, Shir-Ying; Goh, Jia-Hui; Tan, Karen M L; Liu, Te-Chih

    2017-05-01

    Hb Helsinki [HBB: c.248A>T; β82(EF6)Lys→Met] is a high oxygen affinity hemoglobin (Hb) causing polycythemia, whereas Hb H (β4) disease causes mild to severe chronic hemolytic anemia. The clinical characteristics, gel electrophoresis, capillary electrophoresis (CE) and molecular genotyping of a case of Hb Helsinki coinherited with Hb H disease in an ethnic Malay is described, illustrating the interaction between the β-globin variant and coinheritance of three α gene deletions. The proband was asymptomatic, exhibited microcytosis and a normal with Hb value.

  7. (n,d) elastic differential cross section at 2.48 and 3.28 MeV and related phase shift analyses

    International Nuclear Information System (INIS)

    Chatelain, P.; Onel, Y.; Viennet, R.; Weber, J.

    1978-01-01

    In the case of (n,d) scattering, at energies of a few MeV, the elastic differential scattering cross sections are not well determined, especially beyond costhetasub(CM) = -0.8 and the number of data points is rather scarce. This lack of experimental data causes great difficulty to perform a phase shift analysis even in the simple case when partial waves up to lsub(max) = 2 are included as free parameters in the parametrization of the scattering amplitude. We have therefore, in the framework of our study of the (n,d) scattering, measured this cross section at 2.48 and 3.28 MeV with special emphasize on large scattering angles. (orig./WL) [de

  8. Photodissociation of CH3CHO at 248 nm by time-resolved Fourier-transform infrared emission spectroscopy: Verification of roaming and triple fragmentation

    Science.gov (United States)

    Hung, Kai-Chan; Tsai, Po-Yu; Li, Hou-Kuan; Lin, King-Chuen

    2014-02-01

    By using time-resolved Fourier-transform infrared emission spectroscopy, the HCO fragment dissociated from acetaldehyde (CH3CHO) at 248 nm is found to partially decompose to H and CO. The fragment yields are enhanced by the Ar addition that facilitates the collision-induced internal conversion. The channels to CH2CO + H2 and CH3CO + H are not detected significantly. The rotational population distribution of CO, after removing the Ar collision effect, shows a bimodal feature comprising both low- and high-rotational (J) components, sharing a fraction of 19% and 81%, respectively, for the vibrational state v = 1. The low-J component is ascribed to both roaming pathway and triple fragmentation. They are determined to have a branching ratio of 0.06, respectively, relative to the whole v = 1 population. The CO roaming is accompanied by a highly vibrational population of CH4 that yields a vibrational bimodality.

  9. Effects of temperature on the p53-DNA binding interactions and their dynamical behavior: comparing the wild type to the R248Q mutant.

    Directory of Open Access Journals (Sweden)

    Khaled Barakat

    Full Text Available BACKGROUND: The protein p53 plays an active role in the regulation of cell cycle. In about half of human cancers, the protein is inactivated by mutations located primarily in its DNA-binding domain. Interestingly, a number of these mutations possess temperature-induced DNA-binding characteristics. A striking example is the mutation of Arg248 into glutamine or tryptophan. These mutants are defective for binding to DNA at 310 K although they have been shown to bind specifically to several p53 response elements at sub-physiological temperatures (298-306 K. METHODOLOGY/PRINCIPAL FINDINGS: This important experimental finding motivated us to examine the effects of temperature on the structure and configuration of R248Q mutant and compare it to the wild type protein. Our aim is to determine how and where structural changes of mutant variants take place due to temperature changes. To answer these questions, we compared the mutant to the wild-type proteins from two different aspects. First, we investigated the systems at the atomistic level through their DNA-binding affinity, hydrogen bond networks and spatial distribution of water molecules. Next, we assessed changes in their long-lived conformational motions at the coarse-grained level through the collective dynamics of their side-chain and backbone atoms separately. CONCLUSIONS: The experimentally observed effect of temperature on the DNA-binding properties of p53 is reproduced. Analysis of atomistic and coarse-grained data reveal that changes in binding are determined by a few key residues and provide a rationale for the mutant-loss of binding at physiological temperatures. The findings can potentially enable a rescue strategy for the mutant structure.

  10. Altered fast- and slow-twitch muscle fibre characteristics in female mice with a (S248F) knock-in mutation of the brain neuronal nicotinic acetylcholine receptor.

    Science.gov (United States)

    Cannata, David J; Finkelstein, David I; Gantois, Ilse; Teper, Yaroslav; Drago, John; West, Jan M

    2009-01-01

    We generated a mouse line with a missense mutation (S248F) in the gene (CHRNA4) encoding the alpha4 subunit of neuronal nicotinic acetylcholine receptor (nAChR). Mutant mice demonstrate brief nicotine induced dystonia that resembles the clinical events seen in patients with the same mutation. Drug-induced dystonia is more pronounced in female mice, thus our aim was to determine if the S248F mutation changed the properties of fast- and slow-twitch muscle fibres from female mutant mice. Reverse transcriptase-PCR confirmed CHRNA4 gene expression in the brain but not skeletal muscles in normal and mutant mice. Ca(2+) and Sr(2+) force activation curves were obtained using skinned muscle fibres prepared from slow-twitch (soleus) and fast-twitch (EDL) muscles. Two significant results were found: (1) the (pCa(50) - pSr(50)) value from EDL fibres was smaller in mutant mice than in wild type (1.01 vs. 1.30), (2) the percentage force produced at pSr 5.5 was larger in mutants than in wild type (5.76 vs. 0.24%). Both results indicate a shift to slow-twitch characteristics in the mutant. This conclusion is supported by the identification of the myosin heavy chain (MHC) isoforms. Mutant EDL fibres expressed MHC I (usually only found in slow-twitch fibres) as well as MHC IIa. Despite the lack of spontaneous dystonic events, our findings suggest that mutant mice may be having subclinical events or the mutation results in a chronic alteration to muscle neural input.

  11. Br2 elimination in 248-nm photolysis of CF2Br2 probed by using cavity ring-down absorption spectroscopy.

    Science.gov (United States)

    Hsu, Ching-Yi; Huang, Hong-Yi; Lin, King-Chuen

    2005-10-01

    By using cavity ring-down absorption spectroscopy technique, we have observed the channel of Br2 molecular elimination following photodissociation of CF2Br2 at 248 nm. A tunable laser beam, which is crossed perpendicular to the photolyzing laser beam in a ring-down cell, is used to probe the Br2 fragment in the B 3Piou+-X1Sigmag+ transition. The vibrational population is obtained in a nascent state, despite ring-down time as long as 500-1000 ns. The population ratio of Br2(v=1)/Br2(v=0) is determined to be 0.4+/-0.2, slightly larger than the value of 0.22 evaluated by Boltzmann distribution at room temperature. The quantum yield of the Br2 elimination reaction is also measured to be 0.04+/-0.01. This work provides direct evidence to support molecular elimination occurring in the CF2Br2 photodissociation and proposes a plausible pathway with the aid of ab initio potential-energy calculations. CF2Br2 is excited probably to the 1B1 and 3B2 states at 248 nm. As the C-Br bond is elongated upon excitation, the coupling of the 1A'(1B1) state to the high vibrational levels of the ground state X 1A'(1A1) may be enhanced to facilitate the process of internal conversion. After transition, the highly vibrationally excited CF2Br2 feasibly surpasses a transition barrier prior to decomposition. According to the ab initio calculations, the transition state structure tends to correlate with the intermediate state CF2Br+Br(CF2Br...Br) and the products CF2+Br2. A sequential photodissociation pathway is thus favored. That is, a single C-Br bond breaks, and then the free-Br atom moves to form a Br-Br bond, followed by the Br2 elimination. The formed Br-Br bond distance in the transition state tends to approach equilibrium such that the Br2 fragment may be populated in cold vibrational distribution. Observation of a small vibrational population ratio of Br2(v=1)Br2(v=0) agrees with the proposed mechanism.

  12. Remarkably High Stability of Late Actinide Dioxide Cations: Extending Chemistry to Pentavalent Berkelium and Californium.

    Science.gov (United States)

    Dau, Phuong D; Vasiliu, Monica; Peterson, Kirk A; Dixon, David A; Gibson, John K

    2017-12-06

    Actinyl chemistry is extended beyond Cm to BkO 2 + and CfO 2 + through transfer of an O atom from NO 2 to BkO + or CfO + , establishing a surprisingly high lower limit of 73 kcal mol -1 for the dissociation energies, D[O-(BkO + )] and D[O-(CfO + )]. CCSD(T) computations are in accord with the observed reactions, and characterize the newly observed dioxide ions as linear pentavalent actinyls; these being the first Bk and Cf species with oxidation states above IV. Computations of actinide dioxide cations AnO 2 + for An=Pa to Lr reveal an unexpected minimum for D[O-(CmO + )]. For CmO 2 + , and AnO 2 + beyond EsO 2 + , the most stable structure has side-on bonded η 2 -(O 2 ), as An III peroxides for An=Cm and Lr, and as An II superoxides for An=Fm, Md, and No. It is predicted that the most stable structure of EsO 2 + is linear [O=Es V =O] + , einsteinyl, and that FmO 2 + and MdO 2 + , like CmO 2 + , also have actinyl(V) structures as local energy minima. The results expand actinide oxidation state chemistry, the realm of the distinctive actinyl moiety, and the non-periodic character towards the end of the periodic table. © 2017 Wiley-VCH Verlag GmbH & Co. KGaA, Weinheim.

  13. Total neutron cross sections of berkelium-249 and californium-249 below 100 eV

    International Nuclear Information System (INIS)

    Benjamin, R.W.; Harvey, J.A.; Hill, N.W.; Pandey, M.S.; Carlton, R.F.

    1979-01-01

    The neutron total cross sections of 249 Bk and 249 Cf have been measured from 0.03 to 100 eV using the Oak Ridge Electron Linear Accelerator (ORELA) as a source of pulsed neutrons. The 1.6 mm dia. cylindrical transmission samples contained initially up to 5.3 mg of 98% 249 Bk and 2% 249 Cf: 4.5 years later, when the final measurements were made, the composition of the samples had become 2.5% 249 Bk, 96.9% 249 Cf, and 0.6% 245 Cm. Samples were cooled with liquid nitrogen to reduce Doppler broadening. Thirty-nine resonances were identified in 249 Bk and analyzed using a single-level Breit-Wigner formalism. Fifty-five resonances were identified in 249 Cf and analyzed using an R-matrix multilevel formalism. Fifty-five resonances were identified in 249 Cf and analyzed using an R-matrix multilevel formalism. The resonance parameters obtained have been used to determine the average level spacings and the s-wave neutron and fission strength functions. Where possible, bound-level parameters were derived to fit the thermal neutron total cross section data

  14. 248 nm photolysis of CH2Br2 by using cavity ring-down absorption spectroscopy: Br2 molecular elimination at room temperature.

    Science.gov (United States)

    Wei, Pei-Ying; Chang, Yuan-Ping; Lee, Wei-Bin; Hu, Zhengfa; Huang, Hong-Yi; Lin, King-Chuen; Chen, K T; Chang, A H H

    2006-10-07

    Following photodissociation of CH2Br2 at 248 nm, Br2 molecular elimination is detected by using a tunable laser beam, as crossed perpendicular to the photolyzing laser beam in a ring-down cell, probing the Br2 fragment in the B 3Piou+ -X 1Sigmag+ transition. The nascent vibrational population is obtained, yielding a population ratio of Br2(v = 1)Br2(v = 0) to be 0.7 +/- 0.2. The quantum yield for the Br2 elimination reaction is determined to be 0.2 +/- 0.1. Nevertheless, when CH2Br2 is prepared in a supersonic molecular beam under cold temperature, photofragmentation gives no Br2 detectable in a time-of-flight mass spectrometer. With the aid of ab initio potential energy calculations, a plausible pathway is proposed. Upon excitation to the 1B1 or 3B1 state, C-Br bond elongation may change the molecular symmetry of Cs and enhance the resultant 1 1,3A'-X 1A' (or 1 1,3B1-X 1A1 as C2v is used) coupling to facilitate the process of internal conversion, followed by asynchronous concerted photodissociation. Temperature dependence measurements lend support to the proposed pathway.

  15. Probing the ignored elimination channel of Br2 in the 248 nm photodissociation of 1,1-dibromoethylene by cavity ring-down absorption spectroscopy.

    Science.gov (United States)

    Lee, Ping-Chen; Tsai, Po-Yu; Hsiao, Ming-Kai; Lin, King-Chuen; Huang, C H; Chang, A H H

    2009-03-09

    In the photodissociation of 1,1-C(2)H(2)Br(2) at 248 nm, the Br(2) elimination channel is probed by using cavity ring-down absorption spectroscopy (CRDS). In terms of spectral simulation, the vibrational population ratio of Br(2)(v = 1)/Br(2)(v = 0) is found to be 0.55+/-0.05, which indicates that the Br(2) fragment is vibrationally hot. The rotational population is thermally equilibrated with a Boltzmann temperature of 349+/-38 K. According to ab initio potential energy calculations, the obtained fragments are anticipated to result primarily from photodissociation of the ground electronic state that undergoes 1) H migration followed by three-center elimination, and 2) isomerization forming either trans- or cis-1,2-C(2)H(2)Br(2) from which Br(2) is eliminated. RRKM calculations predict that the Br(2) dissociation rates through the ground singlet state prevail over those through the triplet state. Measurements of temperature and Ar pressure dependence are examined to support the proposed pathway via internal conversion. The quantum yield for the Br(2) elimination reaction is determined to be 0.07+/-0.04. This result is smaller than that obtained in 1,2-C(2)H(2)Br(2), probably because the dissociation rates are slowed in the isomerization stage.

  16. Photodissociation of 1,2-dibromoethylene at 248 nm: Br2 molecular elimination probed by cavity ring-down absorption spectroscopy.

    Science.gov (United States)

    Chang, Yuan-Pin; Lee, Ping-Chen; Lin, King-Chuen; Huang, C H; Sun, B J; Chang, A H H

    2008-06-02

    The Br2 elimination channel is probed for 1,2-C2H2Br2 in the B(3)Pi(+)ou-X(1)Sigma(+)g transition upon irradiation at 248 nm by using cavity ring-down absorption spectroscopy (CRDS). The nascent vibrational population ratio of Br2(v=1)/Br2(v=0) is obtained to be 0.7+/-0.2, thus indicating that the Br2 fragment is produced in hot vibrational states. The obtained Br2 products are anticipated to result primarily from photodissociation of the ground-state cis isomer via four-center elimination or from cis/trans isomers via three-center elimination, each mechanism involving a transition state that has a Br-Br distance much larger than that of ground state Br2. According to ab initio potential energy calculations, the pathways that lead to Br2 elimination may proceed either through the electronic ground state by internal conversion or through the triplet state by intersystem crossing. Temperature-dependence measurements are examined, thereby supporting the pathway that involves internal conversion--which was excluded previously by using product translational spectroscopy (PTS). The quantum yield for the Br2 elimination reaction is determined to be 0.120.1, being substantially contributed by the ground-state Br2 product. The discrepancy of this value from that (of 0.2) obtained by PTS may rise from the lack of measurements in probing the triplet-state Br2 product.

  17. Molecular elimination of Br2 in photodissociation of CH2BrC(O)Br at 248 nm using cavity ring-down absorption spectroscopy.

    Science.gov (United States)

    Fan, He; Tsai, Po-Yu; Lin, King-Chuen; Lin, Cheng-Wei; Yan, Chi-Yu; Yang, Shu-Wei; Chang, A H H

    2012-12-07

    The primary elimination channel of bromine molecule in one-photon dissociation of CH(2)BrC(O)Br at 248 nm is investigated using cavity ring-down absorption spectroscopy. By means of spectral simulation, the ratio of nascent vibrational population in v = 0, 1, and 2 levels is evaluated to be 1:(0.5 ± 0.1):(0.2 ± 0.1), corresponding to a Boltzmann vibrational temperature of 581 ± 45 K. The quantum yield of the ground state Br(2) elimination reaction is determined to be 0.24 ± 0.08. With the aid of ab initio potential energy calculations, the obtained Br(2) fragments are anticipated to dissociate on the electronic ground state, yielding vibrationally hot Br(2) products. The temperature-dependence measurements support the proposed pathway via internal conversion. For comparison, the Br(2) yields are obtained analogously from CH(3)CHBrC(O)Br and (CH(3))(2)CBrC(O)Br to be 0.03 and 0.06, respectively. The trend of Br(2) yields among the three compounds is consistent with the branching ratio evaluation by Rice-Ramsperger-Kassel-Marcus method. However, the latter result for each molecule is smaller by an order of magnitude than the yield findings. A non-statistical pathway so-called roaming process might be an alternative to the Br(2) production, and its contribution might account for the underestimate of the branching ratio calculations.

  18. Photodissociation of gaseous CH3COSH at 248 nm by time-resolved Fourier-transform infrared emission spectroscopy: Observation of three dissociation channels

    International Nuclear Information System (INIS)

    Hu, En-Lan; Tsai, Po-Yu; Fan, He; Lin, King-Chuen

    2013-01-01

    Upon one-photon excitation at 248 nm, gaseous CH 3 C(O)SH is dissociated following three pathways with the products of (1) OCS + CH 4 , (2) CH 3 SH + CO, and (3) CH 2 CO + H 2 S that are detected using time-resolved Fourier-transform infrared emission spectroscopy. The excited state 1 (n O , π * CO ) has a radiative lifetime of 249 ± 11 ns long enough to allow for Ar collisions that induce internal conversion and enhance the fragment yields. The rate constant of collision-induced internal conversion is estimated to be 1.1 × 10 −10 cm 3 molecule −1 s −1 . Among the primary dissociation products, a fraction of the CH 2 CO moiety may undergo further decomposition to CH 2 + CO, of which CH 2 is confirmed by reaction with O 2 producing CO 2 , CO, OH, and H 2 CO. Such a secondary decomposition was not observed previously in the Ar matrix-isolated experiments. The high-resolution spectra of CO are analyzed to determine the ro-vibrational energy deposition of 8.7 ± 0.7 kcal/mol, while the remaining primary products with smaller rotational constants are recognized but cannot be spectrally resolved. The CO fragment detected is mainly ascribed to the primary production. A prior distribution method is applied to predict the vibrational distribution of CO that is consistent with the experimental findings.

  19. Br2 molecular elimination in photolysis of (COBr)2 at 248 nm by using cavity ring-down absorption spectroscopy: A photodissociation channel being ignored

    International Nuclear Information System (INIS)

    Wu, Chia-Ching; Lin, Hsiang-Chin; Chang, Yuan-Bin; Tsai, Po-Yu; Yeh, Yu-Ying; Fan, He; Lin, King-Chuen; Francisco, J. S.

    2011-01-01

    A primary dissociation channel of Br 2 elimination is detected following a single-photon absorption of (COBr) 2 at 248 nm by using cavity ring-down absorption spectroscopy. The technique contains two laser beams propagating in a perpendicular configuration. The tunable laser beam along the axis of the ring-down cell probes the Br 2 fragment in the B 3 Π ou + -X 1 Σ g + transition. The measurements of laser energy- and pressure-dependence and addition of a Br scavenger are further carried out to rule out the probability of Br 2 contribution from a secondary reaction. By means of spectral simulation, the ratio of nascent vibrational population for v = 0, 1, and 2 levels is evaluated to be 1:(0.65 ± 0.09):(0.34 ± 0.07), corresponding to a Boltzmann vibrational temperature of 893 ± 31 K. The quantum yield of the ground state Br 2 elimination reaction is determined to be 0.11 ± 0.06. With the aid of ab initio potential energy calculations, the pathway of molecular elimination is proposed on the energetic ground state (COBr) 2 via internal conversion. A four-center dissociation mechanism is followed synchronously or sequentially yielding three fragments of Br 2 + 2CO. The resulting Br 2 is anticipated to be vibrationally hot. The measurement of a positive temperature effect supports the proposed mechanism.

  20. Br2 molecular elimination in photolysis of (COBr)2 at 248 nm by using cavity ring-down absorption spectroscopy: a photodissociation channel being ignored.

    Science.gov (United States)

    Wu, Chia-Ching; Lin, Hsiang-Chin; Chang, Yuan-Bin; Tsai, Po-Yu; Yeh, Yu-Ying; Fan, He; Lin, King-Chuen; Francisco, J S

    2011-12-21

    A primary dissociation channel of Br(2) elimination is detected following a single-photon absorption of (COBr)(2) at 248 nm by using cavity ring-down absorption spectroscopy. The technique contains two laser beams propagating in a perpendicular configuration. The tunable laser beam along the axis of the ring-down cell probes the Br(2) fragment in the B(3)Π(ou)(+)-X(1)Σ(g)(+) transition. The measurements of laser energy- and pressure-dependence and addition of a Br scavenger are further carried out to rule out the probability of Br(2) contribution from a secondary reaction. By means of spectral simulation, the ratio of nascent vibrational population for v = 0, 1, and 2 levels is evaluated to be 1:(0.65 ± 0.09):(0.34 ± 0.07), corresponding to a Boltzmann vibrational temperature of 893 ± 31 K. The quantum yield of the ground state Br(2) elimination reaction is determined to be 0.11 ± 0.06. With the aid of ab initio potential energy calculations, the pathway of molecular elimination is proposed on the energetic ground state (COBr)(2) via internal conversion. A four-center dissociation mechanism is followed synchronously or sequentially yielding three fragments of Br(2) + 2CO. The resulting Br(2) is anticipated to be vibrationally hot. The measurement of a positive temperature effect supports the proposed mechanism.

  1. A molecular beam study of the one, two, and three photon photodissociation mechanism of the group VIB (Cr,Mo,W) hexacarbonyls at 248 nm

    International Nuclear Information System (INIS)

    Venkataraman, B.; Hou, H.; Zhang, Z.; Chen, S.; Bandukwalla, G.; Vernon, M.

    1990-01-01

    Photodissociation of the group VIB (Cr,Mo,W) hexacarbonyls has been studied at 248 nm using molecular beam photofragment spectroscopy. One, two and three photon processes have been observed. Analysis of the product velocity distributions shows that the photodissociation mechanism consists of sequential CO eliminations with the nth photon channel best described as the single photon photodissociation of the stable products of the n-1st photon channel. The product translational energy distribution for the first CO elimination step is quantitatively similar for all three hexacarbonyls and characteristic of a repulsive translational energy release. The product translational energy distributions of all subsequent CO elimination steps are accurately described by a simple, microcanonical model. Qualitative molecular orbital considerations suggest that the large product translational energy observed in the first CO elimination step results from a repulsive σ interaction between the closed shell CO ligand and an excited molecular orbital which has a significant admixture of metal (n+1)p z , (n+1)s and nd z 2 orbitals. This repulsive interaction is absent in the remaining CO elimination steps because there are vacancies in the coordination shell along the z axis

  2. Pressure dependence for the CO quantum yield in the photolysis of acetone at 248 nm: a combined experimental and theoretical study.

    Science.gov (United States)

    Somnitz, H; Fida, M; Ufer, T; Zellner, R

    2005-09-21

    The quantum yield of CO in the laser pulse photolysis of acetone at 248 nm and at 298 K in the pressure range 20-900 mbar (N2) has been measured directly using quantitative infrared diode laser absorption of CO. It is found that the quantum yield of CO shows a significant dependence on total pressure with Phi(CO) decreasing with pressure from around 0.45 at 20 mbar to approximately 0.25 at 900 mbar. From a combination of ab initio quantum chemical calculations on the molecular properties of the acetyl (CH3CO) radical and its unimolecular fragmentation as well as the application of statistical (RRKM) and dynamical calculations we show that CO production results from prompt secondary fragmentation (via(2a)) of the internally excited primary CH3CO* photolysis product with an excess energy of approximately 62.8 kJ mol(-1). Hence, our findings are consistent with a consecutive photochemically induced decomposition model, viz. step (1): CH3COCH3+hv--> CH3CO*+ CH3, step (2a): CH3CO*--> CH3+ CO or step (2b) CH3CO*-(+M)--> CH3CO. Formation of CO via a direct and/or concerted channel CH3COCH3+hv--> 2CH(3)+ CO (1') is considered to be unimportant.

  3. Accurate determination of Curium and Californium isotopic ratios by inductively coupled plasma quadrupole mass spectrometry (ICP-QMS) in 248Cm samples for transmutation studies

    Energy Technology Data Exchange (ETDEWEB)

    Gourgiotis, A.; Isnard, H.; Aubert, M.; Dupont, E.; AlMahamid, I.; Cassette, P.; Panebianco, S.; Letourneau, A.; Chartier, F.; Tian, G.; Rao, L.; Lukens, W.

    2011-02-01

    The French Atomic Energy Commission has carried out several experiments including the mini-INCA (INcineration of Actinides) project for the study of minor-actinide transmutation processes in high intensity thermal neutron fluxes, in view of proposing solutions to reduce the radiotoxicity of long-lived nuclear wastes. In this context, a Cm sample enriched in {sup 248}Cm ({approx}97 %) was irradiated in thermal neutron flux at the High Flux Reactor (HFR) of the Laue-Langevin Institute (ILL). This work describes a quadrupole ICP-MS (ICP-QMS) analytical procedure for precise and accurate isotopic composition determination of Cm before sample irradiation and of Cm and Cf after sample irradiation. The factors that affect the accuracy and reproducibility of isotopic ratio measurements by ICP-QMS, such as peak centre correction, detector dead time, mass bias, abundance sensitivity and hydrides formation, instrumental background, and memory blank were carefully evaluated and corrected. Uncertainties of the isotopic ratios, taking into account internal precision of isotope ratio measurements, peak tailing, and hydrides formations ranged from 0.3% to 1.3%. This uncertainties range is quite acceptable for the nuclear data to be used in transmutation studies.

  4. The reaction {sup 48}Ca+{sup 248}Cm{yields}{sup 296}116{sup *} studied at the GSI-SHIP

    Energy Technology Data Exchange (ETDEWEB)

    Hofmann, S. [GSI Helmholtzzentrum fuer Schwerionenforschung, Darmstadt (Germany); Goethe-Universitaet Frankfurt, Institut fuer Physik, Frankfurt (Germany); Heinz, S.; Mann, R.; Khuyagbaatar, J.; Ackermann, D.; Barth, W.; Block, M.; Burkhard, H.G.; Comas, V.F.; Dahl, L.; Heredia, J.A.; Kindler, B.; Kojouharov, I.; Lang, R.; Lommel, B.; Muenzenberg, G.; Tinschert, K. [GSI Helmholtzzentrum fuer Schwerionenforschung, Darmstadt (Germany); Maurer, J.; Hessberger, F.P. [GSI Helmholtzzentrum fuer Schwerionenforschung, Darmstadt (Germany); Johannes Gutenberg-Universitaet, Helmholtz-Institut Mainz, Mainz (Germany); Antalic, S.; Saro, S. [Comenius University, Department of Nuclear Physics and Biophysics, Bratislava (Slovakia); Eberhardt, K.; Kratz, J.V.; Runke, J.; Thoerle-Pospiech, P.; Trautmann, N. [Johannes Gutenberg-Universitaet Mainz, Mainz (Germany); Gostic, J.; Henderson, R.A.; Kenneally, J.M.; Moody, K.J.; Nelson, S.L.; Shaughnessy, D.A.; Stoyer, M.A.; Wilk, P.A. [Lawrence Livermore National Laboratory, Livermore, CA (United States); Leino, M.; Uusitalo, J. [University of Jyvaeskylae, Department of Physics, Jyvaeskylae (Finland); Nishio, K. [Japan Atomic Energy Agency, Tokai, Ibaraki (Japan); Popeko, A.G.; Yeremin, A.V. [Joint Institute for Nuclear Research, Dubna (Russian Federation)

    2012-05-15

    The synthesis of element 116 in fusion-evaporation reactions of a {sup 48}Ca beam with radioactive {sup 248}Cm targets was studied at the velocity filter SHIP of GSI in Darmstadt. At excitation energies of the compound nuclei of 40.9MeV, four decay chains were measured, which were assigned to the isotope {sup 292}116, and one chain, which was assigned to {sup 293}116. Measured cross-sections of (3.4{sub -1.6}{sup +2.7})pb and (0.9{sub -0.7}{sup +2.1}), respectively, and decay data of the chains agree with data measured previously at the Flerov Laboratory of Nuclear Reactions in Dubna. As a new result, one {alpha}-decay chain was measured, which terminates after four {alpha} decays by spontaneous fission. The {alpha} energies of the second-to-fourth decay are considerably higher than those measured for the {alpha} decays of {sup 289}114, {sup 285}Cn, and {sup 281}Ds and the spontaneous fission half-life is significantly longer than that of {sup 277}Hs measured in previous experiments. A possible assignment is discussed in the frame of excited quasiparticle states of nuclei populated in the decay chain from {sup 293}116. Also other possible assignments were considered and are discussed. At an excitation energy of 45.0MeV no events were observed resulting in a one-event cross-section limit of 1.6 pb. The technical aspects related with the use of radioactive target material at SHIP are described in detail. The experience gained in this experiment will serve as a basis for future experiments aiming to study still heavier elements at the velocity filter SHIP. (orig.)

  5. Characterization of the in vitro expressed autoimmune rippling muscle disease immunogenic domain of human titin encoded by TTN exons 248-249

    Energy Technology Data Exchange (ETDEWEB)

    Zelinka, L. [Biomedical Sciences Program, Kent State University, Kent, OH (United States); McCann, S.; Budde, J.; Sethi, S.; Guidos, M.; Giles, R. [Center for Applied Chemical Biology, Department of Biological Sciences, Youngstown State University, One University Plaza, Youngstown, OH 44555 (United States); Walker, G.R., E-mail: grwalker@ysu.edu [Center for Applied Chemical Biology, Department of Biological Sciences, Youngstown State University, One University Plaza, Youngstown, OH 44555 (United States); Biomedical Sciences Program, Kent State University, Kent, OH (United States)

    2011-08-05

    Highlights: {yields} Affinity purification of the autoimmune rippling muscle disease immunogenic domain of titin. {yields} Partial sequence analysis confirms that the peptides is in the I band region of titin. {yields} This region of the human titin shows high degree of homology to mouse titin N2-A. -- Abstract: Autoimmune rippling muscle disease (ARMD) is an autoimmune neuromuscular disease associated with myasthenia gravis (MG). Past studies in our laboratory recognized a very high molecular weight skeletal muscle protein antigen identified by ARMD patient antisera as the titin isoform. These past studies used antisera from ARMD and MG patients as probes to screen a human skeletal muscle cDNA library and several pBluescript clones revealed supporting expression of immunoreactive peptides. This study characterizes the products of subcloning the titin immunoreactive domain into pGEX-3X and the subsequent fusion protein. Sequence analysis of the fusion gene indicates the cloned titin domain (GenBank ID: (EU428784)) is in frame and is derived from a sequence of N2-A spanning the exons 248-250 an area that encodes the fibronectin III domain. PCR and EcoR1 restriction mapping studies have demonstrated that the inserted cDNA is of a size that is predicted by bioinformatics analysis of the subclone. Expression of the fusion protein result in the isolation of a polypeptide of 52 kDa consistent with the predicted inferred amino acid sequence. Immunoblot experiments of the fusion protein, using rippling muscle/myasthenia gravis antisera, demonstrate that only the titin domain is immunoreactive.

  6. Characterization of the in vitro expressed autoimmune rippling muscle disease immunogenic domain of human titin encoded by TTN exons 248-249

    International Nuclear Information System (INIS)

    Zelinka, L.; McCann, S.; Budde, J.; Sethi, S.; Guidos, M.; Giles, R.; Walker, G.R.

    2011-01-01

    Highlights: → Affinity purification of the autoimmune rippling muscle disease immunogenic domain of titin. → Partial sequence analysis confirms that the peptides is in the I band region of titin. → This region of the human titin shows high degree of homology to mouse titin N2-A. -- Abstract: Autoimmune rippling muscle disease (ARMD) is an autoimmune neuromuscular disease associated with myasthenia gravis (MG). Past studies in our laboratory recognized a very high molecular weight skeletal muscle protein antigen identified by ARMD patient antisera as the titin isoform. These past studies used antisera from ARMD and MG patients as probes to screen a human skeletal muscle cDNA library and several pBluescript clones revealed supporting expression of immunoreactive peptides. This study characterizes the products of subcloning the titin immunoreactive domain into pGEX-3X and the subsequent fusion protein. Sequence analysis of the fusion gene indicates the cloned titin domain (GenBank ID: (EU428784)) is in frame and is derived from a sequence of N2-A spanning the exons 248-250 an area that encodes the fibronectin III domain. PCR and EcoR1 restriction mapping studies have demonstrated that the inserted cDNA is of a size that is predicted by bioinformatics analysis of the subclone. Expression of the fusion protein result in the isolation of a polypeptide of 52 kDa consistent with the predicted inferred amino acid sequence. Immunoblot experiments of the fusion protein, using rippling muscle/myasthenia gravis antisera, demonstrate that only the titin domain is immunoreactive.

  7. VLBI observations of the quasars CTD20 (0234+285), OJ248 (0827+243), and 4C19.44 (1354+195), and the millimeter-x-ray connection

    International Nuclear Information System (INIS)

    Marscher, A.P.; Broderick, J.J.

    1983-01-01

    We have obtained limited VLBI data on the quasars CTD20, OJ248, and 4C19.44 at 2.8 cm. CTD20 was also observed at 6 and 18 cm. All three sources contain multicomponent structure, and rather large fractions of the 2.8-cm flux densities arise in unresolved regions. All of the radio flux density of CTD20 originates in compact components. 4C19.44 is dominated at low frequencies by a steep-spectrum component which exceeds about 7 mas in size. Above 2 GHz the spectrum is flat and variable owing to several compact components. CTD20 and OJ248 belong to a sample of millimeter-excess quasars which were shown by Owen, Helfand, and Spangler to have highly predictable ratios of 90 GHz to 2-keV flux densities. A self-Compton explanation of this relationship is supported by the existence of unresolved radio components. However, the rapid 90-GHz variability of OJ248 and other quasars with strong millimeter emission should destroy the observed tight correlation except under special circumstances. A synchrotron origin of the radio-to-x-ray emission requires that any variations in the radio should be time delayed relative to the x ray

  8. Incidence and clinical characteristics of unexpected uterine sarcoma after hysterectomy and myomectomy for uterine fibroids: a retrospective study of 10,248 cases

    Directory of Open Access Journals (Sweden)

    Zhao WC

    2015-10-01

    Full Text Available Wan-Cheng Zhao,1 Fang-Fang Bi,1 Da Li,2 Qing Yang11Department of Obstetrics and Gynecology, 2Center of Reproductive Medicine, Shengjing Hospital of China Medical University, Shenyang, People’s Republic of ChinaBackground: Uterine fibroids often require a hysterectomy or myomectomy via laparotomy or laparoscopy. Morcellation is often necessary to perform a laparoscopic surgery. The objective of this study is to determine the incidence of unexpected uterine sarcomas (UUSs after hysterectomy and myomectomy for uterine fibroids and to reduce the occurrence and avoid the morcellation of UUSs by analyzing their characteristics.Methods: Women who had a hysterectomy or myomectomy for uterine fibroids in Shengjing Hospital of China Medical University between November 2008 and November 2014 were selected for the study, and their clinical characteristics were analyzed.Results: During the period, 48 UUSs were found in 10,248 cases, and the overall incidence was 0.47%. There was no statistical difference (P=0.449 regarding the incidence (0.50% vs 0.33% between 42 UUSs in 8,456 cases undergoing laparotomy and six UUSs in 1,792 cases undergoing laparoscopy. Most of the UUSs were stage I (89.58%, which occurred more commonly (56.25% in women aged 40–49. Abnormal uterine bleeding (39.58% was the main clinical manifestation. Rapidly growing pelvic masses (12.5%, rich blood flow signals (18.75%, and degeneration of uterine fibroids (18.75% prompted by ultrasonography may suggest the possibility of UUSs. The margins of most UUSs (93.75% were regular, which may cause UUSs to be misdiagnosed as uterine fibroids. Fifteen cases underwent magnetic resonance imaging examinations. Approximately 73.33% showed heterogeneous and hypointense signal intensity on T1-weighted images, and 80% showed intermediate-to-high signal intensity on T2-weighted images, with necrosis and hemorrhage in 40% of cases. After contrast administration, 80% presented early heterogeneous

  9. Comparación de variables físicas, culinarias y amilográficas del cultivar de arroz (Oryza sativa L. MD248 con dos cultivares comerciales de arroz en Venezuela

    Directory of Open Access Journals (Sweden)

    Manuel Ávila

    2014-12-01

    Full Text Available El objetivo del estudio fue evaluar las variables físicas culinarias y amilográficas del cultivar MD248 y su potencial como arroz de mesa en Venezuela. Para ello, MD248 se sembró bajo un diseño completamente aleatorizado, en Calabozo (Estado Guárico, Venezuela, junto con 2 cultivares empleados como testigos de buena (D-Sativa y baja (D-Primera calidad culinaria. De cada cultivar se cosecharon 2.500 g de arroz paddy y se procesaron hasta obtener una fracción de arroz entero pulido la cual fue evaluada para: largo, ancho, espesor, relación largo/ancho (L/A, peso de 100 granos, contenido de amilosa aparente, tiempo de cocción, relación de expansión volumétrica (REV, relación de absorción de agua (RAA, viscosidades pico, media, final, ‘breakdown’, ‘setback’, consistencia y temperatura de empaste del perfil amilográfico. Además, atributos sensoriales descriptivos (brillo, percepción visual de la adhesividad, adhesividad manual, adhesividad entre los granos y preferenciales (apariencia, adhesividad, calidad global del arroz cocido. Los resultados indicaron diferencias estadísticas altamente significativas (p ≤ 0,01 entre los cultivares para largo, relación L/A, peso de 100 granos, contenido de amilosa aparente, tiempo de cocción, REV, RAA y todas las variables amilográficas, excepto para viscosidad media y temperatura de empaste (p > 0,05. En los perfiles descriptivo y preferencial hubo diferencias altamente significativas (p ≤ 0,01 para todos los atributos evaluados. MD248 estuvo asociado con los mayores valores de largo de grano (7,07 mm, relación L/A (3,43, peso de 100 granos (2,20 g y amilosa aparente (19,14 %, y con los menores valores de tiempo de cocción (22,90 min, REV (3,07, RAA (1,55, viscosidad pico (159,61 RVU, media (130,10 RVU, p > 0,05 y ‘breakdown’ (29,51 RVU. MD248 presentó un perfil descriptivo comparable al cultivar de buena calidad culinaria y se diferenció ampliamente del cultivar de baja

  10. Evaluation of thermal neutron cross-sections and resonance integrals of protactinium, americium, curium, and berkelium isotopes

    International Nuclear Information System (INIS)

    Belanova, T.S.

    1994-12-01

    Data on the thermal neutron fission and capture cross-sections as well as their corresponding resonance integrals are reviewed and analysed. The data are classified according to the form of neutron spectra under investigation. The weighted mean values of the cross-sections and resonance integrals for every type of neutron spectra were adopted as evaluated data. (author). 87 refs, 2 tabs

  11. Oxidation-reduction properties of americium, curium, berkelium, californium, einsteinium and fermium, and thermodynamic consequences for the 5f series

    International Nuclear Information System (INIS)

    Samhoun, K.

    1976-01-01

    The amalgamation of 5f elements from Am to Fm has been studied by using 241 Am, 244 Cm, 249 Bk, 249 Cf, 252 Cf, 253 Es, 254 Es, 252 Fm and 255 Fm with two electrochemical methods, radiocoulometry and radiopolarography, perfectly adapted to investigate extremely diluted solutions when the concentration of electroactive species is as low as 10 -16 M. The theory of radiocoulometry has been developed in the general cases of reversible and irreversible electrode process. It has been used to interpret the experimental data on the kinetic curves of amalgamation, and to estimate the standard rate constant of the electrode process in complexing medium (citric). On the other hand the radiopolarographic method has been applied to study the mechanism of reduction at the dropping mercury electrode of cations M 3+ in aqueous medium to the metal M with formation of amalgam. The results are exploited into two directions: 1- Acquisition of some data concerning the oxidation-reduction properties of elements from Am to Fm. Therefore the standard electrode E 0 [M(III-0)] potentials for Bk, Cf and Es, and the standard electrode E 0 [M(II-0)] potential for Fm are estimated and the relative stability of each oxidation state (from II to VII) of 5f elements is discussed; 2- Acquisition of unknown thermodynamic data on transcalifornium elements. Correlations between 4f and 5f elements are precised and some divergences appear for the second half of 4f and 5f series (i.e. for 65 [fr

  12. Experimental Cross Sections for Reactions of Heavy Ions and 208Pb, 209Bi, 238U, and 248Cm Targets

    Energy Technology Data Exchange (ETDEWEB)

    Patin, Joshua Barnes [Univ. of California, Berkeley, CA (United States)

    2002-01-01

    The study of the reactions between heavy ions and 208Pb, 209Bi, 238U, and 248Cm Cm targets was performed to look at the differences between the cross sections of hot and cold fusion reactions. Experimental cross sections were compared with predictions from statistical computer codes to evaluate the effectiveness of the computer code in predicting production cross sections. Hot fusion reactions were studied with the MG system, catcher foil techniques and the Berkeley Gas-filled Separator (BGS). 3n- and 4n-exit channel production cross sections were obtained for the 238U(18O,xn)256-xFm, 238U(22Ne,xn)260-xNo, and 248Cm(15N,xn)263-xLr reactions and are similar to previous experimental results. The experimental cross sections were accurately modeled by the predictions of the HIVAP code using the Reisdorf and Schaedel parameters and are consistent with the existing systematics of 4n exit channel reaction products. Cold fusion reactions were examined using the BGS. The 48Pb(238Ca,xn)256-xNo, 208Pb(50Ti,xn)258-xRf, 208Pb(51V,xn)259-xDb, 50Bi(238Ti,xn)259-xDb, and 209Bi(51V,xn)260-xSg reactions were studied. The experimental production cross sections are in agreement with the results observed in previous experiments. It was necessary to slightly alter the Reisdorf and Schaedel parameters for use in the HIVAP code in order to more accurately model the experimental data. The cold fusion experimental results are in agreement with current 1n- and 2n-exit channel systematics.

  13. 24 CFR 248.201 - Definitions.

    Science.gov (United States)

    2010-04-01

    ... long-range planning by the board of directors to ensure the physical, financial and social viability of... remaining after deducting from the surplus cash, as defined by the regulatory agreement, the amount of all...

  14. 7 CFR 248.2 - Definitions.

    Science.gov (United States)

    2010-01-01

    ..., training, monitoring, auditing, the development of and accountability for coupon and market management... who assemble at a defined location for the purpose of selling their produce directly to consumers... relationships between nutrition and health, all in keeping with the individual's personal, cultural, and...

  15. 17 CFR 248.3 - Definitions.

    Science.gov (United States)

    2010-04-01

    ... 1940 (15 U.S.C. 80a-2(a)(9)). (j) Customer means a consumer who has a customer relationship with you. (k)(1) Customer relationship means a continuing relationship between a consumer and you under which... provide brokerage services to the individual or establish a continuing relationship with the individual...

  16. 21 CFR 558.248 - Erythromycin thiocyanate.

    Science.gov (United States)

    2010-04-01

    ... (9.25) Starter ration for animals up to 35 lb body weight 061623 (iv) 18.5 Laying chickens; aids in... disease during periods of stress Feed for 2 d before stress and 3 to 6 d after stress; withdraw 24 h... during periods of stress Feed for 2 d before stress and 3 to 6 d after stress (vi) 185 1. Chickens; as an...

  17. 24 CFR 248.101 - Definitions.

    Science.gov (United States)

    2010-04-01

    ... officials; (6) Has standards of financial accountability that conform to Attachment F of OMB Circular No. A... neighborhood organizations. For urban areas, “community” may be a neighborhood or neighborhoods, city, county...

  18. Publications | Page 248 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Through books, articles, research publications, and studies, we aim to widen the impact ... This paper presents a summary of the progress in financial inclusion in ... the supply of financial services in CCTPS, and assessments of the process of ...

  19. 7 CFR 248.12 - FMNP costs.

    Science.gov (United States)

    2010-01-01

    ... must obtain prior approval in accordance with 7 CFR 3016.22 before charging to the FMNP any capital... the FMNP. (10) The cost of preparing contracts for farmers/farmers' markets and local WIC providers...

  20. 7 CFR 248.4 - State Plan.

    Science.gov (United States)

    2010-01-01

    ... programs. (19) For States making expansion requests, documentation which demonstrates: (i) The need for an increase in funding; (ii) That the use of the increased funding will be consistent with serving WIC... funding to increase the value of the Federal share of the benefits received by a recipient, the funding...

  1. 7 CFR 248.25 - FMNP information.

    Science.gov (United States)

    2010-01-01

    ..., Massachusetts 02222-1066. (b) Delaware, District of Columbia, Maryland, New Jersey, Pennsylvania, Puerto Rico..., Kentucky, Mississippi, North Carolina, South Carolina, Tennessee: U.S. Department of Agriculture, FNS...

  2. Publications | Page 248 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Bureaucratic resistance to regulatory reforms : the contrasting experiences in electricity and telecommunications in Brazil (restricted access). The process of regulatory diffusion has been extensively explored in developed countries, but much less so in developing countries. In an attempt to open the black box of the diffusion ...

  3. 7 CFR 248.7 - Nondiscrimination.

    Science.gov (United States)

    2010-01-01

    ... participation data (as required by title VI of the Civil Rights Act of 1964) are collected at the time women... through the Department's required nondiscrimination statement on brochures and publications; (2) Review... and Independence Avenue, SW., Washington, DC 20250-9410 (or call (800) 795-3272 (voice) or (202) 720...

  4. ¿Serían la Guardia, Tutela y Curatela Bienes Jurídicos Penales? Un Análisis Crítico de los Arts. 248 y 249 del CP a la Luz de la Exclusiva Protección de Bienes Jurídicos

    Directory of Open Access Journals (Sweden)

    Gerson Faustino Rosa

    2015-12-01

    Full Text Available El presente trabajo tiene por objeto el análisis crítico y la explotación de un importante problema político-criminal de la actualidad: la criminalización de conductas que afrontan la guarda, la tutela y la curatela en el Código Penal, en sus artículos 248 y 249, lo que ya no tiene sentido ante la actual función del sistema penal, criticándose la actividad desenfrenada del Poder Legislativo, que produce ley espenales que no protegen bien jurídico alguno,oque salvaguardan bienes pasibles de protección por otras esferas del Derecho, valiéndose de la fuerza simbólico-comunicativa del Derecho Penal de forma desnecesaria, ampliando demasiadamente el alcance de la pena criminal, hasta el punto de vulgarizar todo el sistema jurídico penalenrazón de su uso indiscriminado. Paraello, enprimer plano,este estudio trata de la política criminal relativa a la libre planificación familiar, criticando la intervención estatal en cuestiones familiares, como ocurre en el Código Penal de 1940, destacando la necesidad de respetarse los principios de intervención mínima y de proporcionalidad antes de que el legislador se valga de la injerencia penal para la protección de cualquier bien jurídico. Más adelante, se presenta la importancia del bien jurídico-penal, con énfasis en la familia como bien jurídico categorial, especialmente la guardia, tutela y curatela, supuestamente lesionadas por los delitos de los artículos 248 y 249 del Código Penal. Así, se analizan brevemente los tipos penales citados, criticándose dicha criminalización, teniéndose en cuenta que tales tipos son subsidiarios, perfectamente prescindibles en el ordenamiento jurídico-penal y pasibles de salvaguardia por el Derecho Civil, que en la solución de los conflictos familiares se muestra mucho más eficaz que la intervención penal.

  5. 7 CFR 248.14 - Distribution of funds.

    Science.gov (United States)

    2010-01-01

    ... Agriculture Regulations of the Department of Agriculture (Continued) FOOD AND NUTRITION SERVICE, DEPARTMENT OF AGRICULTURE CHILD NUTRITION PROGRAMS WIC FARMERS' MARKET NUTRITION PROGRAM (FMNP) State Agency Provisions... spend back funds under this paragraph as FNS may require. (j) Recovery of unused funds. State agencies...

  6. 48 CFR 52.248-3 - Value Engineering-Construction.

    Science.gov (United States)

    2010-10-01

    .... Collateral costs, as used in this clause, means agency costs of operation, maintenance, logistic support, or... increases in the cost of testing, operations, maintenance, and logistic support. The term does not include... reductions resulting from a VECP in the agency's overall projected collateral costs, exlcusive of acquisition...

  7. 28 CFR 2.48 - Revocation: Preliminary interview.

    Science.gov (United States)

    2010-07-01

    ... 28 Judicial Administration 1 2010-07-01 2010-07-01 false Revocation: Preliminary interview. 2.48....48 Revocation: Preliminary interview. (a) Interviewing officer. A parolee who is retaken on a warrant issued by a Commissioner shall be given a preliminary interview by an official designated by the Regional...

  8. 7 CFR 248.10 - Coupon and market management.

    Science.gov (United States)

    2010-01-01

    ... instruction emphasizing: (1) Eligible food choices; (2) Proper FMNP coupon redemption procedures, including...' markets. The State agency shall ensure that farmers/ farmers' markets are promptly paid for food costs. (h... Agriculture Regulations of the Department of Agriculture (Continued) FOOD AND NUTRITION SERVICE, DEPARTMENT OF...

  9. 31 CFR 248.7 - Claims requiring settlement action.

    Science.gov (United States)

    2010-07-01

    ...) FISCAL SERVICE, DEPARTMENT OF THE TREASURY FINANCIAL MANAGEMENT SERVICE ISSUE OF SUBSTITUTES OF LOST... claimant and transmit such data to the Claims Division, General Accounting Office, for settlement action. ...

  10. 47 CFR 90.248 - Wildlife and ocean buoy tracking.

    Science.gov (United States)

    2010-10-01

    ...) Classes of emission are limited to N0N, A1A, A2A, A2B, F1B, J2B, F2A, F2B, and/or F8E. (d) The authorized... temperature range of −30° to +50° centigrade at normal supply voltage and for a variation in the primary supply voltage from 85% to 115% of the rated supply voltage at a temperature of +20 °C. For battery...

  11. Dicty_cDB: CFI248 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available rfkl*sfhrtnldfhtllwwli rcntsifk*hvwf*kcwshswfnfigmgiswcwwwycfliyl**fn**swlwssfslslf g*llldswfhlcglgfslvhknnc...vfl*chiwsgcnwkik*yvpkhvw*k*scwfyggis*wciqf ir*invwfc***iw*kemlysnayhsmffswflnksne

  12. 24 CFR 248.103 - General prepayment limitation.

    Science.gov (United States)

    2010-04-01

    ...) Effect of unauthorized prepayment. A mortgagee's acceptance of a prepayment in violation of paragraph (a... acceptance of a prepayment in violation of paragraph (a) of this section, or attempt to obtain voluntary... administrative action under parts 24 and 25 of this title, in addition to any other remedies available by law...

  13. Dicty_cDB: SFF248 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available PPDQQRLIFA G--- ---KRTPSPFSLKIKRXYANFC*tsxw*txplgsgr*l*h*kxqsqnpxqxrxsprsttf hfrw*tikkwpyxx*lqhpkxipxpfsxxikrwxanx...cknlxw*xxpxgsxrfxxx*kcq sqnsxqxrfsprstxixfxwxtikxwxdxxxlqxskgipxpfsxxxkrxxanxc*nxxr* nxpxgsrrx Transla...*fsl v--- ---KRTPSPFSLKIKRXYANFC*tsxw*txplgsgr*l*h*kxqsqnpxqxrxsprsttf hfrw*tikkwpyxx*lqhpkxipxpfsxxikrwxanx...cknlxw*xxpxgsxrfxxx*kcq sqnsxqxrfsprstxixfxwxtikxwxdxxxlqxskgipxpfsxxxkrxxanxc*nx

  14. 7 CFR 248.17 - Management evaluations and reviews.

    Science.gov (United States)

    2010-01-01

    ... deficiencies and prevent their future recurrence. (iii) If the corrective action plan is acceptable, FNS will... plan, and whether the deficiency is resolved or further corrective action is needed. Compliance buys...

  15. 17 CFR 248.1 - Purpose and scope.

    Science.gov (United States)

    2010-04-01

    ...) REGULATIONS S-P AND S-AM Regulation S-P: Privacy of Consumer Financial Information and Safeguarding Personal... subpart: (1) Requires a financial institution to provide notice to customers about its privacy policies...

  16. 17 CFR 248.8 - Revised privacy notices.

    Science.gov (United States)

    2010-04-01

    ...) REGULATIONS S-P AND S-AM Regulation S-P: Privacy of Consumer Financial Information and Safeguarding Personal... customer to a nonaffiliated third party, if that former customer has not had the opportunity to exercise an...

  17. All projects related to | Page 248 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Researchers are examining the tax policies (exemptions, value-added, property) constraining small and off-farm enterprises, especially those operated by ... Improving access to primary health care and the quality of services in Latin American countries is urgently needed to address high health inequities in the region.

  18. Dicty_cDB: VSJ248 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available vrdnanq*m*s*rsnprrlclwm*kkleclpsmfrsccqira*rksklfrsifrtcsmy **mcwtkiicsikvkymanm*kiviknsnikkkkkixwxkxxlxkx*k...kkfxgxxpfx*xfkkkxf*xffxxkk- -- ---dnanq*m*s*rsnprrlclwm*kkleclpsmfrsccqira*rksklfrsifrtcsmy **mcwtk Frame C:

  19. Dicty_cDB: CHO248 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available TTGTTGCAGTTAAAAAGCTCGTAGTTGAAGTTTAAGGTTXXXXXXXXXX sequence update 2002.10.25 Translated Amino Acid sequence *lvdpasshmlvskikpcms...qqpavipapiaytkvvavkklvvev*g--- Translated Amino Acid sequence (All Frames) Frame A: *lvdpasshmlvskikpcmskykf

  20. 17 CFR 248.124 - Reasonable opportunity to opt out.

    Science.gov (United States)

    2010-04-01

    ...” to indicate their opt out preference or that requires the consumer to check one of two blank check... affiliate to make marketing solicitations to a consumer about your products or services unless the consumer... a reasonable opportunity to opt out. The consumer is given a reasonable opportunity to opt out if...

  1. 248 A CRITICAL REVIEW OF ALEXIS KAGAME'S FOUR ...

    African Journals Online (AJOL)

    Ike Odimegwu

    going to be the task of this paper as it appreciates the four categories of African philosophy ..... extracts from Tutuola's Palm Wine Drunkard. There, beauty ... the impression is that to penetrate an understanding of African philosophy, we need to.

  2. Machine Learning-Augmented Propensity Score-Adjusted Multilevel Mixed Effects Panel Analysis of Hands-On Cooking and Nutrition Education versus Traditional Curriculum for Medical Students as Preventive Cardiology: Multisite Cohort Study of 3,248 Trainees over 5 Years

    Science.gov (United States)

    Dart, Lyn; Vanbeber, Anne; Smith-Barbaro, Peggy; Costilla, Vanessa; Samuel, Charlotte; Terregino, Carol A.; Abali, Emine Ercikan; Dollinger, Beth; Baumgartner, Nicole; Kramer, Nicholas; Seelochan, Alex; Taher, Sabira; Deutchman, Mark; Evans, Meredith; Ellis, Robert B.; Oyola, Sonia; Maker-Clark, Geeta; Budnick, Isadore; Tran, David; DeValle, Nicole; Shepard, Rachel; Chow, Erika; Petrin, Christine; Razavi, Alexander; McGowan, Casey; Grant, Austin; Bird, Mackenzie; Carry, Connor; McGowan, Glynis; McCullough, Colleen; Berman, Casey M.; Dotson, Kerri; Sarris, Leah; Harlan, Timothy S.; Co-investigators, on behalf of the CHOP

    2018-01-01

    Background Cardiovascular disease (CVD) annually claims more lives and costs more dollars than any other disease globally amid widening health disparities, despite the known significant reductions in this burden by low cost dietary changes. The world's first medical school-based teaching kitchen therefore launched CHOP-Medical Students as the largest known multisite cohort study of hands-on cooking and nutrition education versus traditional curriculum for medical students. Methods This analysis provides a novel integration of artificial intelligence-based machine learning (ML) with causal inference statistics. 43 ML automated algorithms were tested, with the top performer compared to triply robust propensity score-adjusted multilevel mixed effects regression panel analysis of longitudinal data. Inverse-variance weighted fixed effects meta-analysis pooled the individual estimates for competencies. Results 3,248 unique medical trainees met study criteria from 20 medical schools nationally from August 1, 2012, to June 26, 2017, generating 4,026 completed validated surveys. ML analysis produced similar results to the causal inference statistics based on root mean squared error and accuracy. Hands-on cooking and nutrition education compared to traditional medical school curriculum significantly improved student competencies (OR 2.14, 95% CI 2.00–2.28, p < 0.001) and MedDiet adherence (OR 1.40, 95% CI 1.07–1.84, p = 0.015), while reducing trainees' soft drink consumption (OR 0.56, 95% CI 0.37–0.85, p = 0.007). Overall improved competencies were demonstrated from the initial study site through the scale-up of the intervention to 10 sites nationally (p < 0.001). Discussion This study provides the first machine learning-augmented causal inference analysis of a multisite cohort showing hands-on cooking and nutrition education for medical trainees improves their competencies counseling patients on nutrition, while improving students' own diets. This study suggests that

  3. Machine Learning-Augmented Propensity Score-Adjusted Multilevel Mixed Effects Panel Analysis of Hands-On Cooking and Nutrition Education versus Traditional Curriculum for Medical Students as Preventive Cardiology: Multisite Cohort Study of 3,248 Trainees over 5 Years.

    Science.gov (United States)

    Monlezun, Dominique J; Dart, Lyn; Vanbeber, Anne; Smith-Barbaro, Peggy; Costilla, Vanessa; Samuel, Charlotte; Terregino, Carol A; Abali, Emine Ercikan; Dollinger, Beth; Baumgartner, Nicole; Kramer, Nicholas; Seelochan, Alex; Taher, Sabira; Deutchman, Mark; Evans, Meredith; Ellis, Robert B; Oyola, Sonia; Maker-Clark, Geeta; Dreibelbis, Tomi; Budnick, Isadore; Tran, David; DeValle, Nicole; Shepard, Rachel; Chow, Erika; Petrin, Christine; Razavi, Alexander; McGowan, Casey; Grant, Austin; Bird, Mackenzie; Carry, Connor; McGowan, Glynis; McCullough, Colleen; Berman, Casey M; Dotson, Kerri; Niu, Tianhua; Sarris, Leah; Harlan, Timothy S; Co-Investigators, On Behalf Of The Chop

    2018-01-01

    Cardiovascular disease (CVD) annually claims more lives and costs more dollars than any other disease globally amid widening health disparities, despite the known significant reductions in this burden by low cost dietary changes. The world's first medical school-based teaching kitchen therefore launched CHOP-Medical Students as the largest known multisite cohort study of hands-on cooking and nutrition education versus traditional curriculum for medical students. This analysis provides a novel integration of artificial intelligence-based machine learning (ML) with causal inference statistics. 43 ML automated algorithms were tested, with the top performer compared to triply robust propensity score-adjusted multilevel mixed effects regression panel analysis of longitudinal data. Inverse-variance weighted fixed effects meta-analysis pooled the individual estimates for competencies. 3,248 unique medical trainees met study criteria from 20 medical schools nationally from August 1, 2012, to June 26, 2017, generating 4,026 completed validated surveys. ML analysis produced similar results to the causal inference statistics based on root mean squared error and accuracy. Hands-on cooking and nutrition education compared to traditional medical school curriculum significantly improved student competencies (OR 2.14, 95% CI 2.00-2.28, p < 0.001) and MedDiet adherence (OR 1.40, 95% CI 1.07-1.84, p = 0.015), while reducing trainees' soft drink consumption (OR 0.56, 95% CI 0.37-0.85, p = 0.007). Overall improved competencies were demonstrated from the initial study site through the scale-up of the intervention to 10 sites nationally ( p < 0.001). This study provides the first machine learning-augmented causal inference analysis of a multisite cohort showing hands-on cooking and nutrition education for medical trainees improves their competencies counseling patients on nutrition, while improving students' own diets. This study suggests that the public health and medical sectors can

  4. Machine Learning-Augmented Propensity Score-Adjusted Multilevel Mixed Effects Panel Analysis of Hands-On Cooking and Nutrition Education versus Traditional Curriculum for Medical Students as Preventive Cardiology: Multisite Cohort Study of 3,248 Trainees over 5 Years

    Directory of Open Access Journals (Sweden)

    Dominique J. Monlezun

    2018-01-01

    Full Text Available Background. Cardiovascular disease (CVD annually claims more lives and costs more dollars than any other disease globally amid widening health disparities, despite the known significant reductions in this burden by low cost dietary changes. The world’s first medical school-based teaching kitchen therefore launched CHOP-Medical Students as the largest known multisite cohort study of hands-on cooking and nutrition education versus traditional curriculum for medical students. Methods. This analysis provides a novel integration of artificial intelligence-based machine learning (ML with causal inference statistics. 43 ML automated algorithms were tested, with the top performer compared to triply robust propensity score-adjusted multilevel mixed effects regression panel analysis of longitudinal data. Inverse-variance weighted fixed effects meta-analysis pooled the individual estimates for competencies. Results. 3,248 unique medical trainees met study criteria from 20 medical schools nationally from August 1, 2012, to June 26, 2017, generating 4,026 completed validated surveys. ML analysis produced similar results to the causal inference statistics based on root mean squared error and accuracy. Hands-on cooking and nutrition education compared to traditional medical school curriculum significantly improved student competencies (OR 2.14, 95% CI 2.00–2.28, p<0.001 and MedDiet adherence (OR 1.40, 95% CI 1.07–1.84, p=0.015, while reducing trainees’ soft drink consumption (OR 0.56, 95% CI 0.37–0.85, p=0.007. Overall improved competencies were demonstrated from the initial study site through the scale-up of the intervention to 10 sites nationally (p<0.001. Discussion. This study provides the first machine learning-augmented causal inference analysis of a multisite cohort showing hands-on cooking and nutrition education for medical trainees improves their competencies counseling patients on nutrition, while improving students’ own diets. This

  5. Ressenya a Grifoll, Isabel, Julián Acebrón, Flocel Sabaté (eds. (2014: Cartografies de l’ànima. Identitat, memòria i escriptura, Lleida, Pagès Editors, 2014, 248 pàgs. ISBN:978-84-9975-517-5; i Acebrón, Julián, Isabel Grifoll, Flocel Sabaté (eds. (2015: La Construcció d’identitats imaginades. Literatura medieval i ideologia, Lleida, Pagès Editors, 2015, 320 pàgs. ISBN:978-84-9975-704-9

    Directory of Open Access Journals (Sweden)

    Vicent Martines

    2016-12-01

    Full Text Available Review to Grifoll, Isabel, Julián Acebrón, Flocel Sabaté (eds. (2014: Cartografies de l’ànima. Identitat, memòria i escriptura, Lleida, Pagès Editors, 2014, 248 pàgs. ISBN:978-84-9975-517-5; and Acebrón, Julián, Isabel Grifoll, Flocel Sabaté (eds. (2015: La Construcció d’identitats imaginades. Literatura medieval i ideologia, Lleida, Pagès Editors, 2015, 320 pàgs. ISBN:978-84-9975-704-9

  6. Transuranium Processing Plant semiannual report of production, status, and plans for period ending December 31, 1975

    International Nuclear Information System (INIS)

    King, L.J.; Bigelow, J.E.; Collins, E.D.

    1976-10-01

    Between July 1, 1975, and December 31, 1975, maintenance was conducted at TRU for a period of three months, 295 g of curium oxide (enough for approximately 26 HFIR targets) were prepared, 100 mg of high-purity 248 Cm, were separated from 252 Cf that had been purified during earlier periods, 11 HFIR targets were fabricated, and 28 product shipments were made. No changes were made in the chemical processing flowsheets normally used at TRU during this report period. However, three equipment racks were replaced (with two new racks) during this time. In Cubicle 6, the equipment replaced was that used to decontaminate the transplutonium elements from rare earth fission products and to separate curium from the heavier elements by means of the LiCl-based anion-exchange process. In Cubicle 5, the equipment used to separate the transcurium elements by high-pressure ion exchange and to purify berkelium by batch solvent extraction was replaced. Two neutron sources were fabricated, bringing the total fabricated to 79. One source that had been used in a completed project was returned to the TRU inventory and is available for reissue. Three sources, for which no further use was foreseen, were processed to isolate and recover the ingrown 248 Cm and the residual 252 Cf. Eight pellets, each containing 100 μg of high-purity 248 Cm were prepared for irradiation in HFIR to study the production of 250 Cm. The values currently being used for transuranium element decay data and for cross-section data in planning irradiation-processing cycles, calculating production forecasts, and assaying products are tabulated

  7. 24 CFR 248.145 - Criteria for approval of a plan of action involving incentives.

    Science.gov (United States)

    2010-04-01

    ...) Due diligence has been given to ensuring that the package of incentives set forth in the plan of... section, for the remaining useful life of the project; (3) Throughout the remaining useful life of the...) Implementation. Any agreement to maintain the low income affordability restrictions for the remaining useful life...

  8. 49 CFR 24.8 - Compliance with other laws and regulations.

    Science.gov (United States)

    2010-10-01

    ...—Equal Employment Opportunity, as amended. (j) Executive Order 11625—Minority Business Enterprise. (k) Executive Orders 11988—Floodplain Management, and 11990—Protection of Wetlands. (l) Executive Order 12250...

  9. Income inequality and mortality: a multilevel prospective study of 521 248 individuals in 50 US states.

    Science.gov (United States)

    Backlund, Eric; Rowe, Geoff; Lynch, John; Wolfson, Michael C; Kaplan, George A; Sorlie, Paul D

    2007-06-01

    Some of the most consistent evidence in favour of an association between income inequality and health has been among US states. However, in multilevel studies of mortality, only two out of five studies have reported a positive relationship with income inequality after adjustment for the compositional characteristics of the state's inhabitants. In this study, we attempt to clarify these mixed results by analysing the relationship within age-sex groups and by applying a previously unused analytical method to a database that contains more deaths than any multilevel study to date. The US National Longitudinal Mortality Study (NLMS) was used to model the relationship between income inequality in US states and mortality using both a novel and previously used methodologies that fall into the general framework of multilevel regression. We adjust age-sex specific models for nine socioeconomic and demographic variables at the individual level and percentage black and region at the state level. The preponderance of evidence from this study suggests that 1990 state-level income inequality is associated with a 40% differential in state level mortality rates (95% CI = 26-56%) for men 25-64 years and a 14% (95% CI = 3-27%) differential for women 25-64 years after adjustment for compositional factors. No such relationship was found for men or women over 65. The relationship between income inequality and mortality is only robust to adjustment for compositional factors in men and women under 65. This explains why income inequality is not a major driver of mortality trends in the United States because most deaths occur at ages 65 and over. This analysis does suggest, however, the certain causes of death that occur primarily in the population under 65 may be associated with income inequality. Comparison of analytical techniques also suggests coefficients for income inequality in previous multilevel mortality studies may be biased, but further research is needed to provide a definitive answer.

  10. 17 CFR 248.6 - Information to be included in privacy notices.

    Science.gov (United States)

    2010-04-01

    ... examples to illustrate the types of third parties in each category: (i) Financial service providers; (ii) Non-financial companies; and (iii) Others. (4) Disclosures under exception for service providers and... (CONTINUED) REGULATIONS S-P AND S-AM Regulation S-P: Privacy of Consumer Financial Information and...

  11. 17 CFR 248.9 - Delivering privacy and opt out notices.

    Science.gov (United States)

    2010-04-01

    ... regarding the customer relationship, and your current privacy notice remains available to the customer upon... reasonably expect that a customer will receive actual notice of your annual privacy notice if: (i) The customer uses your web site to access financial products and services electronically and agrees to receive...

  12. 26 CFR 1.248-1T - Election to amortize organizational expenditures (temporary).

    Science.gov (United States)

    2010-04-01

    ... accounting to which sections 446 and 481(a) apply if the corporation treated the item consistently for two or... business also is treated as a change in method of accounting if the corporation amortized organizational... obtaining of the corporate charter, are not alone sufficient to show the beginning of business. If the...

  13. 26 CFR 1.248-1 - Election to amortize organizational expenditures.

    Science.gov (United States)

    2010-04-01

    ... as drafting the corporate charter, by-laws, minutes of organizational meetings, terms of original stock certificates, and the like; necessary accounting services; expenses of temporary directors and of...

  14. 19 CFR 10.248 - Additional requirements for preferential treatment of brassieres.

    Science.gov (United States)

    2010-04-01

    ... production. The inventory records must reflect the production of the finished article which must be... HOMELAND SECURITY; DEPARTMENT OF THE TREASURY ARTICLES CONDITIONALLY FREE, SUBJECT TO A REDUCED RATE, ETC. Andean Trade Promotion and Drug Eradication Act Apparel and Other Textile Articles Under the Andean Trade...

  15. People and things. CERN Courier, Oct 1984, v. 24(8)

    International Nuclear Information System (INIS)

    Anon.

    1984-01-01

    The article reports on achievements of various people, staff changes and position opportunities within the CERN organization and contains news updates on upcoming or past events. The second Jerusalem Winter School of Theoretical Physics, sponsored by Israel's Ministry of Science and the Institute for Advanced Studies of the Hebrew University of Jerusalem will take place form 27 December 1984 to 4 January 1985, with the title 'Physics in Higher Dimensions '. Formed this year in the University of Tokyo is ICEPP - International Centre for Elementary Particle Physics - under Masatoshi Koshiba. With sports commentators exhausted after the long grind of the British football season, the 10th UK National Bubble Chamber Fivea-Side Soccer Tournament held in London earlier this year did not attract the media coverage it deserved

  16. 17 CFR 248.7 - Form of opt out notice to consumers; opt out methods.

    Science.gov (United States)

    2010-04-01

    ... the right to disclose nonpublic personal information about your consumer to a nonaffiliated third party; (ii) That the consumer has the right to opt out of that disclosure; and (iii) A reasonable means by which the consumer may exercise the opt out right. (2) Examples—(i) Adequate opt out notice. You...

  17. People and things. CERN Courier, Oct 1984, v. 24(8)

    Energy Technology Data Exchange (ETDEWEB)

    Anon.

    1984-10-15

    The article reports on achievements of various people, staff changes and position opportunities within the CERN organization and contains news updates on upcoming or past events. The second Jerusalem Winter School of Theoretical Physics, sponsored by Israel's Ministry of Science and the Institute for Advanced Studies of the Hebrew University of Jerusalem will take place form 27 December 1984 to 4 January 1985, with the title 'Physics in Higher Dimensions '. Formed this year in the University of Tokyo is ICEPP - International Centre for Elementary Particle Physics - under Masatoshi Koshiba. With sports commentators exhausted after the long grind of the British football season, the 10th UK National Bubble Chamber Fivea-Side Soccer Tournament held in London earlier this year did not attract the media coverage it deserved.

  18. 24 CFR 248.121 - Annual authorized return and aggregate preservation rents.

    Science.gov (United States)

    2010-04-01

    ... for the project, assuming a market rate of interest and customary terms; (3) Debt service on the... rehabilitation loan for the project, assuming a market rate of interest and customary terms; (3) Debt service on... local governments and assuming market rate interest rates. ...

  19. 7 CFR 2.48 - Administrator, Rural Business-Cooperative Service.

    Science.gov (United States)

    2010-01-01

    ... organizations throughout the world on subjects related to the development and operation of agricultural... Product Market Development Grant program (note to 7 U.S.C. 1621). (29) Administer the Agriculture... 7 Agriculture 1 2010-01-01 2010-01-01 false Administrator, Rural Business-Cooperative Service. 2...

  20. 17 CFR 248.15 - Other exceptions to notice and opt out requirements.

    Science.gov (United States)

    2010-04-01

    ... providers and joint marketing do not apply when you disclose nonpublic personal information: (1) With the... related to public safety; (5)(i) To a consumer reporting agency in accordance with the Fair Credit....7(f). Relation to Other Laws; Effective Date ...

  1. 27 CFR 24.248 - Processes authorized for the treatment of wine, juice, and distilling material.

    Science.gov (United States)

    2010-04-01

    ... transmembrane pressures of 250 psi or less. Osmotic transport 1 For alcohol reduction (1) Use must not alter the... which are selective for molecules not greater than 500 molecular weight with transmembrane pressures of... water for use in wine production. Thin-film evaporation under reduced pressure 1 To separate wine into a...

  2. S248. RELATION BETWEEN CHILDHOOD TRAUMA AND PSYCHOTIC SYMPTOMS IN SCHIZOPHRENIA

    Science.gov (United States)

    Larnaout, Amine; Nefzi, Rahma; Aissa, Amina; Trabelsi, Rouaa; Hechmi, Zouhaier El

    2018-01-01

    Abstract Background There is renewed interest in the relationship between early childhood trauma and risk of psychosis in adulthood. Trauma and stressful events in childhood and adolescence are known to be more prevalent among individuals with schizophrenia and other psychotic disorders than in the general population. Furthermore, other findings support the role of childhood trauma as a socio-environmental risk factor for psychotic symptoms, and research on the potential etiological relationship between trauma/stressful events in childhood/adolescence and psychotic disorders is evolving. The aim of the current study was to examine relations among all items and domains of childhood trauma and schizophrenic symptoms in patients with schizophrenia. The relationship between types of trauma and their association with psychotic symptoms was analysed. Methods In this study, we collected data from 50 schizophrenic patients (39 males and 11 females). All patients met the DSM 5 criteria for schizophrenia. Psychotic symptoms were measured by the Positive and Negative Syndrome Scale (PANSS). Trauma and stressful events in childhood and adolescence were assessed using the Childhood Trauma Questionnaire (CTQ). Results We found significant correlations between emotional and sexual abuse, emotional neglect and denial scale in CTQ with positive symptoms of the PANSS (pagressive behaviours was also described in litterature. These results went along with the stress sensitization model where the HPA axis is over-active and excessively reactive to the subsequent environemental stressors causing positive symptoms of the disease.

  3. 24 CFR 248.157 - Voluntary sale of housing not in excess of Federal cost limit.

    Science.gov (United States)

    2010-04-01

    ... costs; (5) Receive a distribution equal to an 8 percent annual return on any actual cash investment made... by a priority purchaser seeking to make an offer during either 6-month priority purchaser marketing...-based nonprofit and the offer is submitted within the marketing period established in paragraph (c)(1...

  4. 17 CFR 248.10 - Limits on disclosure of nonpublic personal information to nonaffiliated third parties.

    Science.gov (United States)

    2010-04-01

    ...: Privacy of Consumer Financial Information and Safeguarding Personal Information Limits on Disclosures... customer opens an on-line account with you and agrees to receive the notices required in paragraph (a)(1) of this section electronically, and you allow the customer to opt out by any reasonable means within...

  5. SU-E-J-248: Contributions of Tumor and Stroma Phenotyping in Computer-Aided Diagnosis

    Energy Technology Data Exchange (ETDEWEB)

    Li, H; Lan, L; Sennett, C; Giger, M [Univ Chicago, Chicago, IL (United States)

    2015-06-15

    Purpose: To gain insight into the role of parenchyma stroma in the characterization of breast tumors by incorporating computerized mammographic parenchyma assessment into breast CADx in the task of distinguishing between malignant and benign lesions. Methods: This study was performed on 182 biopsy-proven breast mass lesions, including 76 benign and 106 malignant lesions. For each full-field digital mammogram (FFDM) case, our quantitative imaging analysis was performed on both the tumor and a region-of-interest (ROI) from the normal contralateral breast. The lesion characterization includes automatic lesion segmentation and feature extraction. Radiographic texture analysis (RTA) was applied on the normal ROIs to assess the mammographic parenchymal patterns of these contralateral normal breasts. Classification performance of both individual computer extracted features and the output from a Bayesian artificial neural network (BANN) were evaluated with a leave-one-lesion-out method using receiver operating characteristic (ROC) analysis with area under the curve (AUC) as the figure of merit. Results: Lesion characterization included computer-extracted phenotypes of spiculation, size, shape, and margin. For parenchymal pattern characterization, five texture features were selected, including power law beta, contrast, and edge gradient. Merging of these computer-selected features using BANN classifiers yielded AUC values of 0.79 (SE=0.03) and 0.67 (SE=0.04) in the task of distinguishing between malignant and benign lesions using only tumor phenotypes and texture features from the contralateral breasts, respectively. Incorporation of tumor phenotypes with parenchyma texture features into the BANN yielded improved classification performance with an AUC value of 0.83 (SE=0.03) in the task of differentiating malignant from benign lesions. Conclusion: Combining computerized tumor and parenchyma phenotyping was found to significantly improve breast cancer diagnostic accuracy highlighting the need to consider both tumor and stroma in decision making. Funding: University of Chicago Dean Bridge Fund, NCI U24-CA143848-05, P50-CA58223 Breast SPORE program, and Breast Cancer Research Foundation. COI: MLG is a stockholder in R2 technology/Hologic and receives royalties from Hologic, GE Medical Systems, MEDIAN Technologies, Riverain Medical, Mitsubishi, and Toshiba. MLG is a cofounder and stockholder in Quantitative Insights.

  6. SU-E-T-248: Near Real-Time Analysis of Radiation Delivery and Imaging, Accuracy to Ensure Patient Safety

    Energy Technology Data Exchange (ETDEWEB)

    Wijesooriya, K; Seitter, K; Desai, V; Read, P; Larner, J [University of Virginia Health Systems, Charlottesville, VA (United States)

    2014-06-01

    Purpose: To develop and optimize an effective software method for comparing planned to delivered control point machine parameters for all VARIAN TrueBeam treatments so as to permit (1) assessment of a large patient pool throughout their treatment course to quantify treatment technique specific systematic and random uncertainty of observables, (2) quantify the site specific daily imaging shifts required for target alignment, and (3) define tolerance levels for mechanical parameters and imaging parameters based on statistical analysis data gathered, and the dosimetric impact of variations. Methods: Treatment and imaging log files were directly compared to plan parameters for Eclipse and Pinnacle planned treatments via 3D, IMRT, control point, RapidArc, and electrons. Each control point from all beams/arcs (7984) for all fractions (1940) of all patients treated over six months were analyzed. At each control point gantry angle, collimator angle, couch angle, jaw positions, MLC positions, MU were compared. Additionally per-treatment isocenter shifts were calculated. Results were analyzed as a whole in treatment type subsets: IMRT, 3D, RapidArc; and in treatment site subsets: brain, chest/mediastinum, esophagus, H and N, lung, pelvis, prostate. Results: Daily imaging isocenter shifts from initial external tattoo alignment were dependent on the treatment site with < 0.5 cm translational shifts for H and N, Brain, and lung SBRT, while pelvis, esophagus shifts were ∼1 cm. Mechanical delivery parameters were within tolerance levels for all sub-beams. The largest variations were for RapidArc plans: gantry angle 0.11±0.12,collimator angle 0.00±0.00, jaw positions 0.48±0.26, MLC leaf positions 0.66±0.08, MU 0.14±0.34. Conclusion: Per-control point validation reveals deviations between planned and delivered parameters. If used in a near real-time error checking system, patient safety can be improved by equipping the treatment delivery system with additional forcing functions which by-pass human error avenues.

  7. 77 FR 12365 - Agency Information Collection; Activity Under OMB Review: Submission of Audit Reports-Part 248

    Science.gov (United States)

    2012-02-29

    ... independent public accountant. If a carrier does not have an annual audit, the carrier must file a statement... (BTS), DOT. ACTION: Notice. SUMMARY: In compliance with the Paperwork Reduction Act of 1995, Public Law 104-13, the Bureau of Transportation Statistics invites the general public, industry and other...

  8. Prompt neutron emission from fragments in spontaneous fission of {sup 244,248}Cm and {sup 252}Cf

    Energy Technology Data Exchange (ETDEWEB)

    Vorobyev, A. S.; Shcherbakov, O. A. [Petersburg Nuclear Physics Institute, Gatchina, Leningrad district, 188300 (Russian Federation); Dushin, V. N.; Jakovlev, V. A.; Kalinin, V. A.; Petrov, B. F. [V.G. Khlopin Radium Institute, St. Petersburg, 194021 (Russian Federation); Hambsch, F.J [EC-JRC-Institute for Reference Materials and Measurements Retieseweg 111, B-2440 Geel (Belgium); Laptev, A. B. [Petersburg Nuclear Physics Institute, Gatchina, Leningrad district, 188300 (Russian Federation); Japan Nuclear Cycle Development Institute, Tokai-mura, Naka-gun, Ibaraki 319-1194 (Japan)

    2005-07-01

    Neutrons emitted in fission were measured separately for each complementary fragment in correlation with fission fragment energies. Two high efficiency Gd-loaded liquid scintillator tanks were used for neutron registration. Fission fragment energies were measured using a twin Frisch gridded ionization chamber with a pin-hole collimator. The neutron multiplicity distributions were obtained for each value of the fission fragment mass and energy and corrected for neutron registration efficiency, background and pile-up. The dependencies of these distributions on fragment mass and energy for different energy and mass bins, as well as the mass and energy distribution of the fission fragments are presented and discussed. (authors)

  9. SU-F-T-248: FMEA Risk Analysis Implementation (AAPM TG-100) in Total Skin Electron Irradiation Technique

    Energy Technology Data Exchange (ETDEWEB)

    Ibanez-Rosello, B; Bautista-Ballesteros, J; Bonaque, J [Hospital La Fe, Valencia, Valencia (Spain); Perez-Calatayud, J [Hospital La Fe, Valencia, Valencia (Spain); Clinica Benidorm, Benidorm, Alicante (Spain); Gonzalez-Sanchis, A; Lopez-Torrecilla, J; Brualla-Gonzalez, L; Garcia-Hernandez, T; Vicedo-Gonzalez, A; Granero, D; Serrano, A; Borderia, B; Solera, C [Hospital General ERESA, Valencia, Valencia (Spain); Rosello, J [Hospital General ERESA, Valencia, Valencia (Spain); Universidad de Valencia, Valencia, Valencia (Spain)

    2016-06-15

    Purpose: Total Skin Electron Irradiation (TSEI) is a radiotherapy treatment which involves irradiating the entire body surface as homogeneously as possible. It is composed of an extensive multi-step technique in which quality management requires high consumption of resources and a fluid communication between the involved staff, necessary to improve the safety of treatment. The TG-100 proposes a new perspective of quality management in radiotherapy, presenting a systematic method of risk analysis throughout the global flow of the stages through the patient. The purpose of this work has been to apply TG-100 approach to the TSEI procedure in our institution. Methods: A multidisciplinary team specifically targeting TSEI procedure was formed, that met regularly and jointly developed the process map (PM), following TG-100 guidelines of the AAPM. This PM is a visual representation of the temporal flow of steps through the patient since start until the end of his stay in the radiotherapy service. Results: This is the first stage of the full risk analysis, which is being carried out in the center. The PM provides an overview of the process and facilitates the understanding of the team members who will participate in the subsequent analysis. Currently, the team is implementing the analysis of failure modes and effects (FMEA). The failure modes of each of the steps have been identified and assessors are assigning a value of severity (S), frequency of occurrence (O) and lack of detection (D) individually. To our knowledge, this is the first PM made for the TSEI. The developed PM can be useful for those centers that intend to implement the TSEI technique. Conclusion: The PM of TSEI technique has been established, as the first stage of full risk analysis, performed in a reference center in this treatment.

  10. SU-E-T-248: Near Real-Time Analysis of Radiation Delivery and Imaging, Accuracy to Ensure Patient Safety

    International Nuclear Information System (INIS)

    Wijesooriya, K; Seitter, K; Desai, V; Read, P; Larner, J

    2014-01-01

    Purpose: To develop and optimize an effective software method for comparing planned to delivered control point machine parameters for all VARIAN TrueBeam treatments so as to permit (1) assessment of a large patient pool throughout their treatment course to quantify treatment technique specific systematic and random uncertainty of observables, (2) quantify the site specific daily imaging shifts required for target alignment, and (3) define tolerance levels for mechanical parameters and imaging parameters based on statistical analysis data gathered, and the dosimetric impact of variations. Methods: Treatment and imaging log files were directly compared to plan parameters for Eclipse and Pinnacle planned treatments via 3D, IMRT, control point, RapidArc, and electrons. Each control point from all beams/arcs (7984) for all fractions (1940) of all patients treated over six months were analyzed. At each control point gantry angle, collimator angle, couch angle, jaw positions, MLC positions, MU were compared. Additionally per-treatment isocenter shifts were calculated. Results were analyzed as a whole in treatment type subsets: IMRT, 3D, RapidArc; and in treatment site subsets: brain, chest/mediastinum, esophagus, H and N, lung, pelvis, prostate. Results: Daily imaging isocenter shifts from initial external tattoo alignment were dependent on the treatment site with < 0.5 cm translational shifts for H and N, Brain, and lung SBRT, while pelvis, esophagus shifts were ∼1 cm. Mechanical delivery parameters were within tolerance levels for all sub-beams. The largest variations were for RapidArc plans: gantry angle 0.11±0.12,collimator angle 0.00±0.00, jaw positions 0.48±0.26, MLC leaf positions 0.66±0.08, MU 0.14±0.34. Conclusion: Per-control point validation reveals deviations between planned and delivered parameters. If used in a near real-time error checking system, patient safety can be improved by equipping the treatment delivery system with additional forcing functions which by-pass human error avenues

  11. 17 CFR Appendix A to Subpart A of... - Appendix A to Subpart A of Part 248 Forms

    Science.gov (United States)

    2010-04-01

    ... use my personal information to market to me.” (4) Nonaffiliate opt-out. If the financial institution... market to me.” (h) Barcodes. A financial institution may elect to include a barcode and/or “tagline” (an... parties, state: “[name of financial institution] does not share with nonaffiliates so they can market to...

  12. SU-E-J-248: Comparative Study of Two Image Registration for Image-Guided Radiation Therapy in Esophageal Cancer

    Energy Technology Data Exchange (ETDEWEB)

    Shang, K; Wang, J; Liu, D; Li, R; Cao, Y; Chi, Z [The Fourth Hospital of Hebei Medical University, Shijiazhuang, Hebei, CN, Shijiazhuang, Hebei (China)

    2014-06-01

    Purpose: Image-guided radiation therapy (IGRT) is one of the major treatment of esophageal cancer. Gray value registration and bone registration are two kinds of image registration, the purpose of this work is to compare which one is more suitable for esophageal cancer patients. Methods: Twenty three esophageal patients were treated by Elekta Synergy, CBCT images were acquired and automatically registered to planning kilovoltage CT scans according to gray value or bone registration. The setup errors were measured in the X, Y and Z axis, respectively. Two kinds of setup errors were analysed by matching T test statistical method. Results: Four hundred and five groups of CBCT images were available and the systematic and random setup errors (cm) in X, Y, Z directions were 0.35, 0.63, 0.29 and 0.31, 0.53, 0.21 with gray value registration, while 0.37, 0.64, 0.26 and 0.32, 0.55, 0.20 with bone registration, respectively. Compared with bone registration and gray value registration, the setup errors in X and Z axis have significant differences. In Y axis, both measurement comparison results of T value is 0.256 (P value > 0.05); In X axis, the T value is 5.287(P value < 0.05); In Z axis, the T value is −5.138 (P value < 0.05). Conclusion: Gray value registration is recommended in image-guided radiotherapy for esophageal cancer and the other thoracic tumors. Manual registration could be applied when it is necessary. Bone registration is more suitable for the head tumor and pelvic tumor department where composed of redundant interconnected and immobile bone tissue.

  13. A pacemaker with P = 2.48 h modulated the generator of flares in the X-ray light curve of Sgr A* in the year 2012

    Science.gov (United States)

    Leibowitz, Elia

    2017-01-01

    In an intensive observational campaign in the nine month duration of Chandra X-ray Visionary Project that was conducted in the year 2012, 39 large X-ray flares of Sgr A* were recorded. An analysis of the times of the observed flares reveals that the 39 flares are separated in time by intervals that are grouped around integer numbers times 0.10333 days. This time interval is thus the period of a uniform grid of equally spaced points on the time axis. The grouping of the flares around tic marks of this grid is derived from the data with at least a 3.2 σ level of statistical significance. No signal of any period can be found among 22 flares recorded by Chandra in the years 2013-2014. If the 0.10333 day period is that of a nearly circular Keplerian orbit around the blackhole at the center of the Galaxy, its radius is at 7.6 Schwarzschild radii. Large flares were more likely to be triggered when the agent responsible for their outbursts was near the peri-center phase of its slightly eccentric orbit.

  14. Historic Archaeology of the Johnson (41DN248) and Jones (41DN250) Farmsteads in the Ray Roberts Lake Area: 1850-1950

    Science.gov (United States)

    1996-08-15

    9 settlement, little bluestem was the dominant grass ( McCormick et al. 1975:4). According to Hill (1887:293), the increased fertility of the soils in...recovered from Block I during mitigation. Other identified bottles in Block 1 included snuff (n=12 sherds), condiment (n=8), brandy/bitters (n=9), case...bottle sherds were 13 medicinal/extract, 1 lightning iall fruit jar, 1 liquor/beverage, 9 fruit jar inset caps, 8 fruit jars, and 1 food/ condiment jar

  15. Donatella della Porta, Social Movements in Times of Austerity: Bringing Capitalism Back into Protest Analysis, Cambridge: Polity Press, 2015, 248 pages, ISBN-13: 9780745688589 (hbk

    Directory of Open Access Journals (Sweden)

    Marius Ioan TĂTAR

    2016-11-01

    Full Text Available The global economic crisis had major social and political impact on European societies. The political consequences of the crisis mainly stem from rising unemployment, the freezing or cuts of public sector pay, declining purchasing power, pessimism about future developments and perceptions of bad governance. In this context, a new wave of protest has spread across Europe as a reaction to the austerity measures adopted during the economic crisis. Governments’ inability to deal with the crisis has generated in many places anxiety, which then turned into popular anger. People who have been hard hit by the crisis placed most of the blame with incumbent governments and condemned the corruption and lack of political responsibility of the political class in general.

  16. Statistics for Health Care Professionals Ian Scott Statistics for Health Care Professionals and Debbie Mazhindu Sage 248 :£19.99 0761974768 0761974768 [Formula: see text].

    Science.gov (United States)

    2005-10-01

    As a recent recruit to a lecturerpractitioner post with little recent experience in the subject area covered by this book, I found it met my needs very well. After all, this topic can be quite daunting for some. The 18 chapters are relatively short and I was able to dip into them when time allowed. However, it can also be read for extended periods, as the text is broken up with numerous information boxes, diagrams and tables. All the examples are relevant and appropriate to practice settings.

  17. Safety analysis report for packaging: neutron shipping cask, model 0.5T

    International Nuclear Information System (INIS)

    Peterson, R.T.

    1976-01-01

    The Safety Analysis Report for Packaging demonstrates that the neutron shipping cask can safely transport, in solid or powder form, all isotopes of uranium, plutonium, americium, curium, berkelium, californium, einsteinium, and fermium. The shipping cask and its contents are described. It also evaluates transport conditions, structural parameters (e.g., load resistance, pressure and impact effects, lifting and tiedown devices), and shielding. Finally, it discusses compliance with Chapter 0529 of the Energy Research and Development Administration Manual

  18. Directed evolution of the periodic table: probing the electronic structure of late actinides.

    Science.gov (United States)

    Marsh, M L; Albrecht-Schmitt, T E

    2017-07-25

    Recent investigations of the coordination chemistry and physical properties of berkelium (Z = 97) and californium (Z = 98) have revealed fundamental differences between post-curium elements and lighter members of the actinide series. This review highlights these developments and chronicles key findings and concepts from the last half-century that have helped usher in a new understanding of the evolution of electronic structure in the periodic table.

  19. Amplification at λ ∼ 2.8 A on Xe(L),(2s-bar2p-bar) double-vacancy states produced by 248 nm excitation of Xe clusters in plasma channels

    International Nuclear Information System (INIS)

    Borisov, Alex B; Song Xiangyang; Zhang Ping; Dasgupta, Arati; Davis, Jack; Kepple, Paul C; Dai Yang; Boyer, Keith; Rhodes, Charles K

    2005-01-01

    Xe(L),(2s-bar2p-bar) double-vacancy states undergo strong amplification in relativistic self-trapped plasma channels on 3d → 2p transitions in the λ = 2.78-2.81 A region. The 2 P 3/2 → 2 S 1/2 component at λ ≅ 2.786 A exhibits saturated amplification demonstrated by both (1) the observation of spectral hole-burning in the spontaneous emission profile and (2) the correlated enhancement of 3p → 2s cascade transitions ( 2 S 1/2 → 2 P j ; j = 1/2, 3/2) at λ = 2.558 and λ = 2.600 A. The condition of saturation places a lower limit of ∼10 17 W cm -2 on the intensity of the x-ray beam produced by the amplification in the channel. The anomalous strength of the amplification signalled by the saturation mirrors the equivalently anomalous behaviour observed for all 3d → 2p transitions corresponding to 2p-bar) single-vacancy Xe q+ arrays (q = 31, 32, 34, 35, 36) that exhibit gain. The conspicuous absence of amplification involving states with (2p-bar) 2 double-vacancy configurations suggests the operation of a selective interaction that enhances the production of 2s-bar2p-bar states. Overall, the generation of double-vacancy states of this genre demonstrates that an excitation rate approaching ∼1 W/atom for ionic species is achievable in self-trapped plasma channels

  20. CTD data of the Hawaii Ocean Time-series (HOT) program in the North Pacific 100 miles north of Oahu, Hawaii for cruises HOT239-248 during 2012 (NODC Accession 0119895)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — The HOT program makes repeated observations of the physics, biology and chemistry at a site approximately 100 km north of Oahu, Hawaii. Two stations are visited...

  1. Directive of the Minister of Justice of 16 December 1969, Stcrt. 248 concerning the implementation of Section 83 of the Nuclear Energy Act (Civil Servants Competent for the Prosecution of Criminal Acts)

    International Nuclear Information System (INIS)

    1969-01-01

    This Directive, made in implementation of the Nuclear Energy Act, Lays down that Chief Inspectors and Regional Inspectors of the Ministry of Social Affairs and Public health are competent in respect of the prosecution of criminal acts. (NEA) [fr

  2. Design and characterization of a low-viscous muscle tissue mimicking media at the ISM-band (2.4–2.48 GHz) for easy antenna displacement in in vitro measurements

    DEFF Research Database (Denmark)

    Jónasson, Sævar Þór; Zhurbenko, Vitaliy; Johansen, Tom Keinicke

    2012-01-01

    -ionized water and diethylene glycol butyl ether are examined in range of widely used biomedical frequencies. A recipe for 2.45 GHz is given, which provides less than 5.6% deviation from the reference. With help of curve fitting of the discrete measurement points, recipes for other parts of the body can...

  3. Early Child Care and Education: HHS and Education Are Taking Steps to Improve Workforce Data and Enhance Worker Quality. Report to the Chairman, Committee on Finance, U.S. Senate. GAO-12-248

    Science.gov (United States)

    Brown, Kay E.

    2012-01-01

    Research shows that well trained and educated early child care and education (ECCE) workers are key to helping children in care reach their full developmental potential. Federal and state governments spend billions of dollars each year to improve ECCE programs, including the quality of its caregivers and teachers. Because of the importance of this…

  4. Niskin bottle data of the Hawaii Ocean Time-series (HOT) program in the North Pacific 100 miles north of Oahu, Hawaii for cruises HOT239-248 during 2012 (NCEI Accession 0119430)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — The HOT program makes repeated observations of the physics, biology and chemistry at a site approximately 100 km north of Oahu, Hawaii. Two stations are visited...

  5. The prevalence of psychotherapy and psychopharmacotherapy at the Integrated Health and Social Well Being Center of Santa Maria, state of Rio Grande do Sul (RS - DOI: 10.3395/reciis.v3i4.248en

    Directory of Open Access Journals (Sweden)

    Cecilia Cassol Dalmolin

    2009-12-01

    Full Text Available This study aims to verify the prevalence of psychopharmacotherapy and psychotherapy and the therapeutic interaction between these at the Integrated Health and Social Well Being Center (Cisbes located in the town of Santa Maria/RS. For this purpose, a descriptive survey of the therapeutic practices used in the said service during the period from January to July 2005 was carried out, along with a survey of the user profile, using sociodemographic variables. The results show that 1456 people were undergoing treatment during the time of research. Out of these people, 78% (1140 received psychopharmacological treatment, 9% (132 received psychotherapy and 13% (184 had therapeutic interaction. It was seen that the average user age was 36, most were married, 75% lived with family members, 69% were women and 51% had basic schooling. The study looks at factors that may be associated to the results obtained, both in relation to the mental health care model in Brazil and also the possible difficulties faced by the mental health services in the public network.

  6. Protein (Viridiplantae): 128879 [PGDBj - Ortholog DB

    Lifescience Database Archive (English)

    Full Text Available 5:248 3803:248 ... 3814:248 ... 163722:3689 ... 3826:3689 ... 3827:3689 ... PREDICTED: uncharacterized protein LOC101515541 Cicer arietinum MNSSTI...CSLFLGLILISQSANAKGHGGGLVVTICKGATDRAACENILGSNSEISHAKSFSQL

  7. PROCEEDINGS OF THE SYMPOSIUM COMMEMORATING THE 25th ANNIVERSARY OF ELEMENTS 97 and 98 HELD ON JAN. 20, 1975

    Energy Technology Data Exchange (ETDEWEB)

    Seaborg, Glenn T.; Street Jr., Kenneth; Thompson, Stanley G.; Ghiorso, Albert

    1976-07-01

    This volume includes the talks given on January 20, 1975, at a symposium in Berkeley on the occasion of the celebration of the 25th anniversary of the discovery of berkelium and californium. Talks were given at this symposium by the four people involved in the discovery of these elements and by a number of people who have made significant contributions in the intervening years to the investigation of their nuclear and chemical properties. The papers are being published here, without editing, in the form in which they were submitted by the authors in the months following the anniversary symposium, and they reflect rather faithfully the remarks made on that occasion.

  8. Radiological safety considerations in the design and operation of the ORNL Transuranium Research Laboratory (TRL)

    International Nuclear Information System (INIS)

    Haynes, C.E.

    1976-01-01

    The Transuranium Research Laboratory (TRL) is the central facility at Oak Ridge National Laboratory (ORNL) for chemical and physical research involving transuranium elements. Transuranium Research Laboratory investigations are about equally divided between studies of inorganic and structural chemistry of the heavy elements and nuclear structure and properties of their isotopes. Elements studied include neptunium, plutonium, americium, curium, berkelium, californium, and einsteinium, each in microgram-to-gram quantities depending upon availability and experimental requirements. This paper describes an eight-step safety procedure followed in planning and approving individual research projects. This procedure should provide an optimum margin of safety and should permit the accomplishment of successful research

  9. Composition containing transuranic elements for use in the homeopathic treatment of aids

    International Nuclear Information System (INIS)

    Lustig, D.

    1996-01-01

    A homeopathic remedy consisting of a composition containing one or more transuranic elements, particularly plutonium, for preventing and treating acquired immunodeficiency syndrome (AIDS) in humans, as well as seropositivity for human immunodeficiency virus (HIV). Said composition is characterized in that it uses any chemical or isotopic form of one or more transuranic elements (neptunium, plutonium, americium, curium, berkelium, californium or einsteinium), particularly plutonium, said form being diluted and dynamized according to conventional homeopathic methods, particularly the so-called Hahnemann and Korsakov methods, and provided preferably but not exclusively in the form of lactose and/or saccharose globules or granules impregnated with the active principle of said composition. (author)

  10. Actinides

    International Nuclear Information System (INIS)

    Martinot, L.; Fuger, J.

    1985-01-01

    The oxidation behavior of the actinides is explained on the basis of their electronic structure. The actinide elements, actinium, thorium, protactinium, uranium, neptunium, plutonium, americium, curium, berkelium, californium, einsteinium, fermium, mendelevium, nobelium, and laurencium are included. For all except the last three elements, the points of discussion are oxidation states, Gibbs energies and potentials, and potential diagram for the element in acid solution; and thermodynamic properties of these same elements are tabulated. References are cited following discussion of each element with a total of 97 references being cited. 13 tables

  11. Safety analysis report for packaging: neutron shipping cask, model 4T

    International Nuclear Information System (INIS)

    Peterson, R.T.

    1977-01-01

    This Safety Analysis Report for Packaging demonstrates that the neutron shipping cask can safely transport, in solid or powder form, all isotopes of uranium, plutonium, americium, curium, berkelium, californium, einsteinium, and fermium. The cask and its contents are described. It also evaluates transport conditions, structural parameters (e.g., load resistance, pressure and impact effects, lifting and tiedown devices), and shielding. Finally, it discusses compliance with Chapter 0529 of the Energy Research and Development Administration Manual, Safety Standards for the Packaging of Fissile and Other Radioactive Materials

  12. TOWARD AN IMPROVED UNDERSTANDING OF STRUCTURE AND MAGNETISM IN NEPTUNIUM AND PLUTONIUM PHOSPHONATES AND SULFONATES

    Energy Technology Data Exchange (ETDEWEB)

    Albrecht-Schmitt, Thomas

    2012-03-01

    This grant supported the exploratory synthesis of new actinide materials with all of the actinides from thorium to californium with the exceptions of protactinium and berkelium. We developed detailed structure-property relationships that allowed for the identification of novel materials with selective ion-exchange, selective oxidation, and long-range magnetic ordering. We found novel bonding motifs and identified periodic trends across the actinide series. We identified structural building units that would lead to desired structural features and novel topologies. We also characterized many different spectroscopic trends across the actinide series. The grant support the preparation of approximately 1200 new compounds all of which were structurally characterized.

  13. ORF Alignment: NC_003911 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available RAVNFPTPVPDSAGIPPGVADQVLVAPFNDLEAVA 180 ... Query: 248 HYGVTPDIVTLGKVIGGGFPLAALGASARIMAHFDKGAVGGEGWLMQLGTLSGNPV...AAAA 307 ... HYGVTPDIVTLGKVIGGGFPLAALGASARIMAHFDKGAVGGEGWLMQLGTLSGNPVAAAA Sbjct: 241 HYGVTPDIVTLGKVIGGGFPLAALGASARIMA

  14. ORF Alignment: NC_002940 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NIIGVKEATGDLTRLPLIKTLAGEDFI 180 ... Query: 248 LFIEANPIPVKWAAYKLGLISEPSLRLPLTPLSETAQPTILKALQKAGL 296 ... LFIEANPIPVKWAAYKLGLISEPS...LRLPLTPLSETAQPTILKALQKAGL Sbjct: 241 LFIEANPIPVKWAAYKLGLISEPSLRLPLTPLSETAQPTILKALQKAGL 289

  15. ORF Alignment: NC_004757 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available ... Length = 212 ... Query: 189 LSGKRVLVTAGPTFEALDAVRGLTNLSSGKTXXXXXXXXXXXXXXVTLVCGPVCPPFPAV 248 ... LSGKRVLVTAGPTFE...ALDAVRGLTNLSSGKT ... VTLVCGPVCPPFPAV Sbjct: 1 ... LSGKRVLVTAGPTFE

  16. ORF Alignment: NC_004369 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available YLESAHKIIIEVNSWQSLELEGMADIYRVPH 180 ... Query: 248 LEGEVRAGRLTYDGYIMQSGVGNVPNAVMAGLLDSKFENIKAYTEVVQDGMLDLIDAGKM... 307 ... LEGEVRAGRLTYDGYIMQSGVGNVPNAVMAGLLDSKFENIKAYTEVVQDGMLDLIDAGKM Sbjct: 241 LEGEVRAGRLTYDGYIMQSGVGNVPNAVMAG

  17. ORF Alignment: NC_004369 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NAAEKIIIEVNSWQSADLEGMHDIWSMPK 180 ... Query: 248 LEGEVRAGRLSYDGYVMQSGVGNVPNAVMAGLLDSKFENIQAYTEVIQDGMVDLIDAGKM 3...07 ... LEGEVRAGRLSYDGYVMQSGVGNVPNAVMAGLLDSKFENIQAYTEVIQDGMVDLIDAGKM Sbjct: 241 LEGEVRAGRLSYDGYVMQSGVGNVPNAVMAG

  18. 248. Reemplazo de raíz de aorta según técnica de david y de arco aórtico con injerto trifurcado, en un paciente diagnosticado de síndrome de loeys-dietz

    Directory of Open Access Journals (Sweden)

    A. Forteza Gil

    2010-01-01

    Resultado y conclusiones: No hubo complicaciones postoperatorias. El tratamiento quirúrgico precoz en los pacientes afectos de síndrome de Loeys-Dietz es imprescindible. La experiencia acumulada hasta el momento revela la agresividad de esta enfermedad. Por ello, es necesario un abordaje completo cuando existe afectación a distintos niveles. El empleo de técnicas de preservación valvular permite además disminuir la morbimortalidad asociada a las prótesis valvulares.

  19. Study of Search Engine Transaction Logs Shows Little Change in How Users use Search Engines. A review of: Jansen, Bernard J., and Amanda Spink. “How Are We Searching the World Wide Web? A Comparison of Nine Search Engine Transaction Logs.” Information Processing & Management 42.1 (2006: 248‐263.

    Directory of Open Access Journals (Sweden)

    David Hook

    2006-09-01

    Full Text Available Objective – To examine the interactions between users and search engines, and how they have changed over time. Design – Comparative analysis of search engine transaction logs. Setting – Nine major analyses of search engine transaction logs. Subjects – Nine web search engine studies (4 European, 5 American over a seven‐year period, covering the search engines Excite, Fireball, AltaVista, BWIE and AllTheWeb. Methods – The results from individual studies are compared by year of study for percentages of single query sessions, one term queries, operator (and, or, not, etc. usage and single result page viewing. As well, the authors group the search queries into eleven different topical categories and compare how the breakdown has changed over time. Main Results – Based on the percentage of single query sessions, it does not appear that the complexity of interactions has changed significantly for either the U.S.‐based or the European‐based search engines. As well, there was little change observed in the percentage of one‐term queries over the years of study for either the U.S.‐based or the European‐based search engines. Few users (generally less than 20% use Boolean or other operators in their queries, and these percentages have remained relatively stable. One area of noticeable change is in the percentage of users viewing only one results page, which has increased over the years of study. Based on the studies of the U.S.‐based search engines, the topical categories of ‘People, Place or Things’ and ‘Commerce, Travel, Employment or Economy’ are becoming more popular, while the categories of ‘Sex and Pornography’ and ‘Entertainment or Recreation’ are declining. Conclusions – The percentage of users viewing only one results page increased during the years of the study, while the percentages of single query sessions, oneterm sessions and operator usage remained stable. The increase in single result page viewing implies that users are tending to view fewer results per web query. There was also a significant difference in the percentage of queries using Boolean operators between the US‐based and the European‐based search engines. One of the study’s findings was that results from a study of a particular search engine cannot necessarily be applied to all search engines. Finally, web search topics show a trend towards information or commerce searching rather than entertainment.

  20. Comment on "Nanosecond laser textured superhydrophobic metallic surfaces and their chemical sensing applications" by Duong V. Ta, Andrew Dunn, Thomas J. Wasley, Robert W. Kay, Jonathan Stringer, Patrick J. Smith, Colm Connaughton, Jonathan D. Shephard (Appl. Surf. Sci. 357 (2015) 248-254)

    Science.gov (United States)

    Boinovich, L. B.; Emelyanenko, A. M.; Emelyanenko, K. A.; Domantovsky, A. G.; Shiryaev, A. A.

    2016-08-01

    Nowadays the problem of design of durable ecologically friendly superhydrophobic surfaces is of great importance for science and technology. A recent paper in Applied Surface Science reports the method of fabricating the superhydrophobic metallic surfaces by infrared nanosecond laser surface texturing without using hydrophobic agents. Since this method of surface texturing can be considered as one of the most suitable for various industrial applications, the nature of superhydrophobic state of surfaces produced by laser texturing in the abovementioned paper deserves to be analyzed in detail. Authors of the commented paper attributed the change in wettability to the partial deoxidation of CuO into Cu2O on the surface during storage in atmosphere. However, such interpretation of the results contradicts to the basic notions in the theory of wetting and to more accurate and detailed data. In our Comment we discuss these contradictions point by point.

  1. Chemical consequences of radioactive decay. 1. Study of 249Cf ingrowth into crystalline 249BkBr3: a new crystalline phase of CfBr3

    International Nuclear Information System (INIS)

    Young, J.P.; Haire, R.G.; Peterson, J.R.; Ensor, D.D.; Fellows, R.L.

    1980-01-01

    Spectrophotometric and x-ray powder diffraction methods have been applied to a study of the ingrowth of californium-249 by β - decay of berkelium-249 in crystalline 249 BkBr 3 . It was found that the Cf daughter grows in with the same oxidation state and crystal structure as the parent. Thus, six-coordinate BkBr 3 (AlCl 3 -type monoclinic structure) generates six-coordinate CfBr 3 , and eight-coordinate BkBr 3 (PuBr 3 -type orthorhombic structure) generates eight-coordinate CfBr 3 , a previously unknown form of CfBr 3 . It was also found that the daughter Cf(III) in the BkBr 3 parent compound can be reduced to Cf(II) by treatment with H 2 , as it can in pure CfBr 3 . 5 figures

  2. Reactor production of 252Cf and transcurium isotopes

    International Nuclear Information System (INIS)

    Alexander, C.W.; Halperin, J.; Walker, R.L.; Bigelow, J.E.

    1990-01-01

    Berkelium, californium, einsteinium, and fermium are currently produced in the High Flux Isotope Reactor (HFIR) and recovered in the Radiochemical Engineering Development Center (REDC) at the Oak Ridge National Laboratory (ORNL). All the isotopes are used for research. In addition, 252 Cf, 253 Es, and 255 Fm have been considered or are used for industrial or medical applications. ORNL is the sole producer of these transcurium isotopes in the western world. A wide range of actinide samples were irradiated in special test assemblies at the Fast Flux Test Facility (FFTF) at Hanford, Washington. The purpose of the experiments was to evaluate the usefulness of the two-group flux model for transmutations in the special assemblies with an eventual goal of determining the feasibility of producing macro amounts of transcurium isotopes in the FFTF. Preliminary results from the production of 254g Es from 252 Cf will be discussed. 14 refs., 5 tabs

  3. Nuclear fission and the transuranium elements

    International Nuclear Information System (INIS)

    Seaborg, G.T.

    1989-02-01

    Many of the transuranium elements are produced and isolated in large quantities through the use of neutrons furnished by nuclear fission reactions: plutonium (atomic number 94) in ton quantities; neptunium (93), americium (95), and curium (96) in kilogram quantities; berkelium (97) in 100 milligram quantities; californium (98) in gram quantities; and einsteinium (99) in milligram quantities. Transuranium isotopes have found many practical applications---as nuclear fuel for the large-scale generation of electricity, as compact, long-lived power sources for use in space exploration, as means for diagnosis and treatment in the medical area, and as tools in numerous industrial processes. Of particular interest is the unusual chemistry and impact of these heaviest elements on the periodic table. This account will feature these aspects. 9 refs., 5 figs

  4. Nuclear fission and the transuranium elements

    Energy Technology Data Exchange (ETDEWEB)

    Seaborg, G.T.

    1989-02-01

    Many of the transuranium elements are produced and isolated in large quantities through the use of neutrons furnished by nuclear fission reactions: plutonium (atomic number 94) in ton quantities; neptunium (93), americium (95), and curium (96) in kilogram quantities; berkelium (97) in 100 milligram quantities; californium (98) in gram quantities; and einsteinium (99) in milligram quantities. Transuranium isotopes have found many practical applications---as nuclear fuel for the large-scale generation of electricity, as compact, long-lived power sources for use in space exploration, as means for diagnosis and treatment in the medical area, and as tools in numerous industrial processes. Of particular interest is the unusual chemistry and impact of these heaviest elements on the periodic table. This account will feature these aspects. 9 refs., 5 figs.

  5. Changing composition of human capital: the Czech Republic, Hungary, and Poland

    Czech Academy of Sciences Publication Activity Database

    Jeong, Byeongju; Kejak, Michal; Vinogradov, Viatcheslav

    -, č. 248 (2005), s. 1-27 ISSN 1211-3298 Institutional research plan: CEZ:AV0Z70850503 Keywords : human capital * composition * occupation Subject RIV: AH - Economics http://www.cerge-ei.cz/pdf/wp/Wp248.pdf

  6. ORF Alignment: NC_006350 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available DKALAQLFPEFSRSRLQQWIESDRVRVSGAPAKIRQPVPLGATIELLPELLPEQLAFT 60 ... Query: 189 DKETSGLMVVARTLAAQTDLIRQLQARTVKRRYFALAWGRMPDEGTIDAPIGRDPRERT...R 248 ... DKETSGLMVVARTLAAQTDLIRQLQARTVKRRYFALAWGRMPDEGTIDAPIGRDPRERTR... Sbjct: 121 DKETSGLMVVARTLAAQTDLIRQLQARTVKRRYFALAWGRMPDEGTIDAPIGRDPRERTR 180 ... Query: 30

  7. ORF Alignment: NC_006348 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available DKALAQLFPEFSRSRLQQWIESDRVRVSGAPAKIRQPVPLGATIELLPELLPEQLAFT 60 ... Query: 189 DKETSGLMVVARTLAAQTDLVRQLQARTVKRRYFALAWGRMPDEGTIDAPIGRDPRERT...R 248 ... DKETSGLMVVARTLAAQTDL+RQLQARTVKRRYFALAWGRMPDEGTIDAPIGRDPRERTR... Sbjct: 121 DKETSGLMVVARTLAAQTDLIRQLQARTVKRRYFALAWGRMPDEGTIDAPIGRDPRERTR 180 ... Query: 30

  8. ORF Alignment: NC_005125 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available VPATRSNISFVDGKAGVLEYRGIPIDQLAESSTFLETAFLLIFDHLPTKDELLSFE 60 ... Query: 128 AKMPTMVATFHQMRLGNDPIPPRDDLGHAANFLYMLTGKEPDPRAARIFD...VCLMLHAEHT 187 ... AKMPTMVATFHQMRLGNDPIPPRDDLGHAANFLYMLTGKEPDPRAARIFDVCLMLHAEHT Sbjct: ...121 AKMPTMVATFHQMRLGNDPIPPRDDLGHAANFLYMLTGKEPDPRAARIFDVCLMLHAEHT 180 ... Query: 248

  9. Journal of Biosciences | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Home; Journals; Journal of Biosciences; Volume 28; Issue 3. Issue front cover thumbnail. Volume 28, Issue 3. April 2003, pages 248-358. Viral Evasion of Host Responses. pp 248-248. Preface · Shahid Jameel · More Details Fulltext PDF. pp 249-264 Articles. Viral mimicry of the complement system · John Bernet Jayati ...

  10. Dicty_cDB: Contig-U15463-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 40 |pid:none) Bazzania tayloriana voucher NSW712... 248 3e-64 DQ406895_1( DQ406895 |pid:none) Sabia sp. Qiu ...248 3e-64 CP000439_1615( CP000439 |pid:none) Francisella tularensis subsp. n... 248 3e-64 EF101040_1( EF1010

  11. ORF Alignment: NC_005085 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available 248 ... [Chromobacterium violaceum ATCC 12472] ... Length = 120 ... Query: 1146 LRVLLVEDDAINREVA...QALLQDVGLEADMAENGKIAVERVQAAPARYALILMDVQMPEMD 1205 ... LRVLLVEDDAINREVAQAL...LQDVGLEADMAENGKIAVERVQAAPARYALILMDVQMPEMD Sbjct: 1 ... LRVLLVEDDAINREVAQALLQDVGLEADMAENGKIAVERVQAAPARYALILMDVQMPEMD 60 ...

  12. ORF Alignment: NC_003902 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available PEQAIRDAGYGVIWQGQRSW 60 ... Query: 128 KWFQRLLRHAATLVALPHPVALIGDFNVVPTDAHIYDPKGWRKDALLQPESRAAYAQLLA 187 ... ... ... KWFQRLLRHAATLVALPHPVALIGDFNVVPTDAHIYDPKGWRKDALLQPESRAAYAQLLA Sbjct: 121 KWFQR...LLRHAATLVALPHPVALIGDFNVVPTDAHIYDPKGWRKDALLQPESRAAYAQLLA 180 ... Query: 248 EKASDHAPTWI 258 ... EKASDHAPTWI Sbjct: 241 EKASDHAPTWI 251

  13. ORF Alignment: EHA1 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available 2B delta subunit, putative [Entamoeba ... histolytica HM-1:IMSS] ... Length = 249 ... Query: 248 KASKLTQSSECI...PLIEENVKLLEHARTITVGMNNVRKFIFMKNQSIENIIATAQTVSSNI 307 ... KASKLTQSSECIPLIEENVKLLEHARTITVGM...NNVRKFIFMKNQSIENIIATAQTVSSNI Sbjct: 1 ... KASKLTQSSECIPLIEENVKLLEHARTITVGMNNVRKFIFM

  14. ORF Alignment: NC_006177 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available beta ... subunit [Symbiobacterium thermophilum IAM 14863] ... Length = 248 ... Query: 3 ... RAATWETWRPDPANTRQHVAMLVDTSECI...GCKGCEVACKQWNQNEARINQDPGTYQSHPA 62 ... RAATWETWRPDPANTRQHVAMLVDTSECI...GCKGCEVACKQWNQNEARINQDPGTYQSHPA Sbjct: 1 ... RAATWETWRPDPANTRQHVAMLVDTSECIGCKGCEVACKQWNQNEARI

  15. ORF Alignment: NC_002939 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available FliM ... [Geobacter sulfurreducens PCA] ... Length = 79 ... Query: 248 RLSKELLEAPLDVSVEVGGAVISLNDLLSLVPGDTIMLDTPCTSDLT...VKVGGVPKFTGMP 307 ... RLSKELLEAPLDVSVEVGGAVISLNDLLSLVPGDTIMLDTPCTSDLT...VKVGGVPKFTGMP Sbjct: 1 ... RLSKELLEAPLDVSVEVGGAVISLNDLLSLVPGDTIMLDTPCTSDLTVKVGGVPKFTGMP 60 ...

  16. ORF Alignment: NC_003450 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available EITRITEEGYIIPSSSVGNNVEWLNAAEKVILEVNSWQSEDLEGMHDIWSVPA 180 ... Query: 248 LESEVAAGRLSYDGYIMQSGVGNVPNAVMAGLLESKFE...NIQAYTEVIQDGMVDLIDAGKM 307 ... LESEVAAGRLSYDGYIMQSGVGNVPNAVMAGLLESKFENIQAY...TEVIQDGMVDLIDAGKM Sbjct: 241 LESEVAAGRLSYDGYIMQSGVGNVPNAVMAGLLESKFENIQAYTEVIQDGMVDLIDAGKM 300 ... Query: 368 GN

  17. Characterization of a Viking Blade Fabricated by Traditional Forging Techniques

    Science.gov (United States)

    Vo, H.; Frazer, D.; Bailey, N.; Traylor, R.; Austin, J.; Pringle, J.; Bickel, J.; Connick, R.; Connick, W.; Hosemann, P.

    2016-12-01

    A team of students from the University of California, Berkeley, participated in a blade-smithing competition hosted by the Minerals, Metals, and Materials Society at the TMS 2015 144th annual meeting and exhibition. Motivated by ancient forging methods, the UC Berkeley team chose to fabricate our blade from historical smithing techniques utilizing naturally-occurring deposits of iron ore. This approach resulted in receiving the "Best Example of a Traditional Blade Process/Ore Smelting Technique" award for our blade named "Berkelium." First, iron-enriched sand was collected from local beaches. Magnetite (Fe3O4) was then extracted from the sand and smelted into individual high- and low-carbon steel ingots. Layers of high- and low-carbon steels were forge-welded together, predominantly by hand, to form a composite material. Optical microscopy, energy dispersive spectroscopy, and Vickers hardness mechanical testing were conducted at different stages throughout the blade-making process to evaluate the microstructure and hardness evolution during formation. It was found that the pre-heat-treated blade microstructure was composed of ferrite and pearlite, and contained many nonmetallic inclusions. A final heat treatment was performed, which caused the average hardness of the blade edge to increase by more than a factor of two, indicating a martensitic transformation.

  18. Nuclear Chemistry Institute, Mainz University. Annual Report 1995

    International Nuclear Information System (INIS)

    Denschlag, H.O.

    1996-03-01

    The annual report of the Institut fuer Kernchemie addresses inter alia three main research activities. The first belongs to the area of basic research, covering studies in the fields of nuclear fission, chemistry of the super-heavy elements and of heavy-ion reactions extending from the Coulomb barrier to relativistic energies, and nuclear astrophysics in connection with the ''r process''. By means of laser technology, high-precision data could be measured of the ionization energies of berkelium and californium. Studies of atomic clusters in the vacuum of an ionization trap revealed interesting aspects. The second major activity was devoted to the analysis of environmental media, applying inter alia neutron activation analysis and resonance ionization mass spectroscopy (RIMS). The third activity resulted in the development of novel processes, or the enhancement of existing processes or methods, for applications in basic research work and in environmental analytics. Another item of interest is the summarizing report on the operation of the TRIGA research reactor. (orig./SR) [de

  19. The Transplutonium. The superheavy nuclei found in the micas of Madagascar and their interests

    International Nuclear Information System (INIS)

    Raoelina Andriambololona

    1976-01-01

    Since June 1976, evidence for the existence of superheavy elements is discussed about. After having recalled artificial elements with atomic numbers Z of wich go from Z=95 (Americium) to Z=107 (built in 1976), superheavy elements having Z greater than 110 are considered. They have been discovered by american searchers in giant halos seen in Madagascar micas. The samples have been recoked in the Fort-Dauphin region (Haut Mandrare). The corresponding numbers Z are 114, 115, 116, 124, 125, 125, 126, 127. It seems that the existence of Z=126 element should be accepted with a greater degree of confidence. But different experiences done by other groups seem to show the evidence of superheavy elements in micas looks weaker. Nevertheless, it is interesting to investigate the evidence or the non-evidence of those elements. We estimate the mass numbers A of those superheavy elements in the liquid drop model if we assume that they are stable versus β. The results thus obtained agree with the shell-model ones within 4 % approximation. We propose if the evidence of superheavies is confirmed to give the name of madagascarium to one of them (Z=126) by similitude with francium, lutetium, polonium, berkelium, americium, europium, ...Their evidence was first conjectured in Madagascar micas in 1976. Superheavy nuclei are to be distinguished from hypernuclei. [fr

  20. Identification of the new isotope sup 2 sup 4 sup 1 Bk

    CERN Document Server

    Asai, M; Ichikawa, S; Nagame, Y; Nishinaka, I; Akiyama, K; Toyoshima, A; Kaneko, T; Sakama, M; Haba, H; Oura, Y; Kojima, Y; Shibata, M

    2003-01-01

    A new neutron-deficient berkelium isotope sup 2 sup 4 sup 1 Bk produced in the sup 2 sup 3 sup 9 Pu( sup 6 Li, 4n) reaction has been identified using a gas-jet coupled on-line isotope separator. Cm K and L X-rays associated with the EC decay of sup 2 sup 4 sup 1 Bk were observed in the mass-241 fraction, and three gamma transitions were attributed to the EC decay of sup 2 sup 4 sup 1 Bk through X-gamma coincidences. The half-life of sup 2 sup 4 sup 1 Bk was determined to be 4.6+-0.4 min which is 1/2-1/4 of that of theoretical predictions. The half-life value and the observed gamma transitions can be consistently explained as a consequence of the allowed EC transition of pi 7/2 sup + [633] -> nu 7/2 sup + [624]. (orig.)

  1. The creation of new nuclei

    International Nuclear Information System (INIS)

    Armbruster, P.; Hessberger, F.P.

    1998-01-01

    In the last 60 years physicists have created 20 artificial elements beyond uranium. In 1934 Enrico Fermi predicted the creation of new elements by bombarding atoms with neutrons. This method led to the discovery of neptunium (Z=93), plutonium, americium, curium, berkelium, californium, einsteinium and fermium (Z=100). In fact the capture of a neutron is followed by a beta-decay which increases the atomic number (Z) by one unit. Beyond Z=100 beta-decay no more occurs so a new approach was necessary. Between the American Lawrence Berkeley Laboratory and the Russian Dubna Institute a fierce competition broke out to produce new elements by bombarding transuranium nuclei with light elements such as helium, carbon, nitrogen. This new method required heavy equipment: ion accelerator and detectors but led to the creation of all the elements from Z=101 to Z=106. A new idea was to provoke the fusion of heavy nuclei such as lead and bismuth with colliding argon, nickel or zinc ion beams. This method called 'cold fusion' opened the way to reach the nuclei beyond Z=107. In 1996 the element Z=112 was the last discovered. The next step could be the element Z=114 for which a particular stability is expected. (A.C.)

  2. Actinide metals

    Energy Technology Data Exchange (ETDEWEB)

    Brown, Paul L. [Geochem Australia, Kiama, NSW (Australia); Ekberg, Christian [Chalmers Univ. of Technology, Goeteborg (Sweden). Nuclear Chemistry/Industrial Materials Recycling

    2016-07-01

    All isotopes of actinium are radioactive and exist in aqueous solution only in the trivalent state. There have been very few studies on the hydrolytic reactions of actinium(III). The hydrolysis reactions for uranium would only be important in alkaline pH conditions. Thermodynamic parameters for the hydrolysis species of uranium(VI) and its oxide and hydroxide phases can be determined from the stability and solubility constants. The hydrolytic behaviour of neptunium(VI) is quite similar to that of uranium(VI). The solubility constant of NpO{sub 2}OH(am) has been reported a number of times for both zero ionic strength and in fixed ionic strength media. Americium can form four oxidation states in aqueous solution, namely trivalent, tetravalent, pentavalent and hexavalent. Desire, Hussonnois and Guillaumont determined stability constants for the species AmOH{sup 2+} for the actinides, plutonium(III), americium(III), curium(III), berkelium(III) and californium(III) using a solvent extraction technique.

  3. Management of nuclear materials in an R ampersand D environment at the Los Alamos National Laboratory

    International Nuclear Information System (INIS)

    Behrens, R.G.; Roth, S.B.; Jones, S.R.

    1991-01-01

    Los Alamos National Laboratory is a multidisciplinary R ampersand D organization and, as such, its nuclear materials inventory is diverse. Accordingly, major inventories of isotopes such as Pu-238, Pu-239, Pu-242, U-235, Th, tritium, and deuterium, and lesser amounts of isotopes of Am, Cm, Np and exotic isotopes such as berkelium must be managed in accordance with Department of Energy Orders and Laboratory policies. Los Alamos also acts as a national resource for many one-of-a-kind materials which are supplied to universities, industry, and other government agencies within the US and throughout the world. Management of these materials requires effective interaction and communication with many nuclear materials custodians residing in over forty technical groups as well as effective interaction with numerous outside organizations. This paper discusses the role, philosophy, and organizational structure of Nuclear Materials Management at Los Alamos and also briefly presents results of two special nuclear materials management projects: 1- Revision of Item Description Codes for use in the Los Alamos nuclear material data base and 2- The recommendation of new economic discard limits for Pu-239. 2 refs., 1 fig

  4. Extraction of transplutonium elements from carbonate solutions by alkylpyrocatechol

    International Nuclear Information System (INIS)

    Karalova, Z.K.; Myasoedov, B.F.; Rodionova, L.M.; Kuznetsova, V.S.

    1983-01-01

    Extraction of americium, berkelium as well as Ce, Eu, Th, U, Zr, Cs, Fe with solution of 4(α, α-dioctylethyl)pyrocatechol (DOP) in toluene from carbonate solutions to determine conditions of their separation has been studied. It is established that americium extraction is quite sensitive to the changes of potassium carbonate concentration. The maximum extraction of americium (R >90%) is observed in the case of 0.1-0.5 mol/l of K 2 CO 3 solutions and the minimum one (R=2.5%) - in the case of 8 mol/l K 2 CO 3 . Americium extraction increases sharply when sodium hydroxide is introduced in carbonate solutions. It is shown that varying sodium hydroxide concentration it is possible to achieve qualitative extraction of americium even from saturated solution of potassium carbonate. Reextraction of TPE is easily realized with 3 mol/l HCl solution. The system K 2 CO 3 (KOH)-DOP proved to be perspective for Am separation from Bk, Ce, Cs, actinoid elements as well as from Fe

  5. Actinide metals

    International Nuclear Information System (INIS)

    Brown, Paul L.; Ekberg, Christian

    2016-01-01

    All isotopes of actinium are radioactive and exist in aqueous solution only in the trivalent state. There have been very few studies on the hydrolytic reactions of actinium(III). The hydrolysis reactions for uranium would only be important in alkaline pH conditions. Thermodynamic parameters for the hydrolysis species of uranium(VI) and its oxide and hydroxide phases can be determined from the stability and solubility constants. The hydrolytic behaviour of neptunium(VI) is quite similar to that of uranium(VI). The solubility constant of NpO 2 OH(am) has been reported a number of times for both zero ionic strength and in fixed ionic strength media. Americium can form four oxidation states in aqueous solution, namely trivalent, tetravalent, pentavalent and hexavalent. Desire, Hussonnois and Guillaumont determined stability constants for the species AmOH 2+ for the actinides, plutonium(III), americium(III), curium(III), berkelium(III) and californium(III) using a solvent extraction technique.

  6. Paul Scherrer Institute Scientific Report 1999. Volume I: Particles and Matter

    International Nuclear Information System (INIS)

    Gobrecht, J.; Gaeggeler, H.; Herlach, D.; Junker, K.; Kettle, P.-R.; Kubik, P.; Zehnder, A.

    2000-01-01

    Although originally planned for fundamental research in nuclear physics, the particle beams of pions, muons, protons and neutrons are now used in a large variety of disciplines in both natural science and medicine. The beams at PSI have the world's highest intensities and therefore allow certain experiments to be performed, which would not be possible elsewhere. The highlight of research this year was the first-ever determination of the chemical properties of the superheavy element 107 Bohrium. This was undertaken, by an international team led by H. Gaeggeler of PSI's Laboratory for Radiochemistry. Bohrium was produced by bombarding a Berkelium target with Neon ions from the Injector I cyclotron and six atoms were detected after having passed through an online gas chromatography device. At the Laboratory for Particle Physics the focus has shifted from nuclear physics to elementary particle physics with about a fifty-fifty split between investigations of rare processes or particle decays using the high intensity muon, pion and recently also polarized neutron beams of PSI, and research at the highest energy frontier at CERN (Geneva) and DESY (Hamburg). Important space instrumentation has been contributed by the Laboratory for Astrophysics to the European Space Agency and NASA satellite programmes. The Laboratory for Micro and Nanotechnology continued to focus on research into molecular nanotechnology and SiGeC nanostructures, the latter with the aim of producing silicon based optoelectronics. Progress in 1999 in these topical areas is described in this report. A list of scientific publications in 1999 is also provided

  7. Paul Scherrer Institute Scientific Report 1999. Volume I: Particles and Matter

    Energy Technology Data Exchange (ETDEWEB)

    Gobrecht, J; Gaeggeler, H; Herlach, D; Junker, K; Kettle, P -R; Kubik, P; Zehnder, A [eds.

    2000-07-01

    lthough originally planned for fundamental research in nuclear physics, the particle beams of pions, muons, protons and neutrons are now used in a large variety of disciplines in both natural science and medicine. The beams at PSI have the world's highest intensities and therefore allow certain experiments to be performed, which would not be possible elsewhere. The highlight of research this year was the first-ever determination of the chemical properties of the superheavy element {sup 107} Bohrium. This was undertaken, by an international team led by H. Gaeggeler of PSI's Laboratory for Radiochemistry. Bohrium was produced by bombarding a Berkelium target with Neon ions from the Injector I cyclotron and six atoms were detected after having passed through an online gas chromatography device. At the Laboratory for Particle Physics the focus has shifted from nuclear physics to elementary particle physics with about a fifty-fifty split between investigations of rare processes or particle decays using the high intensity muon, pion and recently also polarized neutron beams of PSI, and research at the highest energy frontier at CERN (Geneva) and DESY (Hamburg). Important space instrumentation has been contributed by the Laboratory for Astrophysics to the European Space Agency and NASA satellite programmes. The Laboratory for Micro and Nanotechnology continued to focus on research into molecular nanotechnology and SiGeC nanostructures, the latter with the aim of producing silicon based optoelectronics. Progress in 1999 in these topical areas is described in this report. A list of scientific publications in 1999 is also provided.

  8. Investigations for the influence of geochemical parameters on the sorption and desorption of lanthanides and uranium onto opalinus clay as potential host rock for a repository

    International Nuclear Information System (INIS)

    Moeser, Christina

    2010-01-01

    The development of a disposal in deep geological formations for radioactive waste is a very important task for the future. The safety assessment for more than a hundred thousand years needs a full understanding of all processes of interaction between the radioactive waste and the surrounded formations. This work contributes to this understanding. The interaction between lanthanides (homologues of the actinides americium, curium and berkelium) / uranium and the host rock opalinus clay under influence of organic substances (NOM) have been analyzed and discussed. The complex system was split into 3 binary basic systems with the following interactions - Interactions between lanthanides / uranium and NOM - Interactions between lanthanides / uranium and the opalinus clay - Interactions between NOM and opalinus clay All binary systems can be influenced by geological parameters like pH, ion strength and competing cations. The sorption / desorption of the lanthanides onto the opalinus clay is analyzed via inductively coupled plasma mass spectrometry. For the investigation of the complexation behavior of metals with NOM we used capillary electrophoresis coupled with inductively coupled plasma mass spectrometry. Under these conditions the chosen model organic humic acid affected the sorption of the lanthanides onto opalinus clay favorably. The smaller organic compounds, which dominate in the composition of the clay organics, remobilized the metals after sorption onto clay and the sorption can be inhibited by NOM. Due to the reduced metal sorption onto Opalinus clay by NOM, a migration through the clay may be possible.

  9. Fluorescence and excitation spectra of Bk3+, Cf3+, and Es3+ ions in single crystals of LaCl3

    International Nuclear Information System (INIS)

    Hessler, J.P.; Caird, J.A.; Carnall, W.T.; Crosswhite, H.M.; Sjoblom, R.K.; Wagner, F. Jr.

    1978-01-01

    Dye laser techniques have been used to study the energy level structure of the heavier actinides in single crystals of lanthanum chloride. In the case of einsteinium, fluorescence was detected and measured from the following manifolds: J = 5 at 0.984 μm -1 , J = 4 at 1.572 μm -1 , J = 6 at 2.930 μm -1 . This fluorescence was observed to the five lowest manifolds: J = 8, 5, 7, 2, 6. For californium, fluorescence has been detected from the manifolds: J = 11/2 at 1.190 μm -1 , J = 7/2 at 1.389 μm -1 , J = 5/2 at 1.977 μm -1 . This fluorescence was observed to the three lowest manifolds: J = 15/2, 9/2, 11/2. The fluorescence manifolds of berkelium are J = 6 at 1.540 μm -1 , and J = 4 at 1.953 μm -1 . The three lowest manifolds, J = 6, 5, and 4, have been observed in fluorescence. Absorption spectra data have yielded crystal-field splitting measurements in the higher manifolds of Es + . The location of the manifolds in general confirmed earlier approximate free-ion level structure calculations based on assumed regularities in the energy level parameters derived from spectra of the actinide ions through Cf + . 2 figures

  10. Fulltext PDF

    Indian Academy of Sciences (India)

    Srimath

    236 The Central Dogma of Molecular Biology. A Retrospective after Fifty Years. Michel Morange. 248 Chemistry is Evergreen... 2008 Nobel Prize in Chemistry. Swagata Dasgupta. 248. 226. Page 2. 215. RESONANCE | March 2009. DEPARTMENTS. Editorial. Biman Nath. Hubble Space Telescope, launched in 1991.

  11. Citral derived amides as potent bacterial NorA efflux pump inhibitors

    DEFF Research Database (Denmark)

    Thota, Niranjan; Koul, Surrinder; Reddy, Mallepally V

    2008-01-01

    Monoterpene citral and citronellal have been used as starting material for the preparation of 5,9-dimethyl-deca-2,4,8-trienoic acid amides and 9-formyl-5-methyl-deca-2,4,8-trienoic acid amides. The amides on bioevaluation as efflux pump inhibitors (EPIs) against Staphylococcus aureus 1199 and NorA...

  12. 17 CFR Appendix B to Subpart A of... - Sample Clauses

    Science.gov (United States)

    2010-04-01

    ... Information Pt. 248, Subpt. A, App. B Appendix B to Subpart A of Part 248—Sample Clauses Link to an amendment..., such as “call the following toll-free number: (insert number)”]. A-7—Confidentiality and Security (All...

  13. [Molecular pathogenesis of Waardenburg syndrome type II resulting from SOX10 gene mutation].

    Science.gov (United States)

    Zhang, Hua; Chen, Hongsheng; Feng, Yong; Qian, Minfei; Li, Jiping; Liu, Jun; Zhang, Chun

    2016-08-01

    To explore the molecular mechanism of Waardenburg syndrome type II (WS2) resulting from SOX10 gene mutation E248fs through in vitro experiment. 293T cells were transiently transfected with wild type (WT) SOX10 and mutant type (MT) E248fs plasmids. The regulatory effect of WT/MT SOX10 on the transcriptional activity of MITF gene and influence of E248fs on WT SOX10 function were determined with a luciferase activity assay. The DNA binding capacity of the WT/MT SOX10 with the promoter of the MITF gene was determined with a biotinylated double-stranded oligonucleotide probe containing the SOX10 binding sequence cattgtc to precipitate MITF and E248fs, respectively. The stability of SOX10 and E248fs were also analyzed. As a loss-of-function mutation, the E248fs mutant failed to transactivate the MITF promoter as compared with the WT SOX10 (P<0.01), which also showed a dominant-negative effect on WT SOX10. The WT SOX10 and E248fs mutant were also able to bind specifically to the cattgtc motif in the MITF promoter, whereas E248fs had degraded faster than WT SOX10. Despite the fact that the E248fs has a dominant-negative effect on SOX10, its reduced stability may down-regulate the transcription of MITF and decrease the synthesis of melanin, which may result in haploinsufficiency of SOX10 protein and cause the milder WS2 phenotype.

  14. Dollar Summary of Prime Contract Awards by Contractor, State or Country, and Place, FY83, Part 2 (Gillespie Delorenzo Asla & Assocs-Planning Analysis Corp).

    Science.gov (United States)

    1983-01-01

    BURLINGTON MASS 85 85 85 85 N L AVIATION LTD UN KINGDOM 2,558 273 2,285 2,556 273 2,285 M L ENERGIA INC PRINCETON NEW JERSEY 28 28 28 28 M M L...155 155 PIPE INC PORTSMOUTH VIRGINIA 588 588 743 743 PIPE INSTALLATION CORP ATCO ILw jE6EY 42 42 42 42 PIPELINE RENOVATION SERVICE INC FORT BRAGG NCAR...107 107 PIPELINE RENOVATION SERVICE INC LANGLEY AFB VIRGINIA 205 161 44 PIPELINE RENOVATION SERVICE INC NORFOLK VIRGINIA 248 248 560 268 248 44

  15. Level structures of neutron-rich Xe isotopes

    Energy Technology Data Exchange (ETDEWEB)

    Ahmad, I.; Lister, C.J.; Morss, L.R. [and others

    1995-08-01

    The level structures of neutron-rich Xe isotopes were determined by observing prompt gamma-ray coincidences in {sup 248}Cm fission fragments. A 5-mg {sup 248}Cm, in the form of {sup 248}Cm-KCl pellet, was placed inside Eurogam array which consisted of 45 Compton-suppressed Ge detectors and 5 Low-Energy Photon Spectrometers. Transitions in Xe isotopes were identified by the appearance of new peaks in the {gamma}-ray spectra obtained by gating on the gamma peaks of the complementary Mo fragments.

  16. Two-quasineutron states in 98248Cf and 98250Cf and the neutron-neutron residual interactions

    International Nuclear Information System (INIS)

    Katori, K.; Ahmad, I.; Friedman, A. M.

    2008-01-01

    Two-quasineutron states in 248 Cf and 250 Cf were investigated by single-neutron transfer reactions, 249 Cf(d,t) 248 Cf and 249 Cf(d,p) 250 Cf. The majority of levels observed were assigned to 12 bands in 248 Cf and six bands in 250 Cf, constructed from the single-particle states in neighboring Cf nuclei. The effective two-body interactions between two odd neutrons coupled outside a deformed core were deduced from the differences in the energies of the bandheads formed by the parallel and antiparallel coupling of the intrinsic spins of the two single-particle states

  17. Radiochemical studies of neutron deficient actinide isotopes

    International Nuclear Information System (INIS)

    Williams, K.E.

    1978-04-01

    The production of neutron deficient actinide isotopes in heavy ion reactions was studied using alpha, gamma, x-ray, and spontaneous fission detection systems. A new isotope of berkelium, 242 Bk, was produced with a cross-section of approximately 10 μb in reactions of boron on uranium and nitrogen on thorium. It decays by electron capture with a half-life of 7.0 +- 1.3 minutes. The alpha-branching ratio for this isotope is less than 1% and the spontaneous fission ratio is less than 0.03%. Studies of (Heavy Ion, pxn) and (Heavy Ion, αxn) transfer reactions in comparison with (Heavy ion, xn) compound nucleus reactions revealed transfer reaction cross-sections equal to or greater than the compound nucleus yields. The data show that in some cases the yield of an isotope produced via a (H.I.,pxn) or (H.I.,αxn) reaction may be higher than its production via an xn compound nucleus reaction. These results have dire consequences for proponents of the ''Z 1 + Z 2 = Z/sub 1+2/'' philosophy. It is no longer acceptable to assume that (H.I.,pxn) and (H.I.,αxn) product yields are of no consequence when studying compound nucleus reactions. No evidence for spontaneous fission decay of 228 Pu, 230 Pu, 232 Cm, or 238 Cf was observed indicating that strictly empirical extrapolations of spontaneous fission half-life data is inadequate for predictions of half-lives for unknown neutron deficient actinide isotopes

  18. Radiochemical studies of neutron deficient actinide isotopes

    Energy Technology Data Exchange (ETDEWEB)

    Williams, K.E.

    1978-04-01

    The production of neutron deficient actinide isotopes in heavy ion reactions was studied using alpha, gamma, x-ray, and spontaneous fission detection systems. A new isotope of berkelium, /sup 242/Bk, was produced with a cross-section of approximately 10 ..mu..b in reactions of boron on uranium and nitrogen on thorium. It decays by electron capture with a half-life of 7.0 +- 1.3 minutes. The alpha-branching ratio for this isotope is less than 1% and the spontaneous fission ratio is less than 0.03%. Studies of (Heavy Ion, pxn) and (Heavy Ion, ..cap alpha..xn) transfer reactions in comparison with (Heavy ion, xn) compound nucleus reactions revealed transfer reaction cross-sections equal to or greater than the compound nucleus yields. The data show that in some cases the yield of an isotope produced via a (H.I.,pxn) or (H.I.,..cap alpha..xn) reaction may be higher than its production via an xn compound nucleus reaction. These results have dire consequences for proponents of the ''Z/sub 1/ + Z/sub 2/ = Z/sub 1+2/'' philosophy. It is no longer acceptable to assume that (H.I.,pxn) and (H.I.,..cap alpha..xn) product yields are of no consequence when studying compound nucleus reactions. No evidence for spontaneous fission decay of /sup 228/Pu, /sup 230/Pu, /sup 232/Cm, or /sup 238/Cf was observed indicating that strictly empirical extrapolations of spontaneous fission half-life data is inadequate for predictions of half-lives for unknown neutron deficient actinide isotopes.

  19. Paul Scherrer Institute Scientific Report 1999. Volume I: Particles and Matter

    Energy Technology Data Exchange (ETDEWEB)

    Gobrecht, J.; Gaeggeler, H.; Herlach, D.; Junker, K.; Kettle, P.-R.; Kubik, P.; Zehnder, A. [eds.

    2000-07-01

    lthough originally planned for fundamental research in nuclear physics, the particle beams of pions, muons, protons and neutrons are now used in a large variety of disciplines in both natural science and medicine. The beams at PSI have the world's highest intensities and therefore allow certain experiments to be performed, which would not be possible elsewhere. The highlight of research this year was the first-ever determination of the chemical properties of the superheavy element {sup 107} Bohrium. This was undertaken, by an international team led by H. Gaeggeler of PSI's Laboratory for Radiochemistry. Bohrium was produced by bombarding a Berkelium target with Neon ions from the Injector I cyclotron and six atoms were detected after having passed through an online gas chromatography device. At the Laboratory for Particle Physics the focus has shifted from nuclear physics to elementary particle physics with about a fifty-fifty split between investigations of rare processes or particle decays using the high intensity muon, pion and recently also polarized neutron beams of PSI, and research at the highest energy frontier at CERN (Geneva) and DESY (Hamburg). Important space instrumentation has been contributed by the Laboratory for Astrophysics to the European Space Agency and NASA satellite programmes. The Laboratory for Micro and Nanotechnology continued to focus on research into molecular nanotechnology and SiGeC nanostructures, the latter with the aim of producing silicon based optoelectronics. Progress in 1999 in these topical areas is described in this report. A list of scientific publications in 1999 is also provided.

  20. Minor Actinides Recycling in PWRs

    International Nuclear Information System (INIS)

    Delpech, M.; Golfier, H.; Vasile, A.; Varaine, F.; Boucher, L.; Greneche, D.

    2006-01-01

    Recycling of minor actinides in current and near future PWR is considered as one of the options of the general waste management strategy. This paper presents the analysis of this option both from the core physics and fuel cycle point of view. A first indicator of the efficiency of different neutron spectra for transmutation purposes is the capture to fission cross sections ratio which is less favourable by a factor between 5 to 10 in PWRs compared to fast reactors. Another indicator presented is the production of high ranking isotopes like Curium, Berkelium or Californium in the thermal or epithermal spectrum conditions of PWR cores by successive neutron captures. The impact of the accumulation of this elements on the fabrication process of such PWR fuels strongly penalizes this option. The main constraint on minor actinides loadings in PWR (or fast reactors) fuels are related to their direct impact (or the impact of their transmutation products) on the reactivity coefficients, the reactivity control means and the core kinetics parameters. The main fuel cycle physical parameters like the neutron source, the alpha decay power, the gamma and neutrons dose rate and the criticality aspects are also affected. Recent neutronic calculations based on a reference core of the Evolutionary Pressurized Reactor (EPR), indicates typical maximum values of 1 % loadings. Different fuel design options for minor actinides transmutation purposes in PWRs are presented: UOX and MOX, homogeneous and heterogeneous assemblies. In this later case, Americium loading is concentrated in specific pins of a standard UOX assembly. Recycling of Neptunium in UOX and MOX fuels was also studied to improve the proliferation resistance of the fuel. The impact on the core physics and penalties on Uranium enrichment were underlined in this case. (authors)

  1. Přijetí Úmluvy OSN proti nadnárodnímu organizovanému zločinu

    Czech Academy of Sciences Publication Activity Database

    Šturma, Pavel

    2001-01-01

    Roč. 9, č. 5 (2001), s. 241-248 ISSN 1210-6410 Institutional research plan: CEZ:AV0Z7068917 Keywords : organized crime * scientific conference * Convention against supranational organized crime Subject RIV: AG - Legal Sciences

  2. A Review of Nature and Antiquities: The Making of Archaeology in the Americas

    Directory of Open Access Journals (Sweden)

    Tim Murray

    2016-02-01

    Full Text Available A review of Nature and Antiquities: The Making of Archaeology in the Americas, by Philip Kohl, Irina Podgorny and Stefanie Gänger (Eds., Tucson: University of Arizona Press, 248 pages, $60 US, 2014, ISBN: 9780816531127

  3. Antagonistic effects of three species of Trichoderma sp. on ...

    African Journals Online (AJOL)

    Francis

    This research was funded by a grant (Project No. 247) from National ... quantities of protein utilizing the principle of protein-dye binding, Analytical Biochemistry 72, 248-254. ... Innovative approaches to plant disease control. John Wiley &.

  4. Animal Production Research Advances - Vol 5, No 4 (2009)

    African Journals Online (AJOL)

    Carcass Characteristics and Economics of Broiler Chickens Fed Different Levels of Grasshopper Meal in Place of Fish Meal · EMAIL FULL TEXT EMAIL FULL TEXT DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. MA Muftau, BR Olorede, 248-251 ...

  5. Immunomodulatory Activity of Alcohol Extract of Terminalia chebula ...

    African Journals Online (AJOL)

    Erah

    2011-01-02

    Jan 2, 2011 ... Purpose: To investigate the immunomodulatory activity of the alcohol extract of Terminalia chebula Retz. (Combretaceae) ..... indicates a higher secretion of melatonin. (Mol. Wt. 248 ... especially the immune, nervous, and.

  6. Nanoantenna using mechanical resonance

    KAUST Repository

    Chang Hwa Lee,; Seok Woo Lee,; Lee, Seung S

    2010-01-01

    nanorod array. The modulated signals are received successfully with the transmission carrier wave frequency (248MHz) and the proposed nanoantenna is expected to be used in communication system for ultra small scale sensor. ©2010 IEEE.

  7. Latein als Sprache der mittelalterlichen Schriften über Wettervorhersage

    Czech Academy of Sciences Publication Activity Database

    Kocánová, Barbora

    -, č. 71 (2013), s. 237-248 ISSN 1376-7453 R&D Projects: GA MŠk(CZ) LD13043 Institutional support: RVO:67985955 Keywords : medieval weather forecasting * medieval Latin * medieval manuscripts Subject RIV: AI - Linguistics

  8. Serological evidence of exposure to globally relevant zoonotic parasites in the Estonian population

    DEFF Research Database (Denmark)

    Lassen, Brian; Janson, Marilin; Viltrop, Arvo

    2016-01-01

    We investigated Estonian population and its selected subgroups for serological evidence of exposure to Ascaris lumbricoides, Echinococcus spp., Taenia solium, Toxocara canis, Toxoplasma gondii, and Trichinella spiralis. Serum samples from 999 adults representing general population, 248 children a...

  9. Ichnology of the Early Cambrian Tal Group, Mussoorie Syncline ...

    Indian Academy of Sciences (India)

    Wadia Institute of Himalayan Geology, 33, General Mahadeo Singh Road, Dehradun 248 001, India. ∗ ... Mussoorie Syncline, being one of the five synclines, exposes the Cambrian ... Belt of Lesser Himalaya is represented by the Tal. Group.

  10. South African Medical Journal - Vol 83, No 4 (1993)

    African Journals Online (AJOL)

    Indications for colonoscopy An analysis based on indications and diagnostic yield · EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. I. Berkowitz, M. Kaplan, 245-248 ...

  11. Gupta, Prof. Santosh Kumar

    Indian Academy of Sciences (India)

    objective Evolutionary Algorithm and Experimental Online Optimal Control Address: Distinguished Professor, Department of Chemical Engineering, University of Petroleum & Energy Studies, Energy Acres, PO Bidholi, Dehra Dun 248 007, ...

  12. 76 FR 56724 - Proposed Flood Elevation Determinations

    Science.gov (United States)

    2011-09-14

    ... Town of Clarkstown. Hackensack River confluence. At the upstream side of +248 +247 Little Tor Road... Emergency Management Agency. [FR Doc. 2011-23413 Filed 9-13-11; 8:45 am] BILLING CODE 9110-12-P ...

  13. Comparison of diatom community structure from epilithon and fish guts: implications for inferring past changes in water quality

    Czech Academy of Sciences Publication Activity Database

    Bešta, T.; Muška, Milan; Juggins, S.; Těšitel, J.

    2015-01-01

    Roč. 742, č. 1 (2015), s. 233-248 ISSN 0018-8158 Institutional support: RVO:60077344 Keywords : diatoms * fish * palaeolimnology * aquatic quality * eutrophication Subject RIV: DA - Hydrology ; Limnology Impact factor: 2.051, year: 2015

  14. Global patterns of interaction specialization in bird-flower networks

    Czech Academy of Sciences Publication Activity Database

    Zanata, T. B.; Dalsgaard, B.; Passos, F. C.; Cotton, P. A.; Roper, J. J.; Maruyama, P.K.; Fischer, E.; Schleuning, M.; Gonzalez, A. M. M.; Vizentin-Bugoni, J.; Franklin, D. C.; Abrahamczyk, S.; Alarcon, R.; Araujo, A. C.; Araujo, F. P.; de Azevedo-Junior, S. M.; Baquero, A. C.; Boehning-Gaese, K.; Carstensen, D. W.; Chupil, H.; Coelho, A. G.; Faria, R. R.; Hořák, D.; Ingversen, Tanja T.; Janeček, Štěpán; Kohler, G.; Lara, C.; Las-Casas, F. M. G.; Lopes, A. V.; Machado, A. O.; Machado, C. G.; Machado, Isabel C.; Maglianesi, M. A.; Malucelli, T. S.; Mohd-Azlan, J.; Moura, A. C.; Oliveira, G. M.; Oliveira, P. E.; Ornelas, J. F.; Riegert, J.; Rodrigues, L. C.; Rosero-Lasprilla, L.; Rui, A. M.; Sazima, M.; Schmid, B.; Sedláček, O.; Timmermann, A.; Vollstädt, M. G. R.; Wang, Z.; Watts, S.; Rahbek, C.; Varassin, I. G.

    2017-01-01

    Roč. 44, č. 8 (2017), s. 1891-1910 ISSN 0305-0270 Institutional support: RVO:67985939 Keywords : honeyeaters * hummingbirds * modularity Subject RIV: EH - Ecology, Behaviour OBOR OECD: Ecology Impact factor: 4.248, year: 2016

  15. Tagasi Pariisis / Karl Rumor

    Index Scriptorium Estoniae

    Rumor, Karl, pseud., 1886-1971

    2008-01-01

    Prantsusmaa sisepoliitilisest olustikust. Poliitilistest oludest 1937. aasta Euroopas, sõjameeleoludest Vahemerel, Nyloni konverentsist. Varem ilmunud: Uus Eesti 21. juuni 1937, nr. 166; 8., 13. sept. 1937, nr. 243, 248

  16. Disease: H01868 [KEGG MEDICUS

    Lifescience Database Archive (English)

    Full Text Available I34.1 Q24.8 MeSH: D008945 C535576 OMIM: 607829 314400 PMID:24867995 (description) ... AUTHORS ... Delling FN, Vasan RS ... TITLE ... Epidem...iology and pathophysiology of mitral valve prolapse: new

  17. Sand and clay mineralogy of sal forest soils of the Doon Siwalik ...

    Indian Academy of Sciences (India)

    3Forest Soil & Land Reclamation Division, Forest Research Institute, Dehradun 248 006, India. ∗ e-mail: ... understanding the distribution of forest types and ... Material and methods. 2.1 Study area .... Finally, for the qualitative and quan-.

  18. Review: Lorenzo Cotula, The Great African Land Grab?: Agricultural Investments and the Global Food System (2013

    Directory of Open Access Journals (Sweden)

    Kerstin Nolte

    2013-01-01

    Full Text Available Review of the monograph:Lorenzo Cotula, The Great African Land Grab?: Agricultural Investments and the Global Food System, London, New York: Zed Books, 2013, ISBN 9781780324203, 248 pages

  19. The Molecular Epidemiology of Malaria in Western Kenya

    National Research Council Canada - National Science Library

    Amon, Joseph

    2002-01-01

    ...) Plasmodium falciparum growth dynamics. The first two research topics were examined in a cohort of 248 males recruited from three highly endemic villages in western Kenya where severe malaria anemia is common...

  20. Zoning Districts - Volusia County HUB Zones

    Data.gov (United States)

    NSGIC Local Govt | GIS Inventory — Historically Underutilized Business (HUB) Zones in Volusia County. Go to http://www.sba.gov/hubzone or contact the Department of Economic Development (386) 248-8048...

  1. Study of fusion and nucleon transfer channels in the Au-197 + He-6 reaction in an energy range of He-6 to 20 Mev/A

    Czech Academy of Sciences Publication Activity Database

    Skobelev, N. K.; Penionzhkevich, Y. E.; Kulko, A. A.; Demekhina, N. A.; Kroha, Václav; Kugler, Andrej; Lukyanov, S.; Mrázek, Jaromír; Sobolev, Yu. G.; Maslov, V. A.; Muzychka, Yu. A.; Voskoboynik, E. I.; Fomichev, A. S.

    2013-01-01

    Roč. 10, č. 3 (2013), s. 248-255 ISSN 1547-4771 Institutional support: RVO:61389005 Keywords : nuclear reactions * gamma activity * cross section Subject RIV: BG - Nuclear, Atomic and Molecular Physics, Colliders

  2. Carotenoid-protein interaction alters the S1 energy of hydroxyechinenone in the Orange Carotenoid Protein

    Czech Academy of Sciences Publication Activity Database

    Polívka, Tomáš; Chábera, P.; Kerfeld, C.A.

    2013-01-01

    Roč. 1827, č. 3 (2013), s. 248-254 ISSN 0005-2728 Institutional support: RVO:60077344 Keywords : orange-carotenoid protein * excited states * photoprotection Subject RIV: BO - Biophysics Impact factor: 4.829, year: 2013

  3. Optimal Mirrleesean taxation in a Ben-Porath economy

    Czech Academy of Sciences Publication Activity Database

    Kapička, Marek

    2015-01-01

    Roč. 7, č. 2 (2015), s. 219-248 ISSN 1945-7707 Institutional support: RVO:67985998 Keywords : optimal tax es * unobservable human capital * income tax es Subject RIV: AH - Economics Impact factor: 2.567, year: 2015

  4. Acute ischemic stroke prognostication, comparison between ...

    African Journals Online (AJOL)

    Ossama Y. Mansour

    2014-11-20

    Nov 20, 2014 ... patients with acute ischemic stroke in comparison with the NIHSS and the GCS. Methods: .... All patients received a CT scan of the brain on admission. Diagnostic ... adjusted for age, sex, Charlson Index and Oxfordshire. 248.

  5. Feature Selection and Classifier Development for Radio Frequency Device Identification

    Science.gov (United States)

    2015-12-01

    248 Table C-5: p-values vs Test Statistic for Wine Quality. ................................................. 248 Table C-6...p-values vs Test Statistic for Wisconsin Breast Cancer. .............................. 249 Table C-7: p-values vs Test Statistic for Wine ...electronic devices, such as RF-DNA. A brief review of the various approaches is considered to illustrate the benefits of the RF-DNA approach. 40

  6. Photodissociation of ethylbenzene and n-propylbenzene in a molecular beam

    Science.gov (United States)

    Huang, Cheng-Liang; Jiang, Jyh-Chiang; Lee, Yuan T.; Ni, Chi-Kung

    2002-10-01

    The photodissociation of jet-cooled ethylbenzene and n-propylbenzene at both 193 and 248 nm was studied using vacuum ultraviolet photoionization/multimass ion imaging techniques. The photofragment translational energy distributions from both the molecules obtained at 193 nm show that the probability of portioning energy to product translational energy decreases monotonically with increasing translational energy. They indicate that the dissociation occurs from the ground electronic state. However, the photofragment translational energy distributions from both molecules obtained at 248 nm contain a fast and a slow component. 75% of ethylbenzene and 80% of n-propylbenzene following the 248 nm photoexcitation dissociate from electronic excited state, resulting in the fast component. The remaining 25% of ethylbenzene and 20% of n-propylbenzene dissociate through the ground electronic state, giving rise to the slow component. A comparison with an ab initio calculation suggests that the dissociation from the first triplet state corresponds to the fast component in translational energy distribution.

  7. Ultraviolet-laser ablation of skin

    Energy Technology Data Exchange (ETDEWEB)

    Lane, R.J.; Linsker, R.; Wynne, J.J.; Torres, A.; Geronemus, R.G.

    1985-05-01

    The authors report on the use of pulsed ultraviolet-laser irradiation at 193 nm from an argon-fluoride laser and at 248 nm from a krypton-fluoride laser to ablate skin. In vitro, both wavelengths performed comparably, removing tissue precisely and cleanly, and leaving minimal thermal damage to the surrounding tissue. In vivo, the 193-nm laser radiation failed to remove tissue after bleeding began. The 248-nm radiation, however, continued to remove tissue despite bleeding and left a clean incision with only minimal thermal damage. The krypton-fluoride excimer laser beam at 248 nm, which should be deliverable through a quartz optical fiber, has great potential as a surgical instrument.

  8. Increased level of acute phase reactants in patients infected with modern Mycobacterium tuberculosis genotypes in Mwanza, Tanzania

    DEFF Research Database (Denmark)

    Stavrum, Ruth; PrayGod, George; Range, Nyagosya

    2014-01-01

    a distinct genetic ancestry. This study describes the genetic biodiversity of M. tuberculosis genotypes in Mwanza city, Tanzania and the clinical presentation of the disease caused by isolates of different lineages. METHODS: Two-hundred-fifty-two isolates from pulmonary TB patients in Mwanza, Tanzania were......BACKGROUND: There is increasing evidence to suggest that different Mycobacterium tuberculosis lineages cause variations in the clinical presentation of tuberculosis (TB). Certain M. tuberculosis genotypes/lineages have been shown to be more likely to cause active TB in human populations from....... tuberculosis lineage of the infectious agent for each patient. RESULTS: The most frequent genotype was ST59 (48 out of 248 [19.4%]), belonging to the Euro-American lineage LAM11_ZWE, followed by ST21 (CAS_KILI lineage [44 out of 248 [17.7%]). A low degree of diversity (15.7% [39 different ST's out of 248...

  9. Self assembly and properties of C:WO3 nano-platelets and C:VO2/V2O5 triangular capsules produced by laser solution photolysis

    CSIR Research Space (South Africa)

    Mwakikunga, BW

    2010-01-01

    Full Text Available -Structured Materials, P. O. Box 395, Pretoria, South Africa 123 Nanoscale Res Lett (2010) 5:389–397 DOI 10.1007/s11671-009-9494-4 coherent, intense and almost monochromatic laser light allows it to be tuned to selectively dissociate specific bonds in a precursor... in the current set of experiments. 390 Nanoscale Res Lett (2010) 5:389–397 123 2WðO � C2H5Þ6��! 248nm CxWO3�y þ . . . 2VðO � C2H5Þ4��! 248nm CxVO2þy þ . . . ð3Þ When the same precursors are irradiated with the 248-nm beam from the KrF excimer laser, the W(OR)6...

  10. Settlement induction of Acropora palmata planulae by a GLW-amide neuropeptide

    Science.gov (United States)

    Erwin, P. M.; Szmant, A. M.

    2010-12-01

    Complex environmental cues dictate the settlement of coral planulae in situ; however, simple artificial cues may be all that is required to induce settlement of ex situ larval cultures for reef re-seeding and restoration projects. Neuropeptides that transmit settlement signals and initiate the metamorphic cascade have been isolated from hydrozoan taxa and shown to induce metamorphosis of reef-building Acropora spp. in the Indo-Pacific, providing a reliable and efficient settlement cue. Here, the metamorphic activity of six GLW-amide cnidarian neuropeptides was tested on larvae of the Caribbean corals Acropora palmata, Montastraea faveolata and Favia fragum. A. palmata planulae were induced to settle by the exogenous application of the neuropeptide Hym-248 (concentrations ≥1 × 10-6 M), achieving 40-80% attachment and 100% metamorphosis of competent planulae (≥6 days post-fertilization) during two spawning seasons; the remaining neuropeptides exhibited no activity. Hym-248 exposure rapidly altered larval swimming behavior (96% metamorphosis after 6 h. In contrast , M. faveolata and F. fragum planulae did not respond to any GLW-amides tested, suggesting a high specificity of neuropeptide activators on lower taxonomic scales in corals. Subsequent experiments for A. palmata revealed that (1) the presence of a biofilm did not enhance attachment efficiency when coupled with Hym-248 treatment, (2) neuropeptide-induced settlement had no negative effects on early life-history developmental processes: zooxanthellae acquisition and skeletal secretion occurred within 12 days, colonial growth occurred within 36 days, and (3) Hym-248 solutions maintained metamorphic activity following storage at room temperature (10 days), indicating its utility in remote field settings. These results corroborate previous studies on Indo-Pacific Acropora spp. and extend the known metamorphic activity of Hym-248 to Caribbean acroporids. Hym-248 allows for directed and reliable settlement of

  11. Erythrobacter pelagi sp. nov., a member of the family Erythrobacteraceae isolated from the Red Sea

    KAUST Repository

    Wu, H.-x.

    2011-08-05

    A novel Gram-negative, aerobic, catalase- and oxidase-positive, non-sporulating, non-motile, rod-shaped bacterium, designated strain UST081027-248(T), was isolated from seawater of the Red Sea. Phylogenetic analysis based on 16S rRNA gene sequences showed that strain UST081027-248(T) fell within the genus Erythrobacter. Levels of 16S rRNA gene sequence similarity between the novel strain and the type strains of Erythrobacter species ranged from 95.3% (with Erythrobacter gangjinensis) to 98.2% (with Erythrobacter citreus). However, levels of DNA-DNA relatedness between strain UST081027-248(T) and the type strains of closely related species were below 70%. Optimal growth of the isolate occurred in the presence of 2.0% NaCl, at pH 8.0-9.0 and at 28-36 degrees C. The isolate did not produce bacteriochlorophyll a. The predominant cellular fatty acids were C-17:1 omega 6c, summed feature 8 (C-18:1 omega 6c and/or C-18:1 omega 7c) and C-15:0 2-OH. The genomic DNA G+C content of strain UST081027-248(T) was 60.4 mol%. Phenotypic properties and phylogenetic distinctiveness clearly indicated that strain UST081027-248(T) represents a novel species of the genus Erythrobacter, for which the name Erythrobacter pelagi sp. nov. is proposed. The type strain is UST081027-248(T) (=JCM 17468(T)=NRRL 59511(T)).

  12. Tracing Method with Intra and Inter Protocols Correlation

    Directory of Open Access Journals (Sweden)

    Marin Mangri

    2009-05-01

    Full Text Available MEGACO or H.248 is a protocol enabling acentralized Softswitch (or MGC to control MGsbetween Voice over Packet (VoP networks andtraditional ones. To analyze much deeper the realimplementations it is useful to use a tracing systemwith intra and inter protocols correlation. For thisreason in the case of MEGACO-H.248 it is necessaryto find the appropriate method of correlation with allprotocols involved. Starting from Rel4 a separation ofCP (Control Plane and UP (User Plane managementwithin the networks appears. MEGACO protocol playsan important role in the migration to the new releasesor from monolithic platform to a network withdistributed components.

  13. Bragg Grating Inscription With Low Pulse Energy in Doped Microstructured Polymer Optical Fibers

    DEFF Research Database (Denmark)

    Min, Rui; Ortega, Beatriz; Nielsen, Kristian

    2018-01-01

    in the POFs without high pulse energy (mJ level) at 248-nm wavelength, which reduces maintenance costs. Furthermore, we can consider it as a solution to increase the lifetime of the laser system without high energy still allowing fast and efficient production of the FBGs for sensing applications.......We demonstrate that fiber Bragg gratings (FBGs) can be written in a doped polymer optical fiber (POF) in a low ultraviolet (UV) pulse energy regime (60Jpulse) using a 248-nm krypton fluoride excimer laser system. The total energy density per inscription necessary to obtain Bragg gratings is between...

  14. Magnetic susceptibility of curium pnictides

    International Nuclear Information System (INIS)

    Nave, S.E.; Huray, P.G.; Peterson, J.R.; Damien, D.A.; Haire, R.G.

    1981-09-01

    The magnetic susceptibility of microgram quantities of 248 CmP and 248 CmSb has been determined with the use of a SQUID micromagnetic susceptometer over the temperature range 4.2 to 340 K and in the applied magnetic field range of 0.45 to 1600 G. The fcc (NaCl-type) samples yield magnetic transitions at 73K and 162 K for the phosphide and antimonide, respectively. Together with published magnetic data for CmN and CmAs, these results indicate spatially extended exchange interactions between the relatively localized 5f electrons of the metallic actinide atoms

  15. Structure and Recognition of a Novel HIV-1 gp120-gp41 Interface Antibody that Caused MPER Exposure through Viral Escape

    Energy Technology Data Exchange (ETDEWEB)

    Wibmer, Constantinos Kurt; Gorman, Jason; Ozorowski, Gabriel; Bhiman, Jinal N.; Sheward, Daniel J.; Elliott, Debra H.; Rouelle, Julie; Smira, Ashley; Joyce, M. Gordon; Ndabambi, Nonkululeko; Druz, Aliaksandr; Asokan, Mangai; Burton, Dennis R.; Connors, Mark; Abdool Karim, Salim S.; Mascola, John R.; Robinson, James E.; Ward, Andrew B.; Williamson, Carolyn; Kwong, Peter D.; Morris, Lynn; Moore, Penny L.; Desrosiers, Ronald C.

    2017-01-11

    A comprehensive understanding of the regions on HIV-1 envelope trimers targeted by broadly neutralizing antibodies may contribute to rational design of an HIV-1 vaccine. We previously identified a participant in the CAPRISA cohort, CAP248, who developed trimer-specific antibodies capable of neutralizing 60% of heterologous viruses at three years post-infection. Here, we report the isolation by B cell culture of monoclonal antibody CAP248-2B, which targets a novel membrane proximal epitope including elements of gp120 and gp41. Despite low maximum inhibition plateaus, often below 50% inhibitory concentrations, the breadth of CAP248-2B significantly correlated with donor plasma. Site-directed mutagenesis, X-ray crystallography, and negative-stain electron microscopy 3D reconstructions revealed how CAP248-2B recognizes a cleavage-dependent epitope that includes the gp120 C terminus. While this epitope is distinct, it overlapped in parts of gp41 with the epitopes of broadly neutralizing antibodies PGT151, VRC34, 35O22, 3BC315, and 10E8. CAP248-2B has a conformationally variable paratope with an unusually long 19 amino acid light chain third complementarity determining region. Two phenylalanines at the loop apex were predicted by docking and mutagenesis data to interact with the viral membrane. Neutralization by CAP248-2B is not dependent on any single glycan proximal to its epitope, and low neutralization plateaus could not be completely explained by N- or O-linked glycosylation pathway inhibitors, furin co-transfection, or pre-incubation with soluble CD4. Viral escape from CAP248-2B involved a cluster of rare mutations in the gp120-gp41 cleavage sites. Simultaneous introduction of these mutations into heterologous viruses abrogated neutralization by CAP248-2B, but enhanced neutralization sensitivity to 35O22, 4E10, and 10E8 by 10-100-fold. Altogether, this study expands the region of the HIV-1 gp120-gp41 quaternary interface that is a target for broadly neutralizing

  16. Basic Hydrodynamics of Richtmyer-Meshkov-type Growth and Oscillations in the ICF-Relevant Conditions

    Science.gov (United States)

    2010-01-01

    Washington, DC 20375 3ARTEP Inc ., Ellicott City, Maryland 21042 4Department of Mechanical Engineering, Ben Gurion University, Beer Sheva, Israel...the 56-beam Nike KrF laser facility at the Naval Research Laboratory (3 kJ in 0.248 μm, see Obenschain et al. 1996). Basic hydrodynamics of Richtmyer...2000 Nike (NRL) 0.248 8-13 4 400 40 30, 45 1.85 Si monochrom. Ablative RMI, feedout, classical RMI, impulsive loading, re- shock

  17. Experiments on the interaction of intense femtosecond radiation with dense plasmas. Final report

    International Nuclear Information System (INIS)

    Rhodes, C.K.

    1996-01-01

    An upgraded KrF * (248 nm) system producing a pulse energy of ∼ 400 mJ, a pulse width of ∼ 220 fs, and focal intensities above 10 19 W/cm 2 , has been constructed, tested, operated, and used in experimental studies. The spatial morphology of channeled radiation in plasmas has been measured with a spatial resolution of ∼ 30 μm and damage studies of fused silica indicate that femtosecond (200 - 300 fs) 248 nm radiation has a damage limit not exceeding ∼ 50 GW/cm 2 , an unfavorably low level. 2 figs

  18. Ultraviolet excimer laser ablation: the effect of wavelength and repetition rate on in vivo guinea pig skin

    Energy Technology Data Exchange (ETDEWEB)

    Morelli, J.; Kibbi, A.G.; Farinelli, W.; Boll, J.; Tan, O.T.

    1987-06-01

    Multiple dermatologic conditions that are currently treated with traditional cold-knife surgery are amenable to laser therapy. The ideal surgical treatment would be precise and total removal of abnormal tissue with maximal sparing of remaining structures. The ultraviolet (UV) excimer laser is capable of such precise tissue removal due to the penetration depth of 193 nm and 248 nm irradiation of 1 micron per pulse. This type of ablative tissue removal requires a high repetition rate for efficient lesional destruction. Excimer laser radiation at 193 nm is capable of high repetition rates, which are necessary while 248 nm radiation causes increasing nonspecific thermal injury as the laser repetition rate is increased.

  19. UV, visible and IR laser interaction with gelatine

    International Nuclear Information System (INIS)

    Oujja, M; Rebollar, E; Abrusci, C; Amo, A Del; Catalina, F; Castillejo, M

    2007-01-01

    In this work we investigate the effects on gelatine films of nanosecond pulsed laser irradiation at different laser wavelengths from the UV to the IR at 248, 266, 355, 532 and 1064 nm. We compared gelatines differing in gel strength values (Bloom 75 and 225) and in crosslinking degree. Formation of bubbles at the wavelengths in the UV (248 and 266 nm), melting and resolidification at 355 nm, and formation of craters by ablation in the VIS and IR (532 and 1064 nm) are the observed morphological changes. On the other hand, changes of the fluorescence behaviour of the films upon UV irradiation reveal chemical modifications of photolabile chromophores

  20. Minor Actinide Burning in Thermal Reactors. A Report by the Working Party on Scientific Issues of Reactor Systems

    International Nuclear Information System (INIS)

    Hesketh, K.; Porsch, D.; Rimpault, G.; Taiwo, T.; Worrall, A.

    2013-01-01

    The actinides (or actinoids) are those elements in the periodic table from actinium upwards. Uranium (U) and plutonium (Pu) are two of the principal elements in nuclear fuel that could be classed as major actinides. The minor actinides are normally taken to be the triad of neptunium (Np), americium (Am) and curium (Cm). The combined masses of the remaining actinides (i.e. actinium, thorium, protactinium, berkelium, californium, einsteinium and fermium) are small enough to be regarded as very minor trace contaminants in nuclear fuel. Those elements above uranium in the periodic table are known collectively as the transuranics (TRUs). The operation of a nuclear reactor produces large quantities of irradiated fuel (sometimes referred to as spent fuel), which is either stored prior to eventual deep geological disposal or reprocessed to enable actinide recycling. A modern light water reactor (LWR) of 1 GWe capacity will typically discharge about 20-25 tonnes of irradiated fuel per year of operation. About 93-94% of the mass of uranium oxide irradiated fuel is comprised of uranium (mostly 238 U), with about 4-5% fission products and ∼1% plutonium. About 0.1-0.2% of the mass is comprised of neptunium, americium and curium. These latter elements accumulate in nuclear fuel because of neutron captures, and they contribute significantly to decay heat loading and neutron output, as well as to the overall radio-toxic hazard of spent fuel. Although the total minor actinide mass is relatively small - approximately 20-25 kg per year from a 1 GWe LWR - it has a disproportionate impact on spent fuel disposal, and thus the longstanding interest in transmuting these actinides either by fission (to fission products) or neutron capture in order to reduce their impact on the back end of the fuel cycle. The combined masses of the trace actinides actinium, thorium, protactinium, berkelium and californium in irradiated LWR fuel are only about 2 parts per billion, which is far too low for

  1. Educators' Self-Reported Training, Use, and Perceived Effectiveness of Evidence-Based Classroom Management Practices

    Science.gov (United States)

    Cooper, Justin T.; Gage, Nicholas A.; Alter, Peter J.; LaPolla, Stefanie; MacSuga-Gage, Ashley S.; Scott, Terrance M.

    2018-01-01

    A survey study of 248 educators in four states was conducted to identify respondents' formal training, use, and perceived effectiveness of 37 evidence-based classroom management practices within four general categories: (a) antecedent-based, (b) instructionally based, (c) consequence-based, and (d) self-management. Results indicated that, on…

  2. Emanation thermal analysis study of the preparation of ruthenia-titania-based finely dispersed powders

    Czech Academy of Sciences Publication Activity Database

    Balek, V.; Mitsuhashi, T.; Zeleňák, V.; Večerníková, Eva; Šubrt, Jan; Haneda, H.; Bezdička, Petr

    2002-01-01

    Roč. 248, č. 1 (2002), s. 47-53 ISSN 0021-9797 Institutional research plan: CEZ:AV0Z4032918 Keywords : emanation thermal analysis * TiO2 * RuO2 Subject RIV: CA - Inorganic Chemistry Impact factor: 1.466, year: 2002

  3. Optical properties of PMMA doped with erbium(III) and ytterbium(III) complexes

    Czech Academy of Sciences Publication Activity Database

    Prajzler, V.; Huttel, I.; Lyutakov, O.; Oswald, Jiří; Machovič, V.; Jerabek, V.

    2009-01-01

    Roč. 49, č. 9 (2009), s. 1814-1817 ISSN 0032-3888 Institutional research plan: CEZ:AV0Z10100521 Keywords : polymers * erbium * photoluminescence Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 1.248, year: 2009

  4. Browse Title Index

    African Journals Online (AJOL)

    Items 51 - 100 of 248 ... Vol 40, No 1 (2012), Critical Natural resources factors that promote the adoption of new in-field rainwater harvesting (IRWH) by extentionist in Lambani, Limpopo Province, Abstract PDF. LF Joseph, JJ Botha. Vol 37 (2008), Cultural variations regarding the nature and determinants of opinion leadership ...

  5. An integrative taxonomic approach to assess the status of Corsican bumblebees: implications for conservation

    Czech Academy of Sciences Publication Activity Database

    Lecocq, T.; Brasero, N.; De Meulemeester, T.; Michez, D.; Dellicour, S.; Lhomme, P.; de Jonghe, R.; Valterová, Irena; Urbanová, Klára; Rasmont, P.

    2015-01-01

    Roč. 18, č. 3 (2015), s. 236-248 ISSN 1367-9430 Institutional support: RVO:61388963 Keywords : Bayesian * bumblebees * endemic * evolutionarily significant unit * genetic marker * insular Subject RIV: CC - Organic Chemistry Impact factor: 2.788, year: 2015

  6. Dynamic evolution of telomeric sequences in the green algal order Chlamydomonadales

    Czech Academy of Sciences Publication Activity Database

    Fulnečková, Jana; Hasíková, T.; Fajkus, Jiří; Lukešová, Alena; Eliáš, M.; Sýkorová, Eva

    2012-01-01

    Roč. 4, č. 3 (2012), s. 248-264 ISSN 1759-6653 R&D Projects: GA ČR(CZ) GA521/09/1912 Institutional research plan: CEZ:AV0Z50040702; CEZ:AV0Z60660521 Keywords : telomere * algae * telomerase Subject RIV: BO - Biophysics; BO - Biophysics (BC-A) Impact factor: 4.759, year: 2012

  7. Kultura organizace a syndrom vyhoření

    Czech Academy of Sciences Publication Activity Database

    Havrdová, Z.; Šolcová, Iva; Hradcová, D.; Rohanová, E.

    2010-01-01

    Roč. 54, č. 3 (2010), s. 235-248 ISSN 0009-062X Institutional research plan: CEZ:AV0Z70250504 Keywords : organizational culture * employee satisfaction * health vs. social services Subject RIV: AN - Psychology Impact factor: 0.230, year: 2010

  8. Deposition and characterization of ITO films produced by laser ablation at 355 nm

    DEFF Research Database (Denmark)

    Holmelund, E.; Thestrup Nielsen, Birgitte; Schou, Jørgen

    2002-01-01

    Indium tin oxide (ITO) films have been deposited by pulsed laser deposition (PLD) at 355 nm. Even though the absorption of laser light at the wavelength 355 nm is much smaller than that of the standard excimer lasers for PLD at 248 nm and 193 nm, high-quality films can be produced. At high fluence...

  9. The Holy Logos in the Writings of Philo of Alexandria

    Czech Academy of Sciences Publication Activity Database

    Hoblík, Jiří

    2014-01-01

    Roč. 56, č. 3 (2014), s. 248-266 ISSN 0010-3713 R&D Projects: GA ČR(CZ) GBP401/12/G168 Institutional support: RVO:67985955 Keywords : Philo of Alexandria * Ancient Jewish philosophy * Logos * holiness Subject RIV: AA - Philosophy ; Religion

  10. Bacterial populations within copper mine tailings: long-term effects of amendment with Class A biosolids

    Science.gov (United States)

    This study evaluates the effect of surface application of dried Class A biosolids on microbial populations within copper mine tailings. Methods and Results: Mine tailing sites were established at ASARCO Mission Mine close to Sahuarita, Arizona. Site 1 (Dec. 1998) was amended with 248 tons ha-1 of C...

  11. Moving up the ladder : heterogeneity influencing academic careers through research orientation, gender, and mentors

    NARCIS (Netherlands)

    Ooms, Ward; Werker, C.; Hopp, Christian

    2018-01-01

    We look into the question whether heterogeneity stemming from research orientation, gender, or disciplinary and cultural differences with their PhD supervisors helps or hampers academics’ careers. Based on a sample of 248 academics at two leading European universities of technology, we combine

  12. Sbírka rukopisných zlomků ve Státním okresním archivu v Kutné Hoře

    Czech Academy of Sciences Publication Activity Database

    Brodský, Pavel; Hradilová, Marta; Hrdinová, Martina; Petr, Stanislav; Tošnerová, Marie

    2013-01-01

    Roč. 43, č. 0 (2013), s. 207-248 ISSN 0585-5691 R&D Projects: GA ČR GAP405/10/0027 Institutional support: RVO:67985921 Keywords : codicology * manuscripts fragments * Státní okresní archiv Kutná Hora Subject RIV: AB - History

  13. Žena ve vědě: Alena Lengerová

    Czech Academy of Sciences Publication Activity Database

    Bahenská, Marie

    2011-01-01

    Roč. 3, č. 2 (2011), s. 248-263 ISSN 1803-9448 Institutional research plan: CEZ:AV0Z80770509 Keywords : Lengerová, Alena * history of science * Czechoslovak Academy of Science s Subject RIV: AB - History

  14. University Counseling Centers' Perceptions and Experiences Pertaining to Emotional Support Animals

    Science.gov (United States)

    Kogan, Lori R.; Schaefer, Karen; Erdman, Phyllis; Schoenfeld-Tacher, Regina

    2016-01-01

    Increasing numbers of students are requesting accommodations for emotional support animals (ESAs) in higher education settings. Since the legislation pertaining to this type of service animal differs from the laws governing disability service animals, colleges and universities are faced with developing new policies and guidelines. A sample of 248

  15. Social Factors Determining the Experience of Blindness among Pregnant Women in Developing Countries: The Case of India

    Science.gov (United States)

    Pandey, Shanta; Lin, Yuan; Collier-Tenison, Shannon; Bodden, Jamie

    2012-01-01

    Approximately 10 million pregnant women around the world develop night blindness annually. In India, one in 11 pregnant women suffers from night blindness. This study used a nationally representative sample of 35,248 women from India between the ages of 15 and 49 who had given birth in the past five years to understand the effect of women's…

  16. Pramana – Journal of Physics | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Volume 82 Issue 2 February 2014 pp 243-248 Contributed Papers. Versatile laser microfabrication techniques for lab-on-chip devices in general and uranium analysis in particular ... 82 Issue 2 February 2014 pp 433-437 Contributed Papers. Manipulation of microparticles and red blood cells using optoelectronic tweezers.

  17. Properties of carbonisation products obtained from impregnated coal

    Czech Academy of Sciences Publication Activity Database

    Plevová, Eva; Šugárková, Věra; Kaloč, M.; Vaculíková, Lenka

    -, - (2008), s. 52-61. ISBN 978-80-248-1939-6 Grant - others:GA CŘ(CZ) GA105/00/1698 Institutional research plan: CEZ:AV0Z30860518 Keywords : chlorides * impregnation * coal Subject RIV: CC - Organic Chemistry

  18. The spatial thickness distribution of metal films produced by large area pulsed laser deposition

    DEFF Research Database (Denmark)

    Pryds, Nini; Schou, Jørgen; Linderoth, Søren

    2007-01-01

    Thin films of metals have been deposited in the large-area Pulsed Laser Deposition (PLD) Facility at Riso National Laboratory. Thin films of Ag and Ni were deposited with laser pulses from an excimer laser at 248 nm with a rectangular beam spot at a fluence of 10 J/cm(2) on glass substrates of 127...

  19. An Investigation of Big Five Personality Traits and Career Decidedness among Early and Middle Adolescents

    Science.gov (United States)

    Lounsbury, John W.; Hutchens, Teresa; Loveland, James M.

    2005-01-01

    Big Five personality traits were analyzed in relation to career decidedness among adolescents in middle and high school. Participants were 248 7th-grade, 321 10th-grade, and 282 12th-grade students. As hypothesized, Conscientiousness was positively and significantly correlated with career decidedness in all three grades. Openness and Agreeableness…

  20. Tribological and mechanical properties of nanocrystalline-TiC/a-C nanocomposite thin films

    Czech Academy of Sciences Publication Activity Database

    Musil, Jindřich; Novák, P.; Čerstvý, R.; Soukup, Z.

    2010-01-01

    Roč. 28, č. 2 (2010), s. 244-248 ISSN 0734-2101 R&D Projects: GA AV ČR(CZ) KAN400480701 Institutional research plan: CEZ:AV0Z10100522 Keywords : nc-TiC/a-C nanocomposite * friction * mechanical properties * magnetron sputtering * wear Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 1.291, year: 2010

  1. A toadfish (Batrachoidiformes) from the Oligocene of the Eastern Carpathians (Piatra Neamt, Romania)

    Czech Academy of Sciences Publication Activity Database

    Přikryl, Tomáš; Grădianu, I.; Georgescu, V.; Carnevale, G.

    2018-01-01

    Roč. 287, č. 2 (2018), s. 241-248 ISSN 0077-7749 R&D Projects: GA ČR(CZ) GA16-21523S Institutional support: RVO:67985831 Keywords : Batrachoidiformes * toadfish * Bituminous Marls Formation * Eastern Carpathians * Oligocene Subject RIV: DB - Geology ; Mineralogy Impact factor: 0.777, year: 2016

  2. Nikkaji Dictionary: レゾルシノマイシンA [MeCab user dictionary for science technology term[Archive

    Lifescience Database Archive (English)

    Full Text Available MeCab user dictionary for science technology term レゾルシノマイシンA 名詞 一般 * * * * レゾルシノマイシンA ... Nikkaji J248.155C 200906060374040064 C CA06 UNKNOWN_2 レゾルシノマイシン A

  3. Nikkaji Dictionary: レゾルシノマイシンA [MeCab user dictionary for science technology term[Archive

    Lifescience Database Archive (English)

    Full Text Available MeCab user dictionary for science technology term レゾルシノマイシンA 名詞 一般 * * * * レゾルシノマイシンA ... Nikkaji J248.155C 200906060374040064 C CA06 UNKNOWN_2 レゾルシノマイシン A

  4. Microwave - Assisted Intercatation of 1-Alkanols and 1, omega-Alkanediols into alpha-Zirconium Phosphate. Evidence of Conformational Phase Transitions in the Bimolecular Film of Alkyl Chains

    Czech Academy of Sciences Publication Activity Database

    Costantino, U.; Vivani, R.; Zima, Vítězslav; Beneš, Ludvík; Melánová, Klára

    xx, č. 18 (2002), s. 1211-1217 ISSN 0743-7463 R&D Projects: GA ČR GA202/01/0520 Keywords : zirconium phosphate * intercalation * alkanols Subject RIV: CA - Inorganic Chemistry Impact factor: 3.248, year: 2002

  5. Journal of Earth System Science | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    mean rate 0.084 m/y) whereas comparatively six salt lakes (out of seven salt lakes) exhibited ∼3 times higher mean rate of lake level ... Centre for Glaciology, Wadia Institute of Himalayan Geology, 33 GMS Road, Dehradun 248 001, India.

  6. Resonance – Journal of Science Education | News

    Indian Academy of Sciences (India)

    The Central Dogma of Molecular Biology - A Retrospective after Fifty Years · Michel Morange · More Details Fulltext PDF. pp 248-258 General Article. Chemistry is Everygreen - 2008 Nobel Prize in Chemistry · Swagata Dasgupta · More Details Fulltext PDF. pp 259-271 Series Article. Snippets of Physics - Hubble Expansion ...

  7. Two panels of steroid receptor luciferase reporter cell lines for compound profiling

    Czech Academy of Sciences Publication Activity Database

    Sedlák, David; Paguio, A.; Bartůněk, Petr

    2011-01-01

    Roč. 14, č. 2 (2011), s. 248-266 ISSN 1386-2073 R&D Projects: GA MŠk(CZ) LC06077 Institutional research plan: CEZ:AV0Z50520514 Keywords : nuclear hormone receptor * steroid receptor * cell-based luciferase reporter assay Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 1.785, year: 2011

  8. Chemical behaviour of a few atoms of rutherfordium (Rf, Z= 104) and of dubnium (Db, Z= 105) produced at Orsay

    International Nuclear Information System (INIS)

    Trubert, D.; Hussonnois, M.; Le Naour, C.; Brillard, L.; Monroy Guzman, F.; Le Du, J.F.; Servajean, V.

    1998-01-01

    The isotopes 261 Rf and 262 Db were produced by irradiation of a 248 Cm target with respectively 18 O and 19 F ions, at the MP Tandem accelerator of Orsay (France). These isotopes were isolated in HF medium, using he RACHEL setup. Moreover, the radioisotope 262 DB was produced by a nuclear reaction. (authors)

  9. Pollen-inferred millennial changes in landscape patterns at a major biogeographical interface within Europe

    Czech Academy of Sciences Publication Activity Database

    Jamrichová, Eva; Petr, L.; Jiménez-Alfaro, B.; Jankovská, Vlasta; Dudová, Lydie; Pokorný, P.; Kolaczek, P.; Zernitskaya, V.; Čierniková, M.; Břízová, E.; Syrovátka, V.; Hájková, Petra; Hájek, M.

    2017-01-01

    Roč. 44, č. 10 (2017), s. 2386-2397 ISSN 0305-0270 EU Projects: European Commission(XE) 278065 - LONGWOOD Institutional support: RVO:67985939 Keywords : distribution patterns * gradient analysis * historical biogeography * Holocene * pollen Subject RIV: EH - Ecology, Behaviour OBOR OECD: Ecology Impact factor: 4.248, year: 2016

  10. 76 FR 26731 - Medicare Program; Hospice Wage Index for Fiscal Year 2012

    Science.gov (United States)

    2011-05-09

    ... care under Part A. See Tax Equity and Fiscal Responsibility Act of 1982 (TEFRA), Public Law 97-248, Sec... future cap years. See, e.g., Los Angeles Haven Hospice, Inc. v. Leavitt, 2009 WL 5868513 (C.D. Cal. 2009... the recalculation. The impact of this methodology will be that the fractional allocations for some...

  11. 78 FR 1698 - Semiannual Regulatory Flexibility Agenda

    Science.gov (United States)

    2013-01-08

    ...: Standardized Approach for Risk-weighted Assets; Market Discipline and Disclosure Requirements (Docket No. R... Discipline and Disclosure Requirements (Docket R-1443) Legal Authority: 12 U.S.C. 248(a); 12 U.S.C. 321; 12 U... counterparty credit risk. The NPRM also would introduce disclosure requirements that would apply to top-tier...

  12. Book Review: And then there were none: The demise of Desert Bighorn Sheep in the Pusch Ridge Wilderness

    Science.gov (United States)

    Cain, James W.

    2018-01-01

    And Then There Were None: The Demise of Desert Bighorn Sheep in the Pusch Ridge Wilderness. Paul R.Krausman. 2017. The University of New Mexico Press, Albuquerque, New Mexico, USA. 248 pp. $65.00 hardcover. ISBN 978‐0‐8263‐5785‐4.

  13. 78 FR 76408 - BMW of North America, LLC, Grant of Petition for Decision of Inconsequential Noncompliance

    Science.gov (United States)

    2013-12-17

    ... motor vehicles. ADDRESSES: For further information on this decision contact Ms. Amina Fisher, Office of... (5381 pounds). GAWR: Front--1,299 kilograms (2,864 pounds) with P265/70R16 tires, 16 x 8.0 rims at 248 k... sources and services available which can be used to inform the driver of the correct tire size and tire...

  14. Vergilius ja eesti heksameetri probleem / Ants Oras

    Index Scriptorium Estoniae

    Oras, Ants

    2004-01-01

    Varem ilmunud: Tulimuld, 1962, nr. 4, lk. 242-248 ; rmt.: Vergilius Maro, Publius. Aeneis : eepos kaheteistkümnes laulus. Lund : Eesti Kirjanike Kooperatiiv, 1975, lk. 512 ; rmt.: Vergilius Maro, Publius. Bucolica. Aeneis. Tallinn : Hortus Litterarum, 1992, lk. 55-61, pealkirjaga "Saateks"

  15. Thinking about Applications: Effects on Mental Models and Creative Problem-Solving

    Science.gov (United States)

    Barrett, Jamie D.; Peterson, David R.; Hester, Kimberly S.; Robledo, Issac C.; Day, Eric A.; Hougen, Dean P.; Mumford, Michael D.

    2013-01-01

    Many techniques have been used to train creative problem-solving skills. Although the available techniques have often proven to be effective, creative training often discounts the value of thinking about applications. In this study, 248 undergraduates were asked to develop advertising campaigns for a new high-energy soft drink. Solutions to this…

  16. 77 FR 73558 - Sex Offender Registration Amendments

    Science.gov (United States)

    2012-12-11

    .... FOR FURTHER INFORMATION CONTACT: Rorey Smith, Deputy General Counsel, (202) 220-5797, or rorey.smith... Registration and Notification Act (SORNA), Title I of the Adam Walsh Child Protection and Safety Act of 2006... (SORNA), Title I of the Adam Walsh Child Protection and Safety Act of 2006, (Pub. L. 109-248), requires a...

  17. The Influence of Hemispheric Dominance on Scores of the Myers-Briggs Type Indicator.

    Science.gov (United States)

    Hartman, Steve E.; And Others

    1997-01-01

    Results for 75 medical students and 248 undergraduates suggest that the Myers-Briggs Type Indicator appears to sample only 3 bipolar personality dimensions rather than the 4 that the use of "type tables" implies. One of these dimensions shares substantial variance with the cognitive model of hemispheric dominance. (SLD)

  18. Arora, Dr Baldev Raj

    Indian Academy of Sciences (India)

    Date of birth: 10 October 1947. Specialization: Electromagnetic Geophysics, Seismotectonics and Geomagnetism Address: 36, Janakpuri, Engineers Enclave, Phase III, GMS Road, Dehra Dun 248 001, Uttarakhand Contact: Residence: 98712 87209. Mobile: 98973 91661. Email: arorabr47@gmail.com. YouTube; Twitter ...

  19. A M Umarji

    Indian Academy of Sciences (India)

    Home; Journals; Bulletin of Materials Science. A M Umarji. Articles written in Bulletin of Materials Science. Volume 23 Issue 4 August 2000 pp 243-248 Refractory Cements. Ceramic joining through reactive wetting of alumina with calcium aluminate refractory cements · K Geetha A M Umarji T R N Kutty · More Details ...

  20. Dicty_cDB: VSJ470 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 5.4 Zebrafish DNA sequence *** SEQUENCING IN PROGRESS *** from clone CH211-248L17. 48 0.21 2 AJ277431 |AJ277431.1 Megaselia scala...ris retrotransposon TROMB-Ms2. 36 0.43 2 AJ277430 |AJ277430.1 Megaselia scala

  1. Sexual Advances by Patients in Dental Practice: Implications for the Dental and Dental Hygiene Curricula.

    Science.gov (United States)

    Chiodo, Gary T.; And Others

    1992-01-01

    A survey of Oregon dentists (n=248) and dental hygienists (n=235) investigated frequency of patient-initiated sexual advances and methods of dealing with them. Up to 44 percent experienced 1 or more patient verbal advances, and 23 percent experienced physical advances during a 5-year period. Inclusion of related issues in professional curricula is…

  2. Cross-Cultural Comparison of Effective Leadership in Schools for Children with Blindness or Low Vision in the United States and Nigeria

    Science.gov (United States)

    Ajuwon, Paul M.; Oyinlade, A. Olu

    2016-01-01

    In this project, the authors used the Essential Behavioral Leadership Qualities (EBLQ) method of measuring leadership effectiveness to assess and compare the effectiveness of principals (leaders) of residential schools for children with blindness or low vision in the United States (U.S.) and Nigeria. A total of 248 teachers (subordinates) in 25…

  3. Risk of Abnormal Eating Attitudes among Turkish Dietetic Students

    Science.gov (United States)

    Kiziltan, Gul; Karabudak, Efsun

    2008-01-01

    The purpose of this study was to determine the prevalence of abnormal eating attitudes among Turkish dietetic students and the relations between nutrition education and eating attitudes. The study population was 568 female university students (248 dietetic students, 320 non-dietetic students). Two scales were used: Eating Attitudes Test (EAT-26)…

  4. Original Article

    African Journals Online (AJOL)

    Administratör

    Key words: Ischemic stroke, Risk factors, In-hospital mortality, Palestine. ABSTRACT. Objective: ..... The Lancet 1990; 335: 765–74. 26. MacMahon S, Rodgers A. ... stay in a stroke rehabilitation unit, Part I: analysis of 248 unscreened patients: ...

  5. HTS Teologiese Studies / Theological Studies - Vol 64, No 2 (2008)

    African Journals Online (AJOL)

    Die hermeneutiek van kerkgeskiedenis en “teologiegeskiedenis”: 'n “Nuwe paradigma” vir kerkgeskiedenis · EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT · DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. JP Labuschagne, 861-883. http://dx.doi.org/10.4102/hts.v64i2.48 ...

  6. Uplatnění PETL při řešení některých složitých kauz v oblasti příčinné souvislosti v medicínskoprávních sporech

    Czech Academy of Sciences Publication Activity Database

    Doležal, Adam; Doležal, Tomáš

    2013-01-01

    Roč. 19, 7-8 (2013), s. 242-248 ISSN 1211-4405 R&D Projects: GA ČR GAP408/12/2574 Institutional support: RVO:68378122 Keywords : medical law * causality * medico-legal disputes Subject RIV: AG - Legal Sciences

  7. A note on the typification of Capparis roxburghii DC. (Capparaceae)

    NARCIS (Netherlands)

    Raghavan, R. Sundara

    1972-01-01

    As Capparis corymbosa Roxb. [Hort. Beng. (1814) 93 nom. nud. et Fl. Ind. 2 (1832) 569 ed. Carey] was a later homonym of Capparis corymbosa Lamk. (1785), an African plant, Decandolle in Prod. I (1824) 247—248 had proposed the new name of C. roxburghii for the former basing it on Roxburgh’s specimen

  8. Journal of Earth System Science | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    The dominant forest type is tropical semi-evergreen which comprises 21,678 km2 (35.2%) of the total forest area of Western Ghats, followed by wet evergreen forest (30.6%), moist deciduous forest (24.8%) and dry deciduous forest (8.1%) in 2013. Even though it has the highest population density among the hotspots, there ...

  9. Does Self-Image Matter? Client's Self-Image, Behaviour and Evaluation of a Career Counselling Session: An Exploratory Study

    Science.gov (United States)

    Schedin, Gunnar; Armelius, Kerstin

    2008-01-01

    This exploratory study addresses differences in self-image as a client characteristic in career counselling by using the Structural Analysis of Social Behaviour (Benjamin, L., "Journal of Consulting and Clinical Psychology," 64(6), 1203-1212, 1996; Benjamin, L., "Journal of Personality Assessment," 66(2), 248-266, 1996) and an adaptation…

  10. 121 115 Infilling Direction and Fluid Commu

    African Journals Online (AJOL)

    2008-12-02

    Dec 2, 2008 ... Keywords: Kolo Creek, reservoir geochemistry, reservoir continuity, Niger Delta, petroleum migration ... The infilling of petroleum reservoirs is a ..... Association of Petroleum Geologists Bulletin. 81: 222–248. Hunt, J.M. (1996). Petroleum Geochemistry and. Geology. Freeman and Company, New York.

  11. Various types of chromoproteins extracted from tobacco chloroplasts

    International Nuclear Information System (INIS)

    Sirchis, Jean; Duranton, Jacques

    1959-01-01

    From tobacco chloroplasts a chroma-proteic complex is isolated; this can be fractionally divided into two different species by the difference in their chemical compositions and their speeds of sedimentation. Reprint of a paper published in 'Comptes Rendus des Seances de l'Academie des Sciences', tome 248, p. 2528-2530, sitting of 27 April 1959 [fr

  12. Udder size and milk production potentials of goats and sheep in the ...

    African Journals Online (AJOL)

    During these periods, the udder sizes of the dams were measured weekly before hand milking thrice a week to determine the milk yield. Samples of the milk were analysed for th.eir composition. The results showed that the udder size increased with increasing milk yield (112 - 248ml) up to the peak of lactation which was ...

  13. Journal of Chemical Sciences | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Home; Journals; Journal of Chemical Sciences. G Mugesh. Articles written in Journal of Chemical Sciences. Volume 112 Issue 3 June 2000 pp 239-248. Aspects of organochalcogen (S, Se, Te) compounds stabilized by intramolecular coordination · G Mugesh Arunashree Panda Harkesh B Singh · More Details Abstract ...

  14. Polymer microstructures: are they applicable as optical components?

    DEFF Research Database (Denmark)

    Geschke, Oliver; Jensen, Martin Frøhling; Perozziello, Gerardo

    2004-01-01

    We present a new method to manufacture arrays of microlenses with varying diameter and/or varying focal length on the same substrate material. The method combines direct laser machining with a casting method and is based on the exposure of poly-methylmethacrylate (PMMA) to an UV Excimer Laser (248...

  15. California Bus Aid Still in Budget Cross Hairs

    Science.gov (United States)

    Fleming, Nora

    2012-01-01

    California legislators swiftly passed a budget bill last week aimed at sheltering school busing dollars from a midyear budget cut many districts and advocates said particularly hurt rural school systems, along with urban districts with desegregation plans. While the measure, which Gov. Jerry Brown was expected to sign into law, would restore $248

  16. Evolutionary history of the thicket rats (genus Grammomys) mirrors the evolution of African forests since late Miocene

    Czech Academy of Sciences Publication Activity Database

    Bryja, J.; Šumbera, R.; Kerbis Peterhans, J. C.; Aghová, T.; Bryjová, A.; Mikula, Ondřej; Nicolas, V.; Denys, C.; Verheyen, E.

    2017-01-01

    Roč. 44, č. 1 (2017), s. 182-194 ISSN 0305-0270 Institutional support: RVO:67985904 Keywords : Arvicanthini * coastal forests * late Miocene Subject RIV: EA - Cell Biology OBOR OECD: Biology (theoretical, mathematical, thermal, cryobiology, biological rhythm), Evolutionary biology Impact factor: 4.248, year: 2016

  17. Evolutionary history of the thicket rats (genus Grammomys) mirrors the evolution of African forests since late Miocene

    Czech Academy of Sciences Publication Activity Database

    Bryja, Josef; Šumbera, R.; Kerbis Peterhans, J. C.; Aghová, Tatiana; Bryjová, Anna; Mikula, Ondřej; Nicolas, V.; Denys, C.; Verheyen, E.

    2017-01-01

    Roč. 44, č. 1 (2017), s. 182-194 ISSN 0305-0270 Institutional support: RVO:68081766 Keywords : Arvicanthini * coastal forests * late Miocene * lowland forests * mountain forests * phylogeography * Plio-Pleistocene climate changes * Rodentia * tropical Africa Subject RIV: EG - Zoology OBOR OECD: Ecology Impact factor: 4.248, year: 2016

  18. Maternal Employment, Nonparental Care, Mother-Child Interactions, and Child Outcomes during Preschool Years

    Science.gov (United States)

    Nomaguchi, Kei M.

    2006-01-01

    This study examines the relationships between maternal employment, nonparental care, mother-child interactions, and preschoolers' outcomes. Data from the Canadian National Longitudinal Survey of Children and Youth (N = 1,248) show that maternal employment during the previous year, especially full-time employment, was related to care by…

  19. Dicty_cDB: Contig-U10738-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 1e-69 DQ782871_1( DQ782871 |pid:none) Lecanora hybocarpa isolate AFTOL-I... 248 1e-69 AY803750_1( AY803750 |...... 258 3e-67 AY485622_1( AY485622 |pid:none) Dibaeis baeomyces DNA-dependent RN... 241 3e-67 AY641049_1( AY641049 |pid:none) Lecanor

  20. Borderline personality disorder and emotional intelligence

    NARCIS (Netherlands)

    Peter, M.; Schuurmans, H.; Vingerhoets, A.J.J.M.; Smeets, G.; Verkoeijen, P.; Arntz, A.

    2013-01-01

    The present study investigated emotional intelligence (EI) in borderline personality disorder (BPD). It was hypothesized that patients with BPD (n = 61) compared with patients with other personality disorders (PDs; n = 69) and nonpatients (n = 248) would show higher scores on the ability to perceive

  1. File list: Pol.Epd.20.RNA_polymerase_II.AllCell [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available Pol.Epd.20.RNA_polymerase_II.AllCell hg19 RNA polymerase RNA polymerase II Epidermi...248,SRX663247,SRX807622 http://dbarchive.biosciencedbc.jp/kyushu-u/hg19/assembled/Pol.Epd.20.RNA_polymerase_II.AllCell.bed ...

  2. Reconstituting the Social: Transforming Institutions and Emerging Forms of Knowledge-Making in Korea, Late Nineteenth Century to 1945

    Directory of Open Access Journals (Sweden)

    John DiMoia

    2016-09-01

    Full Text Available Kyung Moon Hwang, Rationalizing Korea: The Rise of the Modern State, 1894-1945. University of California Press, 2015. 416 pp. $75 (cloth; $35 (paper/e-book. Theodore Jun Yoo, It's Madness: The Politics of Mental Health in Colonial Korea. University of California Press, 2016. 248 pp. $65 (cloth/e-book.

  3. Go4Life

    Medline Plus

    Full Text Available ... Go4Life Exercises — Stretching Play all Try some of these Go4Life exercises to improve your flexibility! 2:48 ... Exercises — Building Strength Play all Try some of these Go4Life exercises to improve your strength! Stronger muscles ...

  4. Climate change and agricultural water demand: Impacts and ...

    African Journals Online (AJOL)

    Administrator

    and loss of biodiversity may reduce the natural control of agricultural pests. .... and that released at head - works, which includes field canal efficiency .... Barley. 1180. 248.1. 177.3. 68.5. 0.1. Vetch. 89. 1727.5. 1297.6. 1186.5. 0.1. Alfalfa. 820.

  5. Fast Inscription of Long Period Gratings in Microstructured Polymer Optical Fibers

    DEFF Research Database (Denmark)

    Min, Rui; Marques, Carlos; Nielsen, Kristian

    2018-01-01

    We demonstrate 20 dB long period grating (LPG) fast inscription in microstructured polymer optical fibers (mPOFs) using a point-by-point technique obtaining an LPG total length of 25 mm. Two 248 nm UV laser pulses of 15 ns duration have been employed for every inscription point, which means a time...

  6. Anion-selective materials with 1,4-diazabicyclo[2.2.2]octane functional groups for advanced alkaline water electrolysis

    Czech Academy of Sciences Publication Activity Database

    Hnát, J.; Plevová, M.; Žitka, Jan; Paidar, M.; Bouzek, K.

    2017-01-01

    Roč. 248, 10 September (2017), s. 547-555 ISSN 0013-4686 R&D Projects: GA ČR(CZ) GA16-20728S Institutional support: RVO:61389013 Keywords : water electrolysis * alkaline environment * anion-selective membrane Subject RIV: CG - Electrochemistry OBOR OECD: Electrochemistry (dry cells, batteries, fuel cells, corrosion metals, electrolysis) Impact factor: 4.798, year: 2016

  7. The effect of oxfendazole treatment on muscle pathology in pigs infected with Taenia solium cysticercosis

    DEFF Research Database (Denmark)

    Iburg, Tine Moesgaard; Karlsson, Madeleine; Spång, Frederic

    2012-01-01

    The aim of the present study was to test histopathologically the hypothesis that the time for clearing Taenia solium cysts in muscle tissue of pigs following treatment with oxfendazole is cyst density dependant. A total of 248 cyst lesions in the masseter muscle of 28 naturally infected pigs were...

  8. Refractive microlenses produced by excimer laser machining of poly(methyl methacrylate)

    DEFF Research Database (Denmark)

    Jensen, Martin Frøhling; Krühne, Ulrich; H., L.

    2005-01-01

    A method has been developed whereby refractive microlenses can be produced in poly (methyl methacrylate) by excimer laser irradiation at λ = 248 nm. The lenses are formed by a combined photochemical and thermal process. The lenses are formed as depressions in the substrate material (negative foca...

  9. A Model of Reading Comprehension in Chinese Elementary School Children

    Science.gov (United States)

    Yeung, Pui-sze; Ho, Connie Suk-han; Chan, David Wai-ock; Chung, Kevin Kien-hoa; Wong, Yau-kai

    2013-01-01

    The relationships of reading-related skills (rapid naming, morphological awareness, syntactic skills, discourse skills, and verbal working memory) and word reading to reading comprehension were examined among 248 Chinese fourth graders in Hong Kong. Multiple regression analysis results showed that syntactic skills (word order knowledge,…

  10. 75 FR 7302 - Union Pacific Railroad Company-Abandonment Exemption-in Polk County, IA

    Science.gov (United States)

    2010-02-18

    ... DEPARTMENT OF TRANSPORTATION Surface Transportation Board [STB Docket No. AB-33 (Sub-No. 248X)] Union Pacific Railroad Company--Abandonment Exemption--in Polk County, IA Union Pacific Railroad Company... 225.56 near Berwick to milepost 232.80 near Bondurant, a distance of 7.24 miles, in Polk County, IA...

  11. Language studies in higher education in the Netherlands

    NARCIS (Netherlands)

    Zwarts, Frans; Silkens, B.

    1995-01-01

    Dutch is one of the two official languages of the Netherlands. It is the mother tongue of 15 million Dutchmen and 5,5 million Belgians. The second official language is Frisian, which is spoken by the 500,000 inhabitants of Friesland - a province of the Netherlands, 1,248 square miles in area, in the

  12. Petrographic studies on a newly discovered Indo-Arabian stone anchor from the Gulf of Kachchh, Gujarat: Implications for source area

    Digital Repository Service at National Institute of Oceanography (India)

    Tripati, S.; Mudholkar, A.; Khedekar, V.

    of soil properties in agricultural farm and its application in pre- dicting surface map of hydraulic property. Curr. Sci., 2008, 95, 937–945. 21. Davis, B. M., Uses and abuses of cross-validation in geostatistics. Math. Geol., 1987, 19, 241–248. 22...

  13. EST Table: FS904141 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available ar to 2-aminoethanethiol (cysteamine) dioxygenase [Tribolium castaneum] gb|EFA09634.1| hypothetical protein ...10 33 %/248 aa gnl|Amel|GB12350-PA 10/09/10 35 %/238 aa gi|91090992|ref|XP_974899.1| PREDICTED: similar to 2-aminoethanethiol (cystea

  14. Arsenic Removal from Drinking Water by Iron Removal. U.S. EPA Demonstration Project at Sabin, MN. Six-Month Evaluation Report

    Science.gov (United States)

    This report documents the activities performed during and the results obtained from the first six months of the EPA arsenic removal technology demonstration project at the Sabin, MN. The main objective of the project is to evaluate the effectiveness of the Kinetico FM-248-AS ars...

  15. Unit Ministry Team Religious Support to Casualties on the Airland Battlefield

    Science.gov (United States)

    1987-10-28

    Dysentery, Mod 248 Gastrits, Acute 249 Peptic Ulcer, Severe 250 Peptic Ulcer, Mod 251 Regional Ileitis 252 Regional Ileitis, Mod 253 Helminthiasis ...Severe 254 Helminthiasis , Mod 255 Migraine, acute 256 Varicosities, Severe 257 Varicosities, Mod 258 Essential Hypertension 2,)9 Ischemic Heart

  16. Ambient nitrogen oxides exposure and early childhood respiratory illnesses

    Czech Academy of Sciences Publication Activity Database

    Ghosh, R.; Joad, J.; Beneš, I.; Dostál, Miroslav; Šrám, Radim; Hertz-Picciotto, I.

    2012-01-01

    Roč. 39, č. 1 (2012), s. 96-102 ISSN 0160-4120 R&D Projects: GA MŽP(CZ) SP/1B3/50/07 Institutional research plan: CEZ:AV0Z50390703 Keywords : air pollution * bronchitis * croup Subject RIV: DN - Health Impact of the Environment Quality Impact factor: 6.248, year: 2012

  17. Cretaceous park of sex determination: sex chromosomes are conserved across iguanas

    Czech Academy of Sciences Publication Activity Database

    Rovatsos, M.; Pokorná, Martina; Altmanová, M.; Kratochvíl, L.

    2014-01-01

    Roč. 10, č. 3 (2014), s. 20131093 ISSN 1744-9561 R&D Projects: GA ČR GAP506/10/0718 Institutional support: RVO:67985904 Keywords : Anolis * lizard * male heterogamety Subject RIV: EG - Zoology Impact factor: 3.248, year: 2014

  18. Postprandial triglyceride response in young adult men and familial risk for coronary atherosclerosis

    NARCIS (Netherlands)

    Uiterwaal, C.S.P.M.; Grobbee, D.E.; Witteman, J.C.M.; Stiphout, W.A.H.J. van; Krauss, X.H.; Havekes, L.M.; Bruijn, A.M. de; Tol, A. van; Hofman, A.

    1994-01-01

    Setting: Coronary angiography departments of four central general hospitals in the Netherlands. Patients: 80 sons (mean age, 24.8 years) of men with severe coronary artery disease and 55 sons (mean age, 23.2 years) of controls. Measurements: Postprandial levels of serum triglycerides, retinyl

  19. First-Year Male Students' Perceptions of a Rape Prevention Program 7 Months after Their Participation: Attitude and Behavior Changes

    Science.gov (United States)

    Foubert, John D.; Tatum, Jerry L.; Godin, Eric E.

    2010-01-01

    Seven months after seeing The Men's Program, a commonly used rape prevention program, 248 first-year college men responded to four open-ended questions concerning whether or not the program impacted their attitudes or behavior, particularly regarding alcohol related sexual assault. Two thirds of participants reported either attitude or behavior…

  20. EAMJ September 432-448.indd

    African Journals Online (AJOL)

    2008-09-09

    Sep 9, 2008 ... Objectives: To determine the utilisation rate of design specific eye protection by surgeons and to ... Such infections include HIV, hepatitis B and C virus to name but a ... blood is literally running down the goggles this will be classified as ... procedure was 2.48 drops for the surgeons and 1.49 for the assistants ...

  1. 19 CFR 10.202 - Definitions.

    Science.gov (United States)

    2010-04-01

    ... that date, except as otherwise provided in §§ 10.241 through 10.248; (2) Rum and tafia classified in subheading 2208.40, Harmonized Tariff Schedule of the United States; (3) Sugars, syrups, and sugar-containing...

  2. Energy balance closure at a variety of ecosystems in Central Europe with contrasting topographies

    Czech Academy of Sciences Publication Activity Database

    McGloin, R.; Šigut, L.; Havránková, K.; Dušek, J.; Pavelka, M.; Sedlák, Pavel

    2018-01-01

    Roč. 248, č. 15 (2018), s. 418-431 ISSN 0168-1923 Institutional support: RVO:68378289 Keywords : energy balance closure * eddy covariance * complex terrain * forest ecosystems * cropland * marshland Subject RIV: EH - Ecology, Behaviour OBOR OECD: Meteorology and atmospheric sciences Impact factor: 3.887, year: 2016

  3. Energy balance closure at a variety of ecosystems in Central Europe with contrasting topographies

    Czech Academy of Sciences Publication Activity Database

    McGloin, Ryan; Šigut, Ladislav; Havránková, Kateřina; Dušek, Jiří; Pavelka, Marian; Sedlák, Pavel

    2018-01-01

    Roč. 248, jan (2018), s. 418-431 ISSN 0168-1923 R&D Projects: GA MŠk(CZ) LM2015061; GA MŠk(CZ) LO1415 Institutional support: RVO:86652079 Keywords : Energy balance * Eddy covariance * Complex terrain * Forest ecosystems * Cropland * Marshland Subject RIV: EH - Ecology, Behaviour Impact factor: 3.887, year: 2016

  4. Contrasting phylogeography of two Western Palaearctic fish parasites despite similar life cycles

    Czech Academy of Sciences Publication Activity Database

    Perrot-Minnot, M. J.; Špakulová, M.; Wattier, R.; Kotlík, Petr; Düsen, S.; Aydoğdu, A.; Tougard, C.

    2018-01-01

    Roč. 45, č. 1 (2018), s. 101-115 ISSN 0305-0270 R&D Projects: GA MŠk EF15_003/0000460 Institutional support: RVO:67985904 Keywords : amphipod * British Islands * comparative phylogeography * Cyprinidae * Danube Subject RIV: EG - Zoology Impact factor: 4.248, year: 2016

  5. Multilocus phylogeny of East African gerbils (Rodentia, Gerbilliscus) illuminates the history of the Somali-Masai savanna

    Czech Academy of Sciences Publication Activity Database

    Aghová, T.; Šumbera, R.; Piálek, L.; Mikula, Ondřej; McDonough, M. M.; Lavrenchenko, L. A.; Meheretu, Y.; Mbau, J. S.; Bryja, J.

    2017-01-01

    Roč. 44, č. 10 (2017), s. 2295-2307 ISSN 0305-0270 Institutional support: RVO:67985904 Keywords : biogeography * Gerbillinae * historical DNA * murid rodents * phylogeography Subject RIV: EA - Cell Biology OBOR OECD: Biology (theoretical, mathematical, thermal, cryobiology, biological rhythm), Evolutionary biology Impact factor: 4.248, year: 2016

  6. A Review of Breast Calcifications on Mammography in a Tertiary ...

    African Journals Online (AJOL)

    Biopsies were performed where indicated and histology results were compared with radiological findings. Data was analyzed using the Epi-info statistical software. Results Out of the 248 patients assessed, the predominant presenting symptoms were breast pain (30.2%) and breast lump (27.4%). While assessing the ...

  7. Can epigenetic control explain pronounced within plant heterogeneity of meiosis in a translocation trisome of Secale L.?

    NARCIS (Netherlands)

    Sybenga, J.

    2012-01-01

    Meiotic metaphase I configuration frequencies were determined in different tillers of genetically related plants of rye (Secale cereale L.) heterozygous for reciprocal translocation T248W (between chromosome arms 1RS and 6RS) and with an additional (telocentric) arm 1RS. Seventeen different

  8. NF-1 Dependent Gene Regulation in Drosophila Melanogaster

    Science.gov (United States)

    2004-04-01

    standard cornmeal medium at 25oC in a humidified incubator. Flies were collected and frozen in liquid nitrogen at the same time of day to minimize...melanogaster media, strains and heat-shock conditions Flies were raised at room temperature (22–248C) on standard cornmeal medium. The Nf1 mutants Nf1P1 and

  9. Postmoderne kerk-wees in die lig van publieke teologie – eenheid ...

    African Journals Online (AJOL)

    UPuser

    Die filosoof Immanuel Kant (1724-1804) het volgens Newbigin (in De Reuver 2004:248) .... Postmoderniteit, aan die ander kant, kan geloof nie probeer uitsluit of tot niet maak nie. Dit word dan selfs moontlik dat ..... lesbians from the traditional sexual ethics that support male dominance. (Poling 1995:122). 'n Lewe sonder ...

  10. Optimization of Broadband Optical Response of Multilayer Nanospheres

    Science.gov (United States)

    2012-07-27

    D. Levit , P. Nordlander, and N. J. Halas, “Nanosphere-in-a-nanoshell: A simple nanomatryushka,” J. Phys. Chem. C 114, 7378–7383 (2010). #169722...metal nanoparticles coated with a dye j-aggregate monolayer,” Quantum Electron. 40, 246–248 (2010). 1. Introduction Nanoparticles with strong optical

  11. Go4Life

    Medline Plus

    Full Text Available ... all Try some of these Go4Life exercises to improve your flexibility! 2:48 Play next Play now ... all Try some of these Go4Life exercises to improve your strength! Stronger muscles can make it easier ...

  12. Go4Life

    Medline Plus

    Full Text Available ... YouTube Red Get YouTube TV Best of YouTube Music Sports Gaming Movies TV Shows News Live Spotlight ... all Try some of these Go4Life exercises to improve your flexibility! 2:48 Play next Play now ...

  13. Clinician’s perceptions of and emotional responses to online infidelity

    NARCIS (Netherlands)

    Dijkstra, Pieternel; de Zeeuw, Heleen; Barelds, Dick P.H.; Buunk, Abraham P.

    2015-01-01

    Aim of the present study was to examine the degree to which mental health workers perceive twelve online partner behaviors as different types of infidelity and to examine the degree to which these behaviors evoke two types of jealousy, that is, fait accompli and anxious jealousy among mental. 248

  14. CHAPTER 1

    African Journals Online (AJOL)

    Dr Olaleye

    Research article. Knowledge of Diets as A Modifiable Risk Factor of Obesity ... Frequently consumed high calorie foods included cocoa-based drinks (24.8%), .... of risky food items (fatty, junk and sugary foods) was categorized ... biological children. Details .... “constant exposure to adverts and marketing of high calorie foods ...

  15. Fluid mechanics of needle valves with rounded components Part III: Pressure distributions on walls

    Czech Academy of Sciences Publication Activity Database

    Tesař, Václav

    2016-01-01

    Roč. 248, September (2016), s. 138-147 ISSN 0924-4247 R&D Projects: GA ČR GA13-23046S Institutional support: RVO:61388998 Keywords : needle valves * pressure measurements * valves Subject RIV: BK - Fluid Dynamics Impact factor: 2.499, year: 2016 http://www.sciencedirect.com/science/article/pii/S0924424716303417

  16. Journal of Astrophysics and Astronomy | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    2016-01-27

    Jan 27, 2016 ... Home; Journals; Journal of Astrophysics and Astronomy. NAGENDRA KUMAR. Articles written in Journal of Astrophysics and Astronomy. Volume 29 Issue 1-2 March-June 2008 pp 243-248. Damping of Slow Magnetoacoustic Waves in an Inhomogeneous Coronal Plasma · Nagendra Kumar Pradeep ...

  17. Additional notes on the Rubiaceae of Surinam

    NARCIS (Netherlands)

    Bremekamp, C.E.B.

    1936-01-01

    Since the appearance of my „Notes on the Rubiaceae of Surinam” (in Rec. d. Trav. bot. néerl. XXXI, 1934, 248; also in Meded. Bot. Mus. Herb. Utrecht no. 11, 1934) a number of species and varieties new to the flora of that country have come to light. The majority have been collected by Mr. Rombouts

  18. 78 FR 77089 - Pacific Island Fisheries; 2014 Annual Catch Limits and Accountability Measures

    Science.gov (United States)

    2013-12-20

    ...--groupers 5,600 Holocentridae--squirrelfish......... 2,585 Mugilidae--mullets 2,857 Crustaceans--crabs 2,248...,726 Serranidae--groupers 17,958 Mugilidae--mullets 15,032 Kyphosidae--chubs/rudderfish........ 13,247...; 4,446 giant clams. Mugilidae--mullets 3,308 Siganidae--rabbitfish 2,537 Bolbometopon muricatum...

  19. 78 FR 77115 - Lock 14 Hydro Partners; Notice of Application Ready for Environmental Analysis and Soliciting...

    Science.gov (United States)

    2013-12-20

    ...: Federal Power Act, 16 U.S.C. 791(a)-825(r). h. Applicant Contact: David Brown Kinloch, Lock 14 Hydro... of: (1) An existing 248-foot- long, 17-foot-high concrete lock and dam with a 319-foot-long stone...

  20. The Reasons and Motivation for Pre-Service Teachers Choosing to Specialise in Primary Physical Education Teacher Education

    Science.gov (United States)

    Spittle, Sharna; Spittle, Michael

    2014-01-01

    This study explored the reasons for pre-service teachers choosing to specialise in primary physical education and how these choices related to their motivation. Pre-service teachers who then elected to specialise in primary physical education (n = 248) completed the Attractors and Facilitators for Physical Education (AFPE) questionnaire and the…

  1. 75 FR 41796 - National School Lunch, Special Milk, and School Breakfast Programs, National Average Payments...

    Science.gov (United States)

    2010-07-19

    ... National Average Payments for free, reduced price and paid afterschool snacks as part of the National...; Hawaii--free lunch-- 288 cents, reduced price lunch--248 cents. Afterschool Snacks in Afterschool Care Programs--The payments are: Contiguous States--free snack--74 cents, reduced price snack--37 cents, paid...

  2. Small-Caliber Ammunition Identification Guide. Volume 1. Small-Arms Cartridges Up to 15 mm

    Science.gov (United States)

    1978-06-01

    ti acer - T trac~aute, traCLur, Traiong, traceri traccusc T[ R ElD. tir r6duitc. Gallery practicc, surhcalibcr TI’traiqan ce pcrforaiute AP-T V. B...Mukden Arsenal in 1929. ý,A A242 A248 SWEDEN MALAYSIA 2 Made at Maricbcrg Ammunition 1973. Factory. 1925-1928, 4 DOMINICAN RLPUBIAC ITALY 60 1960

  3. 75 FR 61114 - Airworthiness Directives; Rolls-Royce plc RB211-Trent 800 Series Turbofan Engines

    Science.gov (United States)

    2010-10-04

    ... Airworthiness Directives; Rolls-Royce plc RB211-Trent 800 Series Turbofan Engines AGENCY: Federal Aviation.... Fax: (202) 493-2251. Contact Rolls-Royce plc, P.O. Box 31, Derby, England, DE248BJ; telephone: 011-44... AD. We will consider all comments received by the closing date and may amend this proposed AD based...

  4. 78 FR 12255 - Airworthiness Directives; Rolls-Royce (1971) Limited, Bristol Engine Division Turbojet Engines

    Science.gov (United States)

    2013-02-22

    ...: (202) 493-2251. For service information identified in this AD, contact Rolls-Royce plc, Corporate... received by the closing date and may amend this proposed AD based on those comments. We will post all... this AD, contact Rolls-Royce plc, Corporate Communications, P.O. Box 31, Derby, England, DE248BJ; phone...

  5. 76 FR 68663 - Airworthiness Directives; Rolls-Royce plc (RR) RB211-Trent 800 Series Turbofan Engines

    Science.gov (United States)

    2011-11-07

    ...-0755; Directorate Identifier 2010-NE-12-AD] RIN 2120-AA64 Airworthiness Directives; Rolls-Royce plc (RR... Rolls-Royce plc, Corporate Communications, P.O. Box 31, Derby, England, DE248BJ; phone: 011-44-1332... date and may amend this proposed AD based on those comments. We will post all comments we receive...

  6. Heavy Metals and Physicochemical Properties of Soils in Kano ...

    African Journals Online (AJOL)

    and such soil properties as organic carbon, available P, total N and basic cations on the other. Keywords: ..... addition through fertilizers and agro-chemicals, their ..... Analysis of Fish Tissue for Trace Metals. Afon ... Nutrition 7(2): 244-248.

  7. Haddam Neck Plant. Annual operating report: January--December 1976

    International Nuclear Information System (INIS)

    1976-01-01

    Net electric power generated was 4,026,168.66 MWH with the reactor on line 7,248.60 hrs. Information is presented concerning operations, design changes, start-up physics testing, steam generator eddy current examination, corrective maintenance, shutdowns and power reductions, coolant chemistry, personnel radiation exposure, power generation and fuel performance

  8. Debating the Social Thinking of Carlos Nelson Coutinho

    Directory of Open Access Journals (Sweden)

    Bruno Bruziguessi

    2017-10-01

    Full Text Available BRAZ, Marcelo; RODRIGUES, Mavi (Org.. Cultura, democracia e socialismo: as idéias de Carlos Nelson Coutinho em debate. [Culture, democracy and socialism: The ideas of Carlos Nelson Coutinho in debate]. Rio de Janeiro: Mórula, 2016. 248 p.

  9. The leisure style of Canadian rural recreation participants: An analysis based on three different rural leisure settings

    Science.gov (United States)

    Paul Heintzman; Don. Dawson

    2012-01-01

    This study was a secondary analysis of data from a previous study of 248 Canadians on four dimensions of leisure style: time use, leisure setting, leisure activity participation, and leisure motivation. Correlation analyses were conducted to determine if frequency of participation in three rural leisure settings were related to other leisure style dimensions.

  10. Sales Simulation Games: Student and Instructor Perceptions

    Science.gov (United States)

    Beuk, Frederik

    2016-01-01

    This study combines the perspective of students (n = 137) and sales instructors (n = 248). It compares how well selling and sales management simulation games, case discussions, and traditional lectures are perceived to conform to the seven principles for good practice in undergraduate education. The study further compares each method's performance…

  11. Redefining Projections of Disease and Nonbattle Injury Patient Condition Code Distributions with Casualty Data from Operation Iraqi Freedom

    Science.gov (United States)

    2006-07-30

    2.48% 3.12% 198 Inguinal hernia complicated direct or indirect sliding incarceration of bowel 1.40% 1.76% 199 Inguinal hernia uncomplicated direct...1.10% 0.00% 293 Pelvic inflammatory disease all cases 1.63% 0.00% 294 Cervicitis endocervicitis with symptomatic leukorrhea 11.21% 0.00% 295

  12. Vlevo?

    Czech Academy of Sciences Publication Activity Database

    Janáček, Pavel; Šindelka, M.; Mandys, P.

    2013-01-01

    Roč. 57, 248 příl. Víkend č. 51 (2013), s. 32-34 ISSN 0862-9587 Institutional support: RVO:68378068 Keywords : Czech prose * Czech poetry * literature for children and youth * literature and politics Subject RIV: AJ - Letters, Mass-media, Audiovision

  13. Kinematics and physical conditions of H I in nearby radio sources. The last survey of the old Westerbork Synthesis Radio Telescope

    NARCIS (Netherlands)

    Maccagni, F. M.; Morganti, R.; Oosterloo, T. A.; Geréb, K.; Maddox, N.

    2017-01-01

    We present an analysis of the properties of neutral hydrogen (H I) in 248 nearby (0.02 30 mJy and for which optical spectroscopy is available. The observations were carried out with the Westerbork Synthesis Radio Telescope as the last large project before the

  14. On the collections of Birds, sent by the late A. T. Demery from the Sulymah River (W. Africa)

    NARCIS (Netherlands)

    Büttikofer, J.

    1892-01-01

    The collecting work of our much lamented african naturalist, Mr. A. T. Demery, having been abruptly stopped last year by his unexpected death (N. L. M. 1891, p. 248), it will be of no little importance to publish a list of the species of birds, obtained during his sojourn on the banks of the Sulymah

  15. 78 FR 31973 - Endangered and Threatened Species Permit Applications

    Science.gov (United States)

    2013-05-28

    ... O'odham Nation, Sells, Arizona. Applicant requests an amendment to a current permit for research and... (Herpailurus yagouaroundi), and ocelot (Leopardus pardalis) within Pima County, Tohono O'odham Nation, Arizona... and Wildlife Service, P.O. Box 1306, Room 6034, Albuquerque, NM 87103 at 505-248-6920. Please refer to...

  16. Five-Factor Personality Traits as Predictor of Career Maturity

    Science.gov (United States)

    Atli, Abdullah

    2017-01-01

    Purpose: This study aims to determine the predictive strength of personality traits based on the five-factor theory on the level of career maturity Research Methods: The sample of the study included a total of 429 high school students, 248 females (57.8%) and 181 males (42.2%). The study utilized the "Career Maturity Scale" to determine…

  17. Associateship | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Date of birth: 28 March 1982. Specialization: Molecular Ecology, Conservation Genetics, Wildlife Endocrinology Address: AECB Department, Wildlife Inst. of India, PO Box 18, Chandrabani, Dehradun 248 001, Uttarakhand Contact: Office: (0135) 264 6249. Residence: (0135) 264 6177, 81919 70271. Fax: (0135) 264 0117

  18. Neutron multiplicity of fission fragments

    Energy Technology Data Exchange (ETDEWEB)

    Abdelrahman, Y S [Physics department, mu` rah university Al-Karak, (Jordan)

    1995-10-01

    The total average neutron multiplicity of the fission fragments produced by the spontaneous fission of {sup 248} Cm has been measured. This measurement has been done by using a new experimental technique. This technique mainly depends on {gamma}-{gamma} coincidence using a very high resolution high purity germanium (HPGe) detector. 2 figs.

  19. Effect O6-Guanine Alkylation on DNA Flexibility Studied by Comparative Molecular Dynamics Simulations

    Czech Academy of Sciences Publication Activity Database

    Kara, M.; Dršata, Tomáš; Lankaš, Filip; Zacharias, M.

    2015-01-01

    Roč. 103, č. 1 (2015), s. 23-32 ISSN 0006-3525 R&D Projects: GA ČR(CZ) GA14-21893S Institutional support: RVO:61388963 Keywords : DNA damage * DNA alkylation * DNA repair * molecular simulation * molecular dynamics simulation Subject RIV: BO - Biophysics Impact factor: 2.248, year: 2015

  20. Activity Energy Expenditure and Mobility Limitation in Older Adults: Differential Associations by Sex

    NARCIS (Netherlands)

    Manini, T.M.; Everhart, J.E.; Patel, K.V.; Schoeller, D.A.; Cummings, S.; Mackey, D.C.; Bauer, D.C.; Simonsick, E.M.; Cobert, L.H.; Visser, M.; Tylavsky, F.; Newman, A.B.; Harris, T.B.

    2009-01-01

    In this study, the authors aimed to determine whether higher activity energy expenditure, assessed by using doubly labeled water, was associated with a reduced decline in mobility limitation among 248 older community-dwelling US adults aged 70-82 years enrolled in 1998-1999. Activity energy

  1. The Mississippi River Campaign 1862-1863: The Impact of Climate and Pathogens on Operational Art at the Port Hudson Siege

    Science.gov (United States)

    2017-04-13

    48 1 Introduction Sun Tzu , for one, advised commanders to, “camp on hard ground, the army...51 Bibliography ...Society Papers Volume XIII January to December 1885 (Richmond, VA: The Society, 1891), 329; Bell, 31. 248 Bell, 30. 52 Bibliography Army Doctrine

  2. Sand and clay mineralogy of sal forest soils of the Doon Siwalik ...

    Indian Academy of Sciences (India)

    3Forest Soil & Land Reclamation Division, Forest Research Institute, Dehradun 248 006, India. .... also helps in characterizing the soil mineralogical make-up in relation to the growth and develop- ment of the species essential for sustainable forest management. ...... and Weed S B (Madison: Soil Science Society of America).

  3. Clinical experience with telemetric intracranial pressure monitoring in a Danish neurosurgical center

    DEFF Research Database (Denmark)

    Lilja, Alexander; Andresen, Morten; Hadi, Amer

    2014-01-01

    kinds of hydrocephalus, seven patients had idiopathic intracranial hypertension (IIH) and three patients had normal pressure hydrocephalus (NPH). Fifteen patients had a shunt prior to implantation. Median duration of implantation was 248 (49-666) days and median duration from implantation to last...

  4. Strategies to Improve Teacher Retention in American Overseas Schools in the Near East South Asia Region: A Qualitative Analysis

    Science.gov (United States)

    Mancuso, Steven V.; Roberts, Laura; White, George P.; Yoshida, Roland K.; Weston, David

    2011-01-01

    Using a qualitative analysis and drawing from sociological theory, this study examined reasons for teacher turnover and retention from a representative sample of 248 teachers in American overseas schools in the Near East South Asia region. Results suggested that the most important reasons to stay or move pertained to supportive leadership,…

  5. 2015-2016 Travel and Hospitality Expense Reports for Joanne ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Ruxandra Staicu

    Montreal, Toronto, Vancouver. Airfare: $968.74. Other. Transportation: $248.71. Accommodation: $461.37. Meals and. Incidentals: $302.96. Other: $0.00. Total: $1,981.78. Comments: 2015-2016 Travel and Hospitality Expense. Reports for Joanne Charette, Vice-President,. Corporate Strategy and Communications.

  6. The appraisal of mathematics teachers in Ghana | Fletcher | African ...

    African Journals Online (AJOL)

    This study examined the nature and existing methods of teacher appraisal in Ghana. 441 secondary mathematics teachers participated, of whom 193 teach the subject at the junior secondary level and 248 teach it at the senior secondary level. In addition, 44 Ghana Education Service Officials and 6 Heads of secondary ...

  7. Thakur, Dr Vikram Chandra

    Indian Academy of Sciences (India)

    Home; Fellowship. Fellow Profile. Elected: 1991 Section: Earth & Planetary Sciences. Thakur, Dr Vikram Chandra Ph.D. (London). Date of birth: 15 January 1940. Specialization: Structural Geology, Tectonics of Himalayan Geology and Active Tectonics Address: 9/12 (Lane 9), Ashirwad Eclave, Dehra Dun 248 001, ...

  8. Download this PDF file

    African Journals Online (AJOL)

    1 (2003). Influence of feed energy levels on the growth performance of weaner pigs ... Results show that with increasing energy level in the diet, the Live ... kilogramme depoids wif a baissé de 248.99 F. CFA(2934 kcal/kg) a 155,33 F. CFA ...

  9. The Use of a Performance Assessment for Identifying Gifted Lebanese Students: Is DISCOVER Effective?

    Science.gov (United States)

    Sarouphim, Ketty M.

    2009-01-01

    The purpose of this study was to investigate the effectiveness of DISCOVER, a performance- based assessment in identifying gifted Lebanese students. The sample consisted of 248 students (121 boys, 127 girls) from Grades 3-5 at two private schools in Beirut, Lebanon. Students were administered DISCOVER and the Raven Standard Progressive Matrices…

  10. 77 FR 43873 - P.E. Partners III, LLC, et al.; Notice of Application

    Science.gov (United States)

    2012-07-26

    ... investment company adopt a written code of ethics and every ``access person'' of such registered investment... SECURITIES AND EXCHANGE COMMISSION [Investment Company Act Release No. 30143; 813-248] P.E... Company Act of 1940 (the ``Act'') granting an exemption from all provisions of the Act, except sections 9...

  11. Crystal structure of the cytoplasmic phosphatase and tensin homolog (PTEN)-like region of Ciona intestinalis voltage-sensing phosphatase provides insight into substrate specificity and redox regulation of the phosphoinositide phosphatase activity.

    Science.gov (United States)

    Matsuda, Makoto; Takeshita, Kohei; Kurokawa, Tatsuki; Sakata, Souhei; Suzuki, Mamoru; Yamashita, Eiki; Okamura, Yasushi; Nakagawa, Atsushi

    2011-07-01

    Ciona intestinalis voltage-sensing phosphatase (Ci-VSP) has a transmembrane voltage sensor domain and a cytoplasmic region sharing similarity to the phosphatase and tensin homolog (PTEN). It dephosphorylates phosphatidylinositol 4,5-bisphosphate and phosphatidylinositol 3,4,5-trisphosphate upon membrane depolarization. The cytoplasmic region is composed of a phosphatase domain and a putative membrane interaction domain, C2. Here we determined the crystal structures of the Ci-VSP cytoplasmic region in three distinct constructs, wild-type (248-576), wild-type (236-576), and G365A mutant (248-576). The crystal structure of WT-236 and G365A-248 had the disulfide bond between the catalytic residue Cys-363 and the adjacent residue Cys-310. On the other hand, the disulfide bond was not present in the crystal structure of WT-248. These suggest the possibility that Ci-VSP is regulated by reactive oxygen species as found in PTEN. These structures also revealed that the conformation of the TI loop in the active site of the Ci-VSP cytoplasmic region was distinct from the corresponding region of PTEN; Ci-VSP has glutamic acid (Glu-411) in the TI loop, orienting toward the center of active site pocket. Mutation of Glu-411 led to acquirement of increased activity toward phosphatidylinositol 3,5-bisphosphate, suggesting that this site is required for determining substrate specificity. Our results provide the basic information of the enzymatic mechanism of Ci-VSP.

  12. Alpha thalassemia among sickle cell anaemia patients in Kampala ...

    African Journals Online (AJOL)

    Keywords: Alpha thalassemia, sickle cell anaemia patients, Kampala, Uganda. DOI: http://dx.doi.org/10.4314/ahs.v15i2.48. Introduction. In the early 1960's many adults with sickle cell anaemia. (SCA) as well as those with mild disease were reported in Jamaica1. Various factors, both genetic and environmental, are.

  13. Prevalence and risk factors of anaemia in paediatric patients in ...

    African Journals Online (AJOL)

    South African Journal of Child Health ... deficiency 42.3% (p=0.001), glucose-6 phosphate dehydrogenase (G6PD) deficiency 24.8% (p=0.02), ... Malaria and iron deficiency remain common among ill children <5 years old who are anaemic.

  14. Development of an advanced, continuous mild gasification process for the production of co-products: Topical report

    Energy Technology Data Exchange (ETDEWEB)

    Cha, C.Y.; Merriam, N.W.; Jha, M.C.; Breault, R.W.

    1988-06-01

    Research on mild gasification is discussed. The report is divided into three sections: literature survey of mild gasification processes; literature survey of char, condensibles, and gas upgrading and utilization methods; and industrial market assessment of products of mild gasification. Recommendations are included in each section. (CBS) 248 refs., 58 figs., 62 tabs.

  15. Charged-particle multiplicity measurement in proton-proton collisions at root s=7 TeV with ALICE at LHC

    Czech Academy of Sciences Publication Activity Database

    Aamodt, K.; Abel, N.; Abeysekara, U.; Abrahantes Quintana, A.; Abramyan, A.; Adamová, Dagmar; Bielčík, Jaroslav; Bielčíková, Jana; Kapitán, Jan; Kushpil, Svetlana; Kushpil, Vasilij; Pachr, M.; Petráček, Vojtěch; Rak, Jan; Šumbera, Michal; Tlustý, David; Wagner, Vladimír; Mareš, Jiří A.; Polák, Karel; Závada, Petr

    2010-01-01

    Roč. 68, 3-4 (2010), s. 345-354 ISSN 1434-6044 R&D Projects: GA MŠk LA08015 Institutional research plan: CEZ:AV0Z10480505; CEZ:AV0Z10100502 Keywords : PSEUDORAPIDITY DISTRIBUTIONS * PP INTERACTIONS * ENERGIES Subject RIV: BG - Nuclear, Atomic and Molecular Physics, Colliders Impact factor: 3.248, year: 2010

  16. Profile of TP53 gene mutations in sinonasal cancer

    DEFF Research Database (Denmark)

    Holmila, Reetta; Bornholdt, Jette; Suitiala, Tuula

    2010-01-01

    databases for head and neck squamous cell carcinoma (24%). Characteristically, in our SNC series, the mutations were scattered over a large number of codons, codon 248 being the most frequent target of base substitution. Codon 135 was the second most frequently mutated codon; this nucleotide position has...

  17. 76 FR 60873 - Jeffery M. Freesemann, M.D.; Decision and Order

    Science.gov (United States)

    2011-09-30

    ... of probation with limitations, reporting conditions, and ethics training would ``provide adequate... to purchase methamphetamine. Id. Galvan also telephoned Phil Nunez (Nunez), an individual the... admitted to practice medicine in California) he was hired by a Bakersfield physician. Tr. 248. The...

  18. 77 FR 751 - Federal Motor Vehicle Safety Standards; Matters Incorporated by Reference

    Science.gov (United States)

    2012-01-06

    ... Recommended Practice J1133, ``School Bus Stop Arm,'' revised April 1984, into Sec. 571.131. (45) SAE Standard... constriction requirement of S5.3.1 after having been subjected to a temperature of 248 degrees Fahrenheit (120... mandatory requirements. * * * * * S6.4.5 School bus signal lamp aiming. Each school bus signal lamp must be...

  19. Inclusiveness of identification among farmers in The Netherlands and Galicia (Spain)

    NARCIS (Netherlands)

    Klandermans, P.G.; Sabucedo, J.M.; Rodriguez, M.

    2004-01-01

    In this paper we discuss inclusiveness of identification among farmers in Galicia (Spain) and The Netherlands. Identification with three nested categories - farmers in the local community, farmers in the country, and farmers in Europe was assessed among 167 Dutch and 248 Galician farmers at three

  20. 30 CFR 250.242 - What information must accompany the DPP or DOCD?

    Science.gov (United States)

    2010-07-01

    ... § 250.248; (g) Air emissions information required by § 250.249; (h) Oil and hazardous substance spills...? 250.242 Section 250.242 Mineral Resources MINERALS MANAGEMENT SERVICE, DEPARTMENT OF THE INTERIOR....258; (q) Sulphur operations information required by § 250.259; (r) Coastal zone management information...

  1. Pulmonary hemorrhage complicating radiofrequency ablation, from mild hemoptysis to life-threatening pattern

    Energy Technology Data Exchange (ETDEWEB)

    Nour-Eldin, Nour-Eldin A.; Naguib, Nagy N.N.; Mack, Martin; Abskharon, John E.; Vogl, Thomas J. [Johann Wolfgang Goethe-University Hospital, Institute for Diagnostic and Interventional Radiology, Frankfurt am Main (Germany)

    2011-01-15

    To assess risk factors and the extent of pulmonary hemorrhage complicating radiofrequency ablation (RFA) of pulmonary neoplasms. This retrospective study involved 248 ablation sessions for lung tumors (20 primary lesions and 228 metastatic lesions) in 164 patients (mean age 59.7 years, SD: 10.2). Both unipolar and bipolar radiofrequency systems were used under CT fluoroscopic guidance. Extent and underlying factors associated with development of pulmonary hemorrhage were analyzed. Incidence of intra-parenchymal pulmonary hemorrhage, pleural effusion, and hemoptysis were 17.7% (44/248 sessions), 4% (8/248 sessions), and 16.1% (40/248 sessions), respectively. Death because of massive bleeding occurred in one session (0.4%). Significant risk factors associated with intra-parenchymal hemorrhage included: lesions of <1.5 cm diameter (P = 0.007); basal and middle lung zone lesions (P = 0.026); increased needle track distance traversing the lung parenchyma >2.5 cm (P = 0.0017); traversing pulmonary vessels in the track of ablation (P < 0.001); and the use of multi-tined electrodes (P = 0.004). Concomitant incidence of pulmonary hemorrhage and pneumothorax was 29.2% (14/48 sessions). While typically safe, RFA of pulmonary neoplasms can result in pulmonary hemorrhage ranging from mild to life-threatening. Management of this complication is mainly preventive through adequate patient selection for ablation therapy and exclusion of technically avoidable risk factors. (orig.)

  2. Browse Title Index

    African Journals Online (AJOL)

    Items 101 - 150 of 248 ... AJ Jordaan, D Sakulski, AD Jordaan. Vol 43, No 1 ... Vol 38 (2009), Job burnout and coping strategies among extension agents in south western Nigeria, Abstract ... Vol 44, No 2 (2016), Mobile phone use by small-scale farmers: a potential to transform production and marketing in Zimbabwe, Abstract.

  3. Determinants of Use of Indigenous Fish Processing Practices in ...

    African Journals Online (AJOL)

    Descriptive statistics was used to analyze the socio- economic features of the fish processors while the logit model was used to capture the socio-economic factors ... education (β=1.90), household size (β=2.48), FAI (β=2.80), consumers preference (β=3.37), processing tradition (β=3.74), VFP (β=0.02) and cosmopoliteness ...

  4. Probability inequalities for decomposition integrals

    Czech Academy of Sciences Publication Activity Database

    Agahi, H.; Mesiar, Radko

    2017-01-01

    Roč. 315, č. 1 (2017), s. 240-248 ISSN 0377-0427 Institutional support: RVO:67985556 Keywords : Decomposition integral * Superdecomposition integral * Probability inequalities Subject RIV: BA - General Mathematics OBOR OECD: Statistics and probability Impact factor: 1.357, year: 2016 http://library.utia.cas.cz/separaty/2017/E/mesiar-0470959.pdf

  5. Hydrogeochemical and anthropogenic influence on the quality of ...

    African Journals Online (AJOL)

    Sixty percent (60%) of the groundwater samples were slightly acidic (5.5-6.4) and were different from the WHO (2004) standard for drinking water. Electrical conductivity values (3-274 μS/cm) and total dissolved solids (7.66 to 248.30 mg/l) for groundwater sources were low and signified low mineralisation and freshwater ...

  6. Evaluating compliance to Kenya national cancer guidelines on ...

    African Journals Online (AJOL)

    East African Medical Journal ... Duration from index breast clinic review to surgery was 64.0 ±114.4 days. Documentation on findings from clinical assessment varied between 24.8 to 86.4%. ... place to track as well as prioritize patients with breast cancer in terms of investigations and surgical interventions in a timely manner.

  7. Assembling a species-area curve through colonization, speciation and human-mediated introduction

    Czech Academy of Sciences Publication Activity Database

    Economo, E. P.; Janda, Milan; Guénard, B.; Sarnat, E. M.

    2017-01-01

    Roč. 44, č. 5 (2017), s. 1088-1097 ISSN 0305-0270 R&D Projects: GA ČR GAP505/12/2467 Institutional support: RVO:60077344 Keywords : ants * colonization * exotic species Subject RIV: EH - Ecology, Behaviour OBOR OECD: Ecology Impact factor: 4.248, year: 2016 http://onlinelibrary.wiley.com/doi/10.1111/jbi.12884/abstract

  8. Dysfunctional Relationship Beliefs in Parent-Late Adolescent Relationship and Conflict Resolution Behaviors

    Science.gov (United States)

    Hamamci, Zeynep

    2007-01-01

    The purpose of this study is to investigate the role of dysfunctional relationships beliefs on both the perceptions of their relationships with the parents and conflict resolution behaviors of late adolescence. The sample was consisted of 372 Turkish university students (248 women and 124 men). Interpersonal Cognitive Distortions Scale,…

  9. Ligninolytic enzyme complex of Armillaria spp

    Czech Academy of Sciences Publication Activity Database

    Stoychev, I.; Nerud, František

    2000-01-01

    Roč. 45, č. 3 (2000), s. 248-250 ISSN 0015-5632 Institutional research plan: CEZ:AV0Z5020903 Keywords : lignin olytic enzyme * lignin peroxidase Subject RIV: EE - Microbiology, Virology Impact factor: 0.752, year: 2000

  10. Multiple Facets of Self-Control in Arab Adolescents: Parallel Pathways to Greater Happiness and Less Physical Aggression

    Science.gov (United States)

    Gavriel-Fried, Belle; Ronen, Tammie; Agbaria, Qutaiba; Orkibi, Hod; Hamama, Liat

    2018-01-01

    Adolescence is a period of dramatic change that necessitates using skills and strengths to reduce physical aggression and increase happiness. This study examined the multiple facets of self-control skills in achieving both goals simultaneously, in a sample of 248 Arab adolescents in Israel. We conceptualized and tested a new multi-mediator model…

  11. Predictors of Maternal Sensitivity in At-Risk Families

    Science.gov (United States)

    Neuhauser, Alex

    2018-01-01

    Maternal sensitivity is of central importance to a child's healthy development. This study examines how different types of psychosocial stress originating from the child, the parents, the context, and overall stress relate to maternal sensitivity. Psychosocial stress and its impact on maternal sensitivity are assessed in an at-risk sample of 248

  12. Analysis of genetic diversity of Piper spp. in Hainan Island (China ...

    African Journals Online (AJOL)

    Inter-simple sequence repeat (ISSR) analysis was used to evaluate the genetic variation of Piper spp. from Hainan, China. 247 polymorphic bands out of a total of 248 (99.60%) were generated from 74 individual plants of Piper spp. The overall level of genetic diversity among Piper spp. in Hainan was high, with the mean ...

  13. Genetic diversity of Santalum album using random amplified ...

    African Journals Online (AJOL)

    In the present study Random Amplified Polymorphic DNA (RAPD) technique was used to accesses the genetic diversity among 30 accessions of S. album collected from different parts of South India. A total of 248 polymorphic amplicons were obtained from 30 primers. The value of Jaccard coefficient ranged from 0.66 to ...

  14. Studies on the chemistry of element 104 with the centrifuge system SISAK-3

    Energy Technology Data Exchange (ETDEWEB)

    Eberhardt, K.; Kratz, J.V.; Mendel, M.; Naehler, A.; Trautmann, N.; Wiehl, N. [Mainz Univ. (Germany); Alstadt, J.; Omtvedt, J.P. [Oslo Univ. (Norway); Malmbeck, R.; Skarnemark, G.; Wierczinski, B. [Chalmers Univ. of Technology, Goeteborg (Sweden); Eichler, B.; Gaeggeler, H.W.; Jost, D.T.; Tuerler, A. [Paul Scherrer Inst. (PSI), Villigen (Switzerland)

    1997-09-01

    The centrifuge system SISAK-3 combined with a detector for the measurement of {alpha}-particles and spontaneous fission (SF) fragments in a flowing organic liquid has been applied to study the chemical behaviour of element 104 produced in the reaction {sup 248}Cm({sup 18}O,5n){sup 261}104. (author) 2 figs., 2 refs.

  15. The Language Growth of Spanish-Speaking English Language Learners

    Science.gov (United States)

    Rojas, Raul; Iglesias, Aquiles

    2013-01-01

    Although the research literature regarding language growth trajectories is burgeoning, the shape and direction of English Language Learners' (ELLs) language growth trajectories are largely not known. This study used growth curve modeling to determine the shape of ELLs' language growth trajectories across 12,248 oral narrative language samples…

  16. Relaxation of Shot-Peened Residual Stresses Under Creep Loading (Preprint)

    Science.gov (United States)

    2008-10-01

    Residual Stresses,” SAE Technical Paper No. 710285, SAE , 1971. [8] Hoffman, J., Scholtes, B., Vöhringer, O., and Macherauch, E., “Thermal relaxation of...relaxation in an AISI 4140 steel due to quasistatic and cyclic loading at higher temperatures,” Material Science and Engineering A248, 1998, pp. 9

  17. Erratum: Correction to: Rapid and controllable perforation of carbon nanotubes by microwave radiation

    Science.gov (United States)

    Ojaghi, Neda; Mokhtarifar, Maryam; Sabaghian, Zahra; Arab, Hamed; Maghrebi, Morteza; Baniadam, Majid

    2018-06-01

    This study presents a new controlled approach to deep perforation of millimeter-long carbon nanotube arrays (CNTAs) by fast oxidative cutting. The approach is based on decorating CNTAs with silver (Ag) nanoparticles, followed by heating Ag-decorated CNTAs with microwave radiation (2.48 GHz, 300 W).

  18. Discovery of SM Higgs Boson in ATLAS Experiment

    Indian Academy of Sciences (India)

    Home; Journals; Resonance – Journal of Science Education; Volume 18; Issue 3. Discovery of SM Higgs Boson in ATLAS Experiment. Prafulla Kumar Behera. General Article Volume 18 Issue 3 March 2013 pp 248-263. Fulltext. Click here to view fulltext PDF. Permanent link:

  19. Body Mass Bias in a Combat Fitness Test

    Science.gov (United States)

    2011-02-07

    Allometric scaling of isokinetic peak torque: The Nebraska Wrestling Study. European Journal of Applied Physiology, 80, 240–248. White, C. R...applied to the Movement and 3-mi run times after converting times to velocity (in meters ). The estimated metabolic rate mass coefficients were

  20. Mesophase properties after anthracene thermal exposure

    Czech Academy of Sciences Publication Activity Database

    Šugárková, Věra; Plevová, Eva; Kaloč, M.

    -, - (2008), s. 62-70. ISBN 978-80-248-1939-6 Grant - others:GA ČR GA105/00/1698 Institutional research plan: CEZ:AV0Z30860518 Keywords : mesophase * anthracene * thermal behaviour * anisotropy Subject RIV: CC - Organic Chemistry

  1. 77 FR 77005 - Subsistence Management Program for Public Lands in Alaska; Rural Determination Process

    Science.gov (United States)

    2012-12-31

    ...-R7-SM-2012-N248;FXFR13350700640-134-FF07J00000] Subsistence Management Program for Public Lands in Alaska; Rural Determination Process AGENCIES: Forest Service, Agriculture; Fish and Wildlife Service... the Interior initiated a review of the Federal Subsistence Management Program. An ensuing directive...

  2. Detection of Hg2+ ions in aqueous medium using an indole-based fluorescent probe: Experimental and theoretical investigations

    Czech Academy of Sciences Publication Activity Database

    Joshi, S.; Kumari, S.; Sarmah, Amrit; Pant, D. D.; Sakhuja, R.

    2017-01-01

    Roč. 248, Dec (2017), s. 668-677 ISSN 0167-7322 Institutional support: RVO:61388963 Keywords : coumarin * chemosensor * fluorescence * quenching * mercury * DFT calculations Subject RIV: CF - Physical ; Theoretical Chemistry OBOR OECD: Physical chemistry Impact factor: 3.648, year: 2016

  3. Nb-Ta-Ti-W-Sn-oxide minerals as indicators of a peraluminous P- and F-rich granitic system evolution: Podlesí, Czech Republic

    Czech Academy of Sciences Publication Activity Database

    Breiter, Karel; Škoda, R.; Uher, P.

    2007-01-01

    Roč. 91, 3-4 (2007), s. 225-248 ISSN 0930-0708 Institutional research plan: CEZ:AV0Z30130516 Keywords : minerals * granitic system Subject RIV: DB - Geology ; Mineralogy Impact factor: 0.907, year: 2007

  4. Nigerian Quarterly Journal of Hospital Medicine - Vol 8, No 4 (1998)

    African Journals Online (AJOL)

    Clinical trial of Roxithromychin in the Lagos University Teaching Hospital and other health facilities in Lagos · EMAIL FULL TEXT EMAIL FULL TEXT DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. A F Mabadeje, E O Bandele, T Odugbemi, M O Mabayoje, E L Bamgboye, R B Sanusi, A K Abiose, T A Odutola, 248-250.

  5. ADHD and DAT1: Further evidence of paternal over-transmission of risk alleles and haplotype

    NARCIS (Netherlands)

    Hawi, Z.; Kent, L.; Hill, M.; Anney, R.J.; Brookes, K. J.; Barry, E.; Franke, B.; Banaschewski, T.; Buitelaar, J.; Ebstein, R.; Miranda, A.; Oades, R.D.; Roeyers, H.; Rothenberger, A.; Sergeant, J.A.; Sonuga-Barke, E.; Steinhausen, H.C.; Faraone, S.V.; Asherson, P.; Gill, M.

    2009-01-01

    We [Hawi et al. (2005); Am J Hum Genet 77:958-965] reported paternal over-transmission of risk alleles in some ADHD-associated genes. This was particularly clear in the case of the DAT1 30-UTR VNTR. In the current investigation, we analyzed three new sample comprising of 1,248 ADHD nuclear families

  6. ADHD and DAT1: further evidence of paternal over-transmission of risk alleles and haplotype.

    NARCIS (Netherlands)

    Hawi, Z.; Kent, L.; Hill, M.; Anney, R.J.; Brookes, K.J.; Barry, E.; Franke, B.; Banaschewski, T.; Buitelaar, J.K.; Ebstein, R.; Miranda, A.; Oades, R.D.; Roeyers, H.; Rothenberger, A.; Sergeant, J.A.; Sonuga-Barke, E.J.S.; Steinhausen, H.C.; Faraone, S.V.; Asherson, P.; Gill, M.

    2010-01-01

    We [Hawi et al. (2005); Am J Hum Genet 77:958-965] reported paternal over-transmission of risk alleles in some ADHD-associated genes. This was particularly clear in the case of the DAT1 3'-UTR VNTR. In the current investigation, we analyzed three new sample comprising of 1,248 ADHD nuclear families

  7. Urban Principal Leadership Skill Proficiency and Student Achievement

    Science.gov (United States)

    Winn, Pam; Erwin, Sue; Gentry, Jim; Cauble, Mary

    2009-01-01

    Because of the importance of developing highly skilled urban school leaders, statewide assessments of 248 urban Texas public school administrators were analyzed to determine principal confidence levels in leadership skill domains identified by the National Policy Board of Educational Administration (NPBEA). Important findings indicate differences…

  8. Limitations to Plasticity of Language Network Reorganization in Localization Related Epilepsy

    Science.gov (United States)

    Mbwana, J.; Berl, M. M.; Ritzl, E. K.; Rosenberger, L.; Mayo, J.; Weinstein, S.; Conry, J. A.; Pearl, P. L.; Shamim, S.; Moore, E. N.; Sato, S.; Vezina, L. G.; Theodore, W. H.; Gaillard, W. D.

    2009-01-01

    Neural networks for processing language often are reorganized in patients with epilepsy. However, the extent and location of within and between hemisphere re-organization are not established. We studied 45 patients, all with a left hemisphere seizure focus (mean age 22.8, seizure onset 13.3), and 19 normal controls (mean age 24.8) with an fMRI…

  9. List of Participating Institutions: Associated Schools Project in Education for International Co-operation and Peace = Liste des establissements participants: Systeme des ecoles associees appliquant un programme d'education pour la cooperation internationale et la paix = Lista de Instituciones Participantes: Plan de Escuelas Asociadas en la Educacion para la Cooperacion Internacional y la Paz.

    Science.gov (United States)

    United Nations Educational, Scientific, and Cultural Organization, Paris (France).

    A list of participating institutions at the Associated Schools Project in Education for International Co-Operation and Peace, December 31, 1985 is presented. A total of 1,970 institutions in 94 countries participated, including 47 nursery schools, 556 primary schools, 1,123 secondary schools, and 248 teacher training institutions. Addresses of…

  10. 78 FR 42544 - Outer Continental Shelf (OCS), Gulf of Mexico (GOM), Oil and Gas Lease Sale, Western Planning...

    Science.gov (United States)

    2013-07-16

    ... Prepare a Supplemental Environmental Impact Statement (EIS) SUMMARY: Consistent with the regulations... 248; Central Planning Area (CPA) Lease Sales 227, 231, 235, 241, and 247, Final Environmental Impact... Supplemental Environmental Impact Statement (OCS EIS/EA BOEM 2013-0118) (WPA 233/CPA 231 Supplemental EIS). The...

  11. Does Bachelor's-Level Social Work Education Impact Students' Knowledge and Attitudes Regarding Substance-Abusing Clients?

    Science.gov (United States)

    Senreich, Evan; Straussner, Shulamith Lala A.

    2013-01-01

    This study compared 248 graduating seniors with 301 beginning juniors at 10 bachelor's-level social work programs in the Northeast concerning their knowledge and attitudes regarding working with substance-abusing clients. Graduating seniors demonstrated modestly higher levels of knowledge and only slightly more positive attitudes toward working…

  12. Ontogenesis of the oral vestibule in the sheep (Ovis aries, Ruminantia)

    Czech Academy of Sciences Publication Activity Database

    Pavlíková, H.; Witter, K.; Míšek, Ivan

    2001-01-01

    Roč. 248, č. 3 (2001), s. 270-270 ISSN 0362-2525 R&D Projects: GA AV ČR IAA7039901; GA AV ČR KSK6005114 Keywords : striated palatal muscle Subject RIV: EG - Zoology Impact factor: 0.959, year: 2001

  13. Zonisamide suppresses the tonic phase but not the clonic phase of generalized seizures in developing rats

    Czech Academy of Sciences Publication Activity Database

    Mareš, Pavel

    2010-01-01

    Roč. 92, 2-3 (2010), s. 244-248 ISSN 0920-1211 R&D Projects: GA MŠk(CZ) LC554 Institutional research plan: CEZ:AV0Z50110509 Keywords : zonisamide * pentylenetetrazol * ontogeny Subject RIV: FR - Pharmacology ; Medidal Chemistry Impact factor: 2.302, year: 2010

  14. [Results of school inspections in the county of Karl-Marx-Stadt (author's transl)].

    Science.gov (United States)

    Arnold, J

    1978-10-01

    Within the Health Protection in Childhood and Adolescence Research Project a hygienic inspection questionnaire was designed for schools. To test this questionnaire, 248 schools in 11 districts of the county of Karl-Marx-Stadt were inspected. From the ascertainments made, several instances are cited to point out the priorities of school hygiene.

  15. Go4Life

    Medline Plus

    Full Text Available ... some of these Go4Life exercises to improve your flexibility! 2:48 Play next Play now Go4Life Exercise-- ... 17,679 views Exercise your upper body at work like Linda with Go4Life's Wall Pushups. CC 1: ...

  16. Use of Complementary and Alternative Medicine (CAM) Treatments by Parents of Children with Autism Spectrum Disorders

    Science.gov (United States)

    Christon, Lillian M.; Mackintosh, Virginia H.; Myers, Barbara J.

    2010-01-01

    Parents of children with autism spectrum disorders (ASDs) may elect to use complementary and alternative medicine (CAM) treatments with their children in place of, or in addition to, conventional treatments. CAM treatments are controversial and understudied and, for most, the efficacy has not been established. The current study (n = 248) examined…

  17. Postsecondary Strengths, Challenges, and Supports Experienced by Foster Care Alumni College Graduates

    Science.gov (United States)

    Salazar, Amy M.; Jones, Kevin R.; Emerson, John C.; Mucha, Lauren

    2016-01-01

    Young people transitioning from foster care to college experience unique identities and circumstances that make being successful in college especially challenging. We used qualitative survey data from 248 college graduates who were formerly in foster care to explore the strengths, challenges, and supports they experienced while in college that…

  18. Estrogenic activity in extracts and exudates of cyanobacteria and green algae

    Czech Academy of Sciences Publication Activity Database

    Sychrová, E.; Štěpánkdová, T.; Nováková, K.; Bláha, Luděk; Giesy, J.P.; Hilscherová, K.

    2012-01-01

    Roč. 39, č. 1 (2012), s. 134-140 ISSN 0160-4120 R&D Projects: GA ČR GA524/08/0496 Institutional support: RVO:67985939 Keywords : cyanobacteria * endocrine disruption * estrogenicity * algae * phytoplankton Subject RIV: EF - Botanics Impact factor: 6.248, year: 2012

  19. 1731-IJBCS-Article-Ngbolua K. N

    African Journals Online (AJOL)

    hp

    anthocyanin extract from Justicia secunda Vahl on the solubility of haemoglobin S and membrane stability of sickle erythrocytes. Blood Transfus., 8: 248-254. Mpiana PT, Mudogo V, Kabangu YF,. Tschibangu DST, Ngbolua KN, Atibu,. EK, Mangwala KP, Mbala MB, Makelele. LK, Bokota MT. 2009a. Antisickling activity and.

  20. Synthesis and evaluation of organovermiculite-polypropylene nanocomposites

    Czech Academy of Sciences Publication Activity Database

    Valášková, M.; Simha Martynková, G.; Matějka, V.; Barabaszová, K.; Plevová, Eva; Měřínská, D.

    2008-01-01

    Roč. 2, - (2008), s. 148-151. ISBN 978-80-248-1863-4. ISSN N Grant - others:GA ČR(CZ) GA205/08/0869 Institutional research plan: CEZ:AV0Z30860518 Keywords : Organocermiculite * intercalation * thermal stability Subject RIV: CC - Organic Chemistry

  1. Isolation and genetic characterization of Toxoplasma gondii from the gray wolf Canis lupus

    Science.gov (United States)

    Little is known of the genetic diversity of Toxoplasma gondii circulating in wildlife. In the present study feral gray wolf (Canis lupus) from Minnesota were examined for T. gondii infection. Antibodies to T. gondii were detected in 130 (52.4%) of 248 wolves tested by the modified agglutination test...

  2. 76 FR 73775 - Information Collection Activities

    Science.gov (United States)

    2011-11-29

    ... materials shipments. Part 172 of the HMR requires persons who offer or transport certain hazardous materials... shipment of hazardous materials in a bulk packaging with a capacity equal to or greater than 13,248 L (3... such a requirement posed problems for motor carriers with regard to complying with segregation...

  3. A closed solar photobioreactor for cultivation of microalgac under supra-high irradiance: basic design and performance

    Czech Academy of Sciences Publication Activity Database

    Masojídek, Jiří; Papáček, Štěpán; Sergejevova, Magda; Jirka, V.; Červený, J.; Kunc, J.; Korečko, J.; Verbovikova, O.; Kopecký, Jiří; Štys, Dalibor; Torzillo, G.

    2003-01-01

    Roč. 15, - (2003), s. 239-248 ISSN 0921-8971 R&D Projects: GA MŠk LN00A141 Institutional research plan: CEZ:AV0Z5020903 Keywords : cyanobacterium * spirulina * photoinhibition Subject RIV: CE - Biochemistry Impact factor: 0.828, year: 2003

  4. Surveying Adult Education Practitioners about Ethical Issues.

    Science.gov (United States)

    McDonald, Kimberly S.; Wood, George S., Jr.

    1993-01-01

    An Indiana survey of 113 of 248 adult basic educators, 113 of 117 trainers, and 23 of 29 continuing educators identified ethical dilemmas they face. Fifty-two percent believed a code of ethics should be created and enforced by professional associations, covering broad issues. Those who had experience with codes were positive about them. (SK)

  5. Organometallic Half-Sandwich Iridium Anticancer Complexes

    Czech Academy of Sciences Publication Activity Database

    Liu, Z.; Habtemariam, A.; Pizarro, A.M.; Fletcher, S.A.; Kisová, Anna; Vrána, Oldřich; Salassa, L.; Bruijnincx, P.C.A.; Clarkson, G.J.; Brabec, Viktor; Sadler, P. J.

    2011-01-01

    Roč. 54, č. 8 (2011), 3011-3026 ISSN 0022-2623 R&D Projects: GA ČR(CZ) GPP303/11/P047; GA ČR(CZ) GAP301/10/0598 Keywords : RUTHENIUM(II) ARENE COMPLEXES * CANCER-CELL CYTOTOXICITY * DNA-BINDING PROPERTIES Subject RIV: BO - Biophysics Impact factor: 5.248, year: 2011

  6. Novel thidiazuron-derived inhibitors of cytokinin oxidase/dehydrogenase

    Czech Academy of Sciences Publication Activity Database

    Nisler, Jaroslav; Kopečný, D.; Končitíková, R.; Zatloukal, Marek; Bazgier, Václav; Berka, K.; Zalabák, D.; Briozzo, P.; Strnad, Miroslav; Spíchal, Lukáš

    2016-01-01

    Roč. 92, 1-2 (2016), s. 235-248 ISSN 0167-4412 R&D Projects: GA MŠk(CZ) LO1204; GA ČR GA15-22322S Institutional support: RVO:61389030 Keywords : Cytokinin oxidase/dehydrogenase * Crystal structure * Molecular docking Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 3.356, year: 2016

  7. AcEST: BP919367 [AcEST

    Lifescience Database Archive (English)

    Full Text Available |Q0VJ74_9BILA Calreticulin OS=Heligmosomoides polygyrus... 36 1.3 tr|A8WXR3|A8WXR3_CAEBR Putative uncharacte...+ +++A AE KK +R+ Sbjct: 248 QAAIDSLQRKRARRSAALAEQRKKLQQRQ 276 >tr|Q0VJ74|Q0VJ74_9BILA Calreticulin OS=Heligmos

  8. Location-level links between diversity and innovative climate depend on national power distance

    NARCIS (Netherlands)

    Van der Vegt, Gerben S.; Van de Vliert, Evert; Huang, X

    2005-01-01

    In this study, we examined the relationship between the demographic diversity and innovative climates of 248 organizational locations of a multinational company in 24 countries. Supporting a status characteristics perspective, multilevel analyses revealed that diversity in the more task-oriented

  9. Quality Indicators and Outcomes of Emergency Caesarean ...

    African Journals Online (AJOL)

    AJRH Managing Editor

    The objective of this research study is to identify quality indicators of cesarean deliveries and determine their relationship to neonatal ..... (N=39). P value. Mean. Age. 24.8 + 5.8. 25.6 + 5.9. 0.74. Duration of labor. (hours) ... chains must be improved on a national and local ... emergency obstetric care: A handbook, Geneva,.

  10. Vliv typu vazby historického zdiva na jeho teplotní namáhání

    Czech Academy of Sciences Publication Activity Database

    Beran, Pavel

    2013-01-01

    Roč. 22, č. 10 (2013), s. 248-253 ISSN 1805-2576 R&D Projects: GA ČR(CZ) GBP105/12/G059 Institutional support: RVO:68378297 Keywords : thermal expansion * masonry * thermal stress * compatibility Subject RIV: JN - Civil Engineering http://www.stavebniobzor.cz/clanek/vliv-typu-vazby-historickeho-zdiva-na-jeho-teplotni-namahani/

  11. ORF Alignment: NC_004557 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_004557 gi|28211518 >1v7zA 1 255 3 250 2e-62 ... ref|NP_782462.1| creatininase [Clo...stridium tetani E88] gb|AAO36399.1| creatininase ... [Clostridium tetani E88] ... Length = 248

  12. Affinity Capillary Electrophoresis – A Powerful Tool to Investigate Biomolecular Interactions

    Czech Academy of Sciences Publication Activity Database

    Kašička, Václav

    2017-01-01

    Roč. 30, č. 5 (2017), s. 248 ISSN 1471-6577 Institutional support: RVO:61388963 Keywords : capillary affinity electrophoresis * biomolecular interactions * binding constants Subject RIV: CB - Analytical Chemistry, Separation OBOR OECD: Analytical chemistry Impact factor: 0.663, year: 2016

  13. 7 CFR 275.21 - Quality control review reports.

    Science.gov (United States)

    2010-01-01

    ... terminals, the State agency shall submit the results of each QC review in a format specified by FNS. Upon... in the individual case records, or legible copies of that material, as well as legible hard copies of... selection and completion on the Form FNS-248, Status of Sample Selection and Completion or other format...

  14. The distribution of the ABO blood groups among the diabetes ...

    African Journals Online (AJOL)

    The distribution of the ABO blood groups among the diabetes mellitus patients. ... Among diabetic men, the frequency of only blood group B was significantly higher, while on the contrary among diabetic women the frequency of both A and B (29.7% vs. 24.8%; P = 0.03 and 25.5% vs. 20%; P < 0.009, respectively) were ...

  15. Bacteriology of post–operative wound infections in the surgical ...

    African Journals Online (AJOL)

    A total of 248 swab specimens from post-operative wounds suspected to be infected were bacteriologically evaluated. Of these, bacterial growth was recorded in 204 specimens (82.3%) while 44 specimens (17.7%) yielded no growth. The bacteria isolated from the samples in decreasing order of prevalence were: ...

  16. Biodiversity of traits and species both show weak responses to hydromorphological alteration in lowland river macroinvertebrates

    Czech Academy of Sciences Publication Activity Database

    Feld, Ch. K.; de Bello, Francesco; Dolédec, S.

    2014-01-01

    Roč. 59, č. 2 (2014), s. 233-248 ISSN 0046-5070 R&D Projects: GA ČR GAP505/12/1296 Institutional support: RVO:67985939 Keywords : taxonomic distinctness * taxonomic diversity * trait diversity Subject RIV: EH - Ecology, Behaviour Impact factor: 2.738, year: 2014

  17. Erythrobacter pelagi sp. nov., a member of the family Erythrobacteraceae isolated from the Red Sea

    KAUST Repository

    Wu, H.-x.; Lai, P. Y.; Lee, O. O.; Zhou, X.-j.; Miao, L.; Wang, H.; Qian, P.-Y.

    2011-01-01

    C. The isolate did not produce bacteriochlorophyll a. The predominant cellular fatty acids were C-17:1 omega 6c, summed feature 8 (C-18:1 omega 6c and/or C-18:1 omega 7c) and C-15:0 2-OH. The genomic DNA G+C content of strain UST081027-248(T) was 60

  18. Towards the spatial coherence of biogeographical regionalizations at subcontinental and landscape scales

    Czech Academy of Sciences Publication Activity Database

    Divíšek, Jan; Storch, D.; Zelený, D.; Culek, M.

    2016-01-01

    Roč. 43, č. 43 (2016), s. 2489-2501 ISSN 0305-0270 Institutional support: RVO:68145535 Keywords : beta diversity * biogeographical regions * spatial scale Subject RIV: DE - Earth Magnetism, Geodesy, Geography Impact factor: 4.248, year: 2016 http://onlinelibrary.wiley.com/doi/10.1111/jbi.12832/full

  19. Composition dependence of the lattice vibrations in Sr.sub.n+1./sub.Ti.sub.n./sub.O.sub.3n+1./sub. Ruddlesden-Popper homologous series

    Czech Academy of Sciences Publication Activity Database

    Kamba, Stanislav; Samoukhina, Polina; Kadlec, Filip; Pokorný, Jan; Petzelt, Jan; Reaney, I. M.; Wise, P. L.

    2003-01-01

    Roč. 23, - (2003), s. 2639-2645 ISSN 0955-2219 R&D Projects: GA ČR GA202/01/0612; GA ČR GA203/99/0067 Institutional research plan: CEZ:AV0Z1010914 Keywords : dielectric properties * perovskites * spectroscopy Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 1.248, year: 2003

  20. Implications of Posttraumatic Stress among Military-Affiliated and Civilian Students

    Science.gov (United States)

    Barry, Adam E.; Whiteman, Shawn D.; MacDermid Wadsworth, Shelley M.

    2012-01-01

    Objectives: To determine whether posttraumatic stress (PTS) symptoms are associated with problem drinking and alcohol-related consequences, as well as academic correlates among military-affiliated and civilian students. Participants: The final sample (n = 248) included 78 combat-exposed student service members/veterans, 53 non-combat-exposed…