WorldWideScience

Sample records for berkelium 248

  1. New berkelium isotope: 242Bk

    International Nuclear Information System (INIS)

    A new isotope of berkelium, 242Bk, was produced with a cross section of approx. 10 μb in reactions of boron on uranium and nitrogen on thorium. It decays by electron capture with a half-life of 7 +- 1.3 minutes. The branching ratio for this isotope for alpha decay is less than 1% and that for spontaneous fission is less than 0.03%. 2 figures, 2 tables

  2. Characterization of berkelium(III) dipicolinate and borate compounds in solution and the solid state.

    Science.gov (United States)

    Silver, Mark A; Cary, Samantha K; Johnson, Jason A; Baumbach, Ryan E; Arico, Alexandra A; Luckey, Morgan; Urban, Matthew; Wang, Jamie C; Polinski, Matthew J; Chemey, Alexander; Liu, Guokui; Chen, Kuan-Wen; Van Cleve, Shelley M; Marsh, Matthew L; Eaton, Teresa M; van de Burgt, Lambertus J; Gray, Ashley L; Hobart, David E; Hanson, Kenneth; Maron, Laurent; Gendron, Frédéric; Autschbach, Jochen; Speldrich, Manfred; Kögerler, Paul; Yang, Ping; Braley, Jenifer; Albrecht-Schmitt, Thomas E

    2016-08-26

    Berkelium is positioned at a crucial location in the actinide series between the inherently stable half-filled 5f(7) configuration of curium and the abrupt transition in chemical behavior created by the onset of a metastable divalent state that starts at californium. However, the mere 320-day half-life of berkelium's only available isotope, (249)Bk, has hindered in-depth studies of the element's coordination chemistry. Herein, we report the synthesis and detailed solid-state and solution-phase characterization of a berkelium coordination complex, Bk(III)tris(dipicolinate), as well as a chemically distinct Bk(III) borate material for comparison. We demonstrate that berkelium's complexation is analogous to that of californium. However, from a range of spectroscopic techniques and quantum mechanical calculations, it is clear that spin-orbit coupling contributes significantly to berkelium's multiconfigurational ground state. PMID:27563098

  3. Extraction of tetravalent berkelium and cerium by aliquate-336-S-NO3 quaternary ammonium salt

    International Nuclear Information System (INIS)

    Extraction of tetravalent berkelium and cerium by aliquate-336-S-NO3 quaternary ammonium salt from nitric acid solutions is investigated. The effect of concentrations of nitric acid and extracting agent, nature of an oxidant (potassium bromate, potassium bichromate, mixture of AgNO3 and (NH4)2S2O8) and solvent on the distribution coefficient of berkelium(4) and cerium(4) is studied. It is established that solutions of aliquate-336-S-NO3 in carbon tetrachloride and dichloroethane extract quantitatively tetravalent berkelium from 10-12 M nitric acid solutions and cerium - from 1-10 M nitric acid solutions containing potassium bichromate as an oxidant. It is shown that the value of distribution coefficient for berkelium and cerium depends on the nature of an oxidant and extracting agent concentration. It is established that in the case of extraction by quaternary ammonium salt with one berkelium(4) mole four aliquate-336-SNO3 moles are associated and 1.5-1.6 mole of extracting agent are associated with one cerium(4) mole. It permits to make a conclusion that stoichiometry of extraction reactions by quaternary ammonium salt is not the same for tetravalent berkelium and cerium. It is shown that trivalent transplutonium and rare earth elements are not practically extracted by aliquate-336-S-NO3 from nitric acid solutions

  4. Actinide production in the reaction of heavy ions with curium-248

    International Nuclear Information System (INIS)

    Chemical experiments were performed to examine the usefulness of heavy ion transfer reactions in producing new, neutron-rich actinide nuclides. A general quasi-elastic to deep-inelastic mechanism is proposed, and the utility of this method as opposed to other methods (e.g. complete fusion) is discussed. The relative merits of various techniques of actinide target synthesis are discussed. A description is given of a target system designed to remove the large amounts of heat generated by the passage of a heavy ion beam through matter, thereby maximizing the beam intensity which can be safely used in an experiment. Also described is a general separation scheme for the actinide elements from protactinium (Z=91) to mendelevium (Z=101), and fast specific procedures for plutonium, americium and berkelium. The cross sections for the production of several nuclides from the bombardment of 248Cm with 18O, 86Kr and 136Xe projectiles at several energies near and below the Coulomb barrier were determined. The results are compared with yields from 48Ca and 238U bombardments of 248Cm. Simple extrapolation of the product yields into unknown regions of charge and mass indicates that the use of heavy ion transfer reactions to produce new, neutron-rich above-target species is limited. The substantial production of neutron-rich below-target species, however, indicates that with very heavy ions like 136Xe and 238U the new species 248Am, 249Am and 247Pu should be produced with large cross sections from a 248Cm target. A preliminary, unsuccessful attempt to isolate 247Pu is outlined. The failure is probably due to the half life of the decay, which is calculated to be less than 3 minutes. The absolute gamma ray intensities from 251Bk decay, necessary for calculating the 251Bk cross section, are also determined

  5. 25 CFR 248.6 - Structures.

    Science.gov (United States)

    2010-04-01

    ... 25 Indians 1 2010-04-01 2010-04-01 false Structures. 248.6 Section 248.6 Indians BUREAU OF INDIAN AFFAIRS, DEPARTMENT OF THE INTERIOR FISH AND WILDLIFE USE OF COLUMBIA RIVER INDIAN IN-LIEU FISHING SITES § 248.6 Structures. Dwellings, camping facilities, and other structures such as fish drying...

  6. 7 CFR 248.19 - Investigations.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 4 2010-01-01 2010-01-01 false Investigations. 248.19 Section 248.19 Agriculture Regulations of the Department of Agriculture (Continued) FOOD AND NUTRITION SERVICE, DEPARTMENT OF AGRICULTURE..., where appropriate, a review of pertinent practices and policies of any State and local agency,...

  7. 7 CFR 248.9 - Nutrition education.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 4 2010-01-01 2010-01-01 false Nutrition education. 248.9 Section 248.9 Agriculture... Nutrition education. (a) Goals. Nutrition education shall emphasize the relationship of proper nutrition to.... (b) Requirement. The State agency shall integrate nutrition education into FMNP operations and...

  8. Dicty_cDB: SSA248 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSA248 (Link to dictyBase) - - - Contig-U13424-1 - (Link to Original site) - - SSA...248Z 500 - - - - Show SSA248 Library SS (Link to library) Clone ID SSA248 (Link to dicty...iol.tsukuba.ac.jp/CSM/SS/SSA2-B/SSA248Q.Seq.d/ Representative seq. ID - (Link to ...Original site) Representative DNA sequence >SSA248 (SSA248Q) /CSM/SS/SSA2-B/SSA248Q.Seq.d/ XXXXXXXXXXTTTAGAT...nk*kkikxnkl*iy*k*kk Homology vs CSM-cDNA Score E Sequences producing significant alignments: (bits) Value SSA248 (SSA

  9. 40 CFR 1065.248 - Gas divider.

    Science.gov (United States)

    2010-07-01

    ... testing. You may use critical-flow gas dividers, capillary-tube gas dividers, or thermal-mass-meter gas... Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) AIR POLLUTION CONTROLS ENGINE-TESTING PROCEDURES Measurement Instruments Flow-Related Measurements § 1065.248 Gas divider. (a) Application. You...

  10. 7 CFR 248.7 - Nondiscrimination.

    Science.gov (United States)

    2010-01-01

    ... Regulations of the Department of Agriculture (Continued) FOOD AND NUTRITION SERVICE, DEPARTMENT OF AGRICULTURE CHILD NUTRITION PROGRAMS WIC FARMERS' MARKET NUTRITION PROGRAM (FMNP) Recipient Eligibility § 248.7... the Civil Rights Act of 1964, title IX of the Education Amendments of 1972, section 504 of...

  11. 7 CFR 248.12 - FMNP costs.

    Science.gov (United States)

    2010-01-01

    ... associated with the provision of nutrition education which meets the requirements of § 248.9 of this part. (2... Regulations of the Department of Agriculture (Continued) FOOD AND NUTRITION SERVICE, DEPARTMENT OF AGRICULTURE CHILD NUTRITION PROGRAMS WIC FARMERS' MARKET NUTRITION PROGRAM (FMNP) State Agency Provisions §...

  12. 7 CFR 248.3 - Administration.

    Science.gov (United States)

    2010-01-01

    ... nutrition education in coordination with the WIC Program, coupon and market management, fiscal reporting... Regulations of the Department of Agriculture (Continued) FOOD AND NUTRITION SERVICE, DEPARTMENT OF AGRICULTURE CHILD NUTRITION PROGRAMS WIC FARMERS' MARKET NUTRITION PROGRAM (FMNP) General § 248.3 Administration....

  13. 7 CFR 248.4 - State Plan.

    Science.gov (United States)

    2010-01-01

    ... farmers' markets. (5) Outline of administrative staff and job descriptions. (6) Detailed description of... with the State Plan. (c) Retention of copy. A copy of the approved State Plan shall be kept on file at... education, and documentation of coordinated efforts as required in § 248.3(e), as well as copies...

  14. 7 CFR 58.248 - Nonfat dry milk.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 3 2010-01-01 2010-01-01 false Nonfat dry milk. 58.248 Section 58.248 Agriculture... Products Bearing Usda Official Identification § 58.248 Nonfat dry milk. (a) Nonfat dry milk in commercial....S. Standard Grade. (b) Regular nonfat dry milk in consumer size packages which bears an...

  15. 47 CFR 90.248 - Wildlife and ocean buoy tracking.

    Science.gov (United States)

    2010-10-01

    ... 47 Telecommunication 5 2010-10-01 2010-10-01 false Wildlife and ocean buoy tracking. 90.248 Section 90.248 Telecommunication FEDERAL COMMUNICATIONS COMMISSION (CONTINUED) SAFETY AND SPECIAL RADIO SERVICES PRIVATE LAND MOBILE RADIO SERVICES Non-Voice and Other Specialized Operations § 90.248 Wildlife and ocean buoy tracking. (a) The...

  16. 24 CFR 248.177 - Delegated responsibility to State agencies.

    Science.gov (United States)

    2010-04-01

    ... CFR part 91 that the proposed activities are consistent with the approved consolidated plan of the... agencies. 248.177 Section 248.177 Housing and Urban Development Regulations Relating to Housing and Urban... Housing Preservation and Resident Homeownership Act of 1990 § 248.177 Delegated responsibility to...

  17. 7 CFR 248.11 - Financial management system.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 4 2010-01-01 2010-01-01 false Financial management system. 248.11 Section 248.11... § 248.11 Financial management system. (a) Disclosure of expenditures. The State agency shall maintain a financial management system which provides accurate, current and complete disclosure of the financial...

  18. 248nm silicon photoablation: Microstructuring basics

    Energy Technology Data Exchange (ETDEWEB)

    Poopalan, P.; Najamudin, S. H.; Wahab, Y.; Mazalan, M. [Advanced Multidisciplinary MEMS-Based Integrated Electronic NCER Centre of Excellent (AMBIENCE), School of Microelectronic Engineering, Universiti Malaysia Perlis, 02600 Arau, Perlis (Malaysia)

    2015-05-15

    248nm pulses from a KrF excimer laser was used to ablate a Si wafer in order to ascertain the laser pulse and energy effects for use as a microstructuring tool for MEMS fabrication. The laser pulses were varied between two different energy levels of 8mJ and 4mJ while the number of pulses for ablation was varied. The corresponding ablated depths were found to range between 11 µm and 49 µm, depending on the demagnified beam fluence.

  19. CD248 facilitates tumor growth via its cytoplasmic domain

    International Nuclear Information System (INIS)

    Stromal fibroblasts participate in the development of a permissive environment for tumor growth, yet molecular pathways to therapeutically target fibroblasts are poorly defined. CD248, also known as endosialin or tumor endothelial marker 1 (TEM1), is a transmembrane glycoprotein expressed on activated fibroblasts. We recently showed that the cytoplasmic domain of CD248 is important in facilitating an inflammatory response in a mouse model of arthritis. Others have reported that CD248 gene inactivation in mice results in dampened tumor growth. We hypothesized that the conserved cytoplasmic domain of CD248 is important in regulating tumor growth. Mice lacking the cytoplasmic domain of CD248 (CD248CyD/CyD) were generated and evaluated in tumor models, comparing the findings with wild-type mice (CD248WT/WT). As compared to the response in CD248WT/WT mice, growth of T241 fibrosarcomas and Lewis lung carcinomas was significantly reduced in CD248CyD/CyD mice. Tumor size was similar to that seen with CD248-deficient mice. Conditioned media from CD248CyD/CyD fibroblasts were less effective at supporting T241 fibrosarcoma cell survival. In addition to our previous observation of reduced release of activated matrix metalloproteinase (MMP)-9, CD248CyD/CyD fibroblasts also had impaired PDGF-BB-induced migration and expressed higher transcripts of tumor suppressor factors, transgelin (SM22α), Hes and Hey1. The multiple pathways regulated by the cytoplasmic domain of CD248 highlight its potential as a therapeutic target to treat cancer

  20. CD248 facilitates tumor growth via its cytoplasmic domain

    Directory of Open Access Journals (Sweden)

    Janssens Tom

    2011-05-01

    Full Text Available Abstract Background Stromal fibroblasts participate in the development of a permissive environment for tumor growth, yet molecular pathways to therapeutically target fibroblasts are poorly defined. CD248, also known as endosialin or tumor endothelial marker 1 (TEM1, is a transmembrane glycoprotein expressed on activated fibroblasts. We recently showed that the cytoplasmic domain of CD248 is important in facilitating an inflammatory response in a mouse model of arthritis. Others have reported that CD248 gene inactivation in mice results in dampened tumor growth. We hypothesized that the conserved cytoplasmic domain of CD248 is important in regulating tumor growth. Methods Mice lacking the cytoplasmic domain of CD248 (CD248CyD/CyD were generated and evaluated in tumor models, comparing the findings with wild-type mice (CD248WT/WT. Results As compared to the response in CD248WT/WT mice, growth of T241 fibrosarcomas and Lewis lung carcinomas was significantly reduced in CD248CyD/CyD mice. Tumor size was similar to that seen with CD248-deficient mice. Conditioned media from CD248CyD/CyD fibroblasts were less effective at supporting T241 fibrosarcoma cell survival. In addition to our previous observation of reduced release of activated matrix metalloproteinase (MMP-9, CD248CyD/CyD fibroblasts also had impaired PDGF-BB-induced migration and expressed higher transcripts of tumor suppressor factors, transgelin (SM22α, Hes and Hey1. Conclusions The multiple pathways regulated by the cytoplasmic domain of CD248 highlight its potential as a therapeutic target to treat cancer.

  1. 31 CFR 248.4 - Undertaking of indemnity.

    Science.gov (United States)

    2010-07-01

    ... 31 Money and Finance: Treasury 2 2010-07-01 2010-07-01 false Undertaking of indemnity. 248.4 Section 248.4 Money and Finance: Treasury Regulations Relating to Money and Finance (Continued) FISCAL... in the circumstances set forth below, a corporate surety authorized by the Secretary of the...

  2. 24 CFR 248.223 - Alternative State strategy.

    Science.gov (United States)

    2010-04-01

    ... 24 Housing and Urban Development 2 2010-04-01 2010-04-01 false Alternative State strategy. 248.223... Preservation Act of 1987 § 248.223 Alternative State strategy. (a) The Commissioner may approve a State strategy providing for State approval of plans of action that involve termination of low...

  3. 10 CFR 72.248 - Safety analysis report updating.

    Science.gov (United States)

    2010-01-01

    ... Approval of Spent Fuel Storage Casks § 72.248 Safety analysis report updating. (a) Each certificate holder for a spent fuel storage cask design shall update periodically, as provided in paragraph (b) of this... Commission, in accordance with § 72.4, within 90 days after the spent fuel storage cask design has...

  4. 49 CFR 195.248 - Cover over buried pipeline.

    Science.gov (United States)

    2010-10-01

    ... MATERIALS SAFETY ADMINISTRATION, DEPARTMENT OF TRANSPORTATION (CONTINUED) PIPELINE SAFETY TRANSPORTATION OF HAZARDOUS LIQUIDS BY PIPELINE Construction § 195.248 Cover over buried pipeline. (a) Unless specifically... the pipe and the ground level, road bed, river bottom, or underwater natural bottom (as determined...

  5. 17 CFR 248.127 - Renewal of opt out elections.

    Science.gov (United States)

    2010-04-01

    ... (CONTINUED) REGULATIONS S-P AND S-AM Regulation S-AM: Limitations on Affiliate Marketing § 248.127 Renewal of... marketing solicitations to the consumer; (5) That the consumer's election has expired or is about to expire... expires, you may not make marketing solicitations to a consumer who previously opted out, unless: (i)...

  6. 14 CFR 248.2 - Filing of audit reports.

    Science.gov (United States)

    2010-01-01

    ... Information, in duplicate, a special report consisting of a true and complete copy of the audit report... included in, attached to, or submitted with or separately as a part of, the audit report. (b) Each air... 14 Aeronautics and Space 4 2010-01-01 2010-01-01 false Filing of audit reports. 248.2 Section...

  7. 248 nm imaging photolithography assisted by surface plasmon polariton interference

    Science.gov (United States)

    Tian, Man-man; Mi, Jia-jia; Shi, Jian-ping; Wei, Nan-nan; Zhan, Ling-li; Huang, Wan-xia; Zuo, Ze-wen; Wang, Chang-tao; Luo, Xian-gang

    2014-01-01

    A new photolithography technique for 248 nm based on the interference of surface plasmon waves is proposed and demonstrated by using computer simulations. The basic structure consists of surface plasmon polariton (SPP) interference mask and multi-layer film superlens. Using the amplification effect of superlens on evanescent wave, the near field SPP interference pattern is imaged to the far field, and then is exposed on photo resist (PR). The simulation results based on finite difference time domain (FDTD) method show that the full width at half maximum (FWHM) of the interference pattern is about 19 nm when the p-polarization light from 248 nm source is vertically incident to the structure. Meanwhile, the focal depth is 150 nm for negative PR and 60 nm for positive PR, which is much greater than that in usual SPP photolithography.

  8. 31 CFR 248.5 - Exception to requirement of undertaking of indemnity Form 2244.

    Science.gov (United States)

    2010-07-01

    ... undertaking of indemnity Form 2244. 248.5 Section 248.5 Money and Finance: Treasury Regulations Relating to... POSSESSIONS Action to Be Taken by Claimants § 248.5 Exception to requirement of undertaking of indemnity Form... officer or employee responsible for handling the claim, in his discretion, may accept an undertaking...

  9. 24 CFR 248.405 - Grants for building resident capacity and funding predevelopment costs.

    Science.gov (United States)

    2010-04-01

    ... capacity and funding predevelopment costs. 248.405 Section 248.405 Housing and Urban Development... Technical Assistance and Capacity Building § 248.405 Grants for building resident capacity and funding..., including third party costs for training, development consulting, legal, appraisal,...

  10. 24 CFR 248.111 - Appraisal and preservation value of eligible low income housing.

    Science.gov (United States)

    2010-04-01

    ... of actual project operating expenses at the time of the appraisal, based on the average of the actual... receive incentives under §§ 248.153, 248.157 or 248.161 only based upon an appraisal conducted in... regarding the performance of an appraisal pursuant to this section. (c) Appraisers. The Commissioner and...

  11. Dicty_cDB: CFI248 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CF (Link to library) CFI248 (Link to dictyBase) - - - Contig-U14964-1 - (Link to Original site) ... -18 CP001196_2670( CP001196 |pid:none) Oligotropha car boxidovorans OM5... 93 7e-18 AF168363_3( AF168363 | ... pid:none) Lactococcus lactis pyrrolidone car ... 93 7e-18 CP000517_1515( CP000517 |pid:none) Lac ...

  12. Actinide production from xenon bombardments of curium-248

    International Nuclear Information System (INIS)

    Production cross sections for many actinide nuclides formed in the reaction of 129Xe and 132Xe with 248Cm at bombarding energies slightly above the coulomb barrier were determined using radiochemical techniques to isolate these products. These results are compared with cross sections from a 136Xe + 248Cm reaction at a similar energy. When compared to the reaction with 136Xe, the maxima in the production cross section distributions from the more neutron deficient projectiles are shifted to smaller mass numbers, and the total cross section increases for the production of elements with atomic numbers greater than that of the target, and decreases for lighter elements. These results can be explained by use of a potential energy surface (PES) which illustrates the effect of the available energy on the transfer of nucleons and describes the evolution of the di-nuclear complex, an essential feature of deep-inelastic reactions (DIR), during the interaction. The other principal reaction mechanism is the quasi-elastic transfer (QE). Analysis of data from a similar set of reactions, 129Xe, 132Xe, and 136Xe with 197Au, aids in explaining the features of the Xe + Cm product distributions, which are additionally affected by the depletion of actinide product yields due to deexcitation by fission. The PES is shown to be a useful tool to predict the general features of product distributions from heavy ion reactions

  13. Femtosecond ultraviolet (248 nm) excimer laser processing of Teflon (PTFE)

    International Nuclear Information System (INIS)

    We have investigated by X-ray photoelectron spectroscopy (XPS) the surface of poly(tetrafluoroethylene) (PTFE) films, which were subjected to processing by femtosecond (fs) UV radiation from an excimer laser (KrF: λ=248 nm, tp∼380 fs) in air. Bulk characterization of processed PTFE films by Fourier transform infrared spectroscopy (FTIR) permit an investigation of the laser induced modifications in the material at energy densities below the ablation threshold. No features in XPS and FTIR spectra indicated the incorporation of hydrogen and/or oxygen, or the formation of a cross-linked network of carbon indicating chemically clean processing in contrast to nanosecond excimer laser processing which chemically degrades the surface. Scanning electron microscopy (SEM) of the micrometer size vertical interconnect (microvia) indicated mechanically and thermally damage free processing of PTFE with good edge quality, in contrast to nanosecond excimer laser processing

  14. Bk and Cf chromatographic separation and 249Bk/248Cm and 249Cf/248Cm elemental ratios determination by inductively coupled plasma quadrupole mass spectrometry

    International Nuclear Information System (INIS)

    The French Atomic Energy Commission has carried out several experiments for the study of minor-actinide transmutation processes in high intensity thermal neutron flux. In this context a Cm sample enriched in 248Cm (97%) was irradiated in a thermal neutron flux at the High Flux Reactor (HFR) of the Laue-Langevin Institute (ILL). The precise and accurate determination of Cf isotope ratios and of 249Bk/248Cm and 249Cf/248Cm elemental ratios in the 248Cm irradiated sample is crucial for the calculation of actinide neutron capture cross-sections.This work describes an analytical procedure for the separation and the isotope ratio measurement of Bk and Cf in the irradiated sample.The Bk and Cf separation is based on a lanthanides separation protocol previously developed by the laboratory. Well-defined retention times for Bk and Cf were obtained by coupling the Ionic Chromatography (IC) with an ICP-QMS. All conditions of element separation by IC and the different steps of the analytical protocol in order to obtain the isotopic and elemental ratios are presented. Relative uncertainties of Cf isotopic ratios range from 0.3% to 0.5% and the uncertainty of the 249Bk/248Cm and 249Cf/248Cm elemental ratios are respectively 6.1% and 3.2%.This level of uncertainty for both isotopic and elemental ratios is in perfect agreement with the requirement for transmutation studies. (authors)

  15. 24 CFR 248.175 - Resident homeownership program-limited equity cooperative.

    Science.gov (United States)

    2010-04-01

    ...-limited equity cooperative. 248.175 Section 248.175 Housing and Urban Development Regulations Relating to... Resident homeownership program—limited equity cooperative. (a) Tenants may carry out a resident homeownership program through the purchase of eligible low income housing by a limited equity cooperative...

  16. 24 CFR 248.157 - Voluntary sale of housing not in excess of Federal cost limit.

    Science.gov (United States)

    2010-04-01

    ... excess of Federal cost limit. 248.157 Section 248.157 Housing and Urban Development Regulations Relating... UNDER NATIONAL HOUSING ACT AND OTHER AUTHORITIES PREPAYMENT OF LOW INCOME HOUSING MORTGAGES Prepayments and Plans of Action Under the Low Income Housing Preservation and Resident Homeownership Act of...

  17. 24 CFR 248.161 - Mandatory sale of housing in excess of the Federal cost limit.

    Science.gov (United States)

    2010-04-01

    ... of the Federal cost limit. 248.161 Section 248.161 Housing and Urban Development Regulations Relating... UNDER NATIONAL HOUSING ACT AND OTHER AUTHORITIES PREPAYMENT OF LOW INCOME HOUSING MORTGAGES Prepayments and Plans of Action Under the Low Income Housing Preservation and Resident Homeownership Act of...

  18. 24 CFR 248.127 - Limitations on action pursuant to Federal cost limit.

    Science.gov (United States)

    2010-04-01

    ... Federal cost limit. 248.127 Section 248.127 Housing and Urban Development Regulations Relating to Housing... HOUSING ACT AND OTHER AUTHORITIES PREPAYMENT OF LOW INCOME HOUSING MORTGAGES Prepayments and Plans of Action Under the Low Income Housing Preservation and Resident Homeownership Act of 1990 §...

  19. 17 CFR 248.13 - Exception to opt out requirements for service providers and joint marketing.

    Science.gov (United States)

    2010-04-01

    ... requirements for service providers and joint marketing. 248.13 Section 248.13 Commodity and Securities Exchanges SECURITIES AND EXCHANGE COMMISSION (CONTINUED) REGULATIONS S-P AND S-AM Regulation S-P: Privacy of... out requirements for service providers and joint marketing. (a) General rule. (1) The opt...

  20. 17 CFR 248.12 - Limits on sharing account number information for marketing purposes.

    Science.gov (United States)

    2010-04-01

    ..., direct mail marketing, or other marketing through electronic mail to the consumer. (b) Exceptions... number information for marketing purposes. 248.12 Section 248.12 Commodity and Securities Exchanges... account number information for marketing purposes. (a) General prohibition on disclosure of...

  1. Single-pulse laser effects measurements at 248 nm

    International Nuclear Information System (INIS)

    We have measured induced impulse and mass loss from exposures of a number of materials to 50 ns, KrF (0.248 μm) laser pulses as a function of incident laser fluence, ambient atmospheric pressure, and angle of incidence. The energy on target was normally about 100 J but was varied down to about 10 J and the beam diameter on target was varied from about 0.1 to 38 mm providing incident laser fluences of from about 104 J/m2 to about 1010 J/m2. Calculations indicate that for fluences in these experiments below about 107 J/m2, the blowoff hydrodynamics is predominately one dimensional. The ambient atmospheric pressure was varied from about 105 Pa of dry air to a vacuum of less than 10-2 Pa; the angle of incidence was varied from normal incidence to 100 from grazing incidence. In a few cases, the pressure was measured as a function of time, sometimes concurrently with impulse. A number of plasma physics measurements were also performed concurrently

  2. Photofragment Translational Spectroscopy of Propargyl Radicals at 248 nm

    Energy Technology Data Exchange (ETDEWEB)

    Goncher, S.J.; Moore, D.T.; Sveum, N.E.; Neumark, D.M.

    2007-12-21

    The photodissociation of propargyl radical, C{sub 3}H{sub 3}, and its perdeuterated isotopolog was investigated using photofragment translational spectroscopy. Propargyl radicals were produced by 193 nm photolysis of allene entrained in a molecular beam expansion, and then photodissociated at 248 nm. photofragment time-of-flight spectra were measured at a series of laboratory angles using electron impact ionization coupled to a mass spectrometer. Data for ion masses corresponding to C{sub 3}H{sub 2}{sup +}, C{sub 3}H{sup +}, C{sub 3}{sup +}, and the analogous deuterated species show that both H and H{sub 2} loss occur. The translational energy distributions for these processes have average values = 5.7 and 15.9 kcal/mol, respectively, and are consistent with dissociation on the ground state following internal conversion, with no exit barrier for H loss but a tight transition state for H{sub 2} loss. The translational energy distribution for H atom loss is similar to that in previous work on propargyl in which the H atom, rather than the heavy fragment, was detected. The branching ratio for H loss/H{sub 2} loss was determined to be 97.6/2.4 {+-} 1.2, in good agreement with RRKM results.

  3. PHILIPS 248X3LFH 时尚和健康的完美组合

    Institute of Scientific and Technical Information of China (English)

    刘宗宇

    2012-01-01

    飞利浦MODA显示器248C3LSB依靠时尚的造型和优秀的显示效果获得了《微型计算机》编辑部年度推荐产品称号。而现在,飞利浦新推出了一款可以称之为MODA升级版的248x3LFH显示器。

  4. Liquid phase silylation process for 248-nm lithography using EL IR photoresist

    Science.gov (United States)

    Zhang, Guojing; Smith, Bruce W.; Fuller, Lynn F.

    1994-05-01

    The goal of this investigation was to develop a 0.3 micron silylation process for 248 nm exposure, using a commercial photoresist material. Presented are results from investigation into liquid silylation of 248 nm exposure of Dynachem EL IRTM, a non-melamine image reversal novalac material designed for i-line application. A GCA BOLD 0.42 NA, 248 nm excimer laser projection system was used for exposure. A process has been developed utilizing a silylation solution of hexamethyl- cyclotrisilazane (HMCTS), propylene-glycol-methyl-ether-acetate (PGMEA), and xylene mixtures. Using a 15 run Box-Behnken statistically designed experiment, dry development in 02 RIE has been optimized with chamber pressure, flow rate, and 02 flow as process factors. Process responses optimized were selectivity, etch rate, and anisotropy. Results show capabilities and sensitivities of the process. Response surfaces are presented, along with resist image results of 0.3 microns at 5:1 aspect ratio.

  5. P53 codon 11, 72, and 248 gene polymorphisms in endometriosis

    OpenAIRE

    Hsieh, Yao-Yuan; Lin, Chich-Sheng

    2006-01-01

    Objective: Mutated p53 gene is related to the instability of cell growth and cell cycle progression. We aimed to evaluate the association between endometriosis and p53 codon 11, 72 and 248 gene polymorphisms. Patients and methods: Women were divided into two groups: (1) moderate/severe endometriosis (n=148), and (2) non-endometriosis groups (n=150). P53 gene polymorphisms include codon11 Glu/Gln or Lys (GAG->CAG or AAG), codon 72 Arg/Pro (CGC->CCC), and codon 248 Arg/Thr (CGG->TCG). These gen...

  6. Chalcogenide compounds made by pulsed laser deposition at 355 and 248 nm

    DEFF Research Database (Denmark)

    Ettlinger, Rebecca Bolt; Cazzaniga, Andrea Carlo; Crovetto, Andrea; Ravnkilde, Lasse; Youngman, Tomas Hugh; Pryds, Nini; Schou, Jørgen

    Thin films made by pulsed laser deposition may differ depending on the laser wavelength. We compared ZnS, Cu2SnS3 and a target enriched with SnS relative to Cu2SnS3 using 355 nm and 248 nm lasers......Thin films made by pulsed laser deposition may differ depending on the laser wavelength. We compared ZnS, Cu2SnS3 and a target enriched with SnS relative to Cu2SnS3 using 355 nm and 248 nm lasers...

  7. 17 CFR 248.122 - Scope and duration of opt out.

    Science.gov (United States)

    2010-04-01

    ... (CONTINUED) REGULATIONS S-P AND S-AM Regulation S-AM: Limitations on Affiliate Marketing § 248.122 Scope and... before the company's affiliates may make marketing solicitations to the consumer using eligibility... consumer's election to opt out prohibits any affiliate covered by the opt out notice from using...

  8. 17 CFR 248.125 - Reasonable and simple methods of opting out.

    Science.gov (United States)

    2010-04-01

    ... COMMISSION (CONTINUED) REGULATIONS S-P AND S-AM Regulation S-AM: Limitations on Affiliate Marketing § 248.125... consumer that you receive from an affiliate to make a marketing solicitation to the consumer about your... electronically mailed or processed at an Internet Web site, if the consumer agrees to the electronic delivery...

  9. 17 CFR 248.123 - Contents of opt out notice; consolidated and equivalent notices.

    Science.gov (United States)

    2010-04-01

    ... Marketing § 248.123 Contents of opt out notice; consolidated and equivalent notices. (a) Contents of opt out...”; (iii) A general description of the types of eligibility information that may be used to make marketing... make marketing solicitations to the consumer; (v) That the consumer's election will apply for...

  10. 19 CFR 10.248 - Additional requirements for preferential treatment of brassieres.

    Science.gov (United States)

    2010-04-01

    ... documents, work orders and other production records, and inventory control records; and (v) Accounting books..., column 34), or its electronic equivalent, the distinct and unique identifier assigned by CBP to the... States was at least 75 percent (or 85 percent, if applicable under 19 CFR 10.248(b)(1)(ii)) of...

  11. PCR-RFLP to Detect Codon 248 Mutation in Exon 7 of "p53" Tumor Suppressor Gene

    Science.gov (United States)

    Ouyang, Liming; Ge, Chongtao; Wu, Haizhen; Li, Suxia; Zhang, Huizhan

    2009-01-01

    Individual genome DNA was extracted fast from oral swab and followed up with PCR specific for codon 248 of "p53" tumor suppressor gene. "Msp"I restriction mapping showed the G-C mutation in codon 248, which closely relates to cancer susceptibility. Students learn the concepts, detection techniques, and research significance of point mutations or…

  12. P53 codon 11, 72, and 248 gene polymorphisms in endometriosis

    Directory of Open Access Journals (Sweden)

    Yao-Yuan Hsieh , Chich-Sheng Lin

    2006-01-01

    Full Text Available Objective: Mutated p53 gene is related to the instability of cell growth and cell cycle progression. We aimed to evaluate the association between endometriosis and p53 codon 11, 72 and 248 gene polymorphisms. Patients and methods: Women were divided into two groups: (1 moderate/severe endometriosis (n=148, and (2 non-endometriosis groups (n=150. P53 gene polymorphisms include codon11 Glu/Gln or Lys (GAG->CAG or AAG, codon 72 Arg/Pro (CGC->CCC, and codon 248 Arg/Thr (CGG->TCG. These gene polymorphisms were amplified by polymerase chain reaction and detected by electrophoresis after restriction enzyme (Taq I, BstU I, Hap II digestions. Associations between the endometriosis and p53 polymorphisms were evaluated. Results: The distributions of p53 codon 72 polymorphisms in both groups were significantly different. The proportions of Arg homozygotes/heterozygotes/Pro homozygotes in both groups were 9.5/66.2/24.3% and 30.7/50/19.3%. The proportions of Arg/Pro alleles were 42.6/57.4% and 56/44%. The distributions of p53 codon 11 and 248 polymorphisms in both groups were non-significantly different. All individuals appeared the wild genotypes (Glu11 and Arg248 homozygotes. Conclusion: Association between endometriosis and p53 codon 72 polymorphism exists. P53 codon 72*Pro-related genotype and allele are related with higher susceptibility of endometriosis. P53 codon 11 and 248 polymorphisms are not related with endometriosis susceptibility.

  13. Stability of 248-254^Cf isotopes against alpha and cluster radioactivity

    OpenAIRE

    Santhosh, K. P.; Biju, R. K.

    2013-01-01

    Stability of 248-254^Cf nuclei against alpha and cluster emission is studied within our Coulomb and proximity potential model (CPPM). It is found that these nuclei are stable against light clusters (except alpha particle) and instable against heavy cluster emissions. For heavy cluster emissions the daughter nuclei lead to doubly magic 208^Pb or neighbouring one. The effect of quadrapole and hexadecapole deformations of parent nuclei, daughter nuclei and emitted cluster on half lives are also ...

  14. Spatial structure of oligopeptide PAP(248-261), the N-terminal fragment of the HIV enhancer prostatic acid phosphatase peptide PAP(248-286), in aqueous and SDS micelle solutions

    Science.gov (United States)

    Blokhin, Dmitriy S.; Filippov, Andrei V.; Antzutkin, Oleg N.; Karataeva, Farida Kh.; Klochkov, Vladimir V.

    2014-07-01

    Prostatic acid phosphatase (PAP) is an enzyme that facilitates infection of cells by HIV. Its peptide fragment PAP(248-286) forms amyloid fibrils known as SEVI, which enhance attachment of the virus by viral adhesion to the host cell prior to receptor-specific binding via reducing the electrostatic repulsion between the membranes of the virus and the target cell. The secondary structure of PAP(248-286) in aqueous and SDS solutions can be divided into an N-terminal disordered region, an α-helical central part and an α/310-helical C-terminal region (Nanga et al., 2009). In this work, we used NMR spectroscopy to study the spatial structure of the isolated N-terminal fragment of PAP(248-286), PAP(248-261) (GIHKQKEKSRLQGG), in aqueous and SDS micelle solutions. Formation of a PAP(248-261)-SDS complex was confirmed by chemical shift alterations in the 1H NMR spectra of the peptide, as well as by the signs and values of Nuclear Overhauser Effect (NOE). In addition, the PAP(248-261) peptide does not form any specified secondary structure in either aqueous or SDS solutions.

  15. Photothermal Ablation of Polystyrene Film by 248 NM Excimer Laser Irradiation: a Mechanistic Study by Time-Resolved Measurements

    OpenAIRE

    Tsuboi, Yasuyuki; Sakashita, Shin-Ichi; Hatanaka, Koji; Fukumura, Hiroshi; Masuhara, Hiroshi

    1996-01-01

    Laser ablation mechanism at 248 nm irradiation of polystyrene film was investigated and discussed. An ablation threshold was determined by etch depth measurement and nanosecond photographic observation. Temperature at the threshold was evaluated to be 370℃ by using an effective absorption coefficient which was confirmed by transmission measurement of the excitation pulse. The temperature was in good agreement with that of thermal degradation of the polymer, showing that 248 nm ablation of pol...

  16. Photodissociation dynamics of 2-nitropropane and 2-methyl-2-nitropropane at 248 and 193 nm.

    Science.gov (United States)

    Sengupta, Sumana; Indulkar, Yogesh; Kumar, Awadhesh; Dhanya, Suresh; Naik, Prakash Dattatray; Bajaj, Parma Nand

    2008-12-11

    Dynamics of formation of electronically excited NO2 and formation of OH fragment, during photo dissociation of 2-nitropropane (NP) and 2-methyl-2-nitropropane (MNP), were investigated at 193 and 248 nm. The radiative lifetime of the electronically excited NO2 fragment, observed at 193 nm, was measured to be 1.2 ( 0.1 micros and the rate coefficient of quenching of its emission by MNP was measured as (2.7 ( 0.1) x 10(-10) molecule(-1) cm3 s(-1). Formation of the ground electronic state of OH was confirmed in both molecules. State selective laser induced fluorescence technique was used to detect the nascent OH (X 2Pi, v'', J'') fragments in different ro-vibrational states, and to obtain information on energy partitioning. Though MNP and NP differ in the types of the available H atoms, the dynamics of OH formation is found to be the same in both. The relative population in different rotational states does not follow Boltzmann equilibrium distribution in both the molecules at 193 and 248 nm. The translational energies of the OH fragments, calculated from the Doppler width, are 21.2 ( 7.2 and 25.0 ( 2.5 kcal mol-1 for NP at 248 and 193 nm, respectively. The translational energies of the OH fragments, in the case of MNP, are found to be lower, 17.5 ( 4.1 and 22.0 ( 3.2 kcal mol-1,respectively, at 248 nm 193 nm. These results are compared with the earlier reports on photodissociation of nitromethane (NM), nitroethane (NE), and other nitroalkanes. All possible dissociation pathways of these molecules--NM, NE, NP, and MNPs leading to the formation of the OH fragment were investigated computationally, with geometry optimization at the B3LYP/6-311+G(d,p) level and energy calculation at the MP4(SDQ)/6-311+G (d,p) level. The results suggest that in NM, OH is formed after isomerization to CH2N(OH)O, whereas in all other cases OH is formed from HONO, a primary product of molecular elimination of nitroalkanes, formed with sufficient internal energy. PMID:19053556

  17. Minimum fluence for laser blow-off of thin gold films at 248 and 532 nm

    International Nuclear Information System (INIS)

    The minimum 248 nm, 25 ns, and 532 nm, 15 ns laser fluences required to blow off thin gold films from optical quartz have been measured as a function of film thickness. The films apparently blow off when the gold-quartz interface reaches the normal boiling point of gold. Even though the initial reflectivities at the two wavelengths are very different, the actual laser fluences required to blow off the films are very similar. While the reflectivities above the melting point appear to be very low, as expected, large decreases in the reflectivity at 532 nm may also occur prior to film melting

  18. Minimum fluence for laser blow-off of thin gold films at 248 and 532 nm

    Energy Technology Data Exchange (ETDEWEB)

    Baseman, R.J.; Froberg, N.M.; Andreshak, J.C.; Schlesinger, Z. (IBM Thomas J. Watson Research Center, Yorktown Heights, New York 10598 (USA))

    1990-04-09

    The minimum 248 nm, 25 ns, and 532 nm, 15 ns laser fluences required to blow off thin gold films from optical quartz have been measured as a function of film thickness. The films apparently blow off when the gold-quartz interface reaches the normal boiling point of gold. Even though the initial reflectivities at the two wavelengths are very different, the actual laser fluences required to blow off the films are very similar. While the reflectivities above the melting point appear to be very low, as expected, large decreases in the reflectivity at 532 nm may also occur prior to film melting.

  19. Decay properties of 266Bh and 262Db produced in the 248Cm+23Na reaction

    International Nuclear Information System (INIS)

    Decay properties of an isotope 266Bh and its daughter nucleus 262Db produced by the 248Cm(23Na,5n) reaction were studied by using a gas-filled recoil separator coupled with a position-sensitive semiconductor detector. 266Bh was clearly identified from the correlation of the known nuclide, 262Db. The obtained decay properties of 266Bh and 262Db are consistent with those observed in the 278113 chain, which provided further confirmation of the discovery of 278113. (author)

  20. TGFβ-mediated suppression of CD248 in non-cancer cells via canonical Smad-dependent signaling pathways is uncoupled in cancer cells

    International Nuclear Information System (INIS)

    CD248 is a cell surface glycoprotein, highly expressed by stromal cells and fibroblasts of tumors and inflammatory lesions, but virtually undetectable in healthy adult tissues. CD248 promotes tumorigenesis, while lack of CD248 in mice confers resistance to tumor growth. Mechanisms by which CD248 is downregulated are poorly understood, hindering the development of anti-cancer therapies. We sought to characterize the molecular mechanisms by which CD248 is downregulated by surveying its expression in different cells in response to cytokines and growth factors. Only transforming growth factor (TGFβ) suppressed CD248 protein and mRNA levels in cultured fibroblasts and vascular smooth muscle cells in a concentration- and time-dependent manner. TGFβ transcriptionally downregulated CD248 by signaling through canonical Smad2/3-dependent pathways, but not via mitogen activated protein kinases p38 or ERK1/2. Notably, cancer associated fibroblasts (CAF) and cancer cells were resistant to TGFβ mediated suppression of CD248. The findings indicate that decoupling of CD248 regulation by TGFβ may contribute to its tumor-promoting properties, and underline the importance of exploring the TGFβ-CD248 signaling pathway as a potential therapeutic target for early prevention of cancer and proliferative disorders

  1. A bright-rimmed cloud sculpted by the H ii region Sh2-48

    CERN Document Server

    Ortega, M E; Giacani, E; Rubio, M; Dubner, G

    2013-01-01

    To characterize a bright-rimmed cloud embedded in the HII region Sh2-48 searching for evidence of triggered star formation. We carried out observations towards a region of 2'x2' centered at RA=18h 22m 11.39s, dec.=-14deg 35m 24.81s (J2000) using the Atacama Submillimeter Telescope Experiment (ASTE; Chile) in the 12CO J=3-2,13CO J=3-2, HCO+ J=4-3, and CS J=7-6 lines with an angular resolution of about 22". We also present radio continuum observations at 5 GHz carried out with the Jansky Very Large Array (JVLA; EEUU) interferometer with a synthetized beam of 7"x5". The analysis of our molecular observations reveals the presence of a relatively dense clump with n(H_2)~3x10^3 cm^-3, located in projection onto the interior of the HII region Sh2-48. The emission distribution of the four observed molecular transitions has, at VLSR~38 kms^-1, morphological anti-correlation with the bright-rimmed cloud as seen in the optical emission. From the new radio continuum observations we identify a thin layer of ionized gas lo...

  2. Separation of 248Cm (III) from 252Cf (III) and its use in time resolved fluorescence spectroscopic (TRFS) studies

    International Nuclear Information System (INIS)

    The present report gives a description of the methodology for the separation of 248Cm(III) from decayed 252Cf (III) waste solution. The waste solution was first assayed for 252Cf content by neutron counting using a neutron well coincidence counter. The sample was subjected to the chemical separation of 248Cm (III) from 252Cf (III) following anion and cation exchange chromatography. The alpha spectrum of the separated curium fraction showed peaks due to 246Cm and 248Cm while the corresponding alpha spectrum of californium fraction showed 249,250,251,252Cf. The gamma ray abundances of 249Cf were determined with respect to its gamma rays of 387 keV and the data agreed well with that in literature. Separated Cm(III) was further characterized by recording its time resolved fluorescence spectrum (TRFS) in aqueous medium. (author)

  3. 清新护眼 飞利浦睿蓝摩登248X3LFH登场

    Institute of Scientific and Technical Information of China (English)

    2012-01-01

    飞利浦将创新的睿蓝光波(LightFrame)与Moda摩登系列产品完美结合,为用户带来最新力作——睿蓝摩登248X3LFH!与其它Moda产品不同的是248X3LFH机身背部采用了黑色镜面烤漆,而机身框架则采用极具金属质感的镀银处理,这样搭配圆润的铝铸基座,

  4. Photodissociation of pernitric acid (HO2NO2) at 248 nm

    Science.gov (United States)

    Macleod, Helene; Smith, Gregory P.; Golden, David M.

    1989-01-01

    The photodissociation of pernitric acid (PNA) was studied at 248 nm. The quantum yield for production of OH radicals is 34 + or - 16 percent. The yield of OH from PNA was measured relative to that of H2O2. The translational and rotational energy content of the OH photofragment from PNA was characterized. A fluorescent emission was also observed and characterized. It is attributed to electronically excited NO2 produced in the PNA photodissociation. A maximum yield of 30 percent for NO2 production was determined. The intensity of this emission, and a mass spectrometric peak at m/e = 33, were found to be useful means of characterizing the purity of the PNA sample.

  5. Study of 242‑248Cm isotopes in the projected shell model framework

    Science.gov (United States)

    Sadiq, Saiqa; Devi, Rani; Khosa, S. K.

    2016-04-01

    The projected shell model framework is employed to study the band spectra in 242‑248Cm isotopes. The present calculations reproduce the available experimental data on the yrast bands. Besides this, B(E2) transition probabilities of even-even Cm isotopes have also been calculated. The low spin states of yrast band are seen to arise purely from zero-quasi-particle (o-qp) intrinsic states whereas the high spin states have multi-quasi-particle structure. For the odd-neutron (odd-N) isotopes, the calculated results qualitatively reproduce the available data on ground and lowest excited state bands for 243,245Cm. However, for 247Cm the negative-parity ground state band is in reasonable agreement with the experimental data.

  6. Laser conditioning of LaF 3 MgF 2 dielectric coatings at 248 nm

    Science.gov (United States)

    Eva, E.; Mann, K.; Kaiser, N.; Anton, B.; Henking, R.; Ristau, D.; Weissbrodt, P.; Mademann, D.; Raupach, L.; Hacker, E.

    1996-10-01

    Highly reflective LaF3/MgF2 systems for a wavelength of 248 nm on MgF2 and crystalline quartz substrates were investigated. The influence of laser conditioning on damage threshold and absorptance was remarkable in those coatings that had a high initial absorptance. Monitoring with a laser calorimeter revealed the conditioning effect to be a function of the irradiation dose rather than of energy density or pulse rate. Furthermore, x-ray photoelectron spectroscopy and transmission electron microscopy investigations showed that conditioning induces stoichiometric and structural changes in the multilayers, especially in near-surface sublayers, whereas scanning electron microscopy and atomic force microscopy investigations indicated that the surface remains unchanged.

  7. A systematic study of actinide production from the interactions of heavy ions with 248Cm

    International Nuclear Information System (INIS)

    Production cross sections for heavy actinides produced from the interactions of 12C, 31P, 40Ar, and 44Ca ions with 248Cm were measured at energies ranging from 0.98 to 1.35 X Coulomb barrier. The recoiling reaction products were collected in copper or gold catcher foils located near the 248Cm target. Separate fractions of Bk, Cf, Es, Fm, and Md were obtained from a radiochemical separation procedure. For the 12C system, a He/KCl jet was used to transport the recoiling No activities of interest to a rotating wheel system. The isotopic distributions of the actinide products were found to be essentially symmetric about the maximum with full-widths-at-half-maximum of approximately 2.5 mass units. Isotopic distributions of the 12C, 31P, 40Ar, and 44Ca systems were found to be very similar to the 40,48Ca systems studied previously. The maxima of the isotopic distributions generally occurred for those reaction channels which involved the exchange of the fewest number of nucleons between the target and projectile for which the calculated excitation energy was a positive quantity. Additionally, the maxima of the excitation functions occurred at those projectile energies which were consistent with the calculated reaction barriers based upon a binary reaction mechanism. The experimental data from the four systems investigated were compared to several models of heavy ion interactions including a damped reaction mechanism, compound nucleus formation and subsequent particle evaporation, and classical partial wave calculations for binary systems

  8. 17 CFR Appendix A to Subpart A of... - Appendix A to Subpart A of Part 248 Forms

    Science.gov (United States)

    2010-04-01

    .... The opt-out choices made available to the consumer who contacts the institution through these methods...; investment experience; credit-based insurance scores; insurance claim history; medical information; overdraft... under this part, must comply with section 624 of the FCRA and 17 CFR part 248, subpart B, with...

  9. 77 FR 12365 - Agency Information Collection; Activity Under OMB Review: Submission of Audit Reports-Part 248

    Science.gov (United States)

    2012-02-29

    ... published on April 11, 2000 (65 FR 19477-78) or you may visit http://DocketInfo.dot.gov . Docket: For access... the audit report, BTS will accept the annual report submitted to the stockholders. The audited reports...: Submission of Audit Reports--Part 248 AGENCY: Research and Innovative Technology Administration...

  10. 77 FR 26824 - Agency Information Collection; Activity Under OMB Review; Submission of Audit Reports-Part 248

    Science.gov (United States)

    2012-05-07

    ... the following collection of information was published on February 29, 2012 (77 FR 12365). No comments... the audit report, BTS will accept the annual report submitted to the stockholders. The audited reports...; Submission of Audit Reports--Part 248 AGENCY: Research & Innovative Technology Administration (RITA),...

  11. Cold valleys in the radioactive decay of 248-254Cf isotopes

    Indian Academy of Sciences (India)

    R K Biju; Sabina Sahadevan; K P Santosh; Antony Joseph

    2008-04-01

    Based on the concept of cold valley in cold fission and fusion, we have investigated the cluster decay process in 248-254Cf isotopes. In addition to alpha particle minima, other deep minima occur for S, Ar and Ca clusters. It is found that inclusion of proximity potential does not change the position of minima but minima become deeper. Taking Coulomb and proximity potential as interacting barrier for post-scission region, we computed half-lives and other characteristics for various clusters from these parents. Our study reveals that these parents are stable against light clusters and unstable against heavy clusters. Computed half-lives for alpha decay agree with experimental values within two orders of magnitude. The most probable clusters from these parents are predicted to be 46Ar, 48,50Ca which indicate the role of doubly or near doubly magic clusters in cluster radioactivity. Odd A clusters are found to be favorable for emission from odd A parents. Cluster decay model is extended to symmetric region and it is found that symmetric fission is also probable which stresses the role of doubly or near doubly magic 132Sn nuclei. Geiger-Nuttal plots were studied for various clusters and are found to be linear with varying slopes and intercepts.

  12. Multiwavelength behaviour of the blazar OJ 248 from radio to {\\gamma}-rays

    CERN Document Server

    Carnerero, M I; Villata, M; Acosta-Pulido, J A; D'Ammando, F; Smith, P S; Larionov, V M

    2015-01-01

    We present an analysis of the multiwavelength behaviour of the blazar OJ 248 at z = 0.939 in the period 2006-2013. We use low-energy data (optical, near-infrared, and radio) obtained by 21 observatories participating in the GLAST-AGILE Support Program (GASP) of the Whole Earth Blazar Telescope (WEBT), as well as data from the Swift (optical-UV and X-rays) and Fermi (gamma-rays) satellites, to study flux and spectral variability and correlations among emissions in different bands. We take into account the effect of absorption by the Damped Lyman Alpha intervening system at z = 0.525. Two major outbursts were observed in 2006-2007 and in 2012-2013 at optical and near-IR wavelengths, while in the high-frequency radio light curves prominent radio outbursts are visible peaking at the end of 2010 and beginning of 2013, revealing a complex radio-optical correlation. Cross-correlation analysis suggests a delay of the optical variations after the gamma-ray ones of about a month, which is a peculiar behaviour in blazar...

  13. Decontamination and decommissioning of rooms 62-248 and 62-250 at Ernest Orlando Lawrence Berkeley National Laboratory

    Energy Technology Data Exchange (ETDEWEB)

    Garabedian, G.

    1996-05-01

    This document details the decontamination and decommissioning (D&D) process of Rooms 248 and 250 of Building 62 at the Ernest Orlando Lawrence Berkeley National Laboratory (LBNL). The document describes the D&D efforts for the rooms, their contents, and adjacent areas containing ancillary equipment. The rooms and equipment, before being released, were required to meet the unrestricted release criteria and requirements set forth in DOE orders 5400.5 and 5480.11, LBNL`s internal release-criteria procedure (EH&S Procedure 708), and the LBNL Radiological Control Manual. The radioactive material and items not meeting the release criteria were either sent to the Hazardous Waste Handling Facility (HWHF) for disposal or transferred to other locations approved for radioactive material. The D&D was undertaken by the Radiation Protection Group of LBNL`s Environment, Health and Safety (EH&S) Division at the request of the Materials Sciences Division. Current and past use of radioactive material in both Rooms 248 and 250 necessitated the D&D in order to release both rooms for nonradioactive work. (1) Room 248 was designated a {open_quotes}controlled area.{close_quotes} There was contained radioactive material in some of the equipment. The previous occupants of Room 248 had worked with radioactive materials. (2) Room 250 was designated a {open_quotes}Radioactive Materials Management Area{close_quotes} (RMMA) because the current occupants used potentially dispersible radioisotopes. Both laboratories, during the occupancy of U.C. Berkeley Professor Leo Brewer and Ms. Karen Krushwitz, were kept in excellent condition. There was a detailed inventory of all radioactive materials and chemicals. All work and self surveys were documented. The labs were kept extremely orderly, clean, and in compliance. In October 1993 Ms. Krushwitz received an award in recognition of her efforts in Environmental Protection, Health, and Safety at LBNL.

  14. Formation of copper tin sulfide films by pulsed laser deposition at 248 and 355 nm

    DEFF Research Database (Denmark)

    Ettlinger, Rebecca Bolt; Crovetto, Andrea; Canulescu, Stela; Cazzaniga, Andrea Carlo; Ravnkilde, Lasse; Youngman, Tomas Hugh; Hansen, Ole; Pryds, Nini; Schou, Jørgen

    2016-01-01

    The influence of the laser wavelength on the deposition of copper tin sulfide (CTS) and SnS-rich CTS with a 248-nm KrF excimer laser (pulse length τ = 20 ns) and a 355-nm frequency-tripled Nd:YAG laser (τ = 6 ns) was investigated. A comparative study of the two UV wavelengths shows that the CTS...

  15. X-Ray Emission from Stellar Jets by Collision against High-density Molecular Clouds: an Application to HH 248

    Science.gov (United States)

    López-Santiago, J.; Bonito, R.; Orellana, M.; Miceli, M.; Orlando, S.; Ustamujic, S.; Albacete-Colombo, J. F.; de Castro, E.; Gómez de Castro, A. I.

    2015-06-01

    We investigate the plausibility of detecting X-ray emission from a stellar jet that impacts a dense molecular cloud, a scenario that may be typical for classical T Tauri stars with jets in dense star-forming complexes. We first model the impact of a jet against a dense cloud using two-dimensional axisymmetric hydrodynamic simulations, exploring different configurations of the ambient environment. Then, we compare our results with XMM-Newton observations of the Herbig-Haro object HH 248, where extended X-ray emission aligned with the optical knots is detected at the edge of the nearby IC 434 cloud. Our simulations show that a jet can produce plasma with temperatures up to 107 K, consistent with production of X-ray emission, after impacting a dense cloud. We find that jets denser than the ambient medium but less dense than the cloud produce detectable X-ray emission only at impact with the cloud. From an exploration of the model parameter space, we constrain the physical conditions (jet density and velocity and cloud density) that reproduce the intrinsic luminosity and emission measure of the X-ray source possibly associated with HH 248 well. Thus, we suggest that the extended X-ray source close to HH 248 corresponds to a jet impacting a dense cloud.

  16. Hysteresis in the spectral states of the neutron star low-mass X-ray binary EXO 1745-248

    CERN Document Server

    Mukherjee, Arunava

    2011-01-01

    We study the low-frequency timing properties and the spectral state evolution of the transient neutron star low-mass X-ray binary EXO 1745-248 using the entire Rossi X-ray Timing Explorer Proportional Counter Array data. We tentatively conclude that EXO 1745-248 is an atoll source, and report the discovery of a ~ 0.45 Hz low-frequency quasi-periodic oscillation and ~ 10 Hz peaked noises. If it is an atoll, this source is unusual because (1) instead of a `C'-like curve, it traced a clear overall clockwise hysteresis curve in each of the colour-colour diagram and the hardness-intensity diagram; and (2) the source took at least 2.5 months to trace the softer banana state, as opposed to a few hours to a day, which is typical for an atoll source. The shape of the hysteresis track was intermediate between the characteristic `q'-like curves of several black hole systems and `C'-like curves of atolls, implying that EXO 1745-248 is an important source for the unification of the black hole and neutron star accretion pr...

  17. Production of Hs-isotopes (Z=108) in the reaction 26Mg+248Cm

    International Nuclear Information System (INIS)

    Chemical studies of superheavy elements (SHE) are most convincing if, after chemical isolation, a nuclide is unambiguously identified by its nuclear decay properties. Thus chemists contribute not only new data on chemical properties of SHE but also nuclear structure information. Since chemists usually work with neutron-rich, longer-lived isotopes of SHE which are accessible only in asymmetric reactions with actinide targets and thus hard to access with recoil separators, this contribution is especially valuable. We have used the so-called In-situ Volatilization and On-line detection (IVO) technique to study the excitation function of the reaction 248Cm(26Mg,xn)274-xHs (x-5) thereby measuring the decay properties of the new nuclide 270Hs and its daughter 266Sg. It appears as if in earlier experiments our tentative assignment of two decay chains to 270Hs was not correct. This assignment was based on the decay properties of 266Sg reported by Lazarev et al., where the discovery of265Sg and 266Sg was described. Our new data indicates now, that due to an isomeric state in 261Rf which decays mostly by spontaneous fission, two decay chains tentatively assigned earlier to 270Hs and 266Sg are actually due to 269Hs and 265Sg. In addition, we observed several decay chains which were tentatively assigned to 271Hs and its decay daughters. The measured cross sections are of the order of few picobarns. Prospects to apply the IVO technique to other nuclides of SHE will be discussed. In addition, an overview about the status of the gas-filled separator TASCA (TransActinide Separator and Chemistry Apparatus) which is currently under construction at Gesellschaft fuer Schwerionenforschung (GSI) will be presented

  18. Multiwavelength behaviour of the blazar OJ 248 from radio to γ-rays

    Science.gov (United States)

    Carnerero, M. I.; Raiteri, C. M.; Villata, M.; Acosta-Pulido, J. A.; D'Ammando, F.; Smith, P. S.; Larionov, V. M.; Agudo, I.; Arévalo, M. J.; Arkharov, A. A.; Bach, U.; Bachev, R.; Benítez, E.; Blinov, D. A.; Bozhilov, V.; Buemi, C. S.; Bueno Bueno, A.; Carosati, D.; Casadio, C.; Chen, W. P.; Damljanovic, G.; Paola, A. Di; Efimova, N. V.; Ehgamberdiev, Sh. A.; Giroletti, M.; Gómez, J. L.; González-Morales, P. A.; Grinon-Marin, A. B.; Grishina, T. S.; Gurwell, M. A.; Hiriart, D.; Hsiao, H. Y.; Ibryamov, S.; Jorstad, S. G.; Joshi, M.; Kopatskaya, E. N.; Kurtanidze, O. M.; Kurtanidze, S. O.; Lähteenmäki, A.; Larionova, E. G.; Larionova, L. V.; Lázaro, C.; Leto, P.; Lin, C. S.; Lin, H. C.; Manilla-Robles, A. I.; Marscher, A. P.; McHardy, I. M.; Metodieva, Y.; Mirzaqulov, D. O.; Mokrushina, A. A.; Molina, S. N.; Morozova, D. A.; Nikolashvili, M. G.; Orienti, M.; Ovcharov, E.; Panwar, N.; Pastor Yabar, A.; Puerto Giménez, I.; Ramakrishnan, V.; Richter, G. M.; Rossini, M.; Sigua, L. A.; Strigachev, A.; Taylor, B.; Tornikoski, M.; Trigilio, C.; Troitskaya, Yu. V.; Troitsky, I. S.; Umana, G.; Valcheva, A.; Velasco, S.; Vince, O.; Wehrle, A. E.; Wiesemeyer, H.

    2015-07-01

    We present an analysis of the multiwavelength behaviour of the blazar OJ 248 at z = 0.939 in the period 2006-2013. We use low-energy data (optical, near-infrared, and radio) obtained by 21 observatories participating in the Gamma-Ray Large Area Space Telescope (GLAST)-AGILE Support Program of the Whole Earth Blazar Telescope, as well as data from the Swift (optical-UV and X-rays) and Fermi (γ-rays) satellites, to study flux and spectral variability and correlations among emissions in different bands. We take into account the effect of absorption by the Damped Lyman α intervening system at z = 0.525. Two major outbursts were observed in 2006-2007 and in 2012-2013 at optical and near-IR wavelengths, while in the high-frequency radio light curves prominent radio outbursts are visible peaking at the end of 2010 and beginning of 2013, revealing a complex radio-optical correlation. Cross-correlation analysis suggests a delay of the optical variations after the γ-ray ones of about a month, which is a peculiar behaviour in blazars. We also analyse optical polarimetric and spectroscopic data. The average polarization percentage P is less than 3 per cent, but it reaches ˜19 per cent during the early stage of the 2012-2013 outburst. A vague correlation of P with brightness is observed. There is no preferred electric vector polarization angle and during the outburst the linear polarization vector shows wide rotations in both directions, suggesting a complex behaviour/structure of the jet and possible turbulence. The analysis of 140 optical spectra acquired at the Steward Observatory reveals a strong Mg II broad emission line with an essentially stable flux of 6.2 × 10- 15 erg cm- 2 s- 1 and a full width at half-maximum of 2053 km s- 1.

  19. A Compact Group of Galaxies at z = 2.48 Hosting an AGN-driven Outflow

    Science.gov (United States)

    Shih, Hsin-Yi; Stockton, Alan

    2015-12-01

    We present observations of a remarkable compact group of galaxies at z = 2.48. Four galaxies, all within 40 kpc of each other, surround a powerful high-redshift radio source. This group comprises two compact red passive galaxies and a pair of merging galaxies. One of the red galaxies, with an apparent stellar mass of 3.6 × 1011M⊙ and an effective radius of 470 pc, is one of the most extreme examples of a massive quiescent compact galaxy found so far. One of the pair of merging galaxies hosts the active galactic nucleus (AGN) producing the large powerful radio structure. The merger is massive and enriched, consistent with the mass-metallicity relation expected at this redshift. Close to the merging nuclei, the emission lines exhibit broad and asymmetric profiles that suggest outflows powered either by a very young expanding radio jet or by AGN radiation. At ≳50 kpc from the system, we found a fainter extended-emission region that may be a part of a radio-jet-driven outflow. Some of the data presented herein were obtained at the W. M. Keck Observatory, which is operated as a scientific partnership among the California Institute of Technology, the University of California, and the National Aeronautics and Space Administration. The Observatory was made possible by the generous financial support of the W. M. Keck Foundation. The work is also based, in part, on data collected at the Subaru Telescope, which is operated by the National Astronomical Observatory of Japan, and on observations obtained at the Gemini Observatory, which is operated by the Association of Universities for Research in Astronomy, Inc., under a cooperative agreement with the NSF on behalf of the Gemini partnership: the National Science Foundation (United States), the National Research Council (Canada), CONICYT (Chile), the Australian Research Council (Australia), Ministério da Ciência, Tecnologia e Inovação (Brazil), and Ministerio de Ciencia, Tecnología e Innovación Productiva (Argentina).

  20. Search for surviving actinides and superheavy nuclei in damped collisions of 238U with 238U and 248Cm

    International Nuclear Information System (INIS)

    In the present talk aspects of the reaction mechanism related to the survival probability of the heaviest fragments in 238U + 238U collisions are discussed first. This is followed by a description of the experiments that have been performed to search for surviving superheavy fragments in the 238U + 238U reaction and by a presentation of the results obtained so far. In a third section our recent first attempts with the 238U + 248Cm reaction are described and preliminary results are discussed. (orig.)

  1. Influence of nuclear dissipation on fission dynamics of the excited nucleus $^{248}$Cf within a stochastic approach

    Indian Academy of Sciences (India)

    ESLAMIZADEH HADI

    2016-07-01

    A stochastic approach to fission dynamics based on two-dimensional Langevin equations was applied to calculate the anisotropy of the fission fragments angular distribution and average pre-scission neutron multiplicities for the compound nucleus 248Cf formed in the $${16}$O+$^{232}$Th reactions. Postsaddle nuclear dissipation strength of $(12–14) \\times 10^{21} s^{−1}$ was extracted for Cf nucleus by fitting the results of calculations with the experimentaldata. Furthermore, it was found that the results of calculations for the anisotropy of the fission fragments angular distribution and pre-scission neutron multiplicities are very sensitive to the magnitude of post-saddle nucleardissipation.

  2. Disc-Jet Coupling in the Terzan 5 Neutron Star X-ray Binary EXO 1745$-$248

    CERN Document Server

    Tetarenko, A J; Sivakoff, G R; Tremou, E; Linares, M; Tudor, V; Miller-Jones, J C A; Heinke, C O; Chomiuk, L; Strader, J; Altamirano, D; Degenaar, N; Maccarone, T; Patruno, A; Sanna, A; Wijnands, R

    2016-01-01

    We present the results of VLA, ATCA, and Swift XRT observations of the 2015 outburst of the transient neutron star X-ray binary (NSXB), EXO 1745$-$248, located in the globular cluster Terzan 5. Combining (near-) simultaneous radio and X-ray measurements we measure a correlation between the radio and X-ray luminosities of $L_R\\propto L_X^\\beta$ with $\\beta=1.68^{+0.10}_{-0.09}$, linking the accretion flow (probed by X-ray luminosity) and the compact jet (probed by radio luminosity). While such a relationship has been studied in multiple black hole X-ray binaries (BHXBs), this work marks only the third NSXB with such a measurement. Constraints on this relationship in NSXBs are strongly needed, as comparing this correlation between different classes of XB systems is key in understanding the properties that affect the jet production process in accreting objects. Our best fit disc-jet coupling index for EXO 1745$-$248 is consistent with the measured correlation in NSXB 4U 1728$-$34 ($\\beta=1.5\\pm 0.2$) but inconsi...

  3. Rapid fabrication of rigid biodegradable scaffolds by excimer laser mask projection technique: a comparison between 248 and 308 nm

    Science.gov (United States)

    Beke, S.; Anjum, F.; Ceseracciu, L.; Romano, I.; Athanassiou, A.; Diaspro, A.; Brandi, F.

    2013-03-01

    High-resolution photocrosslinking of the biodegradable poly(propylene fumarate) (PPF) and diethyl fumarate (DEF), using pulsed laser light at 248 and 308 nm is presented. The curing depth can be modulated between a few hundreds of nm and a few μm when using 248 nm and ten to a hundred μm when using 308 nm. By adjusting the total fluence (pulse numbers×laser fluence) dose and the weight ratios of PPF, DEF, and the photoinitiator in the photocrosslinkable mixtures, the height of polymerized structures can be precisely tuned. The lateral resolution is evaluated by projecting a pattern of a grid with a specified line width and line spacing. Young’s modulus of the cured parts is measured and found to be several GPa for both wavelengths, high enough to support bone formation. Several 2D and 2.5D microstructures, as well as porous 3D scaffolds fabricated by a layer-by-layer method, are presented. The results demonstrate that excimer laser-based photocuring is suitable for the fabrication of stiff and biocompatible structures with defined patterns of micrometer resolution in all three spatial dimensions.

  4. 节能BCD-248/H、BCD-218/H电冰箱的研究开发%Research and development the super energy- saving fridge BCD-218/H and BCD-248/H

    Institute of Scientific and Technical Information of China (English)

    赵先美

    2002-01-01

    运用项目管理方法及ERA电冰箱分析设计软件来科学决策BCD-248/H、BCD-218/H超级节能冰箱的开发设计方案,对采用压缩机、发泡层厚度、门封结构、门一体发泡、电子温控及数显、采用二位三通电磁阀及制冷系统最优化设计等进行了详细的经济技术分析,根据成本与性能综合最优化原则确定了上述两种冰箱的开发设计方案,据此开发出的样机总体能效水平处于国内领先水平.

  5. Production of new superheavy Z=108-114 nuclei with $^{238}$U, $^{244}$Pu and $^{248,250}$Cm targets

    CERN Document Server

    Feng, Zhao-Qing; Li, Jun-Qing

    2009-01-01

    Within the framework of the dinuclear system (DNS) model, production cross sections of new superheavy nuclei with charged numbers Z=108-114 are analyzed systematically. Possible combinations based on the actinide nuclides $^{238}$U, $^{244}$Pu and $^{248,250}$Cm with the optimal excitation energies and evaporation channels are pointed out to synthesize new isotopes which lie between the nuclides produced in the cold fusion and the $^{48}$Ca induced fusion reactions experimentally, which are feasible to be constructed experimentally. It is found that the production cross sections of superheavy nuclei decrease drastically with the charged numbers of compound nuclei. Larger mass asymmetries of the entrance channels enhance the cross sections in 2n-5n channels.

  6. Yrast spectroscopy of N=82,83 isotopes 136Xe and 137Xe from 248Cm fission

    International Nuclear Information System (INIS)

    Prompt γ-ray cascades in neutron-rich nuclei around doubly magic 132Sn have been studied at Eurogam II using a 248Cm fission source. Here we report results for the four-valence-proton N=82 nucleus 136Xe and for its N=83 neighbor 137Xe. For both nuclei, the yrast level spectra have been considerably extended, and empirical nucleon-nucleon interactions have been used to assign probable shell model configurations. The 136Xe level energies are compared with those calculated using different sets of proton-proton interaction matrix elements, both diagonal and nondiagonal, obtained by fitting experimental data for other N=82 isotones. copyright 1999 The American Physical Society

  7. First observation of new heavy multi-nucleon transfer products in the 48Ca+248Cm reaction performed at SHIP

    International Nuclear Information System (INIS)

    Heavy ion fusion reactions have been successfully used to synthesise super heavy elements (SHE). The heaviest element produced up to now is element Z=118 and the production cross-section limit using conventional HI-fusion has been reached experimentally. Since these methods cannot be applied to reach neutron-rich super heavy nuclei due to the lack of sufficiently neutron-rich projectile and target nuclei. New calculations suggest the use of Multi Nucleon Transfer (MNT) reactions as a promising pathway to the synthesis of new neutron-rich SHE with proton numbers up to about Z=106. In this work, we present results from the analysis of experimental data on MNT reactions with the 48Ca projectile incident on 248Cm target. The experiment was performed at SHIP, GSI in 2010

  8. Experimental Cross Sections for Reactions of Heavy Ions and 208Pb, 209Bi, 238U, and 248Cm Targets

    International Nuclear Information System (INIS)

    The study of the reactions between heavy ions and 208Pb, 209Bi, 238U, and 248 Cm targets was performed to look at the differences between the cross sections of hot and cold fusion reactions. Experimental cross sections were compared with predictions from statistical computer codes to evaluate the effectiveness of the computer code in predicting production cross sections. Hot fusion reactions were studied with the MG system, catcher foil techniques and the Berkeley Gas-filled Separator (BGS). 3n- and 4n-exit channel production cross sections were obtained for the 238U(18O,xn)256-xFm, 238U(22Ne,xn)260-xNo, and 248Cm(15N,xn)263-xLr reactions and are similar to previous experimental results. The experimental cross sections were accurately modeled by the predictions of the HIVAP code using the Reisdorf and Schaedel parameters and are consistent with the existing systematics of 4n exit channel reaction products. Cold fusion reactions were examined using the BGS. The 208Pb(48Ca,xn)256-xNo, 208Pb(50Ti,xn)258-xRf, 208Pb(51V,xn)259-xDb, 209Bi(50Ti,xn)259-xDb, and 209Bi(51V,xn)260-xSg reactions were studied. The experimental production cross sections are in agreement with the results observed in previous experiments. It was necessary to slightly alter the Reisdorf and Schaedel parameters for use in the HIVAP code in order to more accurately model the experimental data. The cold fusion experimental results are in agreement with current 1n- and 2n-exit channel systematics

  9. TP53 gene polymorphisms at codons 11, 72, and 248 and association with endometriosis in a Brazilian population.

    Science.gov (United States)

    Camargo-Kosugi, C M; D'Amora, P; Kleine, J P F O; Carvalho, C V; Sato, H; Schor, E; Silva, I D C G

    2014-01-01

    We evaluated the association between TP53 gene polymorphisms and endometriosis in Brazilian women. Genomic DNA was extracted from swabs of buccal cells collected from hospital patients. TP53 gene polymorphisms were investigated at three codons: TP53 11 Glu/Gln or Lys (GAG->CAG or AAG), TP53 72 Arg/Pro (CCG->CCC), and TP53 248 Arg/Thr (CGG->TCG) using the polymerase chain reaction-restriction fragment length polymorphism method. TP53 11 presented the following genotypic distribution: the control group was 98.28% homozygous wild-type (Glu) and 1.72% homozygous variant (Gln/Lys), and the heterozygous genotype was not identified. The genotypic distribution in the endometriosis group was 96% homozygous wild-type (Glu) and 4% heterozygous (Glu-Gln/Lys); the homozygous variant genotype was not identified (P = 0.02). TP53 72 showed the following genotypic distribution: the control group was 29.75% homozygous wild-type (Arg), 47.11% heterozygous (Arg-Pro), and 23.14% homozygous variant (Pro). The genotypic distribution in the endometriosis group was 16.15% homozygous wild-type (Arg), 51.54% heterozygous (Arg-Pro), and 32.31% homozygous variant (Pro) (odds ratio = 2.26; 95% confidence interval = 1.19-4.03; P = 0.02). Only one patient had the homozygous TP53 248 genotype (Arg-Trp/Gln); all other patients were homozygous wild-type in both the control and endometriosis groups (P = 0.51; NS). We found that TP53 72 polymorphism may be associated with susceptibility to endometriosis; the presence of at least 1 polymorphic allele increased the chance of disease development by 2.26-fold. Hence, this genetic variant is a potential candidate marker for endometriosis. PMID:25177931

  10. Experimental Cross Sections for Reactions of Heavy Ions and 208Pb, 209Bi, 238U, and 248Cm Targets

    Energy Technology Data Exchange (ETDEWEB)

    Patin, Joshua B.

    2002-05-24

    The study of the reactions between heavy ions and {sup 208}Pb, {sup 209}Bi, {sup 238}U, and {sup 248} Cm targets was performed to look at the differences between the cross sections of hot and cold fusion reactions. Experimental cross sections were compared with predictions from statistical computer codes to evaluate the effectiveness of the computer code in predicting production cross sections. Hot fusion reactions were studied with the MG system, catcher foil techniques and the Berkeley Gas-filled Separator (BGS). 3n- and 4n-exit channel production cross sections were obtained for the {sup 238}U({sup 18}O,xn){sup 256-x}Fm, {sup 238}U({sup 22}Ne,xn){sup 260-x}No, and {sup 248}Cm({sup 15}N,xn){sup 263-x}Lr reactions and are similar to previous experimental results. The experimental cross sections were accurately modeled by the predictions of the HIVAP code using the Reisdorf and Schaedel parameters and are consistent with the existing systematics of 4n exit channel reaction products. Cold fusion reactions were examined using the BGS. The {sup 208}Pb({sup 48}Ca,xn){sup 256-x}No, {sup 208}Pb({sup 50}Ti,xn){sup 258-x}Rf, {sup 208}Pb({sup 51}V,xn){sup 259-x}Db, {sup 209}Bi({sup 50}Ti,xn){sup 259-x}Db, and {sup 209}Bi({sup 51}V,xn){sup 260-x}Sg reactions were studied. The experimental production cross sections are in agreement with the results observed in previous experiments. It was necessary to slightly alter the Reisdorf and Schaedel parameters for use in the HIVAP code in order to more accurately model the experimental data. The cold fusion experimental results are in agreement with current 1n- and 2n-exit channel systematics.

  11. Sub-micron period grating structures in Ta2O5 and InOx thin oxide films fabricated using 248nm interferometric excimer laser ablation

    OpenAIRE

    Pissadakis, S.; Reekie, L.; J. S. Wilkinson; Kiriakidis, G.

    2000-01-01

    High quality relief gratings of period 500nm have been patterned in InOx and Ta2O5 thin films using interferometric 248nm excimer laser ablation. Details of the ablation process and the morphology of the gratings are presented.

  12. Bacterial curli protein promotes the conversion of PAP248-286 into the amyloid SEVI: cross-seeding of dissimilar amyloid sequences

    Directory of Open Access Journals (Sweden)

    Kevin Hartman

    2013-02-01

    Full Text Available Fragments of prostatic acid phosphatase (PAP248-286 in human semen dramatically increase HIV infection efficiency by increasing virus adhesion to target cells. PAP248-286 only enhances HIV infection in the form of amyloid aggregates termed SEVI (Semen Enhancer of Viral Infection, however monomeric PAP248-286 aggregates very slowly in isolation. It has therefore been suggested that SEVI fiber formation in vivo may be promoted by exogenous factors. We show here that a bacterially-produced extracellular amyloid (curli or Csg acts as a catalytic agent for SEVI formation from PAP248-286 at low concentrations in vitro, producing fibers that retain the ability to enhance HIV (Human Immunodeficiency Virus infection. Kinetic analysis of the cross-seeding effect shows an unusual pattern. Cross-seeding PAP248-286 with curli only moderately affects the nucleation rate while significantly enhancing the growth of fibers from existing nuclei. This pattern is in contrast to most previous observations of cross-seeding, which show cross-seeding partially bypasses the nucleation step but has little effect on fiber elongation. Seeding other amyloidogenic proteins (IAPP (islet amyloid polypeptide and Aβ1−40 with curli showed varied results. Curli cross-seeding decreased the lag-time of IAPP amyloid formation but strongly inhibited IAPP elongation. Curli cross-seeding exerted a complicated concentration dependent effect on Aβ1−40 fibrillogenesis kinetics. Combined, these results suggest that the interaction of amyloidogenic proteins with preformed fibers of a different type can take a variety of forms and is not limited to epitaxial nucleation between proteins of similar sequence. The ability of curli fibers to interact with proteins of dissimilar sequences suggests cross-seeding may be a more general phenomenon than previously supposed.

  13. X-ray emission from stellar jets by collision against high-density molecular clouds: an application to HH 248

    CERN Document Server

    Lopez-Santiago, Javier; Orellana, Mariana; Miceli, Marco; Orlando, Salvatore; Ustamujic, Sabina; Albacete-Colombo, Juan Facundo; de Castro, Elisa; de Castro, Ana Ines Gomez

    2015-01-01

    We investigate the plausibility of detecting X-ray emission from a stellar jet that impacts against a dense molecular cloud. This scenario may be usual for classical T Tauri stars with jets in dense star-forming complexes. We first model the impact of a jet against a dense cloud by 2D axisymmetric hydrodynamic simulations, exploring different configurations of the ambient environment. Then, we compare our results with XMM-Newton observations of the Herbig-Haro object HH 248, where extended X-ray emission aligned with the optical knots is detected at the edge of the nearby IC 434 cloud. Our simulations show that a jet can produce plasma with temperatures up to 10 MK, consistent with production of X-ray emission, after impacting a dense cloud. We find that jets denser than the ambient medium but less dense than the cloud produce detectable X-ray emission only at the impact onto the cloud. From the exploration of the model parameter space, we constrain the physical conditions (jet density and velocity, cloud den...

  14. Plume diagnostics and room-temperature deposition of carbon nanotubes and nano-onions at 248 nm

    International Nuclear Information System (INIS)

    We report on the deposition of carbon nanotubes and nano-onions at room temperature using excimer laser radiation at 248 nm to ablate mixed graphite-nickel/cobalt targets in the presence of O2 gas. The carbon nanotubes are frequently seen to connect individual onions and have a wall thickness on the order of 20-25 nm, with an overall external tube diameter of 100-200 nm. These tubes have notably large channel diameters and are significantly larger than typically reported single and multi-walled carbon nanotubes. The observed onion structures are both single and clustered and are 100-200 nm in diameter. Ablation of the same targets in comparable pressures of Ar does not result in these nanostructures but instead produces amorphous carbon. Ablating a pure graphite target under the same laser conditions, with or without metal, also does not yield the tubes and onions. In-situ time-resolved emission spectroscopy has been used to follow the emission from molecular carbon such as C2, as well as metals such as Ni or Co in the different ambients

  15. Surfactant Protein B Deficiency Caused by Homozygous C248X Mutation—A Case Report and Review of the Literature

    Directory of Open Access Journals (Sweden)

    Stefan Kurath-Koller

    2015-04-01

    Full Text Available Objective - Surfactant protein B (SP-B deficiency is a rare autosomal recessive disorder that is usually rapidly fatal. The c.397delCinsGAA mutation (121ins2 in exon 4 is found in more than two-thirds of patients. Design - We report on a fatal case of SP-B deficiency caused by a homozygous C248X mutation in exon 7 of the SP-B gene. In addition, we provide an update of the current literature. The EMBASE, MEDLINE, and CINAHL databases were systematically searched to identify all papers published in the English and German literature on SP-B deficiency between 1989 and 2013. Results - SP-B deficiency is characterized by progressive hypoxemic respiratory failure generally in full-term infants. They present with symptoms of respiratory distress and hypoxemia; chest X-ray resembles hyaline membrane disease. Prenatal diagnosis is possible from amniotic fluid or chorionic villi sampling. Conclusion - Thirty-four mutations have been published in the literature. Treatment options are scarce. Gene therapy is hoped to be an option in the future.

  16. Cervical foraminal steroid injections under CT guidance: retrospective study of in situ contrast aspects in a serial of 248 cases

    International Nuclear Information System (INIS)

    To describe all the CT findings after in situ contrast injection just before steroid injection and to recognize the abnormal aspects associated with intravascular contamination. We retrospectively evaluated 248 cervical transforaminal steroid injections done at the university hospital in Dijon, France, in 2008-2012, to treat cervicobrachial neuralgia inadequately improved by optimal medical treatment for at least 3 weeks. Features describing the opacification patterns were recorded. Five main nonvascular opacification patterns were identified: clumps of contrast agent outside the foramen (16 %), a crab claw pattern surrounding the ganglion (13 %), a ''French'' circumflex accent pattern (15 %), reflux along the needle (7 %), and facet joint capsule opacification (22 %). Concerning the situations requiring a change in needle position, intravenous injection occurred in 26 % of the patients, with a crab claw pattern in half the cases and a clump pattern in half the cases. Intraarteriolar injection was noted in two patients. CT after in situ contrast injection ensures proper needle positioning outside the blood vessels before steroid injection. Penetration of the needle tip into a vein is very common, whereas arteriolar puncture is extremely rare. (orig.)

  17. Cervical foraminal steroid injections under CT guidance: retrospective study of in situ contrast aspects in a serial of 248 cases

    Energy Technology Data Exchange (ETDEWEB)

    Pottecher, Pierre; Krause, Denis; Di Marco, Lucy; Loffroy, Romaric; Estivalet, Louis [CHU Dijon Bocage Central, Departement de Radiologie et Imagerie Diagnostique et Interventionnelle, Dijon (France); Duhal, Romain; Demondion, Xavier [CHRU de Lille, Service de Radiologie Musculosquelettique, CCIAL, Laboratoire d' Anatomie, Faculte de Medecine de Lille, Hopital Roger Salengro, Lille (France)

    2015-01-15

    To describe all the CT findings after in situ contrast injection just before steroid injection and to recognize the abnormal aspects associated with intravascular contamination. We retrospectively evaluated 248 cervical transforaminal steroid injections done at the university hospital in Dijon, France, in 2008-2012, to treat cervicobrachial neuralgia inadequately improved by optimal medical treatment for at least 3 weeks. Features describing the opacification patterns were recorded. Five main nonvascular opacification patterns were identified: clumps of contrast agent outside the foramen (16 %), a crab claw pattern surrounding the ganglion (13 %), a ''French'' circumflex accent pattern (15 %), reflux along the needle (7 %), and facet joint capsule opacification (22 %). Concerning the situations requiring a change in needle position, intravenous injection occurred in 26 % of the patients, with a crab claw pattern in half the cases and a clump pattern in half the cases. Intraarteriolar injection was noted in two patients. CT after in situ contrast injection ensures proper needle positioning outside the blood vessels before steroid injection. Penetration of the needle tip into a vein is very common, whereas arteriolar puncture is extremely rare. (orig.)

  18. Molecular genetics and functional anomalies in a series of 248 Brugada cases with 11 mutations in the TRPM4 channel.

    Directory of Open Access Journals (Sweden)

    Hui Liu

    Full Text Available Brugada syndrome (BrS is a condition defined by ST-segment alteration in right precordial leads and a risk of sudden death. Because BrS is often associated with right bundle branch block and the TRPM4 gene is involved in conduction blocks, we screened TRPM4 for anomalies in BrS cases. The DNA of 248 BrS cases with no SCN5A mutations were screened for TRPM4 mutations. Among this cohort, 20 patients had 11 TRPM4 mutations. Two mutations were previously associated with cardiac conduction blocks and 9 were new mutations (5 absent from ~14'000 control alleles and 4 statistically more prevalent in this BrS cohort than in control alleles. In addition to Brugada, three patients had a bifascicular block and 2 had a complete right bundle branch block. Functional and biochemical studies of 4 selected mutants revealed that these mutations resulted in either a decreased expression (p.Pro779Arg and p.Lys914X or an increased expression (p.Thr873Ile and p.Leu1075Pro of TRPM4 channel. TRPM4 mutations account for about 6% of BrS. Consequences of these mutations are diverse on channel electrophysiological and cellular expression. Because of its effect on the resting membrane potential, reduction or increase of TRPM4 channel function may both reduce the availability of sodium channel and thus lead to BrS.

  19. Analysis of damage threshold of K9 glass irradiated by 248-nm KrF excimer laser

    Science.gov (United States)

    Wang, Xi; Shao, Jingzhen; Li, Hua; Nie, Jinsong; Fang, Xiaodong

    2016-02-01

    The theoretical model of K9 glass irradiated by a 248-nm KrF excimer laser was established, and a numerical simulation was performed to calculate temperature and thermal stress fields in the K9 glass sample using the finite element method. The laser-induced damage thresholds were defined and calculated, and the effect of repetition frequency and the number of pulses on the damage threshold were also studied. Furthermore, the experiment research was carried out to confirm the numerical simulation. The damage threshold and damage morphology were analyzed by means of a metallurgical microscope and scanning electron microscopy. The simulation and experimental results indicated that the damage mechanism of K9 glass irradiated by a KrF excimer laser was melting damage and stress damage, and the stress damage first appeared inside the K9 glass sample. The tensile stress damage threshold, the compressive stress damage threshold, and the melting damage threshold were 0.64, 0.76, and 1.05 J/cm2, respectively. The damage threshold decreased with increasing repetition frequency and number of laser pulses. The experimental results indicated that the damage threshold of K9 glass was 2.8 J/cm2.

  20. GMRT and VLA Observations at 49 cm and 20 cm of the HII Region near = 24.8°, = 0.1°

    Indian Academy of Sciences (India)

    N. G. Kantharia; W. M. Goss; D. Anish Roshi; Niruj R. Mohan; Francois Viallefond

    2007-03-01

    We report multi-frequency radio continuum and hydrogen radio recombination line observations of HII regions near = 24.8°, = 0.1° using the Giant Metrewave Radio Telescope(GMRT) at 1.28 GHz ( = 172), 0.61 GHz ( = 220) and the Very Large Array (VLA) at 1.42 GHz ( = 166). The region consists of a large number of resolved HII regions and a few compact HII regions as seen in our continuum maps, many of which have associated infrared (IR) point sources. The largest HII region at = 24.8° and = 0.1° is a few arcmins in size and has a shell-type morphology. It is a massive HII region enclosing ∼ 550 M⊙ with a linear size of 7 pc and an rms electron density of ∼ 110 cm-3 at a kinematic distance of 6 kpc. The required ionization can be provided by a single star of spectral type O5.5. We also report detection of hydrogen recombination lines from the HII region at = 24.8° and = 0.1° at all observed frequencies near = 100 km s-1. We model the observed integrated line flux density as arising in the diffuse HII region and find that the best fitting model has an electron density comparable to that derived from the continuum.We also report detection of hydrogen recombination lines from two other HII regions in the field.

  1. Measurement of intensity-dependent rates of above-threshold ionization (ATI) of atomic hydrogen at 248 nm

    International Nuclear Information System (INIS)

    Measured rates of multiphoton ionization (MPI) from the ground state of atomic hydrogen by a linearly polarized, subpicosecond KrF laser pulse at 248 nm wavelength are compared to predictions of lowest-order perturbation theory, Floquet theory, and Keldysh-Faisal-Reiss (KFR) theory with and without Coulomb correction for peak irradiance of 3 x 1012W/cm2 to 2 x 1014W/cm2. The Coulomb-corrected Keldysh model falls closest to the measured rates, the others being much higher or much lower. At 5 x 1013W/cm2, the number of ATI electrons decreased by a factor of approximately 40 with each additional photon absorbed. ATI of the molecular hydrogen background and of atoms from photodissociation of the molecules were also observed. The experiment employed a crossed-beam technique at ultrahigh vacuum with an rf-discharge atomic hydrogen source and a magnetic-bottle type electron time-of-flight spectrometer to count the electrons in the different ATI channels separately. The apparatus was calibrated to allow comparison of absolute as well as relative ionization rates to the theoretical predictions. This calibration involved measuring the distribution of irradiance in a focal volume that moved randomly and changed its size from time to time. A data collection system under computer control divided the time-of-flight spectra into bins according to the energy of each laser pulse. This is the first measurement of absolute rates of ATI in atomic hydrogen, and the first measurement of absolute test of MPI in atomic hydrogen without a large factor to account for multiple modes in the laser field. As such, the results of this work are important to the development of ATI theories, which presently differ by orders of magnitude in their prediction of the ionization rates. They are also important to recent calculations of temperatures in laser-heated plasmas, many of which incorporate KFR theory

  2. Measurement of intensity-dependent rates of above-threshold ionization (ATI) of atomic hydrogen at 248 nm

    Energy Technology Data Exchange (ETDEWEB)

    Nichols, T.D.

    1991-04-01

    Measured rates of multiphoton ionization (MPI) from the ground state of atomic hydrogen by a linearly polarized, subpicosecond KrF laser pulse at 248 nm wavelength are compared to predictions of lowest-order perturbation theory, Floquet theory, and Keldysh-Faisal-Reiss (KFR) theory with and without Coulomb correction for peak irradiance of 3 {times} 10{sup 12}W/cm{sup 2} to 2 {times} 10{sup 14}W/cm{sup 2}. The Coulomb-corrected Keldysh model falls closest to the measured rates, the others being much higher or much lower. At 5 {times} 10{sup 13}W/cm{sup 2}, the number of ATI electrons decreased by a factor of approximately 40 with each additional photon absorbed. ATI of the molecular hydrogen background and of atoms from photodissociation of the molecules were also observed. The experiment employed a crossed-beam technique at ultrahigh vacuum with an rf-discharge atomic hydrogen source and a magnetic-bottle type electron time-of-flight spectrometer to count the electrons in the different ATI channels separately. The apparatus was calibrated to allow comparison of absolute as well as relative ionization rates to the theoretical predictions. This calibration involved measuring the distribution of irradiance in a focal volume that moved randomly and changed its size from time to time. A data collection system under computer control divided the time-of-flight spectra into bins according to the energy of each laser pulse. This is the first measurement of absolute rates of ATI in atomic hydrogen, and the first measurement of absolute test of MPI in atomic hydrogen without a large factor to account for multiple modes in the laser field. As such, the results of this work are important to the development of ATI theories, which presently differ by orders of magnitude in their prediction of the ionization rates. They are also important to recent calculations of temperatures in laser-heated plasmas, many of which incorporate KFR theory.

  3. Competition between photochemistry and energy transfer in ultraviolet-excited diazabenzenes. I. Photofragmentation studies of pyrazine at 248 nm and 266 nm

    International Nuclear Information System (INIS)

    The quantum yield for the formation of HCN from the photodissociation of pyrazine excited at 248 nm and 266 nm is determined by IR diode probing of the HCN photoproduct. HCN photoproducts from excited pyrazine are produced via three different dissociation channels, one that is extremely ''prompt'' and two others that are ''late.'' The total quantum yield from all reaction channels obtained at low quencher gas pressures, φ=1.3±0.2 for 248 nm and 0.5±0.3 for 266 nm, is in agreement with preliminary studies of this process as well as recent molecular beam studies. To investigate if HCN production is the result of pyrazine multiphoton absorption, this photodissociation process has been further studied by observing the HCN quantum yield as a function of total quencher gas pressure (10 mTorr pyrazine, balance SF6) and as a function of 248 nm laser fluence from 2.8 to 82 mJ/cm2. At the highest SF6 pressures, the HCN quantum yield shows strong positive correlation with laser fluence, indicating that the ''prompt'' channel is the result of multiphoton absorption; however, at low pressure, the HCN quantum yield is affected little by changing laser fluence, indicating that the majority of the HCN photoproducts at low pressure are produced from pyrazine which has absorbed only one UV photon. At the lowest pressures sampled, HCN produced from the one-photon ''late'' process accounts for more than 95% of all HCN formed (at low laser fluence). At high pressures the single photon ''late'' pyrazine dissociation is quenched, and HCN produced at high quencher gas pressures comes only from the multiphoton absorption channel, which can be clearly observed to depend on laser fluence. The HCN quantum yield as a function of laser intensity at high pressure has been fit to a quadratic function that can be used to determine the amount of ''prompt'' ''unquenched'' HCN produced from multiphoton photodissociation. Additionally, the information theoretic prior functions for energy disposal

  4. Decay Properties of 266Bh and 262Db Produced in the 248Cm+23Na Reaction - Further Confirmation of the 278113 Decay Chain

    International Nuclear Information System (INIS)

    Decay properties of an isotope 266Bh and its daughter nucleus 262Db produced by the 248Cm(23Na,5n) reaction were studied by using a gas-filled recoil separator coupled with a position-sensitive semiconductor detector. 266Bh was clearly identified from the correlation of the known nuclide, 262Db. The obtained decay properties of 266Bh and 262Db are consistent with those observed in the 278113 chain by RIKEN collaboration, which provided further confirmation of the discovery of 278113.

  5. A comparison of the femto-, pico- and nano-second multiphoton ionization and dissociation processes of NO 2 at 248 and 496 nm

    Science.gov (United States)

    Ledingham, K. W. D.; Kosmidis, C.; Georgiou, S.; Couris, S.; Singhal, R. P.

    1995-12-01

    The multiphoton ionization and dissociation of NO 2 at 248 nm ( B˜2B 2←X 2A 1) and 496 nm has been carried out for a number of different laser pulsewidths from 15 ns to 300 fs by time-of-flight mass spectrometry in a molecular beam. At 248 nm the NO 2/NO ion ratio (NO 2+/NO +) varies from about 1% using nanosecond laser pulses to about 60% for the shortest pulses used (300 fs). In contrast, at 496 nm the NO 2+/NO + ratio remains very small for excitation with both 5 ps and 500 fs pulses. These results are interpreted in terms of the limited knowledge of the dissociation rates above the NO(X)+O( 1D) fragmentation threshold at 40126 cm -1 using a simple rate equation model. The results can be described using dissociation rates which increase with decreasing pulsewidth, an idea which conforms with the distinction that has been drawn between time and frequency domain experiments. The implications of the results for the analytical potential of femtosecond mass spectrometry are discussed.

  6. Aminodisilanes as silylating agents for dry-developed positive-tone resists for deep-ultraviolet (248-nm) and extreme ultraviolet (13.5-nm) microlithography

    Science.gov (United States)

    Wheeler, David R.; Hutton, Richard S.; Boyce, Craig H.; Stein, Susan M.; Cirelli, Raymond A.; Taylor, Gary N.

    1995-06-01

    Disilanes are used as silylating reagents for near-surface imaging with deep-UV (248 nm) and EUV (13.5 nm) lithography. A relatively thin imaging layer of a photo-cross-linking resist is spun over a thicker layer of hard-baked resist that functions as a planarizing layer and antireflective coating. Photoinduced acid generation and subsequent heating crosslinks render exposed areas impermeable to an aminodisilane that reacts with the unexposed regions. Subsequent silylation and reactive ion etching affords a positive-tone image. The use of disilanes introduces a higher concentration of silicon into the polymer than is possible with silicon reagents that incorporate only one silicon atom per reactive site. The higher silicon content in the silylated polymer increases etching selectivity between exposed and unexposed regions and thereby increases the contrast. The synthesis and reactivity of `smaller' disilanes, N,N-dimethylamino-1,2-dimethyldisilane, (DMADMDS), and N,N-diethylamino-1,2- dimethyldisilane also are described. Additional silylation improvements that minimize flow during silylation also are discussed including the addition of bifunctional disilanes to the monofunctional DMAPMDS. This causes the crosslinking to occur during silylation which minimizes flow. We have resolved high aspect ratio, very high quality 0.20 micrometers line and space patterns at 248 nm with a stepper having a numerical aperture (NA) equals 0.53 and have resolved EQ 0.15 micrometers line and spaces at 13.5 nm.

  7. Structural and magnetic properties of the new ternary silicide Gd{sub 3}Co{sub 2.48}Si{sub 1.52}

    Energy Technology Data Exchange (ETDEWEB)

    Gaudin, E., E-mail: gaudin@icmcb-bordeaux.cnrs.fr [CNRS, Universite de Bordeaux, ICMCB, 87 avenue du Docteur Albert Schweitzer, 33608 Pessac Cedex (France); Mayer, C.; Weill, F.; Chevalier, B. [CNRS, Universite de Bordeaux, ICMCB, 87 avenue du Docteur Albert Schweitzer, 33608 Pessac Cedex (France)

    2012-12-25

    Highlights: Black-Right-Pointing-Pointer The existence of the new intermetallic Gd{sub 3}Co{sub 2.48}Si{sub 1.52} is reported. Black-Right-Pointing-Pointer Its structure derives from the W{sub 3}CoB{sub 3}-type structure. Black-Right-Pointing-Pointer Mixed occupancy between Co- and Si-atoms is observed for two crystallographic sites. Black-Right-Pointing-Pointer A ferromagnetic transition occurs at 180 K. - Abstract: Gd{sub 3}Co{sub 2.48}Si{sub 1.52} was obtained by arc-melting of the elements and subsequent annealing at 1073 K during 1 month. Its structure, determined from single-crystal X-ray diffraction data, derives from the W{sub 3}CoB{sub 3}-type structure with the space group Cmcm and the unit cell parameters a = 4.1185(3), b = 10.2970(7) and c = 12.8166(8) A. Mixed occupancy between Co- and Si-atoms is observed for two crystallographic sites. Only few ternary compounds are known to crystallize with this structure-type. Magnetization measurements reveal at least one ferromagnetic transition at 180 K.

  8. A strong emission line near 24.8 angstrom in the X-ray binary system MAXI J0556--332: gravitational redshift or unusual donor?

    CERN Document Server

    Maitra, Dipankar; Raymond, John C; Reynolds, Mark T

    2011-01-01

    We report the discovery of a strong emission line near 24.8 angstrom (0.5 keV) in the newly discovered X-ray binary system MAXI J0556-332 with the reflection grating spectrometer onboard the XMM-Newton observatory. The X-ray light curve morphology during these observations is complex and shows occasional dipping behavior. Here we present time- and rate-selected spectra from the RGS and show that this strong emission line is unambiguously present in all the XMM observations. The measured line center is consistent with the Ly-alpha transition of N VII in the rest frame. While the spectra contain imprints of absorption lines and edges, there appear to be no other significantly prominent narrow line due to the source itself, thus making the identification of the 24.8 angstrom line uncertain. We discuss possible physical scenarios, including a gravitationally redshifted O VIII Ly-alpha line originating at the surface of a neutron star or an unusual donor with an extremely high N/O abundance (>57) relative to solar...

  9. A STRONG EMISSION LINE NEAR 24.8 Å IN THE X-RAY BINARY SYSTEM MAXI J0556–332: GRAVITATIONAL REDSHIFT OR UNUSUAL DONOR?

    International Nuclear Information System (INIS)

    We report the discovery of a strong emission line near 24.8 Å (0.5 keV) in the newly discovered X-ray binary system MAXI J0556–332 with the reflection grating spectrometer (RGS) on board the XMM-Newton observatory. The X-ray light curve morphology during these observations is complex and shows occasional dipping behavior. Here we present time- and rate-selected spectra from the RGS and show that this strong emission line is unambiguously present in all the XMM observations. The measured line center is consistent with the Lyα transition of N VII in the rest frame. While the spectra contain imprints of absorption lines and edges, there appear to be no other significantly prominent narrow line due to the source itself, thus making the identification of the 24.8 Å line uncertain. We discuss possible physical scenarios, including a gravitationally redshifted O VIII Lyα line originating at the surface of a neutron star or an unusual donor with an extremely high N/O abundance (>57) relative to solar that may have produced this comparatively strong emission line.

  10. Electron Photodetachment from Aqueous Anions. I. Quantum Yields for Generation of Hydrated Electron by 193 and 248 nm Laser Photoexcitation of Miscellaneous Inorganic Anions

    CERN Document Server

    Sauer, M C; Shkrob, I A; Sauer, Myran C.; Shkrob, Ilya A.

    2004-01-01

    Time resolved transient absorption spectroscopy has been used to determine quantum yields for electron photodetachment in 193 nm and (where possible) 248 nm laser excitation of miscellaneous aqueous anions, including hexacyanoferrate(II), sulfate, sulfite, halide anions (Cl-, Br-, and I-), pseudohalide anions (OH-, HS-, CNS-), and several common inorganic anions for which no quantum yields have been reported heretofore: SO3=, NO2-, NO3-, ClO3- and ClO4-. Molar extinction coefficients for these anions and photoproducts of electron detachment from these anions at the excitation wavelengths were also determined. These results are discussed in the context of recent ultrafast kinetic studies and compared with the previous data obtained by product analyses. We suggest using electron photodetachment from the aqueous halide and pseudohalide anions as actinometric standard for time-resolved studies of aqueous photosystems in the UV.

  11. Probing the MSP prenatal stage: the optical identification of the X-ray burster EXO 1745-248 in Terzan 5

    CERN Document Server

    Ferraro, F R; Lanzoni, B; Cadelano, M; Massari, D; Dalessandro, E; Mucciarelli, A; -,

    2015-01-01

    We report on the optical identification of the neutron star burster EXO 1745-248 in Terzan 5. The identification was performed by exploiting HST/ACS images acquired in Director's Discretionary Time shortly after (approximately 1 month) the Swift detection of the X-ray burst. The comparison between these images and previous archival data revealed the presence of a star that currently brightened by ~3 magnitudes, consistent with expectations during an X-ray outburst. The centroid of this object well agrees with the position, in the archival images, of a star located in the Turn-Off/Sub Giant Branch region of Terzan 5. This supports the scenario that the companion should has recently filled its Roche Lobe. Such a system represents the pre-natal stage of a millisecond pulsar, an evolutionary phase during which heavy mass accretion on the compact object occurs, thus producing X-ray outbursts and re-accelerating the neutron star.

  12. Photodissociation of CH3CHO at 248 nm by time-resolved Fourier-transform infrared emission spectroscopy: Verification of roaming and triple fragmentation

    Science.gov (United States)

    Hung, Kai-Chan; Tsai, Po-Yu; Li, Hou-Kuan; Lin, King-Chuen

    2014-02-01

    By using time-resolved Fourier-transform infrared emission spectroscopy, the HCO fragment dissociated from acetaldehyde (CH3CHO) at 248 nm is found to partially decompose to H and CO. The fragment yields are enhanced by the Ar addition that facilitates the collision-induced internal conversion. The channels to CH2CO + H2 and CH3CO + H are not detected significantly. The rotational population distribution of CO, after removing the Ar collision effect, shows a bimodal feature comprising both low- and high-rotational (J) components, sharing a fraction of 19% and 81%, respectively, for the vibrational state v = 1. The low-J component is ascribed to both roaming pathway and triple fragmentation. They are determined to have a branching ratio of 0.06, respectively, relative to the whole v = 1 population. The CO roaming is accompanied by a highly vibrational population of CH4 that yields a vibrational bimodality.

  13. Optimization of power compression and stability of relativistic and ponderomotive self-channeling of 248 nm laser pulses in underdense plasmas

    International Nuclear Information System (INIS)

    The controlled formation in an underdense plasma of stable multi-PW relativistic micrometer-scale channels, which conduct a confined power at 248 nm exceeding 104 critical powers and establish a peak channel intensity of ∼1023 W/cm2, can be achieved with the use of an appropriate gradient in the electron density in the initial launching phase of the confined propagation. This mode of channel formation optimizes both the power compression and the stability by smoothing the transition from the incident spatial profile to that associated with the lowest channel eigenmode, the dynamically robust structure that governs the confined propagation. A chief outcome is the ability to stably conduct coherent energy at fluences greater than 109 J/cm2

  14. Effects of temperature on the p53-DNA binding interactions and their dynamical behavior: comparing the wild type to the R248Q mutant.

    Directory of Open Access Journals (Sweden)

    Khaled Barakat

    Full Text Available BACKGROUND: The protein p53 plays an active role in the regulation of cell cycle. In about half of human cancers, the protein is inactivated by mutations located primarily in its DNA-binding domain. Interestingly, a number of these mutations possess temperature-induced DNA-binding characteristics. A striking example is the mutation of Arg248 into glutamine or tryptophan. These mutants are defective for binding to DNA at 310 K although they have been shown to bind specifically to several p53 response elements at sub-physiological temperatures (298-306 K. METHODOLOGY/PRINCIPAL FINDINGS: This important experimental finding motivated us to examine the effects of temperature on the structure and configuration of R248Q mutant and compare it to the wild type protein. Our aim is to determine how and where structural changes of mutant variants take place due to temperature changes. To answer these questions, we compared the mutant to the wild-type proteins from two different aspects. First, we investigated the systems at the atomistic level through their DNA-binding affinity, hydrogen bond networks and spatial distribution of water molecules. Next, we assessed changes in their long-lived conformational motions at the coarse-grained level through the collective dynamics of their side-chain and backbone atoms separately. CONCLUSIONS: The experimentally observed effect of temperature on the DNA-binding properties of p53 is reproduced. Analysis of atomistic and coarse-grained data reveal that changes in binding are determined by a few key residues and provide a rationale for the mutant-loss of binding at physiological temperatures. The findings can potentially enable a rescue strategy for the mutant structure.

  15. Oxalyl chloride, ClC(O)C(O)Cl: UV/vis spectrum and Cl atom photolysis quantum yields at 193, 248, and 351 nm

    Science.gov (United States)

    Ghosh, Buddhadeb; Papanastasiou, Dimitrios K.; Burkholder, James B.

    2012-10-01

    Oxalyl chloride, (ClCO)2, has been used as a Cl atom photolytic precursor in numerous laboratory kinetic and photochemical studies. In this study, the UV/vis absorption spectrum of (ClCO)2 and the Cl atom quantum yields in its photolysis at 193, 248, and 351 nm are reported. The UV/vis spectrum was measured between 200 and 450 nm at 296 K using diode array spectroscopy in conjunction with an absolute cross section obtained at 213.9 nm. Our results are in agreement with the spectrum reported by Baklanov and Krasnoperov [J. Phys. Chem. A 105, 97-103 (2001), 10.1021/jp0019456], which was obtained at 11 discrete wavelengths between 193.3 and 390 nm. Cl atom quantum yields, Φ(λ), were measured using pulsed laser photolysis coupled with time resolved atomic resonance fluorescence detection of Cl. The UV photolysis of (ClCO)2 has been shown in previous studies to occur via an impulsive three-body dissociation mechanism, (COCl)2 + hv → ClCO* + Cl + CO (2), where the excited ClCO radical, ClCO*, either dissociates or stabilizes ClCO* → Cl + CO (3a), → ClCO (3b). ClCO is thermally unstable at the temperatures (253-298 K) and total pressures (13-128 Torr) used in our experiments ClCO + M → Cl + CO + M (4) leading to the formation of a secondary Cl atom that was resolvable in the Cl atom temporal profiles obtained in the 248 and 351 nm photolysis of (ClCO)2. Φ(193 nm) was found to be 2.07 ± 0.37 independent of bath gas pressure (25.8-105.7 Torr, N2), i.e., the branching ratio for channel 2a or the direct formation of 2Cl + 2CO in the photolysis of (ClCO)2 is >0.95. At 248 nm, the branching ratio for channel 2a was determined to be 0.79 ± 0.15, while the total Cl atom yield, i.e., following the completion of reaction (4), was found to be 1.98 ± 0.26 independent of bath gas pressure (15-70 Torr, N2). Φ(351 nm) was found to be pressure dependent between 7.8 and 122.4 Torr (He, N2). The low-pressure limit of the total Cl atom quantum yield, Φ0(351 nm), was 2.05

  16. Measurements of prompt neutron multiplicity distributions in correlation with mass-energy distribution of fission fragments in spontaneous fission of 252Cf, 244Cm and 248Cm

    International Nuclear Information System (INIS)

    The number of prompt neutrons emitted in the fission event have been measured separately for each complementary fragment in coincidence with fragment mass and kinetic energies in spontaneous fission of 252Cf, 244Cm and 248Cm. Two high efficient Gd-loaded liquid scintillator tanks were used for the neutron registration. Approximately 3x106 fission events coincident with prompt neutron emission have been accumulated for each isotope. The mean neutron multiplicity, the dispersion and the covariance of the multiplicity distributions have been obtained as a function of fission fragment mass and kinetic energy. The neutron multiplicity data have been corrected for neutron registration efficiency, background and pile-up. Dependencies of the moments of the multiplicity distributions on the fragment mass and total kinetic energy for different mass bins, as well as mass and total kinetic energy distributions of the fission fragments are presented, discussed and compared for the different isotopes investigated. The results showed a different behavior of the moments of the multiplicity distribution depending on the fragment mass asymmetry that reflects changes in the dynamical effects for different fission modes. (author)

  17. Accurate determination of Curium and Californium isotopic ratios by inductively coupled plasma quadrupole mass spectrometry (ICP-QMS) in 248Cm samples for transmutation studies

    International Nuclear Information System (INIS)

    The French Atomic Energy Commission has carried out several experiments including the mini-INCA (INcineration of Actinides) project for the study of minor-actinide transmutation processes in high intensity thermal neutron fluxes, in view of proposing solutions to reduce the radiotoxicity of long-lived nuclear wastes. In this context, a Cm sample enriched in 248Cm (∼97 %) was irradiated in thermal neutron flux at the High Flux Reactor (HFR) of the Laue-Langevin Institute (ILL). This work describes a quadrupole ICP-MS (ICP-QMS) analytical procedure for precise and accurate isotopic composition determination of Cm before sample irradiation and of Cm and Cf after sample irradiation. The factors that affect the accuracy and reproducibility of isotopic ratio measurements by ICP-QMS, such as peak centre correction, detector dead time, mass bias, abundance sensitivity and hydrides formation, instrumental background, and memory blank were carefully evaluated and corrected. Uncertainties of the isotopic ratios, taking into account internal precision of isotope ratio measurements, peak tailing, and hydrides formations ranged from 0.3% to 1.3%. This uncertainties range is quite acceptable for the nuclear data to be used in transmutation studies.

  18. Wilms' tumor: natural history and prognostic factors. A retrospective study of 248 cases treated at the Institut Gustave-Roussy 1952--1967

    International Nuclear Information System (INIS)

    A statistical analysis of 248 histologically proven cases of Wilms' tumor treated at the Institut Gustave-Roussy, Villejuif, France, from 1952 to 1967 is presented. Two years recurrence-free survival and five years survival have been selected as prognostic criteria. Patients under two years of age have significantly fewer metastases and a better five-year survival rate than those over two. Stage is strongly correlated with recurrences and survival. Influence of tumor size, number of tumor nodules, tumor rupture, adhesions, regional lymph node involvement, and renal vein infiltration is shown. Detailed analysis of histopathologic features indicates that a favorable clinical course is significantly related to the number of different varieties of epithelial differentiation (tubular, glomerular, microcystic) found in any tumor, whatever the abundance of each of them. Presence of striated muscular cells, however abundant, does not influence survival or metastatic rates. Cases where irradiation given prior to surgery resulted in complete destruction of tumor cells form a distinctive group of very unfavorable prognosis. Relapse of tumor occurs in 54 percent of cases, 10 percent presenting metastases. Involved sites are listed. No correlation is found between date of metastases and other parameters. The three major prognostic factors of age, stage, histologic pattern, bear prognostic value separately. Stage and age are linked, as well as histology and age. Stage and histology are not linked. Age in itself therefore seems less important. It is concluded that these well-defined parameters should be employed in defining treatment for each individual case

  19. Odd oxygen formation in the laser irradiation of O2 at 248 nm - Evidence for reactions of O2 in the Herzberg states with ground state O2

    Science.gov (United States)

    Shi, Jichun; Barker, John R.

    1992-01-01

    Two O3 formation processes (initiation and autocatalytic) are studied in pure O2 and in O2+N2 and O2+Ar mixtures at pressures between 200 and 1600 torr and at temperatures between 298 and 370 K. Evidence is presented that the initiation process produces O3 through chemical reactions between ground state O2 and excited O2 in the Herzberg states, which are produced by the photoabsorption of O2 at 248 nm. For the autocatalytic process, the results are consistent with the proposal that the O3 formation is accelerated by photodissociating vibrationally excited O2(nu), produced in the photolysis of O3 following its initial formation. It is argued that the O2 Herzberg states and O2(nu) may play important roles in the odd oxygen chemistry in the middle atmosphere. It is estimated that the O2(A3Sigma-u(+))+O2 reaction may yield up to about 6 percent of the total odd oxygen production rate near 50 km.

  20. I2 molecular elimination in single-photon dissociation of CH2I2 at 248 nm by using cavity ring-down absorption spectroscopy

    International Nuclear Information System (INIS)

    Following single-photon dissociation of CH2I2 at 248 nm, I2 molecular elimination is detected by using cavity ring-down absorption spectroscopy. The technique comprises two laser beams propagating in a perpendicular configuration, in which a tunable laser beam along the axis of the ring-down cell probes the I2 fragment in the B 3Πou+- X 1Σg+ transition. The nascent vibrational populations for v = 0, 1, and 2 levels are obtained with a population ratio of 1:(0.65 ± 0.10):(0.30 ± 0.05), corresponding to a Boltzmann-like vibrational temperature of 544 ± 73 K. The quantum yield of the ground state I2 elimination reaction is determined to be 0.0040 ± 0.0025. With the aid of ab initio potential energy calculations, the pathway of molecular elimination is proposed on the energetic ground state CH2I2 via internal conversion, followed by asynchronous three-center dissociation. A positive temperature effect supports the proposed mechanism.

  1. Molecular elimination of Br2 in photodissociation of CH2BrC(O)Br at 248 nm using cavity ring-down absorption spectroscopy

    International Nuclear Information System (INIS)

    The primary elimination channel of bromine molecule in one-photon dissociation of CH2BrC(O)Br at 248 nm is investigated using cavity ring-down absorption spectroscopy. By means of spectral simulation, the ratio of nascent vibrational population in v = 0, 1, and 2 levels is evaluated to be 1:(0.5 ± 0.1):(0.2 ± 0.1), corresponding to a Boltzmann vibrational temperature of 581 ± 45 K. The quantum yield of the ground state Br2 elimination reaction is determined to be 0.24 ± 0.08. With the aid of ab initio potential energy calculations, the obtained Br2 fragments are anticipated to dissociate on the electronic ground state, yielding vibrationally hot Br2 products. The temperature-dependence measurements support the proposed pathway via internal conversion. For comparison, the Br2 yields are obtained analogously from CH3CHBrC(O)Br and (CH3)2CBrC(O)Br to be 0.03 and 0.06, respectively. The trend of Br2 yields among the three compounds is consistent with the branching ratio evaluation by Rice-Ramsperger-Kassel-Marcus method. However, the latter result for each molecule is smaller by an order of magnitude than the yield findings. A non-statistical pathway so-called roaming process might be an alternative to the Br2 production, and its contribution might account for the underestimate of the branching ratio calculations.

  2. Br2 molecular elimination in photolysis of (COBr)2 at 248 nm by using cavity ring-down absorption spectroscopy: A photodissociation channel being ignored

    International Nuclear Information System (INIS)

    A primary dissociation channel of Br2 elimination is detected following a single-photon absorption of (COBr)2 at 248 nm by using cavity ring-down absorption spectroscopy. The technique contains two laser beams propagating in a perpendicular configuration. The tunable laser beam along the axis of the ring-down cell probes the Br2 fragment in the B3Πou+-X1Σg+ transition. The measurements of laser energy- and pressure-dependence and addition of a Br scavenger are further carried out to rule out the probability of Br2 contribution from a secondary reaction. By means of spectral simulation, the ratio of nascent vibrational population for v = 0, 1, and 2 levels is evaluated to be 1:(0.65 ± 0.09):(0.34 ± 0.07), corresponding to a Boltzmann vibrational temperature of 893 ± 31 K. The quantum yield of the ground state Br2 elimination reaction is determined to be 0.11 ± 0.06. With the aid of ab initio potential energy calculations, the pathway of molecular elimination is proposed on the energetic ground state (COBr)2 via internal conversion. A four-center dissociation mechanism is followed synchronously or sequentially yielding three fragments of Br2+ 2CO. The resulting Br2 is anticipated to be vibrationally hot. The measurement of a positive temperature effect supports the proposed mechanism.

  3. Ion-forming processes on 248 nm laser excitation of uracil and methyl-monosubstituted uracils: a time-resolved transient conductivity study in aqueous solution

    International Nuclear Information System (INIS)

    Uracil, thymine and 1-, 3-, and 6-methyluracil were studied by time-resolved optical and conductometric methods after 248 nm excitation with 20 ns laser pulses. The transient conductivity in argon-saturated aqueous solution, showing a maximum increase (ΔKmax) during the pulse, is ascribed to the generation of hydrated electrons (eaq-) and protons. Biphotonic photoionization as the primary process is inferred from the almost linear dependence of ΔKmax on the square of the laser intensity (IL2). The quantum yield varies by a factor of about two for the five pyrimidines. The neutralization kinetics depends strongly on pH and the concentrations of laser-induced eaq- and H+, i.e. on IL. At pH 6-7 the ΔK signal decays by second-order kinetics. Under argon the electron adds to the (methyl)uracil and neutralization occurs by reaction of the radical anion with a proton, which originates from a fast decay of the radical cation. (author)

  4. Accurate determination of Curium and Californium isotopic ratios by inductively coupled plasma quadrupole mass spectrometry (ICP-QMS) in Cm-248 samples for transmutation studies

    International Nuclear Information System (INIS)

    The French Atomic Energy Commission has carried out several experiments including the mini-INCA (Incineration of Actinides) project for the study of minor-actinide transmutation processes in high intensity thermal neutron fluxes, in view of proposing solutions to reduce the radiotoxicity of long-lived nuclear wastes. In this context, a Cm sample enriched in 248Cm (similar to 97%) was irradiated in thermal neutron flux at the High Flux Reactor (HFR) of the Laue-Langevin Institute (ILL). This work describes a quadrupole ICP-MS (ICP-QMS) analytical procedure for precise and accurate isotopic composition determination of Cm before sample irradiation and of Cm and Cf after sample irradiation. The factors that affect the accuracy and reproducibility of isotopic ratio measurements by ICP-QMS, such as peak centre correction, detector dead time, mass bias, abundance sensitivity and hydrides formation, instrumental background, and memory blank were carefully evaluated and corrected. Uncertainties of the isotopic ratios, taking into account internal precision of isotope ratio measurements, peak tailing, and hydrides' formations ranged from 0. 3% to 1. 3%. This uncertainties' range is quite acceptable for the nuclear data to be used in transmutation studies. (authors)

  5. Study of regulatory promoter polymorphism (-248 G>A) of Bax gene in patients with gastric cancer in the northern provinces of Iran

    Science.gov (United States)

    Mirmajidi, Seyedeh Habibeh; Najafi, Mojtaba; Mirmajidi, Seyedeh Tahereh; Nasri Nasrabadi, Nafiseh

    2016-01-01

    Aim: The aim of this study is to evaluate the polymorphism in Bax gene and its association with some clinical pathology traits in gastric cancer. Background: Gastric cancer is considered as the fourth most common cancer in the north and northwest of Iran. Bcl2 family has a key role in regulation of apoptosis, and any changes in the expression of Bcl2 lead to cancer. Patients and methods: Blood samples were collected from 100 cases and 89 controls in the northern provinces of Iran to evaluate promoter polymorphism (-248G

  6. Characterization of the in vitro expressed autoimmune rippling muscle disease immunogenic domain of human titin encoded by TTN exons 248-249

    International Nuclear Information System (INIS)

    Highlights: → Affinity purification of the autoimmune rippling muscle disease immunogenic domain of titin. → Partial sequence analysis confirms that the peptides is in the I band region of titin. → This region of the human titin shows high degree of homology to mouse titin N2-A. -- Abstract: Autoimmune rippling muscle disease (ARMD) is an autoimmune neuromuscular disease associated with myasthenia gravis (MG). Past studies in our laboratory recognized a very high molecular weight skeletal muscle protein antigen identified by ARMD patient antisera as the titin isoform. These past studies used antisera from ARMD and MG patients as probes to screen a human skeletal muscle cDNA library and several pBluescript clones revealed supporting expression of immunoreactive peptides. This study characterizes the products of subcloning the titin immunoreactive domain into pGEX-3X and the subsequent fusion protein. Sequence analysis of the fusion gene indicates the cloned titin domain (GenBank ID: (EU428784)) is in frame and is derived from a sequence of N2-A spanning the exons 248-250 an area that encodes the fibronectin III domain. PCR and EcoR1 restriction mapping studies have demonstrated that the inserted cDNA is of a size that is predicted by bioinformatics analysis of the subclone. Expression of the fusion protein result in the isolation of a polypeptide of 52 kDa consistent with the predicted inferred amino acid sequence. Immunoblot experiments of the fusion protein, using rippling muscle/myasthenia gravis antisera, demonstrate that only the titin domain is immunoreactive.

  7. Characterization of the in vitro expressed autoimmune rippling muscle disease immunogenic domain of human titin encoded by TTN exons 248-249

    Energy Technology Data Exchange (ETDEWEB)

    Zelinka, L. [Biomedical Sciences Program, Kent State University, Kent, OH (United States); McCann, S.; Budde, J.; Sethi, S.; Guidos, M.; Giles, R. [Center for Applied Chemical Biology, Department of Biological Sciences, Youngstown State University, One University Plaza, Youngstown, OH 44555 (United States); Walker, G.R., E-mail: grwalker@ysu.edu [Center for Applied Chemical Biology, Department of Biological Sciences, Youngstown State University, One University Plaza, Youngstown, OH 44555 (United States); Biomedical Sciences Program, Kent State University, Kent, OH (United States)

    2011-08-05

    Highlights: {yields} Affinity purification of the autoimmune rippling muscle disease immunogenic domain of titin. {yields} Partial sequence analysis confirms that the peptides is in the I band region of titin. {yields} This region of the human titin shows high degree of homology to mouse titin N2-A. -- Abstract: Autoimmune rippling muscle disease (ARMD) is an autoimmune neuromuscular disease associated with myasthenia gravis (MG). Past studies in our laboratory recognized a very high molecular weight skeletal muscle protein antigen identified by ARMD patient antisera as the titin isoform. These past studies used antisera from ARMD and MG patients as probes to screen a human skeletal muscle cDNA library and several pBluescript clones revealed supporting expression of immunoreactive peptides. This study characterizes the products of subcloning the titin immunoreactive domain into pGEX-3X and the subsequent fusion protein. Sequence analysis of the fusion gene indicates the cloned titin domain (GenBank ID: (EU428784)) is in frame and is derived from a sequence of N2-A spanning the exons 248-250 an area that encodes the fibronectin III domain. PCR and EcoR1 restriction mapping studies have demonstrated that the inserted cDNA is of a size that is predicted by bioinformatics analysis of the subclone. Expression of the fusion protein result in the isolation of a polypeptide of 52 kDa consistent with the predicted inferred amino acid sequence. Immunoblot experiments of the fusion protein, using rippling muscle/myasthenia gravis antisera, demonstrate that only the titin domain is immunoreactive.

  8. Oxidation-reduction properties of americium, curium, berkelium, californium, einsteinium and fermium, and thermodynamic consequences for the 5f series

    International Nuclear Information System (INIS)

    The amalgamation of 5f elements from Am to Fm has been studied by using 241Am, 244Cm, 249Bk, 249Cf, 252Cf, 253Es, 254Es, 252Fm and 255Fm with two electrochemical methods, radiocoulometry and radiopolarography, perfectly adapted to investigate extremely diluted solutions when the concentration of electroactive species is as low as 10-16M. The theory of radiocoulometry has been developed in the general cases of reversible and irreversible electrode process. It has been used to interpret the experimental data on the kinetic curves of amalgamation, and to estimate the standard rate constant of the electrode process in complexing medium (citric). On the other hand the radiopolarographic method has been applied to study the mechanism of reduction at the dropping mercury electrode of cations M3+ in aqueous medium to the metal M with formation of amalgam. The results are exploited into two directions: 1- Acquisition of some data concerning the oxidation-reduction properties of elements from Am to Fm. Therefore the standard electrode E0 [M(III-0)] potentials for Bk, Cf and Es, and the standard electrode E0 [M(II-0)] potential for Fm are estimated and the relative stability of each oxidation state (from II to VII) of 5f elements is discussed; 2- Acquisition of unknown thermodynamic data on transcalifornium elements. Correlations between 4f and 5f elements are precised and some divergences appear for the second half of 4f and 5f series (i.e. for 65<=Z<=71 and 97<=Z<=103)

  9. Evaluation of thermal neutron cross-sections and resonance integrals of protactinium, americium, curium, and berkelium isotopes

    International Nuclear Information System (INIS)

    Data on the thermal neutron fission and capture cross-sections as well as their corresponding resonance integrals are reviewed and analysed. The data are classified according to the form of neutron spectra under investigation. The weighted mean values of the cross-sections and resonance integrals for every type of neutron spectra were adopted as evaluated data. (author). 87 refs, 2 tabs

  10. RRS Discovery Cruise 248, 07 Jul-10 Aug 2000. A multidisciplinary study of the environment and ecology of deep-water coral ecosystems and associated seabed facies and features (The Darwin Mounds, Porcupine Bank and Porcupine Seabight)

    OpenAIRE

    B. J. Bett; Billett, D. S. M.; Masson, D.G.; Tyler, P. A.

    2001-01-01

    RRS Discovery Cruise 248 aimed to carry out a multidisciplinary study of the environment and ecology of deep-water coral ecosystems and associated seabed features in the northeast Atlantic. The study was primarily focused on the Darwin Mounds area, northern Rockall Trough (59° 49’N, 07° 22’W), but also examined a number of sites in the Porcupine Seabight area. The cruise was divided into two legs (Govan-Stornoway, 8 Jul-21 Jul 2000; Stornoway-Southampton, 22 Jul-10 Aug 2000). Leg 1 focused on...

  11. Forme di tutela giuridica per le banche dati fra diritto d'autore e diritto sui generis: il Decreto Legislativo n. 169/99 del 15 giugno 1999 e la Legge n. 248 del 18 agosto 2000 [Italian

    OpenAIRE

    De Robbio, Antonella

    2000-01-01

    The legislative decree 169/99, which acknowledges the European directive 9/96, edits some parts of the law on author rights (n. 633, 22nd April 1941). The new law (n. 248, 18th August 2000) doesn’t modify anything concerning with database as it only reconfirms the legislative decree 169/99 as far as the penal aspects are concerned. Summary: History and presuppositions – Double-protection system – Definition of the word database – Principle and Criteria of the Italian legislative decree – ...

  12. Comparación de variables físicas, culinarias y amilográficas del cultivar de arroz (Oryza sativa L. MD248 con dos cultivares comerciales de arroz en Venezuela

    Directory of Open Access Journals (Sweden)

    Manuel Ávila

    2014-12-01

    Full Text Available El objetivo del estudio fue evaluar las variables físicas culinarias y amilográficas del cultivar MD248 y su potencial como arroz de mesa en Venezuela. Para ello, MD248 se sembró bajo un diseño completamente aleatorizado, en Calabozo (Estado Guárico, Venezuela, junto con 2 cultivares empleados como testigos de buena (D-Sativa y baja (D-Primera calidad culinaria. De cada cultivar se cosecharon 2.500 g de arroz paddy y se procesaron hasta obtener una fracción de arroz entero pulido la cual fue evaluada para: largo, ancho, espesor, relación largo/ancho (L/A, peso de 100 granos, contenido de amilosa aparente, tiempo de cocción, relación de expansión volumétrica (REV, relación de absorción de agua (RAA, viscosidades pico, media, final, ‘breakdown’, ‘setback’, consistencia y temperatura de empaste del perfil amilográfico. Además, atributos sensoriales descriptivos (brillo, percepción visual de la adhesividad, adhesividad manual, adhesividad entre los granos y preferenciales (apariencia, adhesividad, calidad global del arroz cocido. Los resultados indicaron diferencias estadísticas altamente significativas (p ≤ 0,01 entre los cultivares para largo, relación L/A, peso de 100 granos, contenido de amilosa aparente, tiempo de cocción, REV, RAA y todas las variables amilográficas, excepto para viscosidad media y temperatura de empaste (p > 0,05. En los perfiles descriptivo y preferencial hubo diferencias altamente significativas (p ≤ 0,01 para todos los atributos evaluados. MD248 estuvo asociado con los mayores valores de largo de grano (7,07 mm, relación L/A (3,43, peso de 100 granos (2,20 g y amilosa aparente (19,14 %, y con los menores valores de tiempo de cocción (22,90 min, REV (3,07, RAA (1,55, viscosidad pico (159,61 RVU, media (130,10 RVU, p > 0,05 y ‘breakdown’ (29,51 RVU. MD248 presentó un perfil descriptivo comparable al cultivar de buena calidad culinaria y se diferenció ampliamente del cultivar de baja

  13. Molecular elimination of Br{sub 2} in photodissociation of CH{sub 2}BrC(O)Br at 248 nm using cavity ring-down absorption spectroscopy

    Energy Technology Data Exchange (ETDEWEB)

    Fan He; Tsai, Po-Yu; Lin, King-Chuen [Department of Chemistry, National Taiwan University, Taipei 106, Taiwan and Institute of Atomic and Molecular Sciences, Academia Sinica, Taipei 106, Taiwan (China); Lin, Cheng-Wei; Yan, Chi-Yu; Yang, Shu-Wei; Chang, A. H. H. [Department of Chemistry, National Dong Hwa University, Shoufeng, Hualien 974, Taiwan (China)

    2012-12-07

    The primary elimination channel of bromine molecule in one-photon dissociation of CH{sub 2}BrC(O)Br at 248 nm is investigated using cavity ring-down absorption spectroscopy. By means of spectral simulation, the ratio of nascent vibrational population in v = 0, 1, and 2 levels is evaluated to be 1:(0.5 {+-} 0.1):(0.2 {+-} 0.1), corresponding to a Boltzmann vibrational temperature of 581 {+-} 45 K. The quantum yield of the ground state Br{sub 2} elimination reaction is determined to be 0.24 {+-} 0.08. With the aid of ab initio potential energy calculations, the obtained Br{sub 2} fragments are anticipated to dissociate on the electronic ground state, yielding vibrationally hot Br{sub 2} products. The temperature-dependence measurements support the proposed pathway via internal conversion. For comparison, the Br{sub 2} yields are obtained analogously from CH{sub 3}CHBrC(O)Br and (CH{sub 3}){sub 2}CBrC(O)Br to be 0.03 and 0.06, respectively. The trend of Br{sub 2} yields among the three compounds is consistent with the branching ratio evaluation by Rice-Ramsperger-Kassel-Marcus method. However, the latter result for each molecule is smaller by an order of magnitude than the yield findings. A non-statistical pathway so-called roaming process might be an alternative to the Br{sub 2} production, and its contribution might account for the underestimate of the branching ratio calculations.

  14. Use of the selected overlap LIDAR experiment (SOLEX) system with the 248 nm krypton fluoride and the 355 nm neodymium:yttrium aluminum garnet lasers for the calibration of LIDAR systems for water vapor determination

    Science.gov (United States)

    Mensah, Francis Emmanuel Tofodji

    Water vapor is one of the most important atmospheric variables that play a key role in air quality, global warming, climate change and hurricane formation. In this dissertation, use was made of two laser systems, the 248-nm KrF laser and the 355 nm Nd-YAG laser, with the use of Raman scattering to measure water vapor in the atmosphere. These two systems have been calibrated more accurately, using the LIDAR approach named SOLEX (Selected Overlap LIDAR Experiment). All the experiments were carried out at the Howard University Beltsville campus located on a 107 acre research site, at Beltsville, MD, 15 miles from downtown Washington DC, near the National Agricultural Research Center (NARC), and the NASA Goddard Space Flight Center (GSFC). The geographical coordinates are: 39°04.01'N latitude, and 76°52.31'W longitude. The receiver system used during these experiments is a 30" (76.2 cm), f/ 9 Cassegranian telescope, while the detector system uses a prism spectrometer (Beckman), with a 2-meter, double-fold optical path and a variable slit width is placed at the image plane of the telescope. With the use of the SOLEX system, this dissertation provides an accurate calibration of the two LIDAR Systems for water vapor measurement in the troposphere at the following ranges: 83.7 ft, 600 ft, 800 ft, 1000 ft and 1080 ft. Data analysis shows a pretty high sensitivity of the LIDAR system for water vapor measurement and the efficiency of the SOLEX method.

  15. 24 CFR 248.201 - Definitions.

    Science.gov (United States)

    2010-04-01

    ... 24 CFR part 5. Adjusted Income. Annual income, as specified in § 251.21 of this chapter, less... Commissioner under part 221 of this chapter and bearing a below market interest rate as provided under § 221... allowable distributions. Return on Investment. The amount of allowable distributions, tax benefits,...

  16. 7 CFR 248.2 - Definitions.

    Science.gov (United States)

    2010-01-01

    ... means any of the 50 States, the District of Columbia, the Commonwealth of Puerto Rico, the Virgin... harvesting and cleaning processes. Honey, maple syrup, cider, nuts, seeds, eggs, meat, cheese and seafood...

  17. 17 CFR 248.3 - Definitions.

    Science.gov (United States)

    2010-04-01

    ... for personal, family, or household purposes. (2) Examples—(i) Continuing relationship. A consumer has... AND S-AM Regulation S-P: Privacy of Consumer Financial Information and Safeguarding Personal... or limited partnership, association, or similar organization. (g)(1) Consumer means an individual...

  18. Women: The Fifth World. Headline Series 248.

    Science.gov (United States)

    Boulding, Elise

    The document addresses past, present, and future issues concerning women througout the world. It is presented in seven chapters. Chapter I discusses women as the invisible "fifth world." The author contends that this fifth world exists, uncounted and unassisted, on every continent. Chapter II traces the role of women throughout history. The…

  19. 24 CFR 248.101 - Definitions.

    Science.gov (United States)

    2010-04-01

    ... mobility, taking into account the need for vacancies resulting from turnover and to meet growth in renter... moderate income families. Notice of Intent. An owner's notification to the Commissioner of its intention...

  20. QTL Information Table: 248 [Q-TARO

    Lifescience Database Archive (English)

    Full Text Available ntitative characters in rice using RFLP markers. Euphytica V89, 349-354. http://dx.doi.org/10.1007/BF00022292 ... ...ant RFLP C)Interval F2 Palawan IR42 A RG143 RG214 pha Wu, P., Zhang, G., and Huang, N. (1996). Identification of QTLs controlling qua

  1. 17 CFR 248.120 - Definitions.

    Science.gov (United States)

    2010-04-01

    ... group of affiliated companies makes a telephone call to the centralized call center for the affiliated... company, and provides contact information to the call center, the call constitutes an inquiry to the... makes a telephone call to a centralized call center for a group of affiliated companies to inquire...

  2. Measurements of cross sections and decay properties of the isotopes of elements 112, 114, and 116 produced in the fusion reactions 233,238U, 242Pu, and 248Cm+48Ca

    International Nuclear Information System (INIS)

    We have studied the dependence of the production cross sections of the isotopes 282,283112 and 286,287114 on the excitation energy of the compound nuclei 286112 and 290114. The maximum cross section values of the xn-evaporation channels for the reaction 238U(48Ca,xn)286-x112 were measured to be σ3n=2.5-1.1+1.8 pb and σ4n=0.6-0.5+1.6 pb; for the reaction 242Pu(48Ca,xn)290-x114: σ2n∼0.5 pb, σ3n=3.6-1.7+3.4 pb, and σ4n=4.5-1.9+3.6 pb. In the reaction 233U(48Ca,2-4n)277-279112 at E*=34.9=2.2 MeV we measured an upper cross section limit of σxn≤0.6 pb. The observed shift of the excitation energy associated with the maximum sum evaporation residue cross section σER(E*) to values significantly higher than that associated with the calculated Coulomb barrier can be caused by the orientation of the deformed target nucleus in the entrance channel of the reaction. An increase of σER in the reactions of actinide targets with 48Ca is consistent with the expected increase of the survivability of the excited compound nucleus upon closer approach to the closed neutron shell N=184. In the present work we detected 33 decay chains arising in the decay of the known nuclei 282112, 283112, 286114, 287114, and 288114. In the decay of 287114(α)→283112(α)→279110(SF), in two cases out of 22, we observed decay chains of four and five sequential α transitions that end in spontaneous fission of 271Sg (Tα/SF=2.4-1.0+4.3 min) and 267Rf (TSF∼2.3 h), longer decay chains than reported previously. We observed the new nuclide 292116 (Tα=18-6+16 ms,Eα=10.66±0.07 MeV) in the irradiation of the 248Cm target at a higher energy than in previous experiments. The observed nuclear decay properties of the nuclides with Z=104-118 are compared with theoretical nuclear mass calculations and the systematic trends of spontaneous fission properties. As a whole, they give a consistent pattern of decay of the 18 even-Z neutron-rich nuclides with Z=104-118 and N=163-177. The experiments were

  3. Measurements of cross sections and decay properties of the isotopes of elements 112, 114 and 116 produced in the fusion reactions 233,238U, 242Pu, and 248Cm + 48Ca

    International Nuclear Information System (INIS)

    We have studied the dependence of the production cross sections of the isotopes 282,283112 and 286,287114 on the excitation energy of the compound nuclei 286112 and 290114. The maximum cross-section values of the xn-evaporation channels for the reaction 238U(48Ca, xn)286-x112 were measured to be: σ3n = 2.5-1.1+1.8 pb and σ4n = 0.6-0.5+1.6 pb; for the reaction 242Pu(48Ca, xn)290-x114: σ2n ∼ 0.5 pb, σ3n 3.6-1.7+3.4 pb and σ4n = 4.5-1.9+3.6 pb. In the reaction 233U(48Ca, 2-4n)277-279112 at E* = 34.9±2.2 MeV we measured an upper cross-section limit of σxn ≤ 0.6 pb. The observed shift of the excitation energy associated with the maximum sum evaporation residue cross section σER(E*) to values significantly higher than that associated with the calculated Coulomb barrier can be caused by the orientation of the deformed target nucleus in the entrance channel of the reaction. An increase of σER in the reactions of actinide targets with 48Ca is consistent with the expected increase of the survivability of the excited compound nucleus upon closer approach to the closed neutron shell N = 184. In the present work we detected 33 decay chains arising in the decay of the known nuclei: 282112, 283112, 286114, and 288114. In the decay of 287114(α) → 283112(α) → 279110(SF), in two cases out of 22, we observed decay chains of four and five sequential α transitions that end in spontaneous fission of 271Sg(Tα/SF = 2.4 -1.0+4.3 min) and 267Rf(TSF ∼ 2.3 h), longer decay chains than reported previously. We observed the new nuclide 292116(Tα = 18-6+16 ms, Eα = 10.66 ± 0.07 MeV in the irradiation of 248Cm target at a higher energy than in previous experiments. The observed nuclear decay properties of the nuclides with Z = 104-118 are compared with theoretical nuclear mass calculations and the systematic trends of spontaneous fission properties. As a whole, they give a consistent pattern of decay of the 18 even-Z neutron-rich nuclides with Z = 104-118 and N = 163

  4. 17 CFR 248.124 - Reasonable opportunity to opt out.

    Science.gov (United States)

    2010-04-01

    ... means. (3) At the time of an electronic transaction. The opt out notice is provided to the consumer at the time of an electronic transaction, such as a transaction conducted on an Internet Web site. The... date the notice is mailed to elect to opt out by any reasonable means. (2) By electronic means. (i)...

  5. Dicty_cDB: VFK248 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available X sequence update 2001.11.22 Translated Amino Acid sequence pkctiltfsylhqnhnilifqkl*iefcni*pt*iklktikikpqifl...*kifw*h*k ld*kyratcyrlc**n--- Frame C: pkctiltfsylhqnhnilifqkl*iefcni*pt*iklktikikpqifl*iylfsqpinq* ttnl*YRY

  6. 7 CFR 248.23 - Records and reports.

    Science.gov (United States)

    2010-01-01

    ..., FMNP coupon issuance and redemption, equipment purchases and inventory, nutrition education, and civil... Regulations of the Department of Agriculture (Continued) FOOD AND NUTRITION SERVICE, DEPARTMENT OF AGRICULTURE CHILD NUTRITION PROGRAMS WIC FARMERS' MARKET NUTRITION PROGRAM (FMNP) Miscellaneous Provisions §...

  7. 7 CFR 248.17 - Management evaluations and reviews.

    Science.gov (United States)

    2010-01-01

    ..., evaluation of management, accountability, certification, nutrition education, financial management systems....17 Agriculture Regulations of the Department of Agriculture (Continued) FOOD AND NUTRITION SERVICE, DEPARTMENT OF AGRICULTURE CHILD NUTRITION PROGRAMS WIC FARMERS' MARKET NUTRITION PROGRAM (FMNP)...

  8. Thin film type 248-nm bottom antireflective coatings

    Science.gov (United States)

    Enomoto, Tomoyuki; Nakayama, Keisuke; Mizusawa, Kenichi; Nakajima, Yasuyuki; Yoon, Sangwoong; Kim, Yong-Hoon; Kim, Young-Ho; Chung, Hoesik; Chon, Sang Mun

    2003-06-01

    A frequent problem encountered by photoresists during the manufacturing of semiconductor device is that activating radiation is reflected back into the photoresist by the substrate. So, it is necessary that the light reflection is reduced from the substrate. One approach to reduce the light reflection is the use of bottom anti-reflective coating (BARC) applied to the substrate beneath the photoresist layer. The BARC technology has been utilized for a few years to minimize the reflectivity. As the chip size is reduced to sub 0.13-micron, the photoresist thickness has to decrease with the aspect ratio being less than 3.0. Therefore, new Organic BARC is strongly required which has the minimum reflectivity with thinner BARC thickness and higher etch selectivity towards resist. SAMSUNG Electronics has developed the advanced Organic BARC with Nissan Chemical Industries, Ltd. and Brewer Science, Inc. for achieving the above purpose. As a result, the suitable high performance SNAC2002 series KrF Organic BARCs were developed. Using CF4 gas as etchant, the plasma etch rate of SNAC2002 series is about 1.4 times higher than that of conventional KrF resists and 1.25 times higher than the existing product. The SNAC2002 series can minimize the substrate reflectivity at below 40nm BARC thickness, shows excellent litho performance and coating properties.

  9. Dicty_cDB: SSK248 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available rom adult infected midgut library, clone Tse38a11_q1c. 70 4e-17 4 BF294231 |BF294231.1 001PbG02 Pb cDNA #17, Tommaso Pace, Marta... Ponzi, and Clara Frontali Plasmodium berghei cDNA 5', mRNA s...RNA sequence. 50 4e-12 4 T18202 |T18202.1 0812c3 czapPFDd2.1, Debopam Chakrabarti Plasmodium falcipar...07.y1 Xenopus laevis oocyte non normalized Xenopus laevis cDNA clone IMAGE:3747157 5' similar...00 m3a: 0.00 m3b: 0.00 m_ : 1.00 64.0 %: nuclear 28.0 %: cytoplasmic 4.0 %: cytoskeletal 4.0 %: mitochondrial

  10. Dicty_cDB: SFF248 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available PPDQQRLIFA G--- ---KRTPSPFSLKIKRXYANFC*tsxw*txplgsgr*l*h*kxqsqnpxqxrxsprsttf hfrw*tikkwpyxx*lqhpkxipxpfsxxikrwxanxcknlxw*xxpxgsxrf...xxx*kcq sqnsxqxrfsprstxixfxwxtikxwxdxxxlqxskgipxpfsxxxkrxxanxc*nxxr* nxpxgsrrx Transla...*fsl v--- ---KRTPSPFSLKIKRXYANFC*tsxw*txplgsgr*l*h*kxqsqnpxqxrxsprsttf hfrw*tikkwpyxx*lqhpkxipxpfsxxikrwxanxcknlxw*xxpxgsxrf...xxx*kcq sqnsxqxrfsprstxixfxwxtikxwxdxxxlqxskgipxpfsxxxkrxxanxc*nx

  11. 48 CFR 52.248-1 - Value Engineering.

    Science.gov (United States)

    2010-10-01

    ... VECP, such as any net increases in the cost of testing, operations, maintenance, and logistics support... Contracting Officer's forecast of the number of units that will be delivered during the sharing period....

  12. 24 CFR 248.123 - Determination of Federal cost limit.

    Science.gov (United States)

    2010-04-01

    ... rents in the local market area. The relevant local market, and the prevailing rents in such relevant local market, shall be determined on the basis of the appraisal conducted by the appraiser selected by... appropriate. If there are no comparables in the relevant local market and it is not otherwise possible...

  13. 17 CFR 248.126 - Delivery of opt out notices.

    Science.gov (United States)

    2010-04-01

    ... be provided in compliance with either the electronic disclosure provisions in this subpart or the provisions in section 101 of the Electronic Signatures in Global and National Commerce Act, 15 U.S.C. 7001... electronic disclosures by e-mail from the affiliate providing the notice; or (4) Posts the notice on...

  14. Dicty_cDB: VHK248 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available kvlfvmkt*evsvsifmmspst lmpstevvvkssqllvvyxmlln*lppqlx*nqxt**kllpqktllvvftlysivvxvll lvknvvsvphyxlskliyqy*nps...n*rffrwcfpmghqrrccl**kherypfqsl*chpph *chpqrwwsnhpncssctxcc*inclpnxxrtnxlsrnycprk...rywwyllctqssxrycy w*rtsyrfpiixcqssftsirilrfhr*ftfphcrssfptmclrslgfnwccqqr*esh* srfshqkxkrfsprnprs*qiprktlnxls

  15. Use of trioctylphosphine oxide for transplutonium element extraction and purification

    International Nuclear Information System (INIS)

    Investigated was extraction of tri-valent curium, berkelium, californium, einsteinium as well as cerium and europium with trioctylphosphin oxide from lactic acid solutions, containing DTPA and aluminium nitrate depending on the aluminium nitrate and TOPO concentrations and nitric acid solutions of variable concentration as well. Under optimum conditions of extraction chromatography of berkelium studied was the distribution of cobalt, nickel, chromium, iron, aluminium, titanium, zirconium and niobium ions, and the coefficients of berkelium purification from cations investigated were determined. The effect of weight quantities of cation impurities on extraction chromatographic yield of berkelium has been investigated. Examples of practice application of the extraction chromatography with the use of TOPO are given

  16. Transuranium Processing Plant semiannual report of production, status, and plans for period ending December 31, 1975

    Energy Technology Data Exchange (ETDEWEB)

    King, L.J.; Bigelow, J.E.; Collins, E.D.

    1976-10-01

    Between July 1, 1975, and December 31, 1975, maintenance was conducted at TRU for a period of three months, 295 g of curium oxide (enough for approximately 26 HFIR targets) were prepared, 100 mg of high-purity /sup 248/Cm, were separated from /sup 252/Cf that had been purified during earlier periods, 11 HFIR targets were fabricated, and 28 product shipments were made. No changes were made in the chemical processing flowsheets normally used at TRU during this report period. However, three equipment racks were replaced (with two new racks) during this time. In Cubicle 6, the equipment replaced was that used to decontaminate the transplutonium elements from rare earth fission products and to separate curium from the heavier elements by means of the LiCl-based anion-exchange process. In Cubicle 5, the equipment used to separate the transcurium elements by high-pressure ion exchange and to purify berkelium by batch solvent extraction was replaced. Two neutron sources were fabricated, bringing the total fabricated to 79. One source that had been used in a completed project was returned to the TRU inventory and is available for reissue. Three sources, for which no further use was foreseen, were processed to isolate and recover the ingrown /sup 248/Cm and the residual /sup 252/Cf. Eight pellets, each containing 100 ..mu..g of high-purity /sup 248/Cm were prepared for irradiation in HFIR to study the production of /sup 250/Cm. The values currently being used for transuranium element decay data and for cross-section data in planning irradiation-processing cycles, calculating production forecasts, and assaying products are tabulated.

  17. К ВОПРОСУ О ПОНЯТИИ ПРЕДМЕТА И ОБЪЕКТА ПРЕСТУПЛЕНИЯ, ПРЕДУСМОТРЕННОГО СТ. 248 УГОЛОВНОГО КОДЕКСА РФ

    OpenAIRE

    Андреева, Л.

    2010-01-01

    В статье рассматривается понятие предмета и объекта преступления, предусмотренного ст. 248 УК РФ (Нарушение правил безопасности при обращении с микробиологическими либо другими биологическими агентами или токсинами). Автор сопоставляет разные точки зрения ученых-исследователей в этой области, анализирует их, делает свои выводы....

  18. Wavelength tuning of photonic crystal waveguides fabricated using 248-nm deep UV lithography

    DEFF Research Database (Denmark)

    Zhuang, Yanxin; Frandsen, Lars Hagedorn; Harpøth, Anders;

    2004-01-01

    Wavelength tuning of characteristic features of straight photonic crystal waveguides has been obtained by varying the exposure dose in deep UV lithography. The experimental results agree very well with numerical simulations....

  19. 17 CFR 248.6 - Information to be included in privacy notices.

    Science.gov (United States)

    2010-04-01

    ... the types of third parties in each category: (i) Financial service providers; (ii) Non-financial... (CONTINUED) REGULATIONS S-P AND S-AM Regulation S-P: Privacy of Consumer Financial Information and... party to market products or services that you offer alone or jointly with another financial...

  20. Laser-induced condensation by ultrashort laser pulses at 248 nm

    OpenAIRE

    Joly, P; Petrarca, M.; Vogel, A.(Physikalisches Institut, University of Bonn, Bonn, Germany); Pohl, T; Nagy, T.; Jusforgues, Q.; Simon, P.; Kasparian, J.; Weber, K.; Wolf, J.-P.

    2013-01-01

    We compare laser-induced condensation by UV laser pulses of femtosecond, sub-picosecond, and nanosecond duration between each other, as well as with respect to near-infrared (NIR) (800 nm) ultrashort laser pulses. Particle nucleation by UV pulses is so efficient that their growth beyond several hundreds of nm is limited by the local concentration of water vapour molecules. Furthermore, we evidence a dual mechanism: While condensation induced by ultrashort UV pulses rely on nitrogen photo-oxid...

  1. Design of 24.8-kW, 3.8 K cryogenic system for ISABELLE

    International Nuclear Information System (INIS)

    ISABELLE will consist of two proton accelerator/storage rings in a common tunnel. There will be 1084 superconducting magnets installed in the 3.8 km circumference tunnel. The protons will be accelerated to an energy of 400 GeV in each ring and stored for 24 hours. The two beams are counter-rotating and intersect at six places around the ring. The particles which emerge from proton interactions at these intersecting points are studied using various types of detectors

  2. Prompt Neutron Emission from Fragments in Spontaneous Fission of 244, 248Cm and 252Cf

    Science.gov (United States)

    Vorobyev, A. S.; Dushin, V. N.; Hambsch, F.-J.; Jakovlev, V. A.; Kalinin, V. A.; Laptev, A. B.; Petrov, B. F.; Shcherbakov, O. A.

    2005-11-01

    Neutrons emitted in fission were measured separately for each complementary fragment in correlation with fission fragment energies. Two high efficient Gd-loaded liquid scintillator tanks were used for neutron registration. Fission fragment energies were measured using a twin Frisch gridded ionization chamber with a pin-hole collimator. The neutron multiplicity distributions were obtained for each value of the fission fragment mass and energy and corrected for neutron registration efficiency, background and pile-up. The dependencies of these distributions on fragment mass and energy for different energy and mass bins, as well as the mass and energy distribution of the fission fragments are presented and discussed.

  3. 7 CFR 248.22 - Nonprocurement debarment/suspension, drug-free workplace, and lobbying restrictions.

    Science.gov (United States)

    2010-01-01

    ... requirements of the Department's regulations governing nonprocurement debarment/suspension (7 CFR part 3017), drug-free workplace (7 CFR part 3017), and the Department's regulations governing restrictions on lobbying (7 CFR part 3018), where applicable....

  4. 17 CFR 248.4 - Initial privacy notice to consumers required.

    Science.gov (United States)

    2010-04-01

    ... to be used primarily for personal, family, or household purposes, you satisfy the initial notice... reflects your privacy policies and practices to: (1) Customer. An individual who becomes your customer, not later than when you establish a customer relationship, except as provided in paragraph (e) of...

  5. SU-E-J-248: Contributions of Tumor and Stroma Phenotyping in Computer-Aided Diagnosis

    Energy Technology Data Exchange (ETDEWEB)

    Li, H; Lan, L; Sennett, C; Giger, M [Univ Chicago, Chicago, IL (United States)

    2015-06-15

    Purpose: To gain insight into the role of parenchyma stroma in the characterization of breast tumors by incorporating computerized mammographic parenchyma assessment into breast CADx in the task of distinguishing between malignant and benign lesions. Methods: This study was performed on 182 biopsy-proven breast mass lesions, including 76 benign and 106 malignant lesions. For each full-field digital mammogram (FFDM) case, our quantitative imaging analysis was performed on both the tumor and a region-of-interest (ROI) from the normal contralateral breast. The lesion characterization includes automatic lesion segmentation and feature extraction. Radiographic texture analysis (RTA) was applied on the normal ROIs to assess the mammographic parenchymal patterns of these contralateral normal breasts. Classification performance of both individual computer extracted features and the output from a Bayesian artificial neural network (BANN) were evaluated with a leave-one-lesion-out method using receiver operating characteristic (ROC) analysis with area under the curve (AUC) as the figure of merit. Results: Lesion characterization included computer-extracted phenotypes of spiculation, size, shape, and margin. For parenchymal pattern characterization, five texture features were selected, including power law beta, contrast, and edge gradient. Merging of these computer-selected features using BANN classifiers yielded AUC values of 0.79 (SE=0.03) and 0.67 (SE=0.04) in the task of distinguishing between malignant and benign lesions using only tumor phenotypes and texture features from the contralateral breasts, respectively. Incorporation of tumor phenotypes with parenchyma texture features into the BANN yielded improved classification performance with an AUC value of 0.83 (SE=0.03) in the task of differentiating malignant from benign lesions. Conclusion: Combining computerized tumor and parenchyma phenotyping was found to significantly improve breast cancer diagnostic accuracy highlighting the need to consider both tumor and stroma in decision making. Funding: University of Chicago Dean Bridge Fund, NCI U24-CA143848-05, P50-CA58223 Breast SPORE program, and Breast Cancer Research Foundation. COI: MLG is a stockholder in R2 technology/Hologic and receives royalties from Hologic, GE Medical Systems, MEDIAN Technologies, Riverain Medical, Mitsubishi, and Toshiba. MLG is a cofounder and stockholder in Quantitative Insights.

  6. SU-E-J-248: Contributions of Tumor and Stroma Phenotyping in Computer-Aided Diagnosis

    International Nuclear Information System (INIS)

    Purpose: To gain insight into the role of parenchyma stroma in the characterization of breast tumors by incorporating computerized mammographic parenchyma assessment into breast CADx in the task of distinguishing between malignant and benign lesions. Methods: This study was performed on 182 biopsy-proven breast mass lesions, including 76 benign and 106 malignant lesions. For each full-field digital mammogram (FFDM) case, our quantitative imaging analysis was performed on both the tumor and a region-of-interest (ROI) from the normal contralateral breast. The lesion characterization includes automatic lesion segmentation and feature extraction. Radiographic texture analysis (RTA) was applied on the normal ROIs to assess the mammographic parenchymal patterns of these contralateral normal breasts. Classification performance of both individual computer extracted features and the output from a Bayesian artificial neural network (BANN) were evaluated with a leave-one-lesion-out method using receiver operating characteristic (ROC) analysis with area under the curve (AUC) as the figure of merit. Results: Lesion characterization included computer-extracted phenotypes of spiculation, size, shape, and margin. For parenchymal pattern characterization, five texture features were selected, including power law beta, contrast, and edge gradient. Merging of these computer-selected features using BANN classifiers yielded AUC values of 0.79 (SE=0.03) and 0.67 (SE=0.04) in the task of distinguishing between malignant and benign lesions using only tumor phenotypes and texture features from the contralateral breasts, respectively. Incorporation of tumor phenotypes with parenchyma texture features into the BANN yielded improved classification performance with an AUC value of 0.83 (SE=0.03) in the task of differentiating malignant from benign lesions. Conclusion: Combining computerized tumor and parenchyma phenotyping was found to significantly improve breast cancer diagnostic accuracy highlighting the need to consider both tumor and stroma in decision making. Funding: University of Chicago Dean Bridge Fund, NCI U24-CA143848-05, P50-CA58223 Breast SPORE program, and Breast Cancer Research Foundation. COI: MLG is a stockholder in R2 technology/Hologic and receives royalties from Hologic, GE Medical Systems, MEDIAN Technologies, Riverain Medical, Mitsubishi, and Toshiba. MLG is a cofounder and stockholder in Quantitative Insights

  7. Morphology of Copper Tin Sulfide Films Grown by Pulsed Laser Deposition at 248 and 355 nm

    DEFF Research Database (Denmark)

    Ettlinger, Rebecca Bolt; Cazzaniga, Andrea Carlo; Crovetto, Andrea;

    Thin films solar cells based on Cu2ZnSnS4 (CZTS) as absorber layer have seen a rapid development leading to a world record of 8.8% [1]. However, other p-type semiconductors with fewer elements and reduced complexity compared to CZTS are also available, such as ternary Cu–Sn–S systems, i.e. Cu2SnS3...

  8. 7 CFR 2.48 - Administrator, Rural Business-Cooperative Service.

    Science.gov (United States)

    2010-01-01

    ... Loan program (7 U.S.C. 6616). (11) Administer programs authorized by the Cooperative Marketing Act of... Agricultural Marketing Act of 1946 (7 U.S.C. 1621-1627). (13) Work with institutions and international... Executive Order 12088, 3 CFR, 1978 Comp., p. 243, to enter into an inter-agency agreement with the...

  9. 17 CFR 248.121 - Affiliate marketing opt out and exceptions.

    Science.gov (United States)

    2010-04-01

    ... response to this communication. (iii) A registered investment adviser makes a marketing call to the... marketing solicitations would respond to the consumer-initiated communication about mutual funds. (4... 17 Commodity and Securities Exchanges 3 2010-04-01 2010-04-01 false Affiliate marketing opt...

  10. 26 CFR 1.248-1T - Election to amortize organizational expenditures (temporary).

    Science.gov (United States)

    2010-04-01

    ... irrevocable and applies to all organizational expenditures of the corporation. A change in the characterization of an item as an organizational expenditure is a change in method of accounting to which sections... as a change in method of accounting if the corporation amortized organizational expenditures for...

  11. Morphology of Copper Tin Sulfide Films Grown by Pulsed Laser Deposition at 248 and 355 nm

    OpenAIRE

    Ettlinger, Rebecca Bolt; Cazzaniga, Andrea Carlo; Crovetto, Andrea; Ravnkilde, Lasse; Youngman, Tomas Hugh; Canulescu, Stela; Hansen, Ole; Pryds, Nini; Schou, Jørgen

    2015-01-01

    Thin films solar cells based on Cu2ZnSnS4 (CZTS) as absorber layer have seen a rapid development leading to a world record of 8.8% [1]. However, other p-type semiconductors with fewer elements and reduced complexity compared to CZTS are also available, such as ternary Cu–Sn–S systems, i.e. Cu2SnS3 (CTS) [2].

  12. Two-photon-absorption of frequency converter crystals at 248 nm

    Science.gov (United States)

    Divall, M.; Osvay, K.; Kurdi, G.; Divall, E. J.; Klebniczki, J.; Bohus, J.; Péter, Á.; Polgár, K.

    2005-12-01

    The two-photon-absorption coefficient of KDP, BBO, LTB, and CLBO crystals has been determined from the measurement of the intensity dependent transmission through long samples. The intensity of the sub-picosecond KrF excimer laser pulses on the samples was varied from 0.2-80 GW/cm2. The linear absorption of the samples was determined by using a low intensity, long pulse KrF laser. The first-principle simulations to the experimental data show a TPA value of 0.48 cm/GW for KDP, 0.5 cm/GW (o-ray) and 0.34 cm/GW (e-ray) in BBO, 0.22 cm/GW in LTB and 0.53 cm/GW in CLBO.

  13. 17 CFR 248.15 - Other exceptions to notice and opt out requirements.

    Science.gov (United States)

    2010-04-01

    ... COMMISSION (CONTINUED) REGULATIONS S-P AND S-AM Regulation S-P: Privacy of Consumer Financial Information and... to judicial process or government regulatory authorities having jurisdiction over you for examination..., service, product, or transaction; (ii) To protect against or prevent actual or potential...

  14. 27 CFR 24.248 - Processes authorized for the treatment of wine, juice, and distilling material.

    Science.gov (United States)

    2010-04-01

    ... into low Brix and high Brix juice fractions The low Brix fraction derived from such processing may be used in wine production. The high Brix fraction derived from such processing shall not be diluted with water for use in wine production. Thin-film evaporation under reduced pressure 1 To separate wine into...

  15. Ingraham v. Wright, 498 F.2d 248 (5th Cir. 1974)

    Science.gov (United States)

    Federal Reporter, 2d. Series, 1974

    1974-01-01

    Text of a Federal Appeals Court case in which parents sought damages and injunctive relief as to use of corporal punishment in a county school system. The evidence established that use of corporal punishment at one school violated due process and the constitutional prohibition against cruel and unusual punishment. (JF)

  16. 17 CFR 248.9 - Delivering privacy and opt out notices.

    Science.gov (United States)

    2010-04-01

    ... you deliver the notice with or in a stockholder or shareholder report under the conditions in 17 CFR 270.30d-1(f) or 17 CFR 270.30d-2(b), or with or in a prospectus under the conditions in 17 CFR 230.154... expectation of actual notice. You may reasonably expect that a consumer will receive actual notice if you:...

  17. People and things. CERN Courier, Oct 1984, v. 24(8)

    International Nuclear Information System (INIS)

    The article reports on achievements of various people, staff changes and position opportunities within the CERN organization and contains news updates on upcoming or past events. The second Jerusalem Winter School of Theoretical Physics, sponsored by Israel's Ministry of Science and the Institute for Advanced Studies of the Hebrew University of Jerusalem will take place form 27 December 1984 to 4 January 1985, with the title 'Physics in Higher Dimensions '. Formed this year in the University of Tokyo is ICEPP - International Centre for Elementary Particle Physics - under Masatoshi Koshiba. With sports commentators exhausted after the long grind of the British football season, the 10th UK National Bubble Chamber Fivea-Side Soccer Tournament held in London earlier this year did not attract the media coverage it deserved

  18. COS Observations of Molecular H2 at z = 0.248

    Science.gov (United States)

    Kruse, Ethan; Tumlinson, J.; Thom, C.; Sembach, K.

    2011-01-01

    We present HST/COS observations of a QSO sightline through the halo of two merging galaxies at z = 0.25 at impact parameter 90 kpc. This sightline presents the first example of strong H2 absorption features in our large COS survey of galaxy halo gas at low redshift (COS-Halos, Tumlinson et al.). COS spectra reveal a sub-DLA at z = 0.2478 which splits into two components separated by 70 km/s. One component appears to contain more high-ionization states and less neutral H I while the other favors neutral atoms and contains a strong H2 signature (J = 0-3) along with the majority of the H I. Aside from H2 we detect O I, N I and N II, Si II and Si III, and C II. We find a total H2 column density of N(H2) = 16.89 and an H2 fraction of f_{H2} = 0.0034. Fitting the unblended H2 lines from 0-0 to 15-0 to a curve of growth we find a best fit with b = 11.8 km s-1. Due to the full saturation of all Lyman lines, we are unable to separate the H I column density into the two components and therefore cannot get a direct metallicity for either cloud. However through Cloudy modelling we are able to estimate a H I column density and ionization correction in each component and therefore obtain an approximate metallicity through O I absorption. This system shows similar features to a portion of the Magellanic Stream studied by Sembach et al. 2006. Both sightlines have comparable H I and H2 columns, H2 excitation temperatures, and similar metallicities, suggesting this sightline could be a distant counterpart to the Magellanic Stream, perhaps stripped from an unseen companion galaxy to the two merger partners.

  19. Analysis on related factors of 248 cases of failed drug abortion%药物流产失败248例患者的相关因素分析

    Institute of Scientific and Technical Information of China (English)

    高继燕

    2013-01-01

    [Objective]To analyze the reasons of failed drug abortion,master its indication and contraindication.[Methods]2366 patients with failed drug abortion,who received the drug abortion (mifepristone combined with misoprostol) in Tanggu Dahua Hospital of Tianjin,were collected,and a retrospective analysis was conducted to analyze their gestational age,times of pregnancy,diameter of the gestational sac,age of pregnant women and uterine position.[Results] The rate of failed drug abortion in patients with the factors of long time of menopause,more pregnant rimes,diameter of the gestational sac > 2 cm,over 35 years old,uterine retroversion retroflexion increased significantly (P < 0.05).[Conclusion] The factors which affect the success rate of drug abortion include gestational age,times of pregnancy,diameter of the gestational sac,age of pregnant women and uterine position.%目的 分析药物流产失败的原因,以严格掌握其适应证及禁忌证.方法 对2366例在天津市塘沽大华院门诊行药物(米非司酮配合米索前列醇)流产失败患者的孕龄、孕产次数、孕囊直径、孕妇年龄、子宫位置方式等进行回顾性分析.结果 停经时间长、孕产次数越多、孕囊直径>2 cm、年龄≥35岁、子宫后倾后屈位者,使用药物流产失败率明显增高(P<0.05).结论 影响药物流产成功的因素有孕龄、孕产次数、孕囊直径、孕妇年龄、子宫位置.

  20. 17 CFR 248.14 - Exceptions to notice and opt out requirements for processing and servicing transactions.

    Science.gov (United States)

    2010-04-01

    ... collection of amounts charged, debited, or otherwise paid using a debit, credit, or other payment card, check... private label credit card program or other extension of credit on behalf of such entity; or (3) A proposed... therein; or (C) The audit of debit, credit, or other payment information....

  1. SU-E-T-248: Near Real-Time Analysis of Radiation Delivery and Imaging, Accuracy to Ensure Patient Safety

    International Nuclear Information System (INIS)

    Purpose: To develop and optimize an effective software method for comparing planned to delivered control point machine parameters for all VARIAN TrueBeam treatments so as to permit (1) assessment of a large patient pool throughout their treatment course to quantify treatment technique specific systematic and random uncertainty of observables, (2) quantify the site specific daily imaging shifts required for target alignment, and (3) define tolerance levels for mechanical parameters and imaging parameters based on statistical analysis data gathered, and the dosimetric impact of variations. Methods: Treatment and imaging log files were directly compared to plan parameters for Eclipse and Pinnacle planned treatments via 3D, IMRT, control point, RapidArc, and electrons. Each control point from all beams/arcs (7984) for all fractions (1940) of all patients treated over six months were analyzed. At each control point gantry angle, collimator angle, couch angle, jaw positions, MLC positions, MU were compared. Additionally per-treatment isocenter shifts were calculated. Results were analyzed as a whole in treatment type subsets: IMRT, 3D, RapidArc; and in treatment site subsets: brain, chest/mediastinum, esophagus, H and N, lung, pelvis, prostate. Results: Daily imaging isocenter shifts from initial external tattoo alignment were dependent on the treatment site with < 0.5 cm translational shifts for H and N, Brain, and lung SBRT, while pelvis, esophagus shifts were ∼1 cm. Mechanical delivery parameters were within tolerance levels for all sub-beams. The largest variations were for RapidArc plans: gantry angle 0.11±0.12,collimator angle 0.00±0.00, jaw positions 0.48±0.26, MLC leaf positions 0.66±0.08, MU 0.14±0.34. Conclusion: Per-control point validation reveals deviations between planned and delivered parameters. If used in a near real-time error checking system, patient safety can be improved by equipping the treatment delivery system with additional forcing functions which by-pass human error avenues

  2. Distribution of Prompt Neutron Emission Probability for Fission Fragments in Spontaneous Fission of 252Cf and 244,248Cm

    Science.gov (United States)

    Vorobyev, A. S.; Dushin, V. N.; Hambsch, F.-J.; Jakovlev, V. A.; Kalinin, V. A.; Laptev, A. B.; Petrov, B. F.; Shcherbakov, O. A.

    2005-05-01

    Neutrons emitted in fission events were measured separately for each complementary fragment in correlation with fission fragment energies. Two high-efficiency Gd-loaded liquid scintillator tanks were used for neutron registration. Fission fragment energies were measured using a twin Frisch gridded ionization chamber with a pinhole collimator. The neutron multiplicity distributions were obtained for each value of the fission fragment mass and energy and corrected for neutron registration efficiency, background, and pile-up. The dependency of these distributions on fragment mass and energy for different energy and mass bins as well as mass and energy distribution of fission fragments are presented and discussed.

  3. 30 CFR 250.248 - What solid and liquid wastes and discharges information and cooling water intake information must...

    Science.gov (United States)

    2010-07-01

    ..., sanitary and domestic wastes, produced waters, and chemical product wastes) likely to be generated by your..., and rate of discharge for each waste type; and (2) A description of the discharge method (such...

  4. 24 CFR 203.438 - Mortgages on Indian land insured pursuant to section 248 of the National Housing Act.

    Science.gov (United States)

    2010-04-01

    ...-FEDERAL HOUSING COMMISSIONER, DEPARTMENT OF HOUSING AND URBAN DEVELOPMENT MORTGAGE AND LOAN INSURANCE PROGRAMS UNDER NATIONAL HOUSING ACT AND OTHER AUTHORITIES SINGLE FAMILY MORTGAGE INSURANCE Contract Rights... receive insurance benefits, a mortgagee shall be entitled to receive such benefits on a mortgage...

  5. SU-E-T-248: Near Real-Time Analysis of Radiation Delivery and Imaging, Accuracy to Ensure Patient Safety

    Energy Technology Data Exchange (ETDEWEB)

    Wijesooriya, K; Seitter, K; Desai, V; Read, P; Larner, J [University of Virginia Health Systems, Charlottesville, VA (United States)

    2014-06-01

    Purpose: To develop and optimize an effective software method for comparing planned to delivered control point machine parameters for all VARIAN TrueBeam treatments so as to permit (1) assessment of a large patient pool throughout their treatment course to quantify treatment technique specific systematic and random uncertainty of observables, (2) quantify the site specific daily imaging shifts required for target alignment, and (3) define tolerance levels for mechanical parameters and imaging parameters based on statistical analysis data gathered, and the dosimetric impact of variations. Methods: Treatment and imaging log files were directly compared to plan parameters for Eclipse and Pinnacle planned treatments via 3D, IMRT, control point, RapidArc, and electrons. Each control point from all beams/arcs (7984) for all fractions (1940) of all patients treated over six months were analyzed. At each control point gantry angle, collimator angle, couch angle, jaw positions, MLC positions, MU were compared. Additionally per-treatment isocenter shifts were calculated. Results were analyzed as a whole in treatment type subsets: IMRT, 3D, RapidArc; and in treatment site subsets: brain, chest/mediastinum, esophagus, H and N, lung, pelvis, prostate. Results: Daily imaging isocenter shifts from initial external tattoo alignment were dependent on the treatment site with < 0.5 cm translational shifts for H and N, Brain, and lung SBRT, while pelvis, esophagus shifts were ∼1 cm. Mechanical delivery parameters were within tolerance levels for all sub-beams. The largest variations were for RapidArc plans: gantry angle 0.11±0.12,collimator angle 0.00±0.00, jaw positions 0.48±0.26, MLC leaf positions 0.66±0.08, MU 0.14±0.34. Conclusion: Per-control point validation reveals deviations between planned and delivered parameters. If used in a near real-time error checking system, patient safety can be improved by equipping the treatment delivery system with additional forcing functions which by-pass human error avenues.

  6. Discovery of an Excess of Halpha Emitters around 4C 23.56 at z=2.48

    CERN Document Server

    Tanaka, Ichi; Kurk, Jaron D; Taniguchi, Yoshiaki; Kodama, Tadayuki; Matsuda, Yuichi; Packham, Chris; Zirm, Andrew; Kajisawa, Masaru; Ichikawa, Takashi; Seymour, Nick; Stern, Daniel; Stockton, Alan; Venemans, Bram P; Vernet, Joël

    2010-01-01

    We report the discovery of a significant excess of candidate Halpha emitters (HAEs) in the field of the radio galaxy 4C 23.56 at z=2.483. Using the MOIRCS near-infrared imager on the Subaru Telescope we found 11 candidate emission-line galaxies to a flux limit of ~7.5 10^-17 erg s-1 cm-2, which is about 5 times excess from the expected field counts with ~3-sigma significance. Three of these are spectroscopically confirmed as redshifted Halpha at z=2.49. The distribution of candidate emitters on the sky is tightly confined to a 1.2-Mpc-radius area at z=2.49, locating 4C 23.56 at the western edge of the distribution. Analysis of the deep Spitzer MIPS 24 mu m imaging shows that there is also an excess of faint MIPS sources. All but two of the 11 HAEs are also found in the MIPS data. The inferred star-formation rate (SFR) of the HAEs based on the extinction-corrected Halpha luminosity (median SFR >~100 M_solar yr-1) is similar to those of HAEs in random fields at z~2. On the other hand, the MIPS-based SFR for the...

  7. Ras signaling enhances the activity of C/EBPalpha to induce granulocytic differentiation by phosphorylation of serine 248

    OpenAIRE

    Singh, Sheo Mohan

    2003-01-01

    The transcription factor C/EBPa regulates early steps of normal granulocyte differentiation since mice with a disruption of the C/EBPa gene do not express detectable levels of the G-CSF receptor and produce no neutrophils. We have recently shown that C/EBPa function is also impaired in acute myeloid leukemias. However, how the transcriptional activity of C/EBPa is regulated both in myelopoiesis and leukemogenesis, is not fully understood. The current study demonstrates th...

  8. SU-E-J-248: Comparative Study of Two Image Registration for Image-Guided Radiation Therapy in Esophageal Cancer

    International Nuclear Information System (INIS)

    Purpose: Image-guided radiation therapy (IGRT) is one of the major treatment of esophageal cancer. Gray value registration and bone registration are two kinds of image registration, the purpose of this work is to compare which one is more suitable for esophageal cancer patients. Methods: Twenty three esophageal patients were treated by Elekta Synergy, CBCT images were acquired and automatically registered to planning kilovoltage CT scans according to gray value or bone registration. The setup errors were measured in the X, Y and Z axis, respectively. Two kinds of setup errors were analysed by matching T test statistical method. Results: Four hundred and five groups of CBCT images were available and the systematic and random setup errors (cm) in X, Y, Z directions were 0.35, 0.63, 0.29 and 0.31, 0.53, 0.21 with gray value registration, while 0.37, 0.64, 0.26 and 0.32, 0.55, 0.20 with bone registration, respectively. Compared with bone registration and gray value registration, the setup errors in X and Z axis have significant differences. In Y axis, both measurement comparison results of T value is 0.256 (P value > 0.05); In X axis, the T value is 5.287(P value < 0.05); In Z axis, the T value is −5.138 (P value < 0.05). Conclusion: Gray value registration is recommended in image-guided radiotherapy for esophageal cancer and the other thoracic tumors. Manual registration could be applied when it is necessary. Bone registration is more suitable for the head tumor and pelvic tumor department where composed of redundant interconnected and immobile bone tissue

  9. Discovery of Isotopes of the Transuranium Elements with 93 <= Z <= 98

    OpenAIRE

    Fry, C; Thoennessen, M

    2012-01-01

    One hundred and five isotopes of the transuranium elements neptunium, plutonium, americium, curium, berkelium and californium have so far been observed; the discovery of these isotopes is discussed. For each isotope a brief summary of the first refereed publication, including the production and identification method, is presented.

  10. A Pacemaker with P=2.48 hour Modulated the Generator of Flares in the X-ray Light Curve of Sgr A* in the year 2012

    CERN Document Server

    Leibowitz, Elia M

    2016-01-01

    In an intensive observational campaign in the 9 month duration of Chandra X-ray Visionary Project that was conducted in the year 2012, 39 large X-ray flares of Sgr A* were recorded. An analysis of the times of the observed flares reveals that the 39 flares are separated in time by intervals that are grouped around integer numbers times 0.10333 days. This time interval is thus the period of a uniform grid of equally spaced points on the time axis. The grouping of the flares around tic marks of this grid is derived from the data with at least a 3.2 {\\sigma} level of statistical significance. No signal of any period can be found among 22 flares recorded by Chandra in the years 2013-2014. If the 0.10333 d period is that of a nearly circular Keplerian orbit around the blackhole at the center of the Galaxy, its radius is at 7.6 Schwarzschild radii. Large flares were more likely to be triggered when the agent responsible for their outbursts was near the peri-center phase of its slightly eccentric orbit.

  11. Residues 248–252 and 300–304 of the cardiac Na+/Ca2+ exchanger are involved in its regulation by phospholemman

    OpenAIRE

    Zhang, Xue-Qian; Wang, JuFang; Song, Jianliang; Ji, Angi M.; Chan, Tung O.; Cheung, Joseph Y.

    2011-01-01

    Using split cardiac Na+/Ca2+ exchangers (NCX1), we previously demonstrated that phospholemman (PLM) regulates NCX1 by interacting with the proximal linker domain (residues 218–358) of the intracellular loop of NCX1. With the use of overlapping loop deletion mutants, interaction sites are localized to two regions spanning residues 238–270 and residues 300–328 of NCX1. In this study, we used alanine (Ala) linker scanning to pinpoint the residues in the proximal linker domain involved in regulat...

  12. Conflitos Sociais na Europa: uma paz impossível? 10.5102/uri.v4i1.248

    Directory of Open Access Journals (Sweden)

    Leila Bijos

    2007-08-01

    Full Text Available Análise dos movimentos sociais na França e na América Latina, num contexto de ausência de programas políticos de inserção de imigrantes. Por meio da violência, os jovens manifestantes expressam seu inconformismo com o desemprego, o fracasso escolar e outros sintomas da discriminação de que se julgam vítimas, inclusive por parte da polícia. A passagem do estado de natureza até o estado social produz no homem uma mudança bem acentuada, substituindo, em sua conduta, o instinto pelo sentimento de justiça, e outorgando a suas ações relações morais que antes estavam ausentes. À medida que a repressão se intensifique, fica ainda mais difícil a percepção da realidade. A França, como sociedade pode converter-se em uma ameaça a si própria ao não combinar integração e diferenças socioeconômicas, superando a oposição entre um modelo republicano e um comunitarismo carregado de agressividade. A América Latina vivenciou uma longa era de repressão militar, de violência, oprimida por um Estado distante dos indivíduos; incapaz de suprí-los com políticas públicas e sociais. Na sociedade civil é onde surgem e se desenvolvem os conflitos econômicos, sociais, ideológicos, religiosos, que as instituições públicas têm o dever de equacionar.

  13. Phosphorylation of Serine 248 of C/EBPa Is Dispensable for Myelopoiesis but Its Disruption Leads to a Low Penetrant Myeloid Disorder with Long Latency

    DEFF Research Database (Denmark)

    Hasemann, Marie S; Schuster, Mikkel B; Frank, Anne-Katrine; Theilgaard-Mönch, Kim; Pedersen, Thomas Å; Nerlov, Claus; Porse, Bo T

    2012-01-01

    are simultanously recruited and activated to ensure timely gene expression. The transcription factor CCAAT/enhancer binding protein a (C/EBPa) is such a factor and is essential for the development of granulocytic/monocytic cells. The activity of C/EBPa is regulated on several levels including gene...

  14. A linkage map of cultivated cucumber (cucumis sativus l.) with 248 microsatellite marker loci and seven genes for horticulturally important traits

    Science.gov (United States)

    Marker assisted selection (MAS) is playing an increasingly important role in expedite and increase the efficiency of classical plant breeding. In cucumber, MAS is lagging behind as compared with other field crops. In the present study, a genetic map was developed with microsatellite (or simple seque...

  15. Neutron multiplicities for the transplutonium nuclides

    International Nuclear Information System (INIS)

    This paper continues, with respect to the transplutonium nuclides, earlier efforts to collate and evaluate data from the scientific literature on the prompt neutron multiplicity distribution from fission and its first moment = ΣnuPnu. The isotopes considered here for which P/sub nu/ and or data (or both) were found in the literature are of americium (Am), curium (Cm), berkelium (Bk), californium (Cf), einsteinium (Es), fermium (Fm), and nobelium (No)

  16. Directive of the Minister of Justice of 16 December 1969, Stcrt. 248 concerning the implementation of Section 83 of the Nuclear Energy Act (Civil Servants Competent for the Prosecution of Criminal Acts)

    International Nuclear Information System (INIS)

    This Directive, made in implementation of the Nuclear Energy Act, Lays down that Chief Inspectors and Regional Inspectors of the Ministry of Social Affairs and Public health are competent in respect of the prosecution of criminal acts. (NEA)

  17. Thermosalinograph data of the Hawaii Ocean Time-series (HOT) program in the North Pacific 100 miles north of Oahu, Hawaii for cruises HOT239-248 during 2012 (NODC Accession 0120323)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — The HOT program makes repeated observations of the physics, biology and chemistry at a site approximately 100 km north of Oahu, Hawaii. Two stations are visited...

  18. Niskin bottle data of the Hawaii Ocean Time-series (HOT) program in the North Pacific 100 miles north of Oahu, Hawaii for cruises HOT239-248 during 2012 (NCEI Accession 0119430)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — The HOT program makes repeated observations of the physics, biology and chemistry at a site approximately 100 km north of Oahu, Hawaii. Two stations are visited...

  19. Design and characterization of a low-viscous muscle tissue mimicking media at the ISM-band (2.4–2.48 GHz) for easy antenna displacement in in vitro measurements

    DEFF Research Database (Denmark)

    Jónasson, Sævar Þór; Zhurbenko, Vitaliy; Johansen, Tom Keinicke

    Phantoms mimicking electromagnetic properties of biological tissues are widely used in evaluation of electromagnetic field distribution in human body. In this paper, low-viscous, optically transparent liquids that mimic muscle tissue, are designed and characterized. Various mixing ratios of de-ionized...... water and diethylene glycol butyl ether are examined in range of widely used biomedical frequencies. A recipe for 2.45 GHz is given, which provides less than 5.6% deviation from the reference. With help of curve fitting of the discrete measurement points, recipes for other parts of the body can be...

  20. Measurements of Cross Sections and Decay Properties of the Isotopes of Elements 112, 114 and 116 Produced in the Fusion Reactions $^{233,238}$U, $^{242}$Pu, and $^{248}$Cm + $^{48}$Ca

    CERN Document Server

    Oganessian, Yu T; Utyonkov, V K; Lobanov, Yu V; Abdullin, F S; Polyakov, A N; Shirokovsky, I V; Tsyganov, Yu S; Gulbekyan, G G; Bogomolov, S L; Gikal, B N; Mezentsev, A N; Iliev, S; Subbotin, V G; Sukhov, A M; Voinov, A A; Buklanov, G V; Subotic, K M; Zagrebaev, V I; Itkis, M G; Patin, J B; Moody, K J; Wild, J F; Stoyer, M A; Stoyer, N J; Shaughnessy, D A; Kenneally, J M; Wilk, P A; Lougheed, R W; Ilkaev, R I; Vesnovskii, S P

    2004-01-01

    We have studied the dependence of the production cross-sections of the isotopes $^{282,283}$112 and $^{286,287}$114 on the excitation energy of the compound nuclei $^{286}$112 and $^{290}$114. The maximum cross-section values of the \\textit{xn}-evaporation channels for the reaction $^{238}$U($^{48}$Ca, \\textit{xn})$^{286 - x}$112 were measured to be: $\\sigma _{3n}=2.5_{-1.1}^{ + 1.8} $pb and $\\sigma _{4n}=0.6_{ - 0.5}^{ + 1.6} $ pb; for the reaction $^{242}$Pu($^{48}$Ca, \\textit{xn})$^{290 - x}$114: $\\sigma _{2n}\\sim 0.5$ pb, $\\sigma _{3n}=3.6_{- 1.7}^{ + 3.4} $ pb and $\\sigma _{4n}=4.5_{ - 1.9}^{ + 3.6} $ pb. In the reaction $^{233}$U($^{48}$Ca, 2--4$n$)$^{277 - 279}$112 at $E^*=34.9\\pm $2.2 MeV we measured an upper cross-section limit of $\\sigma _{xn} \\leqslant 0.6$ pb. The observed shift of the excitation energy associated with the maximum sum evaporation residue cross section $\\sigma _{\\rm {ER}}(E^*)$ to values significantly higher than that associated with the calculated Coulomb barrier can be caused by ...

  1. CTD data of the Hawaii Ocean Time-series (HOT) program in the North Pacific 100 miles north of Oahu, Hawaii for cruises HOT239-248 during 2012 (NODC Accession 0119895)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — The HOT program makes repeated observations of the physics, biology and chemistry at a site approximately 100 km north of Oahu, Hawaii. Two stations are visited...

  2. Amplification at λ ∼ 2.8 A on Xe(L),(2s-bar2p-bar) double-vacancy states produced by 248 nm excitation of Xe clusters in plasma channels

    International Nuclear Information System (INIS)

    Xe(L),(2s-bar2p-bar) double-vacancy states undergo strong amplification in relativistic self-trapped plasma channels on 3d → 2p transitions in the λ = 2.78-2.81 A region. The 2P3/2 → 2S1/2 component at λ ≅ 2.786 A exhibits saturated amplification demonstrated by both (1) the observation of spectral hole-burning in the spontaneous emission profile and (2) the correlated enhancement of 3p → 2s cascade transitions (2S1/2 → 2Pj; j = 1/2, 3/2) at λ = 2.558 and λ = 2.600 A. The condition of saturation places a lower limit of ∼1017 W cm-2 on the intensity of the x-ray beam produced by the amplification in the channel. The anomalous strength of the amplification signalled by the saturation mirrors the equivalently anomalous behaviour observed for all 3d → 2p transitions corresponding to 2p-bar) single-vacancy Xeq+ arrays (q = 31, 32, 34, 35, 36) that exhibit gain. The conspicuous absence of amplification involving states with (2p-bar)2 double-vacancy configurations suggests the operation of a selective interaction that enhances the production of 2s-bar2p-bar states. Overall, the generation of double-vacancy states of this genre demonstrates that an excitation rate approaching ∼1 W/atom for ionic species is achievable in self-trapped plasma channels

  3. TOWARD AN IMPROVED UNDERSTANDING OF STRUCTURE AND MAGNETISM IN NEPTUNIUM AND PLUTONIUM PHOSPHONATES AND SULFONATES

    Energy Technology Data Exchange (ETDEWEB)

    Albrecht-Schmitt, Thomas

    2012-03-01

    This grant supported the exploratory synthesis of new actinide materials with all of the actinides from thorium to californium with the exceptions of protactinium and berkelium. We developed detailed structure-property relationships that allowed for the identification of novel materials with selective ion-exchange, selective oxidation, and long-range magnetic ordering. We found novel bonding motifs and identified periodic trends across the actinide series. We identified structural building units that would lead to desired structural features and novel topologies. We also characterized many different spectroscopic trends across the actinide series. The grant support the preparation of approximately 1200 new compounds all of which were structurally characterized.

  4. Composition containing transuranic elements for use in the homeopathic treatment of aids

    International Nuclear Information System (INIS)

    A homeopathic remedy consisting of a composition containing one or more transuranic elements, particularly plutonium, for preventing and treating acquired immunodeficiency syndrome (AIDS) in humans, as well as seropositivity for human immunodeficiency virus (HIV). Said composition is characterized in that it uses any chemical or isotopic form of one or more transuranic elements (neptunium, plutonium, americium, curium, berkelium, californium or einsteinium), particularly plutonium, said form being diluted and dynamized according to conventional homeopathic methods, particularly the so-called Hahnemann and Korsakov methods, and provided preferably but not exclusively in the form of lactose and/or saccharose globules or granules impregnated with the active principle of said composition. (author)

  5. Detection of rare earth elements in Powder River Basin sub-bituminous coal ash using laser-induced breakdown spectroscopy (LIBS)

    Energy Technology Data Exchange (ETDEWEB)

    Tran, Phuoc [National Energy Technology Lab. (NETL), Pittsburgh, PA, (United State; Mcintyre, Dustin [National Energy Technology Lab. (NETL), Pittsburgh, PA, (United State

    2015-10-01

    We reported our preliminary results on the use of laser-induced breakdown spectroscopy to analyze the rare earth elements contained in ash samples from Powder River Basin sub-bituminous coal (PRB-coal). We have identified many elements in the lanthanide series (cerium, europium, holmium, lanthanum, lutetium, praseodymium, promethium, samarium, terbium, ytterbium) and some elements in the actinide series (actinium, thorium, uranium, plutonium, berkelium, californium) in the ash samples. In addition, various metals were also seen to present in the ash samples

  6. PROCEEDINGS OF THE SYMPOSIUM COMMEMORATING THE 25th ANNIVERSARY OF ELEMENTS 97 and 98 HELD ON JAN. 20, 1975

    Energy Technology Data Exchange (ETDEWEB)

    Seaborg, Glenn T.; Street Jr., Kenneth; Thompson, Stanley G.; Ghiorso, Albert

    1976-07-01

    This volume includes the talks given on January 20, 1975, at a symposium in Berkeley on the occasion of the celebration of the 25th anniversary of the discovery of berkelium and californium. Talks were given at this symposium by the four people involved in the discovery of these elements and by a number of people who have made significant contributions in the intervening years to the investigation of their nuclear and chemical properties. The papers are being published here, without editing, in the form in which they were submitted by the authors in the months following the anniversary symposium, and they reflect rather faithfully the remarks made on that occasion.

  7. Comment on "Nanosecond laser textured superhydrophobic metallic surfaces and their chemical sensing applications" by Duong V. Ta, Andrew Dunn, Thomas J. Wasley, Robert W. Kay, Jonathan Stringer, Patrick J. Smith, Colm Connaughton, Jonathan D. Shephard (Appl. Surf. Sci. 357 (2015) 248-254)

    Science.gov (United States)

    Boinovich, L. B.; Emelyanenko, A. M.; Emelyanenko, K. A.; Domantovsky, A. G.; Shiryaev, A. A.

    2016-08-01

    Nowadays the problem of design of durable ecologically friendly superhydrophobic surfaces is of great importance for science and technology. A recent paper in Applied Surface Science reports the method of fabricating the superhydrophobic metallic surfaces by infrared nanosecond laser surface texturing without using hydrophobic agents. Since this method of surface texturing can be considered as one of the most suitable for various industrial applications, the nature of superhydrophobic state of surfaces produced by laser texturing in the abovementioned paper deserves to be analyzed in detail. Authors of the commented paper attributed the change in wettability to the partial deoxidation of CuO into Cu2O on the surface during storage in atmosphere. However, such interpretation of the results contradicts to the basic notions in the theory of wetting and to more accurate and detailed data. In our Comment we discuss these contradictions point by point.

  8. International Electronic Journal of Elementary Educ ation, 2013, 5(3, 233-248. ISSN:1307 9298 Copyright © IEJEE www.iejee.com Relationship among Students’ Attitudes, Intentions and Behaviors towards the Inclusion of Peers with Disabilities, in Mainstream Physical Education Classes

    Directory of Open Access Journals (Sweden)

    Evangelos BEBETSOS

    2013-07-01

    Full Text Available Students’ attitudes, intentions and behaviours towards their peers with disabilities are important to their mutual co existence and development. The aim of this study was to investigate a whetherstudents’ attitudes and intentions towards their schoolmates with disabilities are related to their general and modified behavior in mainstream physical education classes, and b if the former variables could serve as predictors of the latter. The participants, 172 children without disabilities(Mage=11.15,SD=.70, completed the revised version of the Planned Behavior Theory questionnaire(PBT and the Children’s’ Attitudes towards Inclusion in Physical Education – Revised questionnaire(CAIPE R. Although results revealed several correlations among the variables under study, only general attitudes accounted for both general and modified behavior, and attitudes for modified behavior. These findings could assist in educating students to develop and perform appropriate behaviours towards their peers in order to facilitate their co existence, and their mutual developmentand learning.

  9. International Electronic Journal of Elementary Educ ation, 2013, 5(3), 233-248. ISSN:1307 9298 Copyright © IEJEE www.iejee.com Relationship among Students’ Attitudes, Intentions and Behaviors towards the Inclusion of Peers with Disabilities, in Mainstream Physical Education Classes

    OpenAIRE

    Evangelos BEBETSOS; Derri , Vassiliki; Stratos ZAFEIRIADIS; Pavlos KYRGIRIDIS

    2013-01-01

    Students’ attitudes, intentions and behaviours towards their peers with disabilities are important to their mutual co existence and development. The aim of this study was to investigate a) whetherstudents’ attitudes and intentions towards their schoolmates with disabilities are related to their general and modified behavior in mainstream physical education classes, and b) if the former variables could serve as predictors of the latter. The participants, 172 children without disabilities(Mage=...

  10. Study of Search Engine Transaction Logs Shows Little Change in How Users use Search Engines. A review of: Jansen, Bernard J., and Amanda Spink. “How Are We Searching the World Wide Web? A Comparison of Nine Search Engine Transaction Logs.” Information Processing & Management 42.1 (2006: 248‐263.

    Directory of Open Access Journals (Sweden)

    David Hook

    2006-09-01

    Full Text Available Objective – To examine the interactions between users and search engines, and how they have changed over time. Design – Comparative analysis of search engine transaction logs. Setting – Nine major analyses of search engine transaction logs. Subjects – Nine web search engine studies (4 European, 5 American over a seven‐year period, covering the search engines Excite, Fireball, AltaVista, BWIE and AllTheWeb. Methods – The results from individual studies are compared by year of study for percentages of single query sessions, one term queries, operator (and, or, not, etc. usage and single result page viewing. As well, the authors group the search queries into eleven different topical categories and compare how the breakdown has changed over time. Main Results – Based on the percentage of single query sessions, it does not appear that the complexity of interactions has changed significantly for either the U.S.‐based or the European‐based search engines. As well, there was little change observed in the percentage of one‐term queries over the years of study for either the U.S.‐based or the European‐based search engines. Few users (generally less than 20% use Boolean or other operators in their queries, and these percentages have remained relatively stable. One area of noticeable change is in the percentage of users viewing only one results page, which has increased over the years of study. Based on the studies of the U.S.‐based search engines, the topical categories of ‘People, Place or Things’ and ‘Commerce, Travel, Employment or Economy’ are becoming more popular, while the categories of ‘Sex and Pornography’ and ‘Entertainment or Recreation’ are declining. Conclusions – The percentage of users viewing only one results page increased during the years of the study, while the percentages of single query sessions, oneterm sessions and operator usage remained stable. The increase in single result page viewing implies that users are tending to view fewer results per web query. There was also a significant difference in the percentage of queries using Boolean operators between the US‐based and the European‐based search engines. One of the study’s findings was that results from a study of a particular search engine cannot necessarily be applied to all search engines. Finally, web search topics show a trend towards information or commerce searching rather than entertainment.

  11. An atomic beam source for actinide elements: concept and realization

    International Nuclear Information System (INIS)

    For ultratrace analysis of actinide elements and studies of their atomic properties with resonance ionization mass spectroscopy (RIMS), efficient and stable sources of actinide atomic beams are required. The thermodynamics and kinetics of the evaporation of actinide elements and oxides from a variety of metals were considered, including diffusion, desorption, and associative desorption. On this basis various sandwich-type filaments were studied. The most promising system was found to consist of tantalum as the backing material, an electrolytically deposited actinide hydroxide as the source of the element, and a titanium covering layer for its reduction to the metal. Such sandwich sources were experimentally proven to be well suited for the production of atomic beams of plutonium, curium, berkelium and californium at relatively low operating temperatures and with high and reproducible yields. (orig.)

  12. EC decay of 244Bk

    Science.gov (United States)

    Sodaye, Suparna; Tripathi, R.; Sudarshan, K.; Sharma, S. K.; Pujari, P. K.; Palit, R.; Mukhopadhyay, S.

    2014-12-01

    Berkelium isotopes have been produced in 11B-induced reaction on 238U. The EC decay of 244Bk → 244Cm has been studied by carrying out the single and coincidence measurements of the γ-rays emitted during the de-excitation of the 244Cm levels. Radiochemical separations have been carried out to minimize the contribution from the fission products and target. The new half-life of 244Bk is obtained as 5.02 ± 0.03 h, which is close to the theoretically calculated value. The relative intensities of the decay γ-rays have been re-evaluated. Based on the coincidence measurements, a tentative partial level scheme for 244Bk → 244Cm decay has been proposed.

  13. Nuclear fission and the transuranium elements

    International Nuclear Information System (INIS)

    Many of the transuranium elements are produced and isolated in large quantities through the use of neutrons furnished by nuclear fission reactions: plutonium (atomic number 94) in ton quantities; neptunium (93), americium (95), and curium (96) in kilogram quantities; berkelium (97) in 100 milligram quantities; californium (98) in gram quantities; and einsteinium (99) in milligram quantities. Transuranium isotopes have found many practical applications---as nuclear fuel for the large-scale generation of electricity, as compact, long-lived power sources for use in space exploration, as means for diagnosis and treatment in the medical area, and as tools in numerous industrial processes. Of particular interest is the unusual chemistry and impact of these heaviest elements on the periodic table. This account will feature these aspects. 9 refs., 5 figs

  14. Nuclear fission and the transuranium elements

    Energy Technology Data Exchange (ETDEWEB)

    Seaborg, G.T.

    1989-02-01

    Many of the transuranium elements are produced and isolated in large quantities through the use of neutrons furnished by nuclear fission reactions: plutonium (atomic number 94) in ton quantities; neptunium (93), americium (95), and curium (96) in kilogram quantities; berkelium (97) in 100 milligram quantities; californium (98) in gram quantities; and einsteinium (99) in milligram quantities. Transuranium isotopes have found many practical applications---as nuclear fuel for the large-scale generation of electricity, as compact, long-lived power sources for use in space exploration, as means for diagnosis and treatment in the medical area, and as tools in numerous industrial processes. Of particular interest is the unusual chemistry and impact of these heaviest elements on the periodic table. This account will feature these aspects. 9 refs., 5 figs.

  15. EC decay of 244Bk

    International Nuclear Information System (INIS)

    Berkelium isotopes have been produced in 11B-induced reaction on 238U. The EC decay of 244Bk → 244Cm has been studied by carrying out the single and coincidence measurements of the γ-rays emitted during the de-excitation of the 244Cm levels. Radiochemical separations have been carried out to minimize the contribution from the fission products and target. The new half-life of 244Bk is obtained as 5.02 ± 0.03 h, which is close to the theoretically calculated value. The relative intensities of the decay γ-rays have been re-evaluated. Based on the coincidence measurements, a tentative partial level scheme for 244Bk → 244Cm decay has been proposed. (paper)

  16. Production of transuranium elements

    International Nuclear Information System (INIS)

    The Radiochemical Engineering Development Center (REDC) has the programmatic responsibility for the Department of Energy's Transuranium Element Program. Principle elements from the program are einsteinium, berkelium, and fermium. Targets containing curium oxide mixed with aluminum powder are fabricated by the REDC and irradiated in the Oak Ridge National Laboratory (ORNL) High Flux Isotope Reactor. Following an irradiation period of 6-12 months, targets are returned to the REDC for chemical processing. Processing operations consists of aluminum dejacketing in a caustic-nitrate solution, filtration, acid dissolution, solvent extraction, anion exchange, and finally a cation exchange to recover the actinides. The processing operations take place in heavily shielded hot cell facilities and all operations are carried out remotely. The chemistry for the separations has been well established over the 26-yr. operating life of the facility

  17. AcEST: DK955984 [AcEST

    Lifescience Database Archive (English)

    Full Text Available TST39A01NGRL0024_I21 545 Adiantum capillus-veneris mRNA. clone: TST39A01NGRL0024_I21. 5' end seq ... 21/159 (76%) Frame = +3 Query: 69 MLVYQXXXXXXXXXXXXFPY KEIQNGILWEVEGKWVVKGAVDVDIGANPSAXXXXXXXXX 248 MLVYQ ... LWEV+GKWVV+GA+DVDIGANPSA Sbjct: 1 MLVYQDLLTGDELLSDSFPY REIENGILWEVDGKWVVQGAIDVDIGANPSAEGGGDDEGV 60 Query: ... 20/159 (75%) Frame = +3 Query: 69 MLVYQXXXXXXXXXXXXFPY KEIQNGILWEVEGKWVVKGAVDVDIGANPSAXXXXXXXXX 248 MLVYQ ... 21/159 (76%) Frame = +3 Query: 69 MLVYQXXXXXXXXXXXXFPY KEIQNGILWEVEGKWVVKGAVDVDIGANPSAXXXXXXXXX 248 MLVYQ ...

  18. Dicty_cDB: Contig-U10615-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Expect = 2e-66 Identities = 248/248 (100%) Strand = Plus / Plus Query: 11 acaaccanaaaanatttccgnatcatcacatgnatgganatcnccna...anaaaanatttccgnatcatcacatgnatgganatcnccnaatgnattcaattc 70 Query: 71 atcntttgggatccntntganattacnccna...|||| Sbjct: 71 atcntttgggatccntntganattacnccnacntccnctggngnanantcaatcccttta 130 Query: 131 ncaaaaccnnangctgg...212 (95%) Strand = Plus / Plus Query: 12 caaccanaaaanatttccgnatcatcacatgnatgganatcnccnaatgnattcaattca 71 |||...||||||||||||||||||||||| || ||||||||||||||||| |||||||||||| Sbjct: 11 caaccanaaaanatttccgnatcatcncangnatgganatcnccna

  19. Drug: D05945 [KEGG MEDICUS

    Lifescience Database Archive (English)

    Full Text Available rial; Coccidiostat [for poultry] CAS: 127-77-5 PubChem: 47207603 LigandBox: D05945 NIKKAJI: J5.401A ATOM 17 ...D05945 Drug Sulfabenz (USAN/INN) C12H12N2O2S 248.0619 248.3009 D05945.gif Antibacte

  20. Unigene BLAST: CBRC-CELE-05-0613 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-CELE-05-0613 gnl|UG|Cel#S5712587 Caenorhabditis elegans Serpentine Receptor, c...lass H family member (srh-248) (srh-248) mRNA, complete cds /cds=p(1,978) /gb=NM_071402 /gi=17561853 /ug=Cel.3249 /len=978 1e-77 44% ...

  1. Unigene BLAST: CBRC-CELE-05-0029 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-CELE-05-0029 gnl|UG|Cel#S5712587 Caenorhabditis elegans Serpentine Receptor, c...lass H family member (srh-248) (srh-248) mRNA, complete cds /cds=p(1,978) /gb=NM_071402 /gi=17561853 /ug=Cel.3249 /len=978 1e-60 36% ...

  2. Gclust Server: 201207 [Gclust Server

    Lifescience Database Archive (English)

    Full Text Available 201207 TET_248.m00028 Cluster Sequences - 203 hypothetical protein chr_0_8253855_24...8; no annotation 1 1.00e-80 0.0 11.11 0.0 0.0 0.0 0.0 Show 201207 Cluster ID 201207 Sequence ID TET_248.m000

  3. 78 FR 64242 - Outer Continental Shelf (OCS), Gulf of Mexico (GOM), Oil and Gas Lease Sales, Western Planning...

    Science.gov (United States)

    2013-10-28

    ... Bureau of Ocean Energy Management Outer Continental Shelf (OCS), Gulf of Mexico (GOM), Oil and Gas Lease Sales, Western Planning Area (WPA) Lease Sales 238, 246, and 248 AGENCY: Bureau of Ocean Energy... proposed OCS oil and gas Lease Sales 238, 246, and 248, which are tentatively scheduled to be held...

  4. AcEST: DK944203 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU02A01NGRL0005_E21 586 Adiantum capillus-veneris mRNA. clone: YMU02A01NGRL0005_E21. 5' end seq ... VSIREGLHYNPYFPGGAIAMPKMLN 244 Query: 248 DGAVEYEDEVPAT ESQMAKDVVTFLSWAAEPEMEERKLMGFKVMFVLSLALLQAGYYKRW 427 ... DGAVEYED +PAT E+QM KDVV+FLSWAAEPEMEERKLMGFK +FVLSLALLQA YY+R Sbjc ... t: 245 DGAVEYEDGIPAT EAQMGKDVVSFLSWAAEPEMEERKLMGFKWIFVLSLALLQAAYYRRL 304 ... VSIREGLHYNPYFPGGAIAMPKMLN 184 Query: 248 DGAVEYEDEVPAT ESQMAKDVVTFLSWAAEPEMEERKLMGFKVMFVLSLALLQAGYYKRW 427 ...

  5. Nuclear Chemistry Institute, Mainz University. Annual Report 1995

    International Nuclear Information System (INIS)

    The annual report of the Institut fuer Kernchemie addresses inter alia three main research activities. The first belongs to the area of basic research, covering studies in the fields of nuclear fission, chemistry of the super-heavy elements and of heavy-ion reactions extending from the Coulomb barrier to relativistic energies, and nuclear astrophysics in connection with the ''r process''. By means of laser technology, high-precision data could be measured of the ionization energies of berkelium and californium. Studies of atomic clusters in the vacuum of an ionization trap revealed interesting aspects. The second major activity was devoted to the analysis of environmental media, applying inter alia neutron activation analysis and resonance ionization mass spectroscopy (RIMS). The third activity resulted in the development of novel processes, or the enhancement of existing processes or methods, for applications in basic research work and in environmental analytics. Another item of interest is the summarizing report on the operation of the TRIGA research reactor. (orig./SR)

  6. Paul Scherrer Institute Scientific Report 1999. Volume I: Particles and Matter

    International Nuclear Information System (INIS)

    Although originally planned for fundamental research in nuclear physics, the particle beams of pions, muons, protons and neutrons are now used in a large variety of disciplines in both natural science and medicine. The beams at PSI have the world's highest intensities and therefore allow certain experiments to be performed, which would not be possible elsewhere. The highlight of research this year was the first-ever determination of the chemical properties of the superheavy element 107 Bohrium. This was undertaken, by an international team led by H. Gaeggeler of PSI's Laboratory for Radiochemistry. Bohrium was produced by bombarding a Berkelium target with Neon ions from the Injector I cyclotron and six atoms were detected after having passed through an online gas chromatography device. At the Laboratory for Particle Physics the focus has shifted from nuclear physics to elementary particle physics with about a fifty-fifty split between investigations of rare processes or particle decays using the high intensity muon, pion and recently also polarized neutron beams of PSI, and research at the highest energy frontier at CERN (Geneva) and DESY (Hamburg). Important space instrumentation has been contributed by the Laboratory for Astrophysics to the European Space Agency and NASA satellite programmes. The Laboratory for Micro and Nanotechnology continued to focus on research into molecular nanotechnology and SiGeC nanostructures, the latter with the aim of producing silicon based optoelectronics. Progress in 1999 in these topical areas is described in this report. A list of scientific publications in 1999 is also provided

  7. Investigations for the influence of geochemical parameters on the sorption and desorption of lanthanides and uranium onto opalinus clay as potential host rock for a repository

    International Nuclear Information System (INIS)

    The development of a disposal in deep geological formations for radioactive waste is a very important task for the future. The safety assessment for more than a hundred thousand years needs a full understanding of all processes of interaction between the radioactive waste and the surrounded formations. This work contributes to this understanding. The interaction between lanthanides (homologues of the actinides americium, curium and berkelium) / uranium and the host rock opalinus clay under influence of organic substances (NOM) have been analyzed and discussed. The complex system was split into 3 binary basic systems with the following interactions - Interactions between lanthanides / uranium and NOM - Interactions between lanthanides / uranium and the opalinus clay - Interactions between NOM and opalinus clay All binary systems can be influenced by geological parameters like pH, ion strength and competing cations. The sorption / desorption of the lanthanides onto the opalinus clay is analyzed via inductively coupled plasma mass spectrometry. For the investigation of the complexation behavior of metals with NOM we used capillary electrophoresis coupled with inductively coupled plasma mass spectrometry. Under these conditions the chosen model organic humic acid affected the sorption of the lanthanides onto opalinus clay favorably. The smaller organic compounds, which dominate in the composition of the clay organics, remobilized the metals after sorption onto clay and the sorption can be inhibited by NOM. Due to the reduced metal sorption onto Opalinus clay by NOM, a migration through the clay may be possible.

  8. Level structures of neutron-rich Xe isotopes

    Energy Technology Data Exchange (ETDEWEB)

    Ahmad, I.; Lister, C.J.; Morss, L.R. [and others

    1995-08-01

    The level structures of neutron-rich Xe isotopes were determined by observing prompt gamma-ray coincidences in {sup 248}Cm fission fragments. A 5-mg {sup 248}Cm, in the form of {sup 248}Cm-KCl pellet, was placed inside Eurogam array which consisted of 45 Compton-suppressed Ge detectors and 5 Low-Energy Photon Spectrometers. Transitions in Xe isotopes were identified by the appearance of new peaks in the {gamma}-ray spectra obtained by gating on the gamma peaks of the complementary Mo fragments.

  9. Characterization of Indoor/Outdoor Particulate Matter Characteristics in Two Residential Houses in Oslo, Norway

    Czech Academy of Sciences Publication Activity Database

    Lazaridis, M.; Dahlin, E.; Hanssen, J. E.; Smolík, Jiří; Schmidbauer, N.; Moravec, Pavel; Ždímal, Vladimír; Hermansen, O.; Glytsos, T.; Dye, C.

    2003. s. 248. [GNEST Conference. 08.09.2003-10.09.2003, Lemnos island] Institutional research plan: CEZ:AV0Z4072921 Keywords : indoor air quality * size distribution Subject RIV: CF - Physical ; Theoretical Chemistry

  10. Communication and Social Regulation in Termites

    Czech Academy of Sciences Publication Activity Database

    Bagneres, A. G.; Hanus, Robert

    Cham: Springer, 2015 - (Aquiloni, L.; Tricarico, E.), s. 193-248 ISBN 978-3-319-17598-0 Institutional support: RVO:61388963 Keywords : termites * communication * chemical communication * pheromones * mechanical communication * social regulation Subject RIV: CC - Organic Chemistry

  11. Review: Lorenzo Cotula, The Great African Land Grab?: Agricultural Investments and the Global Food System (2013

    Directory of Open Access Journals (Sweden)

    Kerstin Nolte

    2013-01-01

    Full Text Available Review of the monograph:Lorenzo Cotula, The Great African Land Grab?: Agricultural Investments and the Global Food System, London, New York: Zed Books, 2013, ISBN 9781780324203, 248 pages

  12. Tagasi Pariisis / Karl Rumor

    Index Scriptorium Estoniae

    Rumor, Karl, pseud., 1886-1971

    2008-01-01

    Prantsusmaa sisepoliitilisest olustikust. Poliitilistest oludest 1937. aasta Euroopas, sõjameeleoludest Vahemerel, Nyloni konverentsist. Varem ilmunud: Uus Eesti 21. juuni 1937, nr. 166; 8., 13. sept. 1937, nr. 243, 248

  13. QTL Information Table: 229 [Q-TARO

    Lifescience Database Archive (English)

    Full Text Available ). Characterization of the main effects, epistatic effects and their environmental interactions of QTLs on the genetic basis of yield traits in rice. Theor Appl Genet 105, 248-257. ...

  14. Myšlenka sjednocené Evropy. Stěžejní ideje Masarykovy "Nové Evropy"

    Czech Academy of Sciences Publication Activity Database

    Pauza, Miroslav

    Praha : Filosofia, 2013, s. 241-248 ISBN 978-80-7007-391-9. - (Filosofie a sociální vědy. 45) Institutional support: RVO:67985955 Keywords : Masaryk * Europe Subject RIV: AA - Philosophy ; Religion

  15. Radiation Exposure from Medical Exams and Procedures

    Science.gov (United States)

    ... nuclear medicine. The NCRP, the American College of Radiology, the World Health Organi- zation, and others are ... W, Yoshizumi TT, Mahesh M. Effective doses in radiology and diagnostic nuclear medicine: A catalog. Radiology 248( ...

  16. The small binary asteroid (939) Isberga

    Czech Academy of Sciences Publication Activity Database

    Carry, B.; Matter, A.; Scheirich, Peter; Pravec, Petr; Molnar, L.; Mottola, S.; Carbognani, A.; Jehin, E.; Marciniak, A.; Binzel, R. P.; DeMeo, E.F.; Birlan, M.; Delbó, M.; Barbotin, E.; Behrend, R.; Bonnardeau, M.; Colas, F.; Farissier, P.; Fauvaud, M.; Fauvaud, S.; Gillier, C.; Gillon, M.; Hellmich, S.; Hirsch, R.; Leroy, A.; Manfroid, J.; Montier, J.; Morelle, E.; Richard, F.; Sobkowiak, K.; Strajnic, J.; Vachier, F.

    2015-01-01

    Roč. 248, March (2015), s. 516-525. ISSN 0019-1035 Institutional support: RVO:67985815 Keywords : asteroids * dynamics * satellites of asteroids Subject RIV: BN - Astronomy, Celestial Mechanics, Astrophysics Impact factor: 3.038, year: 2014

  17. Study of fusion and nucleon transfer channels in the Au-197 + He-6 reaction in an energy range of He-6 to 20 Mev/A

    Czech Academy of Sciences Publication Activity Database

    Skobelev, N. K.; Penionzhkevich, Y. E.; Kulko, A. A.; Demekhina, N. A.; Kroha, Václav; Kugler, Andrej; Lukyanov, S. M.; Mrázek, Jaromír; Sobolev, Yu. G.; Maslov, V. A.; Muzychka, Yu. A.; Voskoboynik, E. I.; Fomichev, A. S.

    2013-01-01

    Roč. 10, č. 3 (2013), s. 248-255. ISSN 1547-4771 Institutional support: RVO:61389005 Keywords : nuclear reactions * gamma activity * cross section Subject RIV: BG - Nuclear, Atomic and Molecular Physics , Colliders

  18. Iron Phthalocyanine as New Efficient Catalyst for Catalytic Transfer Hydrogenation of Simple Aldehydes and Ketones

    Czech Academy of Sciences Publication Activity Database

    Bata, P.; Notheisz, F.; Klusoň, Petr; Zsigmond, A.

    2015-01-01

    Roč. 29, JAN 2015 (2015), s. 45-49. ISSN 0268-2605 Institutional support: RVO:67985858 Keywords : heterogenized complexes * catalytic transfer hydrogenation * reusable catalyst Subject RIV: CC - Organic Chemistry Impact factor: 2.248, year: 2014

  19. Optimal Mirrleesean taxation in a Ben-Porath economy

    Czech Academy of Sciences Publication Activity Database

    Kapička, Marek

    2015-01-01

    Roč. 7, č. 2 (2015), s. 219-248. ISSN 1945-7707 Institutional support: RVO:67985998 Keywords : optimal taxes * unobservable human capital * income taxes Subject RIV: AH - Economics Impact factor: 3.780, year: 2014

  20. Birth characteristics and risk of colorectal cancer: a study among Swedish twins

    OpenAIRE

    Cnattingius, S; Lundberg, F; Iliadou, A.

    2009-01-01

    Type-2 diabetes increases the risk of colorectal cancer, and is also associated with low birth weight. However, we found no evidence of associations between birth characteristics and risk of colorectal cancer (m=248) among Swedish twins.

  1. Fluorinated and trifluoromethylated CB11 carborane anions and radicals

    Czech Academy of Sciences Publication Activity Database

    Higelin, Alexander; Šembera, Filip; Tamadon, F.; Wahab, Abdul; Janoušek, Zbyněk; Ludvík, Jiří; Klíma, Jiří; Crespo, R.; Piqueras, M. C.; Michl, Josef

    San Francisco: American Chemical Society, 2014. 37FLUO. [ACS National Meeting & Exposition /248./. 10.08.2014-14.08.2014, San Francisco] Institutional support: RVO:61388963 Keywords : carborane anions Subject RIV: CC - Organic Chemistry

  2. "Kalevipoeg" Tammsaare tähendamissõnade kumas / Madis Kõiv

    Index Scriptorium Estoniae

    Kõiv, Madis, 1929-2014

    2003-01-01

    Kreutzwaldi "Kalevipoja" ja "Lembitu" filosoofilisest tagamaast. A. H. Tammsaare artiklist ""Kalevipoja" parandamise ümber" (1916). Ilmunud ka kogumikus: Kõiv, Madis. Luhta-minek. Tartu : Ilmamaa, 2005, lk. 206-248

  3. Drug: D09741 [KEGG MEDICUS

    Lifescience Database Archive (English)

    Full Text Available mones 248 Mixed hormone preparations 2482 Estrogens and progestins D09741 Drospiren...[HSA:1557] Therapeutic category of drugs in Japan [BR:br08301] 2 Agents affecting individual organs 24 Hor

  4. 40 CFR 1065.370 - CLD CO2 and H2O quench verification.

    Science.gov (United States)

    2010-07-01

    ... § 1065.248, or use good engineering judgment to develop a different protocol: (1) Use PTFE or stainless... PTFE or stainless steel tubing to make necessary connections. (2) If the CLD analyzer has an...

  5. Comparison of diatom community structure from epilithon and fish guts: implications for inferring past changes in water quality

    Czech Academy of Sciences Publication Activity Database

    Bešta, T.; Muška, Milan; Juggins, S.; Těšitel, J.

    2015-01-01

    Roč. 742, č. 1 (2015), s. 233-248. ISSN 0018-8158 Institutional support: RVO:60077344 Keywords : diatoms * fish * palaeolimnology * aquatic quality * eutrophication Subject RIV: DA - Hydrology ; Limnology Impact factor: 2.275, year: 2014

  6. Carotenoid-protein interaction alters the S1 energy of hydroxyechinenone in the Orange Carotenoid Protein

    Czech Academy of Sciences Publication Activity Database

    Polívka, Tomáš; Chábera, P.; Kerfeld, C.A.

    2013-01-01

    Roč. 1827, č. 3 (2013), s. 248-254. ISSN 0005-2728 Institutional support: RVO:60077344 Keywords : orange-carotenoid protein * excited states * photoprotection Subject RIV: BO - Biophysics Impact factor: 4.829, year: 2013

  7. SnS and SnS2 thin films deposited using a spin-coating technique from intramolecularly coordinated organotin sulfides

    Czech Academy of Sciences Publication Activity Database

    Řečica, T.; Střižík, L.; Dostál, L.; Bouška, M.; Vlček, Milan; Beneš, L.; Wágner, T.; Jambor, R.

    2015-01-01

    Roč. 29, č. 3 (2015), s. 176-180. ISSN 0268-2605 Institutional support: RVO:61389013 Keywords : organotin sulfide * single - source precursor * spin - coating process Subject RIV: CA - Inorganic Chemistry Impact factor: 2.248, year: 2014

  8. Latein als Sprache der mittelalterlichen Schriften über Wettervorhersage

    Czech Academy of Sciences Publication Activity Database

    Kocánová, Barbora

    -, č. 71 (2013), s. 237-248. ISSN 1376-7453 R&D Projects: GA MŠk(CZ) LD13043 Institutional support: RVO:67985955 Keywords : medieval weather forecasting * medieval Latin * medieval manuscripts Subject RIV: AI - Linguistics

  9. Pediatric Palliative Care: A Personal Story

    Medline Plus

    Full Text Available ... count__/__total__ Find out why Close Pediatric Palliative Care: A Personal Story NINRnews Subscribe Subscribed Unsubscribe 248 ... and her family. The story demonstrates how palliative care can positively influence a patient's and family's experience ...

  10. Mathematical Language as a Bridge between Conceptualization of Motion and Experimental Practice

    Czech Academy of Sciences Publication Activity Database

    Kvasz, Ladislav

    Dordrecht: Springer, 2015 - (Pisano, R.), s. 229-248. (History of Mechanism and Machine Science. 27). ISBN 978-94-017-9644-6 Institutional support: RVO:67985955 Keywords : Galileo * Descartes * Newton * force * interaction * experimental practice Subject RIV: AA - Philosophy ; Religion

  11. Detection and molecular analysis of Hop latent virus and Hop latent viroid in hop samples from Poland

    Czech Academy of Sciences Publication Activity Database

    Ziegler, A.; Kawka, M.; Przybys, M.; Doroszewska, T.; Skomra, U.; Kastirr, U.; Matoušek, Jaroslav; Schubert, J.

    2014-01-01

    Roč. 66, č. 7 (2014), s. 248-254. ISSN 1867-0911 Institutional support: RVO:60077344 Keywords : real-time PCR diagnosis * hop virus * Humulus lupulus * viroid Subject RIV: EB - Genetics ; Molecular Biology

  12. Clinical implementation of 4-dihydroxyborylphenylalanine synthesised by an asymetric pathway

    Czech Academy of Sciences Publication Activity Database

    Kulvik, M.; Vahatalo, J.; Buchar, Evžen; Farkkila, M.; Jarviluoma, E.; Jaaskelainen, J.; Kříž, O.; Laakso, J.; Rasilainen, M.; Kallio, M.

    2003-01-01

    Roč. 18, - (2003), s. 155-163. ISSN 0928-0987 Institutional research plan: CEZ:AV0Z5039906 Keywords : Boron neutron capture therapy Subject RIV: FR - Pharmacology ; Medidal Chemistry Impact factor: 2.248, year: 2003

  13. Effects of the Multidisciplinary Risk Assessment and Management Program for Patients with Diabetes Mellitus (RAMP-DM) on biomedical outcomes, observed cardiovascular events and cardiovascular risks in primary care: a longitudinal comparative study

    OpenAIRE

    Jiao, Fang Fang; Fung, Colman Siu Cheung; Wong, Carlos King Ho; Wan, Yuk Fai; Dai, Daisy; Kwok, Ruby; Lam, Cindy Lo Kuen

    2014-01-01

    Background To assess whether the Multidisciplinary Risk Assessment and Management Program for Patients with Diabetes Mellitus (RAMP-DM) led to improvements in biomedical outcomes, observed cardiovascular events and predicted cardiovascular risks after 12-month intervention in the primary care setting. Methods A random sample of 1,248 people with diabetes enrolled to RAMP-DM for at least 12 months was selected and 1,248 people with diabetes under the usual primary care were matched by age, sex...

  14. 黑白双色 飞利浦发布MODA系列显示器

    Institute of Scientific and Technical Information of China (English)

    冯华

    2011-01-01

    近日飞利浦发布了两款被命名为MODA摩登的显示器新品248C3L、248C3LH,无论从外观设计、制造工艺、色彩表现,还是应用体验上,都被誉为"飞利浦史上最美显示器"。

  15. Evaluation of Statens Serum Institut Enteric Medium for Detection of Enteric Pathogens

    OpenAIRE

    Blom, Marianne; Meyer, Aase; Gerner-Smidt, Peter; Gaarslev, Knud; Espersen, Frank

    1999-01-01

    The efficacy of the Statens Serum Institut (SSI) enteric medium for isolation and direct identification of enteric pathogens was evaluated. Six different biochemical reactions can be read by using the SSI enteric medium, allowing direct identification of a range of enteric pathogens. All 248 gram-negative bacterial species that were tested grew on the SSI enteric medium. Only 10 of 248 bacteria (4%) showed discrepant results in the biochemical reactions, and none of these were enteric pathoge...

  16. Supplementation with L-Glutamine and L-Alanyl-L-Glutamine Changes Biochemical Parameters and Jejunum Morphophysiology in Type 1 Diabetic Wistar Rats

    OpenAIRE

    da Rosa, Carlos Vinicius D.; Azevedo, Silvia C. S. F.; Bazotte, Roberto B.; Peralta, Rosane M.; Buttow, Nilza C.; Maria Montserrat D Pedrosa; Vilma A F de Godoi; Maria Raquel M Natali

    2015-01-01

    We evaluated the effects of the supplementation with L-glutamine and glutamine dipeptide (GDP) on biochemical and morphophysiological parameters in streptozotocin-diabetic rats. For this purpose, thirty animals were distributed into six groups treated orally (gavage) during thirty days: non diabetic rats (Control) + saline, diabetic + saline; Control + L-glutamine (248 mg/kg), Diabetic + L-glutamine (248 mg/kg), Control + GDP (400 mg/kg), Diabetic + GDP (400 mg/kg). Diabetes was induced by an...

  17. Enhancing the thermostability of a cold-active lipase from Penicillium cyclopium by in silico design of a disulfide bridge.

    Science.gov (United States)

    Tan, Zhongbiao; Li, Jianfang; Wu, Minchen; Wang, Junqing

    2014-08-01

    Cysteine mutants of a cold-active lipase (PcLipI) from Penicillium cyclopium were designed by the software Disulfide by Design Ver. 1.20 in an effort to improve enzyme thermostability by addition of a disulfide bridge. Those mutants predicted by molecular dynamics simulation to have better thermostability than the wild type were first expressed in Escherichia coli BL21(DE3) and then, for further investigation, in Pichia pastoris GS115. By replacing Val248 and Thr251 with cysteines to create a disulfide bridge, the recombinant lipases reE-PcLipV248C-T251C (expressed in E. coli) and reP-PcLipV248C-T251C (expressed in P. pastoris) were obtained. Both had enhanced thermostability with half-lives at 35 °C about 4.5- and 12.8-fold longer than that of the parent PcLipI expressed in E. coli and P. pastoris, respectively. The temperature optima of reE-PcLipV248C-T251C and reP-PcLipV248C-T251C were 35 and 30 °C, which were each 5 °C higher than those of the parent PcLipI expressed in E. coli and P. pastoris. The K ms of reE-PcLipV248C-T251C and reP-PcLipV248C-T251C toward tributyrin were 53.2 and 39.5 mM, while their V maxs were 1,460 and 3,800 U/mg, respectively. PcLipV248C-T251C had better thermostability and catalytic efficiency than the other mutants and the parent PcLipI. PMID:24867629

  18. Bk and Cf chromatographic separation and ²⁴⁹Bk/²⁴⁸Cm and ²⁴⁹Cf/²⁴⁸Cm elemental ratios determination by inductively coupled plasma quadrupole mass spectrometry.

    Science.gov (United States)

    Gourgiotis, A; Isnard, H; Nonell, A; Aubert, M; Stadelmann, G; Dupont, E; AlMahamid, I; Tiang, G; Rao, L; Lukens, W; Cassette, P; Panebianco, S; Letourneau, A; Chartier, F

    2013-03-15

    The French Atomic Energy Commission has carried out several experiments for the study of minor-actinide transmutation processes in high intensity thermal neutron flux. In this context a Cm sample enriched in (248)Cm (∼97%) was irradiated in a thermal neutron flux at the High Flux Reactor (HFR) of the Laue-Langevin Institute (ILL). The precise and accurate determination of Cf isotope ratios and of (249)Bk/(248)Cm and (249)Cf/(248)Cm elemental ratios in the (248)Cm irradiated sample is crucial for the calculation of actinide neutron capture cross-sections. This work describes an analytical procedure for the separation and the isotope ratio measurement of Bk and Cf in the irradiated sample. The Bk and Cf separation is based on a lanthanides separation protocol previously developed by the laboratory. Well-defined retention times for Bk and Cf were obtained by coupling the Ionic Chromatography (IC) with an ICP-QMS. All conditions of element separation by IC and the different steps of the analytical protocol in order to obtain the isotopic and elemental ratios are presented. Relative uncertainties of Cf isotopic ratios range from 0.3% to 0.5% and the uncertainty of the (249)Bk/(248)Cm and (249)Cf/(248)Cm elemental ratios are respectively 6.1% and 3.2%. This level of uncertainty for both isotopic and elemental ratios is in perfect agreement with the requirement for transmutation studies. PMID:23598093

  19. Minor Actinide Burning in Thermal Reactors. A Report by the Working Party on Scientific Issues of Reactor Systems

    International Nuclear Information System (INIS)

    The actinides (or actinoids) are those elements in the periodic table from actinium upwards. Uranium (U) and plutonium (Pu) are two of the principal elements in nuclear fuel that could be classed as major actinides. The minor actinides are normally taken to be the triad of neptunium (Np), americium (Am) and curium (Cm). The combined masses of the remaining actinides (i.e. actinium, thorium, protactinium, berkelium, californium, einsteinium and fermium) are small enough to be regarded as very minor trace contaminants in nuclear fuel. Those elements above uranium in the periodic table are known collectively as the transuranics (TRUs). The operation of a nuclear reactor produces large quantities of irradiated fuel (sometimes referred to as spent fuel), which is either stored prior to eventual deep geological disposal or reprocessed to enable actinide recycling. A modern light water reactor (LWR) of 1 GWe capacity will typically discharge about 20-25 tonnes of irradiated fuel per year of operation. About 93-94% of the mass of uranium oxide irradiated fuel is comprised of uranium (mostly 238U), with about 4-5% fission products and ∼1% plutonium. About 0.1-0.2% of the mass is comprised of neptunium, americium and curium. These latter elements accumulate in nuclear fuel because of neutron captures, and they contribute significantly to decay heat loading and neutron output, as well as to the overall radio-toxic hazard of spent fuel. Although the total minor actinide mass is relatively small - approximately 20-25 kg per year from a 1 GWe LWR - it has a disproportionate impact on spent fuel disposal, and thus the longstanding interest in transmuting these actinides either by fission (to fission products) or neutron capture in order to reduce their impact on the back end of the fuel cycle. The combined masses of the trace actinides actinium, thorium, protactinium, berkelium and californium in irradiated LWR fuel are only about 2 parts per billion, which is far too low for

  20. Radiological safety considerations in the design and operation of the Oak Ridge National Laboratory Transuranium Research Laboratory (TRL)

    International Nuclear Information System (INIS)

    The Transuranium Research Laboratory (TRL) is the central facility at Oak Ridge National Laboratory (ORNL) for chemical and physical research involving transuranium elements. Transuranium Research Laboratory investigations are about equally divided between studies of inorganic and structural chemistry of the heavy elements and nuclear structure and properties of their isotopes. Elements studied include neptunium, plutonium, americium, curium, berkelium, californium, and einsteinium, each in microgram-to-gram quantities depending upon availability and experimental requirements. This paper describes an eight-step safety procedure that is followed in planning and approving individual research projects. This procedure should provide an ''optimum margin of safety'' and should permit the accomplishment of successful research. Steps in the procedure are as follows: (1) Evaluate the external and internal exposure radioactivity hazards. (2) Establish any concurrent conventional industrial safety risks that may be encountered in the operation. (3) Consider, in the proper perspective, the potential consequences of possible interactions of radioactivity risks with associated industrial safety risks and problems, applying the concepts of credibility and probability. (4) Design equipment, develop operating procedures, and ensure the proficiency of operating personnel to provide necessary safeguards to accomplish programme objectives with minimum risks and minimum operational constraints. (5) Ensure that necessary safeguards are, in fact, incorporated in equipment and procedures before actual work is begun. (6) Ensure that appropriate monitoring instrumentation, surveillance, and other necessary protective technical and craft support are available and are used during operation. (7) Make certain that appropriate measures exist to manage credible radiation accidents and other emergencies properly. (8) Inform others, in sufficient detail, of the success or deficiency of design

  1. Radiochemical studies of neutron deficient actinide isotopes

    International Nuclear Information System (INIS)

    The production of neutron deficient actinide isotopes in heavy ion reactions was studied using alpha, gamma, x-ray, and spontaneous fission detection systems. A new isotope of berkelium, 242Bk, was produced with a cross-section of approximately 10 μb in reactions of boron on uranium and nitrogen on thorium. It decays by electron capture with a half-life of 7.0 +- 1.3 minutes. The alpha-branching ratio for this isotope is less than 1% and the spontaneous fission ratio is less than 0.03%. Studies of (Heavy Ion, pxn) and (Heavy Ion, αxn) transfer reactions in comparison with (Heavy ion, xn) compound nucleus reactions revealed transfer reaction cross-sections equal to or greater than the compound nucleus yields. The data show that in some cases the yield of an isotope produced via a (H.I.,pxn) or (H.I.,αxn) reaction may be higher than its production via an xn compound nucleus reaction. These results have dire consequences for proponents of the ''Z1 + Z2 = Z/sub 1+2/'' philosophy. It is no longer acceptable to assume that (H.I.,pxn) and (H.I.,αxn) product yields are of no consequence when studying compound nucleus reactions. No evidence for spontaneous fission decay of 228Pu, 230Pu, 232Cm, or 238Cf was observed indicating that strictly empirical extrapolations of spontaneous fission half-life data is inadequate for predictions of half-lives for unknown neutron deficient actinide isotopes

  2. Radiochemical studies of neutron deficient actinide isotopes

    Energy Technology Data Exchange (ETDEWEB)

    Williams, K.E.

    1978-04-01

    The production of neutron deficient actinide isotopes in heavy ion reactions was studied using alpha, gamma, x-ray, and spontaneous fission detection systems. A new isotope of berkelium, /sup 242/Bk, was produced with a cross-section of approximately 10 ..mu..b in reactions of boron on uranium and nitrogen on thorium. It decays by electron capture with a half-life of 7.0 +- 1.3 minutes. The alpha-branching ratio for this isotope is less than 1% and the spontaneous fission ratio is less than 0.03%. Studies of (Heavy Ion, pxn) and (Heavy Ion, ..cap alpha..xn) transfer reactions in comparison with (Heavy ion, xn) compound nucleus reactions revealed transfer reaction cross-sections equal to or greater than the compound nucleus yields. The data show that in some cases the yield of an isotope produced via a (H.I.,pxn) or (H.I.,..cap alpha..xn) reaction may be higher than its production via an xn compound nucleus reaction. These results have dire consequences for proponents of the ''Z/sub 1/ + Z/sub 2/ = Z/sub 1+2/'' philosophy. It is no longer acceptable to assume that (H.I.,pxn) and (H.I.,..cap alpha..xn) product yields are of no consequence when studying compound nucleus reactions. No evidence for spontaneous fission decay of /sup 228/Pu, /sup 230/Pu, /sup 232/Cm, or /sup 238/Cf was observed indicating that strictly empirical extrapolations of spontaneous fission half-life data is inadequate for predictions of half-lives for unknown neutron deficient actinide isotopes.

  3. Paul Scherrer Institute Scientific Report 1999. Volume I: Particles and Matter

    Energy Technology Data Exchange (ETDEWEB)

    Gobrecht, J.; Gaeggeler, H.; Herlach, D.; Junker, K.; Kettle, P.-R.; Kubik, P.; Zehnder, A. [eds.

    2000-07-01

    lthough originally planned for fundamental research in nuclear physics, the particle beams of pions, muons, protons and neutrons are now used in a large variety of disciplines in both natural science and medicine. The beams at PSI have the world's highest intensities and therefore allow certain experiments to be performed, which would not be possible elsewhere. The highlight of research this year was the first-ever determination of the chemical properties of the superheavy element {sup 107} Bohrium. This was undertaken, by an international team led by H. Gaeggeler of PSI's Laboratory for Radiochemistry. Bohrium was produced by bombarding a Berkelium target with Neon ions from the Injector I cyclotron and six atoms were detected after having passed through an online gas chromatography device. At the Laboratory for Particle Physics the focus has shifted from nuclear physics to elementary particle physics with about a fifty-fifty split between investigations of rare processes or particle decays using the high intensity muon, pion and recently also polarized neutron beams of PSI, and research at the highest energy frontier at CERN (Geneva) and DESY (Hamburg). Important space instrumentation has been contributed by the Laboratory for Astrophysics to the European Space Agency and NASA satellite programmes. The Laboratory for Micro and Nanotechnology continued to focus on research into molecular nanotechnology and SiGeC nanostructures, the latter with the aim of producing silicon based optoelectronics. Progress in 1999 in these topical areas is described in this report. A list of scientific publications in 1999 is also provided.

  4. Construction of attenuated Salmonella typhimurium Strain expressing Helicobacter pylori conservative region of adhesin antigen and its immunogenicity

    Institute of Scientific and Technical Information of China (English)

    Yang Bai; Ya-Li Zhang; Ji-De Wang; Zhao-Shan Zhang; Dian-Yuan Zhou

    2004-01-01

    AIM: To construct a non-resistant and attenuated Salmonella typhimurium (S. typhimurium) strain which expresses conservative region of adhesion AB of Helicobacter pylori (H pylori) and evaluate its immunogenicity.METHODS: The AB gene amplified by PCR was inserted into the expression vector pYA248 containing asd gene and through two transformations introduced into the delta Cya, delta Crp, delta Asd attenuated Salmonella typhimurium strain, constructing balanced lethal attenuated Salmonella typhimurium strains X4072 (pYA248-AB). Bridged ELISA method was used to measure the expression of AB antigen in sonic ate and culture supernatant. According to the method described by Meacock, stability of the recombinant was evaluated. Semi-lethal capacity test was used to evaluate the safety of recombinant. The immunogenicity of recombinant was evaluated with animal experiments.RESULTS: The attenuated S. typhimurium X4072 (pYA248-AB) which expresses AB was successfully constructed.Furthermore, bridged ELISA assay showed that the content of AB in recombinant X4072 (pYA248- AB) culture supematant was higher than that was in thallus lyric liquor. And after recombinant X4072 (pYA248- AB) was cultured for 100generations without selection pressure, the entire recombinant bacteria selected randomly could grow, and the AB antigen was defected positive by ELISA. The growth curve of the recombinant bacteria showed that the growth states of X4072 (pYA248) and X4072 (pYA248-AB) were basically consistent. The survival rate of C57BL/6 was still 100%, at 30 d after mice taking X4072 (pYA248-AB) 1.0×1010 cfu orally. Oral immunization of mice with X4072 (pYA248-AB)induced a specific immune response.CONCLUSION: In vitro recombinant plasmid appears to be stable and experiments on animals showed that the recombinant strains were safe and immunogenic in vitro,which providing a new live oral vaccine candidate for protection and care of H pylori infection.

  5. Star formation in infrared bright and infrared faint starburst interacting galaxies

    Science.gov (United States)

    Lamb, Susan A.; Bushouse, Howard A.; Towns, John W.

    1990-01-01

    Short wavelength IUE spectra of Arp 248b and UGC 8315N are combined with optical spectra and interpreted using a combination of spectrum synthesis and spectral diagnostics to place constraints on the massive star populations of the central regions of these galaxies and to deduce information about the star formation histories in the last 10(exp 8) years. The authors find that both galaxies have substantial fractions of their optical light coming from massive stars and that Arp 248b may be dominated in the UV by WR stars. The UV spectra are dominated by radiation from evolved massive stars and the authors place and age on the burst in Arp 248b of a few tens of millions of years.

  6. Mass-screening techniques for early selection of banana and plantain crops resistant to major diseases and pests

    International Nuclear Information System (INIS)

    Different in vitro selection techniques that are used for selecting banana and plantain plants resistant to diseases and pests are discussed in this chapter with a focus on Black sigatoka disease. Explants that are suitable for in vitro selection include shoot meristems, micro-cross sections, callus, cell suspension and protoplasts. A double selection system using the crude filtrate and the purified host-specific toxin 2,4,8-trihydroxytetralone (2,4,8-THT) is described. The optimum concentration of the host-specific toxin 2,4,8-THT and the non-host-specific toxin juglone used for selection and the mode of action of the purified toxins are also shown. A combination of mutation induction and effective selection methods appears to be the most effective strategy to improve tolerance to diseases in banana and plantains. (author)

  7. Molecular manipulation and modification of the genes encoding the G2 and G4 glycinin subunits

    Directory of Open Access Journals (Sweden)

    Reda H. Sammour

    2006-01-01

    Full Text Available The genes encoding the glycinin subunits G2 and G4 were molecularly manipulated and modified to test the possibility of increasing the nutritional value of soybean seed proteins. The recombinant DNAs pSP65/G2HG4, pSP65/G4HG2, pSP65/248 Metl, pSP65/248 Met2,3 and pSP65/248 Metl.2,3 were used in in vitro translation to produce (i chimeric proteins consisting of reciprocally exchanged acidic and basic G2 and G4 domains and (ii Gy4 point mutants with an increased number of methionine residues. The ability of the recombinant proteins to assemble into proper quaternary structures was investigated using sucrose gradient fractionation. The data produced by this study could provide valuable clues for the potential improvement of genetically modified crops.

  8. Application of high-refractive index fluid to KrF-immersion lithography

    Science.gov (United States)

    Yada, Yuji; Ito, Koji; Yamaguchi, Yoshikazu; Furukawa, Taiichi; Miyamatsu, Takashi; Wang, Yong; Hieda, Katsuhiko; Shimokawa, Tsutomu

    2006-03-01

    This paper describes the material characteristics for KrF-immersion lithography with a high refractive index fluid. We have obtained promising results in soaking experiments involving KrF lithography without topcoat film. Although water is currently used as the immersion fluid in 193nm lithography, providing suitable refractive index (n=1.44@193nm and n=1.37@248nm) and transmittance (>99%/mm), it is found to have leaching issues when used with KrF resist. On the other hand, our high refractive index fluid (JSR-HIL-001), which was developed for ArF immersion purposes, satisfies the following requirements: HIL-001 has indicated promising characteristics as a 248nm-immmersion fluid. The refractive index is 1.54@248nm and the transmittance is >99%/mm. In this paper the physical and chemical properties of HIL-001 for KrF-immersion fluid application are discussed in detail.

  9. Erythrobacter pelagi sp. nov., a member of the family Erythrobacteraceae isolated from the Red Sea

    KAUST Repository

    Wu, H.-x.

    2011-08-05

    A novel Gram-negative, aerobic, catalase- and oxidase-positive, non-sporulating, non-motile, rod-shaped bacterium, designated strain UST081027-248(T), was isolated from seawater of the Red Sea. Phylogenetic analysis based on 16S rRNA gene sequences showed that strain UST081027-248(T) fell within the genus Erythrobacter. Levels of 16S rRNA gene sequence similarity between the novel strain and the type strains of Erythrobacter species ranged from 95.3% (with Erythrobacter gangjinensis) to 98.2% (with Erythrobacter citreus). However, levels of DNA-DNA relatedness between strain UST081027-248(T) and the type strains of closely related species were below 70%. Optimal growth of the isolate occurred in the presence of 2.0% NaCl, at pH 8.0-9.0 and at 28-36 degrees C. The isolate did not produce bacteriochlorophyll a. The predominant cellular fatty acids were C-17:1 omega 6c, summed feature 8 (C-18:1 omega 6c and/or C-18:1 omega 7c) and C-15:0 2-OH. The genomic DNA G+C content of strain UST081027-248(T) was 60.4 mol%. Phenotypic properties and phylogenetic distinctiveness clearly indicated that strain UST081027-248(T) represents a novel species of the genus Erythrobacter, for which the name Erythrobacter pelagi sp. nov. is proposed. The type strain is UST081027-248(T) (=JCM 17468(T)=NRRL 59511(T)).

  10. 比值-导数光谱法快速测定香草醛%Rapidly Determination of Vanillin by Ratio-derivative Spectrophotometry

    Institute of Scientific and Technical Information of China (English)

    姚丽平; 陈元彩

    2013-01-01

    文章用比值-导数光谱法测定香草醛的含量.实验结果表明,香草醛木素溶液在pH≤7时香草醛在230 nm处有吸收,在pH>7时在248 nm处有吸收.根据不同pH值和不同浓度条件下香草醛木素溶液的比值-导数光谱,说明在230 nm处的光谱信号在pH≤7不受pH值影响,248 nm处的光谱信号在pH>7不受pH值影响.在230 nm和248 nm处的光谱信号对浓度的变化较为敏感,在此两处吸收值可用于香草醛的测定.%Ratio-derivative spectrometry was used for determination of vanillin content. Analysis results indicated that when pH ≤7 vanillin lignin has absorption at 230 nm and when pH>7 vanillin lignin has absorption at 248 nm. Ratio derivative spectrum of vanillin under different pH and different concentrations indicated that when pH ≤ 7 the spectrum at 230 nm would not suffer from pH effect, when pH>7 the spectrum at 248 nm would not suffer from pH effect. The signals at 230 nm and 248 nm in the spectrum are more sensitive to the change of concentrations, thus the two values can be used for the determination of absorption.

  11. Early psychiatrics symptoms in familial Alzheimer's disease with presenilin 1 mutation (I83T).

    Science.gov (United States)

    Fray, Saloua; Ali, Nadia Ben; Rassas, Afef Achouri; Kechaou, Meriem; Oudiaa, Nouria; Cherif, Aroua; Echebbi, Slim; Messaoud, Taieb; Belal, Samir

    2016-04-01

    Several clinical phenotypes were associated with presenilin 1 (PSEN1) mutation in early-onset familial Alzheimer's disease (EOFAD). We report the clinical phenotype of two members of a familial dementia kindred who presented with EOFAD and early psychiatric syndrome as behavioral abnormalities. Sequence analysis of the index patient and his brother's PSEN1 transcript revealed a novel T > C transition in exon 4 which was determined as a missense substitution at position 248 of the coding sequence (cDNA. 248T > C). PMID:26695639

  12. AcEST: DK956868 [AcEST

    Lifescience Database Archive (English)

    Full Text Available TST39A01NGRL0026_N23 491 Adiantum capillus-veneris mRNA. clone: TST39A01NGRL0026_N23. 5' end seq ... s = 38/64 (59%) Frame = +3 Query: 69 NLPSWALKKLDQGMLMDI MDKRLYLNGFDEVQVQRLLYIAFWCIHEDPAMRPHAATVMQW 248 NL W ... ps = 2/75 (2%) Frame = +3 Query: 66 SNLPSWALKKLDQGMLMDI MDKRLYLNGFDEVQVQRLLYIAFWCIHEDPAMRPHAATVMQ 245 SNL + ... aps = 2/80 (2%) Frame = +3 Query: 69 NLPSWALKKLDQGMLMDI MDKRLYLNGFDEVQVQRLLYIAFWCIHEDPAMRPHAATVMQW 248 NL + ... ps = 2/75 (2%) Frame = +3 Query: 66 SNLPSWALKKLDQGMLMDI MDKRLYLNGFDEVQVQRLLYIAFWCIHEDPAMRPHAATVMQ 245 SNL + ...

  13. Photophysical and photochemical processes of riboflavin (vi-tamin B2) by means of the transient absorption spectra in aqueous solution

    Institute of Scientific and Technical Information of China (English)

    2001-01-01

    Using time-resolved techniques of 337 and 248 nm laser flashphotolysis, the photophysical and photochemical processes of riboflavin (RF, vitamin B2) were studied in detail in aqueous solution. The excited triplet state of riboflavin (3RF*) was produced with 337 nm laser, while under 248 nm irradiation, both 3RF* and hydrated electron () formed from photoionization could be detected. Photobiological implications have been inferred on the basis of reactivity of 3RF* including energy transfer, electron transfer and hydrogen abstraction. The RF·+ was gene- rated by oxidation of SO4·- radical with the aim of confirming the results of photolysis

  14. PCR-SSP法用于Dombrock血型Doa/Dob的基因分型%Study on dombrock blood group Doa and Dob genotyping by PCR-SSP technique

    Institute of Scientific and Technical Information of China (English)

    刘衍春; 许剑锋; 吴敏慧

    2009-01-01

    目的:了解Dombrock血型Doa和Dob基因在汉族人群中的分布.方法:采用PCR-SSP技术对Dombrock血型进行Doa和Dob基因分型.结果:248例Dombrock血型Doa的基因频率为0.0867,Dob的基因频率为0.9133.结论:248例Dombroek血型Doa及Dob的基因频率分别为0.0867和0.9133.PCR-SSP技术可以较好的对Dombrock血型进行DO基因分型.

  15. Moods Modelling on the Financial Markets

    Czech Academy of Sciences Publication Activity Database

    Vácha, Lukáš; Vošvrda, Miloslav

    Ostrava : Technical University of Ostrava, 2007, s. 1-7. ISBN 978-80-248-1457-5; ISBN 978-80-248-1458-2. [Mathematical Methods in Economics. Ostrava (CZ), 04.09.2007-06.09.2007] R&D Projects: GA ČR GD402/03/H057; GA ČR(CZ) GA402/06/1417 Institutional research plan: CEZ:AV0Z10750506 Keywords : efficient market s hypothesis * fractal market hypothesis * mood on the financial market Subject RIV: AH - Economics

  16. Drug: D00592 [KEGG MEDICUS

    Lifescience Database Archive (English)

    Full Text Available I-ACNE PREPARATIONS D10A ANTI-ACNE PREPARATIONS FOR TOPICAL USE D10AX Other anti-acne preparations for topic...s Dapsone D00592 Diaphenylsulfone (JAN); Dapsone (USP) Antiinfectives [BR:br08307] Antibacterials Folic acid biosynt...bacterial [leprostatic]; Suppressant [dermatitis herpetiformis] [DS:H00344] Same as: C07666 Therapeuti... Diaphenylsulfone (JAN); Dapsone (USP) USP drug classification [BR:br08302] Antimycobacterials Anti...D00592 Drug Diaphenylsulfone (JAN); Dapsone (USP); Aczone (TN) C12H12N2O2S 248.0619 248.3009 D00592.gif Anti

  17. Lack of Association between the Serotonin Transporter (5-HTT) and Serotonin Receptor (5-HT2A) Gene Polymorphisms with Smoking Behavior among Malaysian Malays

    OpenAIRE

    Rozak, Nur Iwani A; Ahmad, Imran; Gan, Siew Hua; Abu Bakar, Ruzilawati

    2014-01-01

    Abstract An insertion/deletion polymorphism in the promoter region of the serotonin transporter gene (5-HTTLPR) and a polymorphism (rs6313) in the serotonin 2A receptor gene (5-HT2A) have previously been linked to smoking behavior. The objective of this study was to determine the possible association of the 5-HTTLPR and 5-HT2A gene polymorphisms with smoking behavior within a population of Malaysian male smokers (n=248) and non-smokers (n=248). The 5-HTTLPR genotypes were determined using the...

  18. 基于NGN的VOIP系统的性能和安全分析

    Institute of Scientific and Technical Information of China (English)

    尤晓波

    2007-01-01

    本文首先介绍了NGN框架及其分层结构.VOIP网络结构及四种主要的VOIP实现技术:H.323.SIP.MGCP和H.248.然后分析和比较它们的优缺点.着重谈论了当前VOIP市场上的热点MGCP技术.从VOIP网络的安全性问题和QoS上考虑.提出H.248/MEGACO则是将来VOIP广泛接受的标准协议.

  19. GETDB: 103670 [GETDB

    Lifescience Database Archive (English)

    Full Text Available 103670 Link to Original y[*] w[*] P{GawB}NP0600 / FM7c 8F1 Link to DGRC Genome Viewer: 10367...e of Genetics. FM7c Link to clone table - 2 248 Link to cluster table 248 1 Request - sg - sg - - - - - - - - Show 10367...0 DGRC Number 103670 Link to Original Genotype y[*] w[*] P{GawB}NP060...0 / FM7c Insertion Site 8F1 Map Viewer Link to DGRC Genome Viewer: 103670 Related Genes CG3003 CG3099 Origin

  20. Half a century of succession in a temperate oakwood: from species-rich community to mesic forest

    Czech Academy of Sciences Publication Activity Database

    Hédl, Radim; Kopecký, M.; Komárek, J.

    2010-01-01

    Roč. 16, č. 2 (2010), s. 267-276. ISSN 1366-9516 R&D Projects: GA AV ČR IAA600050812; GA ČR GD206/08/H049 Institutional research plan: CEZ:AV0Z60050516 Keywords : homogenization * long-term change * biodiversity loss Subject RIV: EF - Botanics Impact factor: 4.248, year: 2010

  1. Estrogenic activity in extracts and exudates of cyanobacteria and green algae

    Czech Academy of Sciences Publication Activity Database

    Sychrová, E.; Štěpánkdová, T.; Nováková, K.; Bláha, Luděk; Giesy, J.P.; Hilscherová, K.

    2012-01-01

    Roč. 39, č. 1 (2012), s. 134-140. ISSN 0160-4120 R&D Projects: GA ČR GA524/08/0496 Institutional support: RVO:67985939 Keywords : cyanobacteria * endocrine disruption * estrogenicity * algae * phytoplankton Subject RIV: EF - Botanics Impact factor: 6.248, year: 2012

  2. Sbírka rukopisných zlomků ve Státním okresním archivu v Kutné Hoře

    Czech Academy of Sciences Publication Activity Database

    Brodský, Pavel; Hradilová, Marta; Hrdinová, Martina; Petr, Stanislav; Tošnerová, Marie

    2013-01-01

    Roč. 43, č. 0 (2013), s. 207-248. ISSN 0585-5691 R&D Projects: GA ČR GAP405/10/0027 Institutional support: RVO:67985921 Keywords : codicology * manuscripts fragments * Státní okresní archiv Kutná Hora Subject RIV: AB - History

  3. Dicty_cDB: Contig-U12608-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ore = 216 bits (109), Expect = 1e-56 Identities = 248/253 (98%) Strand = Plus / Plus Query: 4 aaaatgctncgagcatgncccagtnaaccnagctaaccn...||||||||||||||||||||||||||||| Sbjct: 4 aaaatgctncgagcatgncccagtnaaccnagctaaccnanaacctgaaagnattgnatt 63 Query...atgatggcgataaaaanananaggatcnaaaatcnactgcttcaaccccccnaggcna 183 ||||||||||||||||||...|||||||||||||||||||||||||||||||||||||||||| Sbjct: 124 ttatgatggcgataaaaanananaggatcnaaaatcnactgcttcaaccccccna...xpect = 2e-05 Identities = 83/105 (79%) Strand = Plus / Plus Query: 150 atcnaaaatcnactgcttcaaccccccnaggcnang

  4. Foreign Science and Engineering Students in the United States. InfoBrief. NSF 10-324

    Science.gov (United States)

    Burrelli, Joan

    2010-01-01

    In 2008, about 568,000 foreign students (those holding temporary visas) studied at U.S. universities and colleges, 248,000 of them in science and engineering (S&E). There was an expectation that fall 2009 foreign enrollments might be negatively affected by the 2008-09 world financial crisis because of schools' restrictions on enrollment, declines…

  5. Functioning of 7-Year-Old Children Born at 32 to 35 Weeks' Gestational Age

    NARCIS (Netherlands)

    Cserjesi, R.; Van Braeckel, K.N.J.A.; Butcher, P.R.; Kerstjens, J.M.; Reijneveld, S.A.; Bouma, A.; Geuze, R.H.; Bos, A.F.

    2012-01-01

    OBJECTIVE: To compare neuropsychological functions in moderately preterm (32-35 weeks' gestation) and full-term children at the age of 7 years and identify gender differences. METHODS: Community-based prospective cohort study of 248 moderately preterm children (138 boys) and 130 full-term children (

  6. Microgrid Control Techniques at Power Converter Level

    Czech Academy of Sciences Publication Activity Database

    Valouch, Viktor; Šimek, Petr; Škramlík, Jiří; Tlustý, J.

    Ostrava: VŠB - TU Ostrava, 2013, s. 611-616. ISBN 978-80-248-2988-3. [Electric Power Engineering - EPE 2013. Kouty nad Desnou (CZ), 28.05.2013-30.05.2013] Institutional support: RVO:61388998 Keywords : microgrid * power converter * droop control Subject RIV: JA - Electronics ; Optoelectronics, Electrical Engineering

  7. Equilibrium constant for aqueous mono fluoro complex of Am(III) by solvent extraction and ion exchange

    International Nuclear Information System (INIS)

    Stability constant of Am(III)-F has been measured by distribution method using two extractants and two cation exchangers. Distribution ratios were measured by counting γ activity from 241Am and the equilibrium free fluoride by ion selective potentiometry. The value of log β1 is 2.48 ± 0.02. (author). 5 refs., 1 tab

  8. Cognitive Ability and the Instructional Efficacy of Collaborative Concept Mapping

    Science.gov (United States)

    Haugwitz, Marion; Nesbit, John C.; Sandmann, Angela

    2010-01-01

    Data were gathered from 248 secondary students (14 years old, 56% female) who learned about the circulatory system in 77 self-selected collaborative groups. The learning outcomes of biology students who summarised by collaborative concept mapping were compared with those of students who summarised by collaborative writing. Learning groups randomly…

  9. New ideas in technology for desulphatation

    Czech Academy of Sciences Publication Activity Database

    Ďurďová, Libuše

    Ostrava: VŠB-TU, 2006 - (Fečko, P.; Čablík, V.), s. 229-234 ISBN 80-248-1214-2. [Recyklace odpadů /10./. Ostrava (CZ), 03.11.2006] Institutional research plan: CEZ:AV0Z20600510 Keywords : AMD * desulphatation * organic substrate * biotechnologies * barriers * in situ application Subject RIV: DA - Hydrology ; Limnology

  10. Drug: D04893 [KEGG MEDICUS

    Lifescience Database Archive (English)

    Full Text Available D04893 Drug Mefenorex hydrochloride (USAN) C12H18ClN. HCl 247.0895 248.192 D04893.gif Anorexic A ... AND METABOLISM A08 ANTIOBESITY PREPARATIONS, EXCL. DIET ... PRODUCTS A08A ANTIOBESITY PREPARATIONS, EXCL. DIET ...

  11. WO.sub.3./sub.-doped zinc borophosphate glasses

    Czech Academy of Sciences Publication Activity Database

    Šubčík, J.; Koudelka, L.; Mošner, P.; Gregora, Ivan; Montagne, L.; Revel, B.

    2009-01-01

    Roč. 50, č. 4 (2009), 243-248. ISSN 1753-3562 R&D Projects: GA AV ČR KAN301370701 Institutional research plan: CEZ:AV0Z10100520 Keywords : tungstate zinc borophosphate glasses * Raman spectroscopy * temperature * NMR Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 0.553, year: 2009

  12. Biodiversity of traits and species both show weak responses to hydromorphological alteration in lowland river macroinvertebrates

    Czech Academy of Sciences Publication Activity Database

    Feld, Ch. K.; de Bello, Francesco; Dolédec, S.

    2014-01-01

    Roč. 59, č. 2 (2014), s. 233-248. ISSN 0046-5070 R&D Projects: GA ČR GAP505/12/1296 Institutional support: RVO:67985939 Keywords : taxonomic distinctness * taxonomic diversity * trait diversity Subject RIV: EH - Ecology, Behaviour Impact factor: 2.738, year: 2014

  13. QTL Information Table: 679 [Q-TARO

    Lifescience Database Archive (English)

    Full Text Available hi7b Morphological trait Seed harvest index SSR C)Interval RIL Dasanbyeo TR22183 A RM420 RM248 p ... ion of QTLs associated with physiological nitrogen use ... efficiency in rice. Mol Cells 23, 72-79. ...

  14. The effect of immobilization/mobilization processes on the temperature onset of a catalyst bed production studied with ethylene oligomerization on HZSM-5 zeolites

    Czech Academy of Sciences Publication Activity Database

    Zikánová, Arlette; Derewinski, M.; Sarv, P.; Hudec, P.; Hrabánek, Pavel; Kočiřík, Milan

    2006-01-01

    Roč. 114, 2-3 (2006), s. 248-256. ISSN 0920-5861 R&D Projects: GA AV ČR IAA400400501 Institutional research plan: CEZ:AV0Z40400503 Keywords : HZSM-5 * ethylene * oligomeration * sorption and reaction dynamics Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 2.148, year: 2006

  15. Measurement of alcohol hangover severity : development of the Alcohol Hangover Severity Scale (AHSS)

    NARCIS (Netherlands)

    Penning, Renske; McKinney, Adele; Bus, Lucien D.; Olivier, Berend; Slot, Karin; Verster, Joris C.

    2013-01-01

    This study aims to develop a new alcohol hangover symptom severity scale and compare its effectiveness with the Hangover Symptoms Scale (HSS), the Acute Hangover Scale (AHS), and a one-item hangover score. Data from 1,410 Dutch students (Penning et al., Alcohol Alcohol 47:248-252, 2012) on the sever

  16. Východiskové tézy k problematike slovensko-českej vzájomnosti a nevzájomnosti

    Czech Academy of Sciences Publication Activity Database

    Zelenková, Anna

    Brno: Masarykova univerzita, 2008 - (Pospíšil, I.), s. 241-248 ISBN 978-80-210-4545-3 R&D Projects: GA AV ČR IAA900920702 Institutional research plan: CEZ:AV0Z90920516 Keywords : Czech-Slovak relations * Czech-Slovak mutuality and non mutuality * methodology of research Subject RIV: AJ - Letters, Mass-media, Audiovision

  17. Ambient nitrogen oxides exposure and early childhood respiratory illnesses

    Czech Academy of Sciences Publication Activity Database

    Ghosh, R.; Joad, J.; Beneš, I.; Dostál, Miroslav; Šrám, Radim; Hertz-Picciotto, I.

    2012-01-01

    Roč. 39, č. 1 (2012), s. 96-102. ISSN 0160-4120 R&D Projects: GA MŽP(CZ) SP/1B3/50/07 Institutional research plan: CEZ:AV0Z50390703 Keywords : air pollution * bronchitis * croup Subject RIV: DN - Health Impact of the Environment Quality Impact factor: 6.248, year: 2012

  18. Poklesy povrchu vlivem hlubinné exploatace prvních slojí multislojového karbonského ložiska

    Czech Academy of Sciences Publication Activity Database

    Hortvík, Karel; Černý, I.

    Ostrava : VŠB-TUO, 2011, s. 65-70. ISBN 978-80-248-2489-5. [Konference SDMG /18./. Ostrava (CZ), 05.10.2012-07.10.2012] Institutional research plan: CEZ:AV0Z30860518 Keywords : surface subsidence * effects of undermining * mathematical modeling Subject RIV: DH - Mining , incl. Coal Mining

  19. Poklesy povrchu indukované exploatací uranového ložiska Rožná

    Czech Academy of Sciences Publication Activity Database

    Hortvík, Karel

    Ostrava : VŠB-TU Ostrava, 2010, s. 38-43. ISBN 978-80-248-2312-6. [Konference SDMG /17./. Hodonín (CZ), 12.10.2010-14.10.2010] Institutional research plan: CEZ:AV0Z30860518 Keywords : surface subsidence * effects of undermining * mathematical modeling Subject RIV: DH - Mining , incl. Coal Mining

  20. Drug: D04462 [KEGG MEDICUS

    Lifescience Database Archive (English)

    Full Text Available of drugs in Japan [BR:br08301] 2 Agents affecting individual organs 24 Hormones 248 Mixed hormone preparation...orethisterone - mestranol mixt G03FB Progestogens and estrogens, sequential preparations G03FB05 Norethisterone and estrogen D04462 Norethisterone - mestranol mixt PubChem: 17398115 ...

  1. 7 CFR 900.101 - Definitions.

    Science.gov (United States)

    2010-01-01

    ... Regulations of the Department of Agriculture (Continued) AGRICULTURAL MARKETING SERVICE (Marketing Agreements... Agricultural Marketing Agreement Act of 1937, as amended (50 Stat. 248, as amended; 7 U.S.C. 671); (b) The term... Administrator of the Agricultural Marketing Service, with power to redelegate, or any officer or employee of...

  2. Exprese jako vtiskování signatury

    Czech Academy of Sciences Publication Activity Database

    Chrz, Vladimír

    Praha : Karolinum, 2013 - (Slavík, J.; Chrz, V.; Štech, S.), s. 223-248 ISBN 9788024623351 R&D Projects: GA ČR(CZ) GAP407/12/2432 Institutional support: RVO:68081740 Keywords : metaphorical exemplification * imprinting * signature * configuration * meaning Subject RIV: AN - Psychology

  3. Dependence of carbon dioxide sorption on the petrographic composition of bituminous coals from the Czech part of the Upper Silesian Basin, Czech Republic

    Czech Academy of Sciences Publication Activity Database

    Weishauptová, Zuzana; Sýkorová, Ivana

    2011-01-01

    Roč. 90, č. 1 (2011), s. 312-323. ISSN 0016-2361 R&D Projects: GA ČR GA106/08/1146; GA AV ČR IAA300460804 Institutional research plan: CEZ:AV0Z30460519 Keywords : bituminous coal * sorption capacity * maceral composition Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 3.248, year: 2011

  4. Social Factors Determining the Experience of Blindness among Pregnant Women in Developing Countries: The Case of India

    Science.gov (United States)

    Pandey, Shanta; Lin, Yuan; Collier-Tenison, Shannon; Bodden, Jamie

    2012-01-01

    Approximately 10 million pregnant women around the world develop night blindness annually. In India, one in 11 pregnant women suffers from night blindness. This study used a nationally representative sample of 35,248 women from India between the ages of 15 and 49 who had given birth in the past five years to understand the effect of women's…

  5. Climate reconstruction from subsurface temperatures demonstrated on example of Cuba

    Czech Academy of Sciences Publication Activity Database

    Čermák, Vladimír; Bodri, L.

    2001-01-01

    Roč. 126, 3/4 (2001), s. 295-310. ISSN 0031-9201 Institutional research plan: CEZ:AV0Z3012916 Keywords : climate change * recent warming * borehole temperatures * inversion technique Subject RIV: DC - Siesmology, Volcanology, Earth Structure Impact factor: 1.248, year: 2001

  6. Effect of Welding Mateial on Mechanical Working Properity of Gay Cast-iron by Cold Arc Welding%灰铸铁电弧冷焊时焊材对加工性能的影响

    Institute of Scientific and Technical Information of China (English)

    李日娟

    2011-01-01

    采用Z208、Z248、Z308、Z116四种焊条对灰铸铁进行电弧冷焊试验,对比了焊缝组织、半熔化区白口硬度及宽度,并从焊接冶金角度作出分析.结果表明:Z208 、Z248所焊焊缝同母材一样为灰铸铁,Z208因白口宽度大不能进行后续机加工;Z308、Z116所焊焊缝与母材异质,Z308几乎无白口,具有优良的加工性能.%The welding tests on Gay cast-iron were made with four kinds of electrode by cold arc welding(Z208 Z248 Z308 Zl 16), metallographic microstructure, the width and microhardness of the partial fusion were compared in welding metallurgy. The results show that the welded joint by Z208 and Z248 is same with base metal, the welded joint by Z208 are not matched; the welded joint by Z308 and Zl 16 is not same with the base metal, but the machining property is better.

  7. Productions and decay studies of transactinide elements for superheavy element chemistry

    International Nuclear Information System (INIS)

    We developed a gas-jet transport system coupled to the GAs-filled Recoil Ion Separator GARIS at the RIKEN Linear Accelerator as a novel technique for superheavy element (SHE) chemistry. The isotopes of 261Rf (atomic number Z = 104), 262Db (Z = 105), and 265Sg (Z = 106) useful for chemistry studies were produced in the 248Cm(18O,5n), 248Cm(19F,5n), and 248Cm(22Ne,5n) reactions, respectively, and they were extracted to a chemistry laboratory by the gas-jet method after the separation by GARIS (1-4). The production and decay properties of those isotopes were investigated in detail for future chemistry studies using a rotating wheel apparatus for α and SF spectrometry. Recently, the chemical synthesis and gas-chromatographic analysis of the first organometallic compound of SHEs, Sg(CO)6, were successfully conducted with preseparated 265Sg. In the conference, preliminary results on the production of Bh (Z = 107) isotopes in the 248Cm(23Na,xn) reactions will also be presented. (author)

  8. Ontogenesis of the oral vestibule in the sheep (Ovis aries, Ruminantia)

    Czech Academy of Sciences Publication Activity Database

    Pavlíková, H.; Witter, K.; Míšek, Ivan

    2001-01-01

    Roč. 248, č. 3 (2001), s. 270-270. ISSN 0362-2525 R&D Projects: GA AV ČR IAA7039901; GA AV ČR KSK6005114 Keywords : striated palatal muscle Subject RIV: EG - Zoology Impact factor: 0.959, year: 2001

  9. Mootorrattad lähevad aina enam moodi / Villy Paimets

    Index Scriptorium Estoniae

    Paimets, Villy, 1972-

    2005-01-01

    Eesti Autoregistrikeskuse andmetel on 2005. aastal esmakordselt registrisse kantud 1076 mootorratast, millest 248 on uued. Diagrammid: Uhiuute mootorrataste esimese poolaasta müügitabelit juhib Yamaha; Yamaha esindaja käive tegi mullu suure hüppe; Esmakordselt arvele võetud mootorrataste hulk kasvab

  10. Saaremaa rannaala võib suureneda 200 meetrilt riigiteeni / Ain Lember

    Index Scriptorium Estoniae

    Lember, Ain

    2003-01-01

    Aasta lõpuks valmiva Saare maakonna rannaalade tsoneeringu ülesandeks on koostada rannaalade andmebaas, hinnata mõju keskkonnale, töötada välja metoodika rannaalade planeerimiseks. Tsoneering hõlmab asustust, kuhu jääb neli alevikku ja 248 küla 10 235 elanikuga

  11. Bending of Beam with Free Ends on Non-linear Subsoil

    Czech Academy of Sciences Publication Activity Database

    Sysala, Stanislav

    Ostrava: VŠB-TUO, 2010 - (Frydrýšek, K.), s. 1-17 ISBN 978-80-248-2256-3. [Mechanical Structures and Foundation Engineering 2010. Ostrava (CZ), 13.09.2010-13.09.2010] Institutional research plan: CEZ:AV0Z30860518 Keywords : beam on subsoil * non-linearity * semi-coercivity Subject RIV: BA - General Mathematics

  12. Dicty_cDB: VSC450 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VS (Link to library) VSC450 (Link to dictyBase) - - - Contig-U15034-1 VSC450Z (Link to Original ... rom clone 248E1 on chromosome 6q23.1-23.3 Contains DOPAMINE -BETA-MONOOXYGENASE PRECURSOR, EF-1-ALPHA-2 pseudog ...

  13. Study of the high-j states in 249Cm

    International Nuclear Information System (INIS)

    The authors have performed the reaction 248Cm(4He, 3He) using 98.5-MeV alpha particles from the IUCF cyclotron to populate high-j states in 249Cm. A tentative assignment of the K17/2 component of the 1/2+[880] Nilsson state has been made

  14. 78 FR 42544 - Outer Continental Shelf (OCS), Gulf of Mexico (GOM), Oil and Gas Lease Sale, Western Planning...

    Science.gov (United States)

    2013-07-16

    ... Bureau of Ocean Energy Management Outer Continental Shelf (OCS), Gulf of Mexico (GOM), Oil and Gas Lease Sale, Western Planning Area (WPA) Lease Sales 238, 246, and 248 MMAA104000 AGENCY: Bureau of Ocean... Supplemental EIS for proposed WPA lease sales beginning with Lease Sale 238 (WPA Lease Sales 238, 246, and...

  15. Dynamic evolution of telomeric sequences in the green algal order Chlamydomonadales

    Czech Academy of Sciences Publication Activity Database

    Fulnečková, Jana; Hasíková, T.; Fajkus, Jiří; Lukešová, Alena; Eliáš, M.; Sýkorová, Eva

    2012-01-01

    Roč. 4, č. 3 (2012), s. 248-264. ISSN 1759-6653 R&D Projects: GA ČR(CZ) GA521/09/1912 Institutional research plan: CEZ:AV0Z50040702; CEZ:AV0Z60660521 Keywords : telomere * algae * telomerase Subject RIV: BO - Biophysics; BO - Biophysics (BC-A) Impact factor: 4.759, year: 2012

  16. Scientific Investigations of Elementary School Children

    Science.gov (United States)

    Valanides, Nicos; Papageorgiou, Maria; Angeli, Charoula

    2014-01-01

    The study provides evidence concerning elementary school children's ability to conduct a scientific investigation. Two hundred and fifty sixth-grade students and 248 fourth-grade students were administered a test, and based on their performance, they were classified into high-ability and low-ability students. The sample of this study was…

  17. Parental Time Pressures and Depression among Married Dual-Earner Parents

    Science.gov (United States)

    Roxburgh, Susan

    2012-01-01

    This article examines whether there is an association between depression and parental time pressure among employed parents. Using a sample of 248 full-time employed parents and using the stress process framework, I also examine the extent to which gender, socioeconomic status, social support, and job conditions account for variation in the…

  18. Výchova a vzdělávání v kontextu raněobrozenské publicistiky (1786-1830)

    Czech Academy of Sciences Publication Activity Database

    Kusáková, Lenka

    Praha : Ústav pro českou literaturu AV ČR, 2004 - (Bláhová, K.; Petrbok, V.), s. 242-248 ISBN 80-85778-43-2 Institutional research plan: CEZ:AV0Z9056905 Keywords : education Subject RIV: AJ - Letters, Mass-media, Audiovision

  19. EST Table: FS935487 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available FS935487 E_FL_fwgP_43C09_F_0 10/09/28 45 %/248 aa ref|XP_001660682.1| filamin, putative [Aedes a ... gi|91079384|ref|XP_971392.1| PREDICTED: similar to jitterbug ... CG30092-PD [Tribolium castaneum] BY917108 fwgP ...

  20. Dysfunctional Relationship Beliefs in Parent-Late Adolescent Relationship and Conflict Resolution Behaviors

    Science.gov (United States)

    Hamamci, Zeynep

    2007-01-01

    The purpose of this study is to investigate the role of dysfunctional relationships beliefs on both the perceptions of their relationships with the parents and conflict resolution behaviors of late adolescence. The sample was consisted of 372 Turkish university students (248 women and 124 men). Interpersonal Cognitive Distortions Scale,…

  1. The Minipig as an Animal Model in Biomedical Stem Cell Research

    Czech Academy of Sciences Publication Activity Database

    Vodička, Petr; Hlučilová, Jana; Klíma, Jiří; Procházka, Radek; Ourednik, J.; Motlík, Jan

    Totowa, New Jersey : Humana Press, 2008 - (Conn, P.), s. 241-248 ISBN 978-1-58829-933-8. - (Medicine) R&D Projects: GA MŠk 1M0538 Institutional research plan: CEZ:AV0Z50450515 Keywords : Animal model * Minipig * Neural stem cell Subject RIV: FH - Neurology

  2. Magnetic Energy Fluctuations: Observations by Light Scattering

    Science.gov (United States)

    Lyons, K. B.; Fleury, P. A.

    1982-01-01

    The first observations of magnetic energy fluctuations by light scattering are reported. The spectra observed in antiferromagnetic KNiF3 are strongly polarized, mildly q dependent, but strongly temperature dependent near TN=248.5 K. The observed line shapes exhibit two characteristic frequencies, one less than 0.6 GHz and the other between 5 and 15 GHz, depending on temperature.

  3. QTL Information Table: 228 [Q-TARO

    Lifescience Database Archive (English)

    Full Text Available i 63 B C547 C2340 pha Xing, Z., Tan, F., Hua, P., Sun, L., Xu, G., and Zhang, Q. (2002). Characterization of the main effects..., epistatic effects and their environmental interactions of QTLs on the genetic basis of yield traits in rice. Theor Appl Genet 105, 248-257. ...

  4. Vizuální kultura: mezi lokálním a globálním pohledem

    Czech Academy of Sciences Publication Activity Database

    Kreuzzieger, Milan

    Dolní Břežany : Scriptorium, 2007 - (Prahl, R.; Winter, T.), 23-27, 248-249 ISBN 978-80-86197-89-0 Institutional research plan: CEZ:AV0Z90090514 Keywords : global isation * visual culture * history of art Subject RIV: AA - Philosophy ; Religion

  5. Diagnosing Students' Misconceptions in Number Sense via a Web-Based Two-Tier Test

    Science.gov (United States)

    Lin, Yung-Chi; Yang, Der-Ching; Li, Mao-Neng

    2016-01-01

    A web-based two-tier test (WTTT-NS) which combined the advantages of traditional written tests and interviews in assessing number sense was developed and applied to assess students' answers and reasons for the questions. In addition, students' major misconceptions can be detected. A total of 1,248 sixth graders in Taiwan were selected to…

  6. Banking sector in new EU members: a sectoral financial flows analysis

    Czech Academy of Sciences Publication Activity Database

    Hanousek, Jan; Kočenda, Evžen; Ondko, Peter

    Ostrava: VŠB - Technical University of Ostrava, 2007, s. 1-8. ISBN 978-80-248-1457-5. [Mathematical Methods in Economics. Ostrava (CZ), 04.09.2007-06.09.2007] R&D Projects: GA ČR GA402/06/1293 Institutional research plan: CEZ:MSM0021620846 Keywords : banking * financial intermediation * emerging markets Subject RIV: AH - Economics

  7. Voltammetry in Analysis of Biological Materials

    Czech Academy of Sciences Publication Activity Database

    Navrátil, Tomáš; Říčařová, B.; Šenholdová, Z.

    1. Jalgaon: Society for Science and Environment, 2009 - (Vojtisek, M.; Prakash, R.), s. 171-248 ISBN 81-85543-09-7 R&D Projects: GA ČR GA203/07/1195 Institutional research plan: CEZ:AV0Z40400503 Keywords : polarography * voltammetry * stripping voltammetry * electrodes Subject RIV: CG - Electrochemistry

  8. First-Year Male Students' Perceptions of a Rape Prevention Program 7 Months after Their Participation: Attitude and Behavior Changes

    Science.gov (United States)

    Foubert, John D.; Tatum, Jerry L.; Godin, Eric E.

    2010-01-01

    Seven months after seeing The Men's Program, a commonly used rape prevention program, 248 first-year college men responded to four open-ended questions concerning whether or not the program impacted their attitudes or behavior, particularly regarding alcohol related sexual assault. Two thirds of participants reported either attitude or behavior…

  9. K vývoji česko-bulharské a bulharsko-české lexikografie

    Czech Academy of Sciences Publication Activity Database

    Rangelova, Albena

    Bratislava : Veda, 2009 - (Šimková, M.), s. 235-248 ISBN 978-80-224-1107-3. [Slovo – Tvorba – Dynamickosť. Modra (SK), 11.03.2009-12.03.2009] Institutional research plan: CEZ:AV0Z90610521 Keywords : bilingual lexicography * Czech * Bulgarian Subject RIV: AI - Linguistics

  10. 77 FR 73558 - Sex Offender Registration Amendments

    Science.gov (United States)

    2012-12-11

    ... of the Adam Walsh Child Protection and Safety Act of 2006, (Pub. L. 109-248), requires a sex offender... SUPERVISION AGENCY FOR THE DISTRICT OF COLUMBIA 28 CFR Part 811 RIN 3225-AA10 Sex Offender Registration... requirements relating to periodic verification of registration information for sex offenders. The proposed...

  11. On periodic solutions of second-order differential equations with attractive-repulsive singularities

    Czech Academy of Sciences Publication Activity Database

    Hakl, Robert; Torres, P.J.

    2010-01-01

    Roč. 248, č. 1 (2010), s. 111-126. ISSN 0022-0396 Institutional research plan: CEZ:AV0Z10190503 Keywords : second - order ordinary differential equation * singular equation * periodic solution * positive solution Subject RIV: BA - General Mathematics Impact factor: 1.261, year: 2010 http://www.sciencedirect.com/science/article/pii/S002203960900271X

  12. 结直肠癌患者淋巴结检查数和淋巴结转移度的临床意义%Prognosis of Patients for Colorectal Cancer with Lymph Node Ratio and Number of Lymph Nodes // Reviewer:

    Institute of Scientific and Technical Information of China (English)

    潘志忠; 张华

    2009-01-01

    @@ 1 文献来源 Rosenberg R, Friederichs J, Schuster T, et al. Prognosis of patients with colorectal cancer is associated with lymph node ratio A single-center analysis of 3 026 patients over a 25-year time period [J]. Ann Surg, 2008,12(6):248:968-978.

  13. Disagreement between skin prick test and specific IgE in young children

    DEFF Research Database (Denmark)

    Schoos, Ann-Marie Malby; Chawes, BLK; Følsgaard, N V;

    2015-01-01

    points was analyzed using kappa statistics. RESULTS: The prevalence of inhalant allergen sensitization increased during childhood diagnosed by both sIgE levels (0.6% to 4.2% to 18.1% to 24.8%, P contrast, the prevalence of food...

  14. Pulmonary hemorrhage complicating radiofrequency ablation, from mild hemoptysis to life-threatening pattern

    Energy Technology Data Exchange (ETDEWEB)

    Nour-Eldin, Nour-Eldin A.; Naguib, Nagy N.N.; Mack, Martin; Abskharon, John E.; Vogl, Thomas J. [Johann Wolfgang Goethe-University Hospital, Institute for Diagnostic and Interventional Radiology, Frankfurt am Main (Germany)

    2011-01-15

    To assess risk factors and the extent of pulmonary hemorrhage complicating radiofrequency ablation (RFA) of pulmonary neoplasms. This retrospective study involved 248 ablation sessions for lung tumors (20 primary lesions and 228 metastatic lesions) in 164 patients (mean age 59.7 years, SD: 10.2). Both unipolar and bipolar radiofrequency systems were used under CT fluoroscopic guidance. Extent and underlying factors associated with development of pulmonary hemorrhage were analyzed. Incidence of intra-parenchymal pulmonary hemorrhage, pleural effusion, and hemoptysis were 17.7% (44/248 sessions), 4% (8/248 sessions), and 16.1% (40/248 sessions), respectively. Death because of massive bleeding occurred in one session (0.4%). Significant risk factors associated with intra-parenchymal hemorrhage included: lesions of <1.5 cm diameter (P = 0.007); basal and middle lung zone lesions (P = 0.026); increased needle track distance traversing the lung parenchyma >2.5 cm (P = 0.0017); traversing pulmonary vessels in the track of ablation (P < 0.001); and the use of multi-tined electrodes (P = 0.004). Concomitant incidence of pulmonary hemorrhage and pneumothorax was 29.2% (14/48 sessions). While typically safe, RFA of pulmonary neoplasms can result in pulmonary hemorrhage ranging from mild to life-threatening. Management of this complication is mainly preventive through adequate patient selection for ablation therapy and exclusion of technically avoidable risk factors. (orig.)

  15. Effect of pressure and high magnetic field on phase transitions and magnetic properties of Ni.sub.1.92./sub.Mn.sub.1.56./sub.Sn.sub.0.52./sub. and Ni.sub.2./sub.MnSn Heusler compounds

    Czech Academy of Sciences Publication Activity Database

    Kaštil, Jiří; Kamarád, Jiří; Isnard, O.; Skourski, Y.; Míšek, Martin; Arnold, Zdeněk

    2015-01-01

    Roč. 650, Nov (2015), s. 248-255. ISSN 0925-8388 R&D Projects: GA ČR GA15-03777S Institutional support: RVO:68378271 Keywords : intermetallics * crystal structure * high pressure * magnetocaloric * magentisation Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 2.999, year: 2014

  16. August Sauer und die Bohemistik

    Czech Academy of Sciences Publication Activity Database

    Petrbok, Václav

    Köln : Böhlau, 2010 - (Höhne, S.), s. 229-248 ISBN 978-3-412-20622-2 Institutional research plan: CEZ:AV0Z90560517 Keywords : German literature * Czech literary studies * Sauer, August Subject RIV: AJ - Letters, Mass-media, Audiovision

  17. Two panels of steroid receptor luciferase reporter cell lines for compound profiling

    Czech Academy of Sciences Publication Activity Database

    Sedlák, David; Paguio, A.; Bartůněk, Petr

    2011-01-01

    Roč. 14, č. 2 (2011), s. 248-266. ISSN 1386-2073 R&D Projects: GA MŠk(CZ) LC06077 Institutional research plan: CEZ:AV0Z50520514 Keywords : nuclear hormone receptor * steroid receptor * cell-based luciferase reporter assay Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 1.785, year: 2011

  18. EST Table: FS898353 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available 29 50 %/248 aa C28H8.11a#CE01822#WBGene00016201#tryptophan 2, 3- dioxygenase#status:Confirmed#UniProt:Q09474...FS898353 E_FL_ftes_30H20_R_0 11/12/09 GO hit GO:0004833(tryptophan 2,3-dioxygenase

  19. Actores protectores que favorecen la resiliencia de estudiantes para lograr su permanencia en la licenciatura en ciencias de la educacion de la UATX /

    OpenAIRE

    Velazquez Flores, Guadalupe

    2012-01-01

     tesis que para obtener el grado de Doctorado en Pedagogía, presenta Guadalupe Velazquez Flores ; tutora principal de tesis Dora Elena Marin Mendez248 páginas : ilustracionesDoctorado en Pedagogía Universidad Nacional Autónoma de México, 2012 Programa de Posgrado en Pedagogía

  20. High resolution Holocene paleomagnetic secular variation records from Bay of Bengal

    Digital Repository Service at National Institute of Oceanography (India)

    Usapkar, A.; Dewangan, P.; Badesab, F.K.; Mazumdar, A.; Ramprasad, T.; Krishna, K.S; Basavaiah, N.

    rates are recorded at MD161/8 (38.8 – 248.3 cm/kyr), MD161/11 (137-336 cm/ky) and MD161/13 (~573 cm/kyr). Rock magnetic data analysis suggests that the remanence signal is carried by titanomagnetite/ titanohematite grains in stable single domain (SSD...

  1. Reductions related with Hopf maps

    CERN Document Server

    Yeghikyan, Vahagn

    2011-01-01

    We consider the reductions of $2p$-dimensional particle system ($p=2,4,8$), associated with the Hopf map. For the third Hopf map we explicitly construct the functions associated to the symmetry related to the rotations in the fiber.

  2. Clinician’s perceptions of and emotional responses to online infidelity

    NARCIS (Netherlands)

    Dijkstra, Pieternel; de Zeeuw, Heleen; Barelds, Dick P.H.; Buunk, Abraham P.

    2015-01-01

    Aim of the present study was to examine the degree to which mental health workers perceive twelve online partner behaviors as different types of infidelity and to examine the degree to which these behaviors evoke two types of jealousy, that is, fait accompli and anxious jealousy among mental. 248 he

  3. EST Table: FY018012 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available FY018012 rbmov21c16 11/11/04 46 %/248 aa ref|XP_001606351.1| PREDICTED: similar to MGC64464 prot ... .1| PREDICTED: similar to regulator of microtubule dynamics ... 1 [Tribolium castaneum] FS783762 bmov ...

  4. Siblings of Disabled Children: Birth Order and Age-Spacing Effects.

    Science.gov (United States)

    Breslau, Naomi

    1982-01-01

    Siblings (N=237) of disabled children were compared to 248 siblings from a random family sampling to examine the effects of relative birth order and age spacing on psychological functioning. Younger males scored higher than older males on psychological impairment, while younger females were psychologically better off than older females. (CL)

  5. Isolation and genetic characterization of Toxoplasma gondii from the gray wolf Canis lupus

    Science.gov (United States)

    Little is known of the genetic diversity of Toxoplasma gondii circulating in wildlife. In the present study feral gray wolf (Canis lupus) from Minnesota were examined for T. gondii infection. Antibodies to T. gondii were detected in 130 (52.4%) of 248 wolves tested by the modified agglutination test...

  6. Optimal Mirrleesean taxation in a Ben-Porath economy

    Czech Academy of Sciences Publication Activity Database

    Kapička, Marek

    2015-01-01

    Roč. 7, č. 2 (2015), s. 219-248. ISSN 1945-7707 R&D Projects: GA ČR(CZ) GA13-29370S Institutional support: PRVOUK-P23 Keywords : optimal taxes * unobservable human capital * income taxes Subject RIV: AH - Economics Impact factor: 3.780, year: 2014

  7. 76 FR 70479 - Draft Environmental Assessment and Safe Harbor Agreement for the Houston Toad Within Nine Texas...

    Science.gov (United States)

    2011-11-14

    ... types that occur on the portion of the property to be enrolled, including ] accurate descriptions of vegetation, water features, and soil types; (4) current land use practices and existing development; and (5.... Box 1306, Albuquerque, New Mexico 87103 (505) 248-6651). SUPPLEMENTARY INFORMATION: Under a...

  8. The effect of oxfendazole treatment on muscle pathology in pigs infected with Taenia solium cysticercosis

    DEFF Research Database (Denmark)

    Iburg, Tine Moesgaard; Karlsson, Madeleine; Spång, Frederic;

    2012-01-01

    The aim of the present study was to test histopathologically the hypothesis that the time for clearing Taenia solium cysts in muscle tissue of pigs following treatment with oxfendazole is cyst density dependant. A total of 248 cyst lesions in the masseter muscle of 28 naturally infected pigs were...

  9. Experiment mimořádných měsíčních odečtů u zákazníků kategorie maloodběr a domácnost

    Czech Academy of Sciences Publication Activity Database

    Bečvář, J.; Blahová, L.; Pihera, M.; Pelikán, Emil; Brabec, Marek

    2007-01-01

    Roč. 87, - (2007), s. 248-250. ISSN 0032-1761 R&D Projects: GA AV ČR 1ET400300513 Institutional research plan: CEZ:AV0Z10300504 Keywords : spotřeba energie * matematické modelování * zemní plyn Subject RIV: IN - Informatics, Computer Science

  10. Pattern Definition with DUV-Lithography at DTU Danchip

    DEFF Research Database (Denmark)

    Keil, Matthias; Khomtchenko, Elena; Nyholt, Henrik;

    2014-01-01

    Deep ultra violet (DUV) illumination generated with the help of a KrF laser can be utilized to produce components having sizes of some hundreds of nanometers. This light source with its 248nm wavelength is exploited in the DUV-lithography equipment at DTU Danchip in order to fill the resolution gap...

  11. Leifsonia soli sp. nov., a yellow-pigmented actinobacterium isolated from teak rhizosphere soil.

    Science.gov (United States)

    Madhaiyan, Munusamy; Poonguzhali, Selvaraj; Lee, Jung-Sook; Senthilkumar, Murugaiyan; Lee, Keun Chul; Sundaram, Subbiah

    2010-06-01

    Two yellow-pigmented, Gram-stain-positive, aerobic, motile, short rod-shaped bacteria were isolated from natural teak tree rhizosphere soil and their taxonomic positions were determined by using a polyphasic approach. Comparative 16S rRNA gene sequence analysis showed that strains TG-S248(T) and TG-S240 formed a distinct phyletic line within the genus Leifsonia. 16S rRNA gene sequence analysis of strain TG-S248(T) with sequences from Leifsonia shinshuensis DB 102(T), L. poae VKM Ac-1401(T), L. naganoensis DB 103(T), L. aquatica DSM 20146(T) and L. xyli subsp. cynodontis JCM 9733(T) revealed pairwise similarities ranging from 98.7 to 99.1 %. The major fatty acids were anteiso-C(15 : 0), anteiso-C(17 : 0) and iso-C(16 : 0). The G+C content of the DNA of the type strain was 69.4 mol%. DNA-DNA hybridization experiments revealed low levels of DNA-DNA relatedness (32 % or less) between strain TG-S248(T) and its closest relatives. Based on differences in phenotypic and genotypic characteristics, strain TG-S248(T) (=LMG 24767(T) =JCM 15679(T)) is designated the type strain of a novel species of the genus Leifsonia, for which the name Leifsonia soli sp. nov. is proposed. PMID:19667370

  12. The Quality of Measures of Accessed Social Capital – Is the Resource Generator Appropriate for the Czech Context?

    Czech Academy of Sciences Publication Activity Database

    Häuberer, Julia

    Wiesbaden: VS Verlag für Sozialwissenschaften, 2011, s. 223-248 ISBN 978-3-531-17626-0 R&D Projects: GA MŠk 2D06014 Institutional research plan: CEZ:AV0Z70280505 Keywords : Resource Generator * reliability * validity Subject RIV: AO - Sociology, Demography

  13. Flow phantom for validation of absolute quantification in dynamic contrast-enhanced MRI

    Czech Academy of Sciences Publication Activity Database

    Jiřík, Radovan; Standara, M.; Malá, A.; Sedláková, S.; Bartoš, M.; Taxt, T.; Starčuk jr., Zenon

    2011-01-01

    Roč. 24, Suppl. 1 (2011), s. 247-248. ISSN 0968-5243. [ESMRMB 2011 Congress. 06.10.2011-08.10.2011, Leipzig] Institutional research plan: CEZ:AV0Z20650511 Keywords : DCE-MRI * flow phantom * perfusion analysis Subject RIV: JA - Electronics ; Optoelectronics, Electrical Engineering

  14. Supervision Practices and Teachers' Satisfaction in Public Secondary Schools: Malaysia and China

    Science.gov (United States)

    Hamzah, Mohd Izham Mohd; Wei, Yan; Ahmad, Jamil; Hamid, Aida Hanim A.; Mansor, Azlin Norhaini

    2013-01-01

    The purpose of this study is to explore supervision practices among school management teams and teachers' satisfaction in secondary schools in Kuala Lumpur, Malaysia and He Fei, China. The samples consist of 248 managers and 367 teachers in Kuala Lumpur, and 175 managers and 346 teachers in He Fei. The study indicates that the level of supervision…

  15. Morphology of nymphs of common stored-product psocids (Psocoptera, Liposcelididae)

    Czech Academy of Sciences Publication Activity Database

    Kučerová, Z.; Li, Z.; Hromádková, Jiřina

    2009-01-01

    Roč. 45, č. 1 (2009), s. 54-60. ISSN 0022-474X Institutional research plan: CEZ:AV0Z40500505 Keywords : Liposcelis * stored-product psocids * nymphs Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 1.248, year: 2009

  16. Spatial distribution of absorbed dose on the spherical phantom at Russian Service Module of ISS measured by passive detectors

    Czech Academy of Sciences Publication Activity Database

    Jadrníčková, Iva; Yasuda, N.; Kawashima, H.; Kurano, M.; Uchihori, Y.; Kitamura, H.; Akatov, YU.; Shurshakov, V.; Kobayashi, I.; Ohguchi, H.; Koguchi, Y.

    Busan : AOGS, 2008. s. 216-216. ISBN N. [Annual Meeting AOGS 2008 /5./. 16.06.2008-20.06.2008, Busan] Grant ostatní: ESA(XE) ILSRA - 2004 - 248 Institutional research plan: CEZ:AV0Z10480505 Keywords : space dosimetry * passive detectors * International space station Subject RIV: BG - Nuclear, Atomic and Molecular Physics, Colliders www.asiaoceania.org

  17. Crystallization of poly(.i.N./i.-methyldodecano-12-lactam) in blends with poly(styrene-stat-acrylic acid)

    Czech Academy of Sciences Publication Activity Database

    Kratochvíl, Jaroslav; Sikora, Antonín

    2007-01-01

    Roč. 43, č. 5 (2007), s. 2155-2164. ISSN 0014-3057 R&D Projects: GA ČR GA106/02/1248 Institutional research plan: CEZ:AV0Z40500505 Keywords : polymer blends * crystallization * secondary crystallization Subject RIV: CD - Macromolecular Chemistry Impact factor: 2.248, year: 2007

  18. Low-mass binary X-Ray sources: Monitoring with various satellites

    Czech Academy of Sciences Publication Activity Database

    Šimon, Vojtěch

    2014-01-01

    Roč. 54, č. 3 (2014), s. 248-253. ISSN 1210-2709. [IBWS (INTEGRAL/BART) workshop. Karlovy Vary, 22.03.2013-25.3.2013] Grant ostatní: GA ČR(CZ) GA13-33324S Institutional support: RVO:67985815 Keywords : radiation mechanisms * accretion disks * X-rays Subject RIV: BN - Astronomy, Celestial Mechanics, Astrophysics

  19. Demonstrating Efficacy in Preclinical Studies of Cellular Therapies for Spinal Cord Injury - How Much is Enough?

    Czech Academy of Sciences Publication Activity Database

    Kwon, B. K.; Soril, L. J. J.; Bacon, M.; Beattie, M. S.; Blesch, A.; Bresnahan, J. C.; Bunge, M. B.; Dunlop, S. A.; Fehlings, M. G.; Ferguson, A. R.; Hill, C. E.; Karimi-Abdolrezaee, S.; Lu, P.; McDonald, J. W.; Müller, H. W.; Oudega, M.; Rosenzweig, E. S.; Reier, P. J.; Silver, J.; Syková, Eva; Xu, X. M.; Guest, J. D.; Tetzlaff, W.

    2013-01-01

    Roč. 248, Oct (2013), s. 30-44. ISSN 0014-4886 R&D Projects: GA ČR GA13-00939S; GA ČR(CZ) GBP304/12/G069 Institutional support: RVO:68378041 Keywords : spinal cord injury * cell transplantation therapies * clinical trial Subject RIV: FH - Neurology Impact factor: 4.617, year: 2013

  20. AcEST: DK948569 [AcEST

    Lifescience Database Archive (English)

    Full Text Available TST38A01NGRL0003_K16 655 Adiantum capillus-veneris mRNA. clone: TST38A01NGRL0003_K16. 5' end seq ... , Gaps = 3/81 (3%) Frame = +2 Query: 266 SREGMATEVQEPA NGNLKKEEAEPLGELRGKED--LKQA-PADLCHAGDVNGCEPVAEKE 436 ... /73 (6%) Frame = +2 Query: 248 GRRGLFSREGMA----TEVQEPA N-GNLKKEEAEPLGELRGKEDLKQAPADLCHAGDVNG 412 GR+G +R G ...

  1. 宗教観と教条主義的傾向との関連について

    OpenAIRE

    高木, 秀明; 安藤, 嘉奈子; 山口, 陽子; 井上, 果子

    1997-01-01

    This study investigates the relation between the religious belief and the tendency of dogmatism among the Japanese adolescents. 248 subjects responded to the questionnaire. According to their responses concerning attitude and interest towards religion, the subjects were divided into 6 groups. Results show that anti religion adolescent group tended to be more dogmatic.

  2. Does Bachelor's-Level Social Work Education Impact Students' Knowledge and Attitudes Regarding Substance-Abusing Clients?

    Science.gov (United States)

    Senreich, Evan; Straussner, Shulamith Lala A.

    2013-01-01

    This study compared 248 graduating seniors with 301 beginning juniors at 10 bachelor's-level social work programs in the Northeast concerning their knowledge and attitudes regarding working with substance-abusing clients. Graduating seniors demonstrated modestly higher levels of knowledge and only slightly more positive attitudes toward…

  3. Thinking about Applications: Effects on Mental Models and Creative Problem-Solving

    Science.gov (United States)

    Barrett, Jamie D.; Peterson, David R.; Hester, Kimberly S.; Robledo, Issac C.; Day, Eric A.; Hougen, Dean P.; Mumford, Michael D.

    2013-01-01

    Many techniques have been used to train creative problem-solving skills. Although the available techniques have often proven to be effective, creative training often discounts the value of thinking about applications. In this study, 248 undergraduates were asked to develop advertising campaigns for a new high-energy soft drink. Solutions to this…

  4. Longitudinal Study on Reciprocity between Personality Traits and Parenting Stress

    Science.gov (United States)

    Rantanen, Johanna; Tillemann, Kati; Metsäpelto, Riitta-Leena; Kokko, Katja; Pulkkinen, Lea

    2015-01-01

    Reciprocal associations between the Big Five personality traits and parenting stress--including both parents' feelings of their distress and perception of their incompetence as parents--were studied with 248 participants (49% of which were males). Longitudinal data, collected at ages 33/36, 42 and 50 years, were used. Cross-lagged path…

  5. An Investigation of Big Five Personality Traits and Career Decidedness among Early and Middle Adolescents

    Science.gov (United States)

    Lounsbury, John W.; Hutchens, Teresa; Loveland, James M.

    2005-01-01

    Big Five personality traits were analyzed in relation to career decidedness among adolescents in middle and high school. Participants were 248 7th-grade, 321 10th-grade, and 282 12th-grade students. As hypothesized, Conscientiousness was positively and significantly correlated with career decidedness in all three grades. Openness and Agreeableness…

  6. Reference: TEF1BOXATA1 [PLACE

    Lifescience Database Archive (English)

    Full Text Available TEF1BOXATA1 Regad F, Herve C, Marinx O, Bergounioux C, Tremousaygue D, Lescue B The tef1 box, a ... vation of plant genes that are highly expressed in cycling ... cells Mol. Gen. Genet. 248: 703-711 (1995) PubMed: ...

  7. List of Participating Institutions: Associated Schools Project in Education for International Co-operation and Peace = Liste des establissements participants: Systeme des ecoles associees appliquant un programme d'education pour la cooperation internationale et la paix = Lista de Instituciones Participantes: Plan de Escuelas Asociadas en la Educacion para la Cooperacion Internacional y la Paz.

    Science.gov (United States)

    United Nations Educational, Scientific, and Cultural Organization, Paris (France).

    A list of participating institutions at the Associated Schools Project in Education for International Co-Operation and Peace, December 31, 1985 is presented. A total of 1,970 institutions in 94 countries participated, including 47 nursery schools, 556 primary schools, 1,123 secondary schools, and 248 teacher training institutions. Addresses of…

  8. Church of San George in Kostoľany pod Tribečom

    Czech Academy of Sciences Publication Activity Database

    Maříková-Kubková, Jana; Baxa, P.; Bisták, P.; Borzová, Z.

    Rijeka : University of Rijeka, 2015 - (Vicelja-Matijašić, M.), s. 213-248 ISBN 978-953-7975-32-6 EU Projects: European Commission(XE) CU7-MULT7/2010-0653/001-001 Institutional support: RVO:67985912 Keywords : Francia Media * Early Medieval Europe * Kostoľany pod Tribečom Subject RIV: AC - Archeology, Anthropology, Ethnology

  9. 76 FR 37979 - Cooperation in USDA Studies and Evaluations, and Full Use of Federal Funds in Nutrition...

    Science.gov (United States)

    2011-06-29

    ... Service 7 CFR Parts 210, 215, 220, 225, 226, 235, 246, and 248 RIN 0584-AE20 Cooperation in USDA Studies... of 2010 (HHFK Act). The HHFK Act requires State and local cooperation in Department of Agriculture... reflect this requirement. Notice and Comment In accordance with the Secretary's Statement of Policy (36...

  10. Teacher Retention in International Schools: The Key Role of School Leadership

    Science.gov (United States)

    Mancuso, Steven V.; Roberts, Laura; White, George P.

    2010-01-01

    The purpose of this study was (1) to track teacher turnover in Near East South Asia (NESA) international schools and (2) to identify correlates of teacher turnover. We received survey responses from 22 school heads and 248 teachers in NESA schools. The average turnover rate was 17 percent from 2006 to 2009, ranging from several schools with no…

  11. Lesión del ligamento cruzado anterior y condromalacia rotulofemoral

    OpenAIRE

    ANGEL CHECA GONZALEZ; FRANCISCO AGUIAR ROMAN; OSVALDO PEREDA CARDOSO

    1995-01-01

    La lesión del ligamento anterior fue un hallazgo a considerar entre las 248 artroscopias realizadas en 24 meses. La ruptura aislada fue patente en pocos casos, en contraposición con la lesión combinada. La condromalacia rotulofemoral fue un diagnóstico endoscópico importante, pocas veces considerado clínicamente.

  12. State, firms, and corporate impact: cash or control

    Czech Academy of Sciences Publication Activity Database

    Hanousek, Jan; Kočenda, Evžen

    Ostrava: VŠB - Technical University of Ostrava, 2007, s. 1-8. ISBN 978-80-248-1457-5. [Mathematical Methods in Economics. Ostrava (CZ), 04.09.2007-06.09.2007] R&D Projects: GA ČR GA402/06/1293 Institutional research plan: CEZ:MSM0021620846 Keywords : privatization * ownership structure * control potential Subject RIV: AH - Economics

  13. Go4Life

    Medline Plus

    Full Text Available ... Go4Life Exercises — Stretching Play all Try some of these Go4Life exercises to improve your flexibility! 2:48 ... Exercises — Building Strength Play all Try some of these Go4Life exercises to improve your strength! Stronger muscles ...

  14. Femtosecond ultraviolet laser ablation of silver and comparison with nanosecond ablation

    DEFF Research Database (Denmark)

    Christensen, Bo Toftmann; Doggett, B.; Budtz-Jørgensen, C.;

    2013-01-01

    The ablation plume dynamics arising from ablation of silver with a 500 fs, 248 nm laser at ~2 J cm-2 has been studied using angle-resolved Langmuir ion probe and thin film deposition techniques. For the same laser fluence, the time-of-flight ion signals from femtosecond and nanosecond laser...

  15. Jet production in ep collisions at low Q.sup.2./sup. and determination of α.sub.S./sub..

    Czech Academy of Sciences Publication Activity Database

    Aaron, F.D.; Alexa, C.; Alimujiang, K.; Cvach, Jaroslav; Reimer, Petr; Zálešák, Jaroslav

    2010-01-01

    Roč. 65, 3-4 (2010), s. 363-383. ISSN 1434-6044 R&D Projects: GA MŠk LA09042 Institutional research plan: CEZ:AV0Z10100502 Keywords : neutral current deep-inelastic scattering * jet production * strong coupling constant Subject RIV: BF - Elementary Particles and High Energy Physics Impact factor: 3.248, year: 2010

  16. EST Table: FS832352 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available FS832352 E_FL_fmgV_40B23_R_0 10/09/28 41 %/248 aa ref|NP_001116815.1| carboxylesterase CarE -11 [ ... Bombyx mori] gb|ACB12415.1| carboxylesterase CarE -11 [Bombyx mori] 10/09/10 low homology 10/08/29 n. ...

  17. Education for a New World, 1994.

    Science.gov (United States)

    Institute of International Education, New York, NY.

    This annual report marks the 75th anniversary of the Institute of International Education (IIE) and describes the IIE's 1994 activities and programs. During 1994 more than 10,000 individuals studied, conducted research, received practical training, or provided international technical assistance under 248 programs IIE administered for 217 sponsors,…

  18. Jazyk v sociální interakci: Nad českým překladem knihy Petera Auera Jazyková interakce

    Czech Academy of Sciences Publication Activity Database

    Kaderka, Petr; Nekvapil, J.

    Praha : Nakladatelství Lidové noviny, 2014, s. 237-248. ISBN 978-80-7422-268-9 R&D Projects: GA ČR GAP406/12/1829 Institutional support: RVO:68378092 Keywords : social interaction * multimodal interaction * linguistic interaction * Peter Auer * translation strategies * terminology management Subject RIV: AI - Linguistics

  19. Vibrace vyvolané odstřelem trhavin při ražbě mělkého důlního díla

    Czech Academy of Sciences Publication Activity Database

    Kaláb, Zdeněk; Knejzlík, Jaromír; Lednická, Markéta

    Stupava : Orgware, 2006, s. 317-324. ISBN 80-248-1124-3. [Geotechnika 2006/11./. Vysoké Tatry (SK), 20.09.2006-22.09.2006] R&D Projects: GA ČBÚ(CZ) AACBU38-05 Institutional research plan: CEZ:AV0Z30860518 Keywords : surface vibrations * explosive blasting * measurements Subject RIV: DC - Siesmology, Volcanology, Earth Structure

  20. Dimenzování výztuže porubních chodeb v uhelných dolech

    Czech Academy of Sciences Publication Activity Database

    Šňupárek, Richard

    Ostrava : VŠB-TUO, FAST, 2012, s. 1-8. ISBN 978-80-248-2785-8. [Geotechnika - 2012 - Geotechnics. Vysoké Tatry (SK), 26.09.2012-28.09.2012] R&D Projects: GA MŠk ED2.1.00/03.0082 Institutional support: RVO:68145535 Keywords : design * support * roadways Subject RIV: DH - Mining, incl. Coal Mining

  1. Globální oteplování – Mýty či fakta?

    Czech Academy of Sciences Publication Activity Database

    Duží, Barbora; Stojanov, Robert

    Praha: Člověk v tísni, 2012 - (Hoduláková, A.; Součková, L.), s. 239-248. (Jeden svět na školách). ISBN 978-80-87456-23-1 Institutional support: RVO:67179843 Keywords : global warming * climate change * mitigation and adaptation measures Subject RIV: EH - Ecology, Behaviour

  2. Geotechnická měření v historickém důlním díle

    Czech Academy of Sciences Publication Activity Database

    Kaláb, Zdeněk

    -, - (2009), s. 1-45. ISBN 978-80-248-1999-0. ISSN 1213-7456 R&D Projects: GA ČR GA105/09/0089 Institutional research plan: CEZ:AV0Z30860518 Keywords : geotechnical measurement * seismological measurement * distributed measurement network Subject RIV: DC - Siesmology, Volcanology, Earth Structure http://www.waset.org/pwaset/current.html

  3. Influence of oxygen pressure on the characteristics of the KrF-laser-induced plasma plume created above an YBaCuO superconducting target

    International Nuclear Information System (INIS)

    The laser-induced plasma plume created above an YBaCuO superconducting target by a KrF laser beam (248 nm) is investigated by time-resolved spectroscopy under an oxygen atmosphere. The influence of the oxygen partial pressure on the ejection velocities of the ablated species and on the relaxation of atomic and molecular excited species is particularly studied

  4. Strategies to Improve Teacher Retention in American Overseas Schools in the Near East South Asia Region: A Qualitative Analysis

    Science.gov (United States)

    Mancuso, Steven V.; Roberts, Laura; White, George P.; Yoshida, Roland K.; Weston, David

    2011-01-01

    Using a qualitative analysis and drawing from sociological theory, this study examined reasons for teacher turnover and retention from a representative sample of 248 teachers in American overseas schools in the Near East South Asia region. Results suggested that the most important reasons to stay or move pertained to supportive leadership,…

  5. Organometallic Half-Sandwich Iridium Anticancer Complexes

    Czech Academy of Sciences Publication Activity Database

    Liu, Z.; Habtemariam, A.; Pizarro, A.M.; Fletcher, S.A.; Kisová, Anna; Vrána, Oldřich; Salassa, L.; Bruijnincx, P.C.A.; Clarkson, G.J.; Brabec, Viktor; Sadler, P. J.

    2011-01-01

    Roč. 54, č. 8 (2011), 3011-3026. ISSN 0022-2623 R&D Projects: GA ČR(CZ) GPP303/11/P047; GA ČR(CZ) GAP301/10/0598 Keywords : RUTHENIUM(II) ARENE COMPLEXES * CANCER -CELL CYTOTOXICITY * DNA-BINDING PROPERTIES Subject RIV: BO - Biophysics Impact factor: 5.248, year: 2011

  6. Richard Werner

    Czech Academy of Sciences Publication Activity Database

    Šimůnek, Michal V.

    Červený Kostelec : Pavel Mervart, 2013 - (Šimůnek, M.; Kostlán, A.), s. 244-248 ISBN 978-80-7465-041-3. - (Studies in the History of Sciences and Humanities. 29) Institutional support: RVO:68378114 Keywords : holocaust * intellectual elite * history of science Subject RIV: AB - History

  7. Implications of Posttraumatic Stress among Military-Affiliated and Civilian Students

    Science.gov (United States)

    Barry, Adam E.; Whiteman, Shawn D.; MacDermid Wadsworth, Shelley M.

    2012-01-01

    Objectives: To determine whether posttraumatic stress (PTS) symptoms are associated with problem drinking and alcohol-related consequences, as well as academic correlates among military-affiliated and civilian students. Participants: The final sample (n = 248) included 78 combat-exposed student service members/veterans, 53 non-combat-exposed…

  8. Drug: D09601 [KEGG MEDICUS

    Lifescience Database Archive (English)

    Full Text Available D09601 Drug Davalintide acetate (USAN) C152H248N50O49S2. (C2H4O2)x Lys Cys Asn Thr Ala Thr Cys V ... -NH2 (Disulfide bridge: 2-7) Peptide Treatment for obesity ... and/or obesity -related metabolic disorders, includ ...

  9. Drug: D09600 [KEGG MEDICUS

    Lifescience Database Archive (English)

    Full Text Available D09600 Drug Davalintide (USAN/INN) C152H248N50O49S2 3621.7893 3624.0311 Lys Cys Asn Thr Ala Thr ... r-NH2 (Disulfide bridge: 2-7) Peptide Treatment of obesity ... and obesity -related disorders Davalintide is a Amy ...

  10. Pediatric Palliative Care: A Personal Story

    Medline Plus

    Full Text Available ... Health - Meriter 43,248 views 13:34 Phoebe's Cancer Story - Duration: 7:46. Family A-Fair 570, ... 20. CBS 54,588 views 14:20 Teen Cancer Stories | UCLA Daltrey/Townshend Teen & Young Adult Cancer ...

  11. Dicty_cDB: VSJ470 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 5.4 Zebrafish DNA sequence *** SEQUENCING IN PROGRESS *** from clone CH211-248L17. 48 0.21 2 AJ277431 |AJ277431.1 Megaselia scala...ris retrotransposon TROMB-Ms2. 36 0.43 2 AJ277430 |AJ277430.1 Megaselia scala

  12. Česká filosofie z druhé strany Šumavy

    Czech Academy of Sciences Publication Activity Database

    Kohák, Erazim

    Praha: FF UK, Nomáda, 2013 - (Bendová, M.; Borovanská, J.; Vejvodová, D.), s. 242-248 ISBN 978-80-7308-455-4 Institutional support: RVO:67985955 Keywords : Communist coup * dissent Subject RIV: AA - Philosophy ; Religion

  13. 76 FR 10561 - New England Fishery Management Council; Public Meeting

    Science.gov (United States)

    2011-02-25

    ...: (978) 750- 7959. Council address: New England Fishery Management Council, 50 Water Street, Mill 2... National Oceanic and Atmospheric Administration RIN 0648-XA248 New England Fishery Management Council... Council (Council) is scheduling a public meeting of its Research Steering Committee (Committee), in...

  14. Examining the Relationship between Work Life Conflict, Stress and Turnover Intentions among Marketing Executives in Pakistan

    OpenAIRE

    Saroj Noor; Nazia Maad

    2009-01-01

    This study examines the antecedents of turnover intentions among marketing executives in Pakistan. Relationship between stress and work life conflict with turnover intentions was examined. The research data was collected from 248 marketing executives working in different organizations across Pakistan. The results suggest that of work life conflict and stress have a significant positive relationship with turnover intentions. Recommendations and strategies are also discussed.

  15. Reevaluated but still enigmatic - the Roman site at »Burgstall« (okr. Brno-venkov/CZ)

    Czech Academy of Sciences Publication Activity Database

    Tejral, Jaroslav

    Mainz : Römisch-Germanisches Zentralmuseum, 2014, s. 221-248. ISBN 978-3-88467-196-2. - (Monographien des Römisch-Germanischen Zentralmuseums. 100) Institutional support: RVO:68081758 Keywords : Barbaricum * Roman military buildings * dating * Moravia * Mušov Subject RIV: AC - Archeology, Anthropology, Ethnology

  16. Learning in a credit economy

    NARCIS (Netherlands)

    T. Assenza; M. Berardi

    2009-01-01

    In this paper we analyze a credit economy à la Kiyotaki and Moore [1997. Credit cycles. Journal of Political Economy 105, 211-248] enriched with learning dynamics, where both borrowers and lenders need to form expectations about the future price of the collateral. We find that under homogeneous lear

  17. Prospective Multicenter Study of Pneumocystis jirovecii Colonization among Cystic Fibrosis Patients in France

    OpenAIRE

    Hernández-Hernández, Francisca; Fréalle, Emilie; Caneiro, Patrick; Salleron, Julia; Durand-Joly, Isabelle; Accoceberry, Isabelle; Bouchara, Jean-Philippe; Wallaert, Benoit; Dei-Cas, Eduardo; Delhaes, Laurence

    2012-01-01

    Pneumocystis carriage was detected in 12.5% of 104 cystic fibrosis (CF) patients during a prospective multicenter French study, with a prevalence of genotype 85C/248C and geographic variations. It was significantly associated with the absence of Pseudomonas aeruginosa colonization and a greater forced expiratory volume in 1 s. Results are discussed considering the natural history of CF.

  18. Deposition and characterization of ITO films produced by laser ablation at 355 nm

    DEFF Research Database (Denmark)

    Holmelund, E.; Thestrup Nielsen, Birgitte; Schou, Jørgen;

    2002-01-01

    Indium tin oxide (ITO) films have been deposited by pulsed laser deposition (PLD) at 355 nm. Even though the absorption of laser light at the wavelength 355 nm is much smaller than that of the standard excimer lasers for PLD at 248 nm and 193 nm, high-quality films can be produced. At high fluence...

  19. The spatial thickness distribution of metal films produced by large area pulsed laser deposition

    DEFF Research Database (Denmark)

    Pryds, Nini; Schou, Jørgen; Linderoth, Søren

    2007-01-01

    Thin films of metals have been deposited in the large-area Pulsed Laser Deposition (PLD) Facility at Riso National Laboratory. Thin films of Ag and Ni were deposited with laser pulses from an excimer laser at 248 nm with a rectangular beam spot at a fluence of 10 J/cm(2) on glass substrates of 127...

  20. Oxidative Addition of Diphenyldichalcogenides PhEEPh (E = S, Se, Te) to Low-Valent CN- and NCN-Chelated Organoantimony and Organobismuth Compounds

    Czech Academy of Sciences Publication Activity Database

    Šimon, Petr; Jambor, R.; Růžička, A.; Dostál, I.

    2013-01-01

    Roč. 32, č. 1 (2013), s. 239-248. ISSN 0276-7333 Institutional support: RVO:61388971 Keywords : MAIN-GROUP ELEMENTS * BOND COVALENT RADII * CRYSTAL-STRUCTURES Subject RIV: CA - Inorganic Chemistry Impact factor: 4.253, year: 2013

  1. Rate-independent damage processes in nonlinear inelasticity

    Czech Academy of Sciences Publication Activity Database

    Mielke, A.; Roubíček, Tomáš

    2005-01-01

    Roč. 16, č. 2 (2005), s. 177-209. ISSN 0218-2025 R&D Projects: GA AV ČR IAA1075402 Institutional research plan: CEZ:AV0Z10750506 Keywords : damage Subject RIV: BC - Control Systems Theory Impact factor: 1.248, year: 2005

  2. Cretaceous park of sex determination: sex chromosomes are conserved across iguanas

    Czech Academy of Sciences Publication Activity Database

    Rovatsos, M.; Pokorná, Martina; Altmanová, M.; Kratochvíl, L.

    2014-01-01

    Roč. 10, č. 3 (2014), s. 20131093. ISSN 1744-9561 R&D Projects: GA ČR GAP506/10/0718 Institutional support: RVO:67985904 Keywords : Anolis * lizard * male heterogamety Subject RIV: EG - Zoology Impact factor: 3.248, year: 2014

  3. What Criteria Do Child Protective Services Investigators Use to Substantiate Exposure to Domestic Violence?

    Science.gov (United States)

    Coohey, Carol

    2007-01-01

    The primary purpose of this study is to determine whether child protective services investigators apply a recognizable set of criteria to substantiate batterers and victims of battering for exposing their children to domestic violence. Although domestic violence occurred in 35% of the 1,248 substantiated incidents of child maltreatment, only 31…

  4. A Canonical Correlation Analysis of the Influence of Social Comparison, Gender, and Grade Level on the Multidimensional Self-Concepts of Gifted Adolescents

    Science.gov (United States)

    Rinn, Anne N.; Jamieson, Kelly M.; Gross, Candace M.; McQueen, Kand S.

    2009-01-01

    This study examines the effects of social comparison, gender, and grade level on gifted adolescents' multidimensional self-concept. Participants include 248 gifted adolescents who had completed the sixth through tenth grade during the previous academic year. Multidimensional self-concept was measured using the Self Description Questionnaire II…

  5. 33 CFR 127.1101 - Piping systems.

    Science.gov (United States)

    2010-07-01

    ... meet 49 CFR 195.248. (c) The transfer manifold of each liquid transfer line and of each vapor return... 33 Navigation and Navigable Waters 2 2010-07-01 2010-07-01 false Piping systems. 127.1101 Section... Waterfront Facilities Handling Liquefied Hazardous Gas Design and Construction § 127.1101 Piping...

  6. Effects of Self-Perceptions on Self-Learning among Teacher Education Students

    Science.gov (United States)

    Liu, Shih-Hsiung

    2015-01-01

    This study evaluates the multivariate hypothesized model that predicts the significance of, and relationships among, various self-perception factors for being a qualified teacher and their direct and mediated effects on self-learning activities among teacher education students. A total of 248 teacher education students enrolled at an education…

  7. Vliv typu vazby historického zdiva na jeho teplotní namáhání

    Czech Academy of Sciences Publication Activity Database

    Beran, Pavel

    2013-01-01

    Roč. 22, č. 10 (2013), s. 248-253. ISSN 1805-2576 R&D Projects: GA ČR(CZ) GBP105/12/G059 Institutional support: RVO:68378297 Keywords : thermal expansion * masonry * thermal stress * compatibility Subject RIV: JN - Civil Engineering http://www.stavebniobzor.cz/clanek/vliv-typu-vazby-historickeho-zdiva-na-jeho-teplotni-namahani/

  8. The unbundling regime for electricity utilities in the EU: a case of legislative and regulatory capture?

    Czech Academy of Sciences Publication Activity Database

    van Koten, Silvester; Ortmann, A.

    2008-01-01

    Roč. 30, č. 6 (2008), s. 3128-3140. ISSN 0140-9883 R&D Projects: GA MŠk LC542 Institutional research plan: CEZ:AV0Z70850503 Keywords : corruption * electricity markets * vertical integration Subject RIV: AH - Economics Impact factor: 2.248, year: 2008

  9. The unbundling regime for electricity utilities in the EU: a case of legislative and regulatory capture?

    Czech Academy of Sciences Publication Activity Database

    van Koten, S.; Ortmann, Andreas

    2008-01-01

    Roč. 30, č. 6 (2008), s. 3128-3140. ISSN 0140-9883 R&D Projects: GA MŠk LC542 Institutional research plan: CEZ:MSM0021620846 Keywords : corruption * electricity markets * vertical integration Subject RIV: AH - Economics Impact factor: 2.248, year: 2008

  10. Národní genetická banka živočichů

    Czech Academy of Sciences Publication Activity Database

    Zemanová, Barbora; Hájková, Petra; Vinkler, M.; Hulva, P.; Vrbová Komárková, Jana; Ďureje, Ľudovít; Buchtová, L.; Velová, H.; Bryja, Josef

    Brno: Ústav biologie obratlovců AV ČR, 2016 - (Bryja, J.; Sedláček, F.; Fuchs, R.). s. 247-248 ISBN 978-80-87189-20-7. [Zoologické dny. 11.02.2016-12.02.2016, České Budějovice] Institutional support: RVO:68081766 Subject RIV: EG - Zoology

  11. The effect of Ga-doping on the defect chemistry of RE.sub.3./sub.Al.sub.5./sub.O.sub.12./sub. garnets

    Czech Academy of Sciences Publication Activity Database

    Stanek, C.R.; Jiang, C.; Yadav, S.K.; McClellan, K.J.; Uberuaga, B.P.; Andersson, D.A.; Nikl, Martin

    2013-01-01

    Roč. 250, č. 2 (2013), s. 244-248. ISSN 0370-1972 R&D Projects: GA ČR GAP204/12/0805 Institutional support: RVO:68378271 Keywords : aluminate garnets * antisite defects * Ga doping Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 1.605, year: 2013

  12. Students’ anticipated situational engagement : the roles of teacher behaviour, personal engagement, and gender

    NARCIS (Netherlands)

    Thijs, J.T.; Verkuyten, M.J.A.M.

    2009-01-01

    Among 9th-grade students (248 girls, 255 boys) from a large multiethnic school, the authors examined 2 aspects of anticipated situational engagement in relation to 3 types of hypothetical teacher behavior: authoritarian, authoritative, permissive. Furthermore, the authors investigated the moderating

  13. Endemic Hepatitis E in two Nordic Countries

    DEFF Research Database (Denmark)

    Norder, H.; Sundqvist, L.; Magnusson, L.;

    2009-01-01

    Antibodies against hepatitis E virus (anti-HEV) were found in 248 Swedish and Danish patients between 1993 and 2007. Most patients were symptomatic and tested for anti-HEV due to travel abroad. Among patients with known country of infection, most were infected in Asia, mainly on the Indian...

  14. MODIFIKOVANÁ ZKOUŠKA EXCENTRICKÝM TAHEM: VYHODNOCENÍ EXPERIMENTÁLNÍCH TESTŮ VÁLCOVÝCH TĚLES Z CEMENTOVÉHO KOMPOZITU

    Czech Academy of Sciences Publication Activity Database

    Holušová, T.; Lozano, M.; Komárková, T.; Kocáb, D.; Seitl, Stanislav

    Ostrava: VŠB-TU Ostrava, 2015 - (Krejsa, M.) ISBN 978-80-248-3756-7. [Modelování v mechanice 2015. Ostrava (CZ), 28.05.2015-29.05.2015] Institutional support: RVO:68081723 Keywords : Modified compact tension test * fracture parameters * composites * ARAMIS * L-COD Subject RIV: JL - Materials Fatigue, Friction Mechanics

  15. Stress analysis of modified compact tension specimens: K-calibration curves

    Czech Academy of Sciences Publication Activity Database

    Seitl, Stanislav; Viszlay, V.

    Ostrava: VŠB-TU Ostrava, 2015 - (Krejsa, M.) ISBN 978-80-248-3756-7. [Modelování v mechanice 2015. Ostrava (CZ), 28.05.2015-29.05.2015] Institutional support: RVO:68081723 Keywords : Modified compact tension specimen * stress intensity factor * concrete * FEM Subject RIV: JL - Materials Fatigue, Friction Mechanics

  16. Development of an advanced, continuous mild gasification process for the production of co-products: Topical report

    Energy Technology Data Exchange (ETDEWEB)

    Cha, C.Y.; Merriam, N.W.; Jha, M.C.; Breault, R.W.

    1988-06-01

    Research on mild gasification is discussed. The report is divided into three sections: literature survey of mild gasification processes; literature survey of char, condensibles, and gas upgrading and utilization methods; and industrial market assessment of products of mild gasification. Recommendations are included in each section. (CBS) 248 refs., 58 figs., 62 tabs.

  17. What is a Spectrum?

    CERN Document Server

    Bolton, Adam S; Brownstein, Joel; Pandey, Parul; Schlegel, David; Shu, Yiping

    2011-01-01

    This contribution describes the "spectro-perfectionism" algorithm of Bolton & Schlegel (2010, PASP, 122, 248) that is being implemented within the Baryon Oscillation Spectroscopic Survey (BOSS) of the Sloan Digital Sky Survey III (SDSS-III), in terms of its potential to deliver Poisson-limited sky subtraction and lossless compression of the input spectrum likelihood functional given raw CCD data.

  18. Charged-particle multiplicity measurement in proton-proton collisions at root s=7 TeV with ALICE at LHC

    Czech Academy of Sciences Publication Activity Database

    Aamodt, K.; Abel, N.; Abeysekara, U.; Abrahantes Quintana, A.; Abramyan, A.; Adamová, Dagmar; Bielčík, Jaroslav; Bielčíková, Jana; Kapitán, Jan; Kushpil, Svetlana; Kushpil, Vasilij; Pachr, M.; Petráček, Vojtěch; Rak, Jan; Šumbera, Michal; Tlustý, David; Wagner, Vladimír; Mareš, Jiří A.; Polák, Karel; Závada, Petr

    2010-01-01

    Roč. 68, 3-4 (2010), s. 345-354. ISSN 1434-6044 R&D Projects: GA MŠk LA08015 Institutional research plan: CEZ:AV0Z10480505; CEZ:AV0Z10100502 Keywords : PSEUDORAPIDITY DISTRIBUTIONS * PP INTERACTIONS * ENERGIES Subject RIV: BG - Nuclear, Atomic and Molecular Physics, Colliders Impact factor: 3.248, year: 2010

  19. 48 CFR 48.102 - Policies.

    Science.gov (United States)

    2010-10-01

    ... value engineering program requirement clause (52.248-1, Alternates I or II) in initial production... VALUE ENGINEERING Policies and Procedures 48.102 Policies. (a) As required by Section 36 of the Office... cost-effective value engineering procedures and processes. Agencies shall provide contractors...

  20. Studies on the chemistry of element 104 with the centrifuge system SISAK-3

    Energy Technology Data Exchange (ETDEWEB)

    Eberhardt, K.; Kratz, J.V.; Mendel, M.; Naehler, A.; Trautmann, N.; Wiehl, N. [Mainz Univ. (Germany); Alstadt, J.; Omtvedt, J.P. [Oslo Univ. (Norway); Malmbeck, R.; Skarnemark, G.; Wierczinski, B. [Chalmers Univ. of Technology, Goeteborg (Sweden); Eichler, B.; Gaeggeler, H.W.; Jost, D.T.; Tuerler, A. [Paul Scherrer Inst. (PSI), Villigen (Switzerland)

    1997-09-01

    The centrifuge system SISAK-3 combined with a detector for the measurement of {alpha}-particles and spontaneous fission (SF) fragments in a flowing organic liquid has been applied to study the chemical behaviour of element 104 produced in the reaction {sup 248}Cm({sup 18}O,5n){sup 261}104. (author) 2 figs., 2 refs.

  1. The role of MRI in the diagnosis of acute radiation reaction in breast cancer patient

    Science.gov (United States)

    Startseva, Zh A.; Musabaeva, L. I.; Usova, AV; Frolova, I. G.; Simonov, K. A.; Velikaya, V. V.

    2016-02-01

    A clinical case with acute radiation reaction of the left breast after organ-preserving surgery with 10 Gy IORT (24.8 Gy) conventional radiation therapy has been presented. Comprehensive MRI examination showed signs of radiation- induced damage to skin, soft tissues and vessels of the residual breast.

  2. Dicty_cDB: Contig-U15078-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available e RP23-248L5 from 14, comple... 38 0.46 7 ( AC116960 ) Dictyostelium discoideum chromosome 2 map complem... ...34 0.61 9 ( AC150299 ) Carollia perspicillata clone 309L9, complete sequ... 40 0.68 3 ( AC023765 ) Homo sapi

  3. Attitudes of Medical School Faculty toward Gifts from the Pharmaceutical Industry.

    Science.gov (United States)

    Banks, James W., III; Mainous, Arch G., III

    1992-01-01

    A survey of 248 University of Kentucky medical school faculty investigated attitudes toward American Medical Association policy concerning gifts from the pharmaceutical industry. Faculty generally agreed with the guidelines but felt gifts did not influence prescribing behaviors. PhD faculty favored more prescriptive policy than did MD faculty.…

  4. Kultura organizace a syndrom vyhoření

    Czech Academy of Sciences Publication Activity Database

    Havrdová, Z.; Šolcová, Iva; Hradcová, D.; Rohanová, E.

    2010-01-01

    Roč. 54, č. 3 (2010), s. 235-248. ISSN 0009-062X Institutional research plan: CEZ:AV0Z70250504 Keywords : organizational culture * employee satisfaction * health vs. social services Subject RIV: AN - Psychology Impact factor: 0.230, year: 2010

  5. Cylindrical Bending of a Plate on an Elastic Foundation

    Czech Academy of Sciences Publication Activity Database

    Gronát, Petr

    Ostrava : VŠB - Technical University of Ostrava, 2011, C376-C393. ISBN 978-80-248-2257-0 R&D Projects: GA ČR GAP101/10/1230 Institutional research plan: CEZ:AV0Z20760514 Keywords : elastic foundation * cylindrical bending Subject RIV: JI - Composite Materials

  6. Synergy of CAY-1, a Fungicidal Saponin, With Amphotericin B and Itreconazole Against Aspergillus spp and Candida albicans

    Science.gov (United States)

    Background: CAY-1 (mol.wt. 1243), a fungicidal saponin in cayenne (Capsicum fruitescens) is highly lethal for Aspergillus species, Candida albicans, and Pneumocystis carinii below 24.8 ug/ml. To further characterize CAY-1, synergy studies with amphotericin B (AMB) and itraconazole (IT) were perform...

  7. Aprender a vivir. Filosofía para mentes jóvenes. [Reseña

    OpenAIRE

    Moros, E. (Enrique)

    2008-01-01

    Reseña L. FERRY, Aprender a vivir. Filosofía para mentes jóvenes, Taurus, Madrid 2007, 322 pp., 13 X 21,5, ISBN 978-84-306-0627-6. IDEM, Vencer los miedos. Lafilosofia como amor a la sabiduría, Edaf, Madrid 2007, 248 pp., 20, ISBN 978- 84-414-1904-9.

  8. Measurement of the charm and beauty structure functions using the H1 vertex detector at HERA

    Czech Academy of Sciences Publication Activity Database

    Aaron, F.D.; Aldaya Martin, M.; Alexa, C.; Cvach, Jaroslav; Reimer, Petr; Zálešák, Jaroslav

    2010-01-01

    Roč. 65, 1-2 (2010), s. 89-109. ISSN 1434-6044 R&D Projects: GA MŠk LA09042 Institutional research plan: CEZ:AV0Z10100502 Keywords : structure functions * charm production * beauty production * deep inelastic scattering Subject RIV: BF - Elementary Particles and High Energy Physics Impact factor: 3.248, year: 2010

  9. Gclust Server: 92219 [Gclust Server

    Lifescience Database Archive (English)

    Full Text Available 92219 PoTR_576267 Cluster Sequences Related Sequences(248) 391 eugene3.00160402 1 1....00e-22 14.29 0.0 0.0 0.0 0.0 0.0 Show 92219 Cluster ID 92219 Sequence ID PoTR_576267 Link to cluster sequen

  10. 77 FR 4374 - Submission for OMB Review; Comments Request

    Science.gov (United States)

    2012-01-27

    ... Investment Policy Questionnaire. Form Number: OPIC248. Frequency of Use: Once per investor per project. Type... From the Federal Register Online via the Government Publishing Office OVERSEAS PRIVATE INVESTMENT CORPORATION Submission for OMB Review; Comments Request AGENCY: Overseas Private Investment Corporation...

  11. Bacterial diversity in snow on North Pole ice floes

    DEFF Research Database (Denmark)

    Hauptmann, Aviaja Zenia Edna Lyberth; Stibal, Marek; Bælum, Jacob;

    2014-01-01

    The microbial abundance and diversity in snow on ice floes at three sites near the North Pole was assessed using quantitative PCR and 454 pyrosequencing. Abundance of 16S rRNA genes in the samples ranged between 43 and 248 gene copies per millilitre of melted snow. A total of 291,331 sequences we...

  12. Conversion efficiency in a solar splitting system

    International Nuclear Information System (INIS)

    In this paper we report on concentrator photovoltaic system made by splitting the solar system based on separate Si, GaAs, and InGaN solar cells. The SSCPV module was fabricated and conversion efficiency up to 24.8% was achieved for the concentration factor of 12.8 that is in correlation with theoretical predictions

  13. Roudnické iluminované rukopisy druhé třetiny 14. století

    Czech Academy of Sciences Publication Activity Database

    Gaudek, Tomáš

    Praha : Scriptorium, 2015 - (Dragoun, M.; Doležalová, L.; Ebersonová, A.), s. 234-248 ISBN 978-80-88013-09-9 R&D Projects: GA ČR GA13-39192S Institutional support: RVO:68378033 Keywords : illuminated manuscripts * Roudnice * 14th century Subject RIV: AL - Art , Architecture, Cultural Heritage

  14. Extent of intramolecular pi stacks in aqueous solution in mixed-ligand copper(II) complexes formed by heteroaromatic amines and the anticancer and antivirally active 9[2-(phosphonomethoxy)ethyl]guanine (PMEG). A comparison with related acyclic nucleotide analogues

    Czech Academy of Sciences Publication Activity Database

    Blindauer, C. A.; Sigel, A.; Operschall, B. P.; Griesser, R.; Holý, Antonín; Sigel, H.

    2016-01-01

    Roč. 103, SI (2016), s. 248-260. ISSN 0277-5387 Institutional support: RVO:61388963 Keywords : anticancer activity * antivirals * aromatic-ring stacking * isomeric equilibria * nucleotide analogues Subject RIV: CC - Organic Chemistry Impact factor: 2.011, year: 2014

  15. Diskuse o soukromém jazyce

    Czech Academy of Sciences Publication Activity Database

    Glombíček, Petr

    Praha : Filosofia, 2006 - (Glombíček, P.), s. 11-34 ISBN 80-7007-248-2 R&D Projects: GA AV ČR(CZ) IAB9009201 Institutional research plan: CEZ:AV0Z90090514 Keywords : Private language * Kripke * mental states Subject RIV: AA - Philosophy ; Religion

  16. EST Table: BP120323 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available inding)|GO:0015074(DNA integration) 10/09/28 46 %/248 aa ref|XP_002431503.1| enzymatic polyprotein; Endonucl...ease; Reverse transcriptase, putative [Pediculus humanus corporis] gb|EEB18765.1| enzymatic polyprotein; End

  17. Resveratrol

    Czech Academy of Sciences Publication Activity Database

    Šmidrkal, J.; Filip, V.; Prekop, J.; Kolouchová, I.; Melzoch, K.; Harmatha, Juraj

    Pardubice: Univerzita Pardubice, 2004, s. 243-248. ISBN 80-7194-644-3. [Vitamins 2004, Targeted Nutritional Therapy. Pardubice (CZ), 13.09.2004-15.09.2004] Institutional research plan: CEZ:AV0Z4055905 Keywords : resveratrol * pterostilben * pinosylvin Subject RIV: CC - Organic Chemistry

  18. The Person and the Challenges. The Journal of Theology, Education, Canon Law and Social Studies Inspired by Pope John Paul II [RECENSIÓN

    OpenAIRE

    Tejero, E. (Eloy)

    2012-01-01

    Recensión de: "THE PONTIFICAL UNIVERSITY OF JOHN PAUL II IN CRACOW SECTION IN TARNÓW, The Person and the Challenges. The Journal of Theology, Education, Canon Law and Social Studies Inspired by Pope John Paul II, Vol, I, n. 1 (2011), 266 pp. y vol. I n. 2 (2011) 248 pp., Press: Wydawnictwo Polihymnia, Lublin."

  19. 75 FR 21037 - Notice of Realty Action: Proposed Non-Competitive (Direct) Sales of Public Lands, Boulder County, CO

    Science.gov (United States)

    2010-04-22

    ..., Royal Gorge Field Office, 3028 East Main Street, Canon City, Colorado 81212. FOR FURTHER INFORMATION... Transaction Facilitation Act (FLTFA), Public Law 106-248, enacted on July 25, 2000. FLTFA provides for the use... Building Contractors, c/o Duane Kraft. Federal law requires purchasers to be: Citizens of the United...

  20. VizieR Online Data Catalog: Evolution of long-lived globular cluster stars (Chantereau+ 2016)

    Science.gov (United States)

    Chantereau, W.; Charbonnel, C.; Meynet, G.

    2016-08-01

    We present a grid of 224 stellar evolution models for low-mass stars with initial masses between 0.3 and 1.0Mȯ and initial helium mass fraction between 0.248 and 0.8 computed for [Fe/H]=-1.75 with the stellar evolution code STAREVOL. (2 data files).

  1. Pelagitalea pacifica gen. nov., sp. nov., a new marine bacterium isolated from seawater.

    Science.gov (United States)

    Lee, Hyunsang; Yoshizawa, Susumu; Kogure, Kazuhiro; Kim, Hyun Soo; Yoon, Jaewoo

    2015-04-01

    A strictly aerobic, Gram-negative, beige-pigmented, short-rod-shaped, non-motile and chemoheterotrophic bacteria, designated K2-48(T) was isolated from seawater collected in the Western North Pacific Ocean near Japan. Preliminary analysis based on the 16S rRNA gene sequence revealed that the novel isolate was affiliated with the family Oceanospirillaceae within the class Gammaproteobacteria and that it showed the highest sequence similarity (93.7 %) to Neptunomonas qingdaonensis P10-2-4(T). The strain could be differentiated phenotypically from recognized members of the family Oceanospirillaceae. The major fatty acids of strain K2-48(T) were identified as summed feature 3 (C16:1 ω7c and/or iso-C15:0 2-OH) and C16:0 as defined by the MIDI system. The DNA G+C content was determined to be 43.2 mol%, the major respiratory quinone was identified as ubiquinone 9 and a polar lipid profile was present consisting of phosphatidylethanolamine, a phosphatidylglycerol and an unidentified phospolipid. On the basis of polyphasic taxonomic studies, it was concluded that strain K2-48(T) represents a novel genus sp. We propose the name Pelagitalea pacifica gen. nov., sp. nov. for this strain; its type strain is K2-48(T) (=KCCM 90119(T)). PMID:25487119

  2. Spreading to a limit: the time required for a neophyte to reach its maximum range

    Czech Academy of Sciences Publication Activity Database

    Gassó, N.; Pyšek, Petr; Vila, M.; Williamson, M.

    2010-01-01

    Roč. 16, č. 2 (2010), s. 310-311. ISSN 1366-9516 R&D Projects: GA MŠk LC06073 Institutional research plan: CEZ:AV0Z60050516 Keywords : plant invasions * maximum range * residence time Subject RIV: EF - Botanics Impact factor: 4.248, year: 2010

  3. Efficient bragg grating fabrication in Ge-rich fibre by high-intensity femtosecond 264 mm irradation

    DEFF Research Database (Denmark)

    Slattery, S.A.; Nikogasyan, D.N.; Plougmann, Nikolai;

    2004-01-01

    Fibre Bragg gratings (FBGs) are usually fabricated by UV laser light (typically, 248 nm radiation from a KrF* excimer laser), which spectrally coincides with the absorption band of defects in germanosilicate fibre core [1, 2]. Recently, it was demonstrated that the use of highintensity femtosecon...

  4. Electron spin resonance investigation of undoped and Li-doped CdWO.sub.4./sub. scintillator crystals

    Czech Academy of Sciences Publication Activity Database

    Buryi, Maksym; Laguta, Valentyn; Hybler, Jiří; Nikl, Martin; Rosa, Jan

    2011-01-01

    Roč. 248, č. 4 (2011), s. 993-996. ISSN 0370-1972 R&D Projects: GA AV ČR IAA100100810 Institutional research plan: CEZ:AV0Z10100521 Keywords : defects * electron spin resonance * scintillators * wolframite Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 1.316, year: 2011

  5. EST Table: FS919694 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available FS919694 E_FL_fufe_48C05_F_0 10/09/28 34 %/248 aa ref|XP_967427.2| PREDICTED: similar to hypoxia ... i|189237669|ref|XP_967427.2| PREDICTED: similar to hypoxia -inducible factor 1 alpha [Tribolium castaneum] FS9 ...

  6. 7 CFR 2003.26 - Functional organization of RBS.

    Science.gov (United States)

    2010-01-01

    ... Administrator and RBS officials on management issues and policies related to: human resources, labor relations... cooperatives on their overall structure, strategic management and planning, financial issues, and operational... Administrator. According to 7 CFR 2.48, the Administrator is responsible for managing and administering...

  7. Electrically conductive composites of polyethylene filled with polyamide particles coated with silver

    Czech Academy of Sciences Publication Activity Database

    Krupa, I.; Miková, G.; Novák, I.; Janigová, I.; Nógellová, Z.; Prokeš, J.; Lednický, František

    2007-01-01

    Roč. 43, č. 6 (2007), s. 2401-2413. ISSN 0014-3057 Institutional research plan: CEZ:AV0Z40500505 Keywords : electro-conductive composites * silver coated filler * mechanical properties * adhesion Subject RIV: CD - Macromolecular Chemistry Impact factor: 2.248, year: 2007

  8. Korean and Foreign Students' Perceptions of the Teacher's Role in a Multicultural Online Learning Environment in Korea

    Science.gov (United States)

    Lee, Dong Yub

    2011-01-01

    This study investigated Korean and foreign students' perception of the teacher's role in multicultural online learning environments in Korea. On the basis of a literature review, a survey questionnaire was developed and piloted with 248 university students in Korea. The questionnaire was subsequently modified on the basis of the results of the…

  9. Fission Dynamics of Compound Nuclei

    OpenAIRE

    Iwata, Yoritaka; Heinz, Sophia

    2012-01-01

    Collisions between $^{248}$Cm and $^{48}$Ca are systematically investigated by time-dependent density functional calculations with evaporation prescription. Depending on the incident energy and impact parameter, fusion, deep-inelastic and quasi-fission events are expected to appear. In this paper, possible fission dynamics of compound nuclei is presented.

  10. A comparison of annual and seasonal carbon dioxide effluxes between subarctic Sweden and high-arctic Svalbard

    DEFF Research Database (Denmark)

    Björkman, Mats P.; Morgner, Elke; Björk, Robert G.; Cooper, Elisabet J.; Elberling, Bo; Klemedtsson, Leif

    2010-01-01

    winter effluxes between snow regimes or vegetation types, indicating that spatial variability in winter soil CO2 effluxes are not directly linked to snow cover thickness or soil temperatures. Total winter emissions (0.004– 0.248 kg CO2 m–2) were found to be in the lower range of those previously...

  11. Macroporous hydrogels based on 2-hydroxyethyl methacrylate. Part 3. Hydrogels as carriers for immobilization of proteins

    Czech Academy of Sciences Publication Activity Database

    Michálek, Jiří; Přádný, Martin; Artyukhov, A.; Šlouf, Miroslav; Smetana Jr., K.

    2005-01-01

    Roč. 16, č. 8 (2005), s. 783-786. ISSN 0957-4530 R&D Projects: GA ČR GA203/01/0737; GA AV ČR IBS4050005; GA MŠk LN00A065 Keywords : macroporous hydrogels * hydroxyethyl methacrylate * crosslinked copolymers Subject RIV: CD - Macromolecular Chemistry Impact factor: 1.248, year: 2005

  12. Purification of a New Manganese Peroxidase of the White-Rot Fungus Irpex lacteus and Degradation of Polycyclic Aromatic Hydrocarbons by the Enzyme

    Czech Academy of Sciences Publication Activity Database

    Baborová, Petra; Möder, M.; Baldrian, Petr; Cajthamlová, Kamila; Cajthaml, Tomáš

    2006-01-01

    Roč. 157, - (2006), s. 248-253. ISSN 0923-2508 R&D Projects: GA AV ČR KJB6020308; GA AV ČR KJB600200516 Institutional research plan: CEZ:AV0Z50200510 Keywords : anthracene * biodegradation * irpex lacteus Subject RIV: EE - Microbiology, Virology Impact factor: 2.504, year: 2006

  13. Fissibility of compound nuclei

    CERN Document Server

    Iwata, Yoritaka

    2012-01-01

    Collisions between $^{248}$Cm and $^{48}$Ca are systematically investigated by time-dependent density functional calculations with evaporation prescription. Depending on the incident energy and impact parameter, fusion, deep-inelastic and fission events are expected to appear. In this paper, a microscopic method of calculating the fissibility of compound nuclei is presented.

  14. Polyvinylchloride/clay nanocomposites based on the alkyl-amine intercalates with different length of chain

    Czech Academy of Sciences Publication Activity Database

    Kalendová, A.; Pospíšil, M.; Kovářová, L.; Měřínská, D.; Šimoník, J.; Čapková, P.; Valášková, M.; Vlková, Helena

    Akron : Polymer Processing Society , 2004. s. 248. [Polymer Processing Society Annual Meeting. 20.06.2004-24.06.2004, Akron] R&D Projects: GA AV ČR KSK4050111 Keywords : polyvinylchloride/clay * alkyl-amine intercalates * polymer nanotechnology Subject RIV: CD - Macromolecular Chemistry

  15. Relationships of new world Phlebotomine sand flies (Diptera: Psychodidae based on fossil evidence

    Directory of Open Access Journals (Sweden)

    José Dilermando Andrade Filho

    2003-01-01

    Full Text Available The fossil record and systematics of phlebotomid sand flies, vectors of leishmaniasis and arbovirus in several regions of the world, strongly support that living genera existed long before the Oligocene (38 million years, myr. A common Phlebotominae ancestor was present in the Triassic period before the separations of continents (248 myr.

  16. An integrative taxonomic approach to assess the status of Corsican bumblebees: implications for conservation

    Czech Academy of Sciences Publication Activity Database

    Lecocq, T.; Brasero, N.; De Meulemeester, T.; Michez, D.; Dellicour, S.; Lhomme, P.; de Jonghe, R.; Valterová, Irena; Urbanová, Klára; Rasmont, P.

    2015-01-01

    Roč. 18, č. 3 (2015), s. 236-248. ISSN 1367-9430 Institutional support: RVO:61388963 Keywords : Bayesian * bumblebees * endemic * evolutionarily significant unit * genetic marker * insular Subject RIV: CC - Organic Chemistry Impact factor: 2.852, year: 2014

  17. Boj proti terorismu v právu EU - trestněprávní rovina

    Czech Academy of Sciences Publication Activity Database

    Stočesová, Simona

    Praha : Vysoká škola aplikovaného práva, 2007 - (Blahož, J.), s. 239-248 ISBN 978-80-86775-13-5 R&D Projects: GA AV ČR IAA700680702 Institutional research plan: CEZ:AV0Z70680506 Keywords : fight against terrorism * criminal law * EU law Subject RIV: AG - Legal Sciences

  18. 77 FR 57092 - Agency Information Collection Activities; Submission for Office of Management and Budget Review...

    Science.gov (United States)

    2012-09-17

    ... Experimental Studies,'' Critical Reviews in Food Science and Nutrition, vol. 48, pp. 160-176, 2008. 9. Kapsak... Presentations for Qualified Health Claims,'' Critical Reviews in Food Science and Nutrition, vol. 48, pp. 248... notice in the Federal Register (72 FR 72738; December 21, 2007) (the 2007 notice) announcing the...

  19. The Language Growth of Spanish-Speaking English Language Learners

    Science.gov (United States)

    Rojas, Raul; Iglesias, Aquiles

    2013-01-01

    Although the research literature regarding language growth trajectories is burgeoning, the shape and direction of English Language Learners' (ELLs) language growth trajectories are largely not known. This study used growth curve modeling to determine the shape of ELLs' language growth trajectories across 12,248 oral narrative language samples…

  20. Zonisamide suppresses the tonic phase but not the clonic phase of generalized seizures in developing rats

    Czech Academy of Sciences Publication Activity Database

    Mareš, Pavel

    2010-01-01

    Roč. 92, 2-3 (2010), s. 244-248. ISSN 0920-1211 R&D Projects: GA MŠk(CZ) LC554 Institutional research plan: CEZ:AV0Z50110509 Keywords : zonisamide * pentylenetetrazol * ontogeny Subject RIV: FR - Pharmacology ; Medidal Chemistry Impact factor: 2.302, year: 2010

  1. 24 CFR 50.20 - Categorical exclusions subject to the Federal laws and authorities cited in § 50.4.

    Science.gov (United States)

    2010-04-01

    ... extraordinary circumstances (40 CFR 1508.4), the requirements of NEPA shall apply (see paragraph (b) of this... incentives) under 24 CFR part 248. (b) For categorical exclusions having the potential for significant impact... the Federal laws and authorities cited in § 50.4. 50.20 Section 50.20 Housing and Urban...

  2. Parasitism of Trichoderma on Meloidogyne javanica and role of the gelatinous matrix

    Science.gov (United States)

    Trichoderma (T. asperellum-203, 44 and GH11; T. atroviride-IMI 206040 and T. harzianum-248) parasitism on Meloidogyne javanica life stages was examined in vitro. Conidium attachment and parasitism differed among the various fungi. Egg masses, their derived eggs and second-stage juveniles (J2) were p...

  3. Drug: D10447 [KEGG MEDICUS

    Lifescience Database Archive (English)

    Full Text Available D10447 Drug Pegbovigrastim (USAN) C859H1370N236O248S9 . [C2H4O]n TPLGPARSLP QSFLLKCLEQ VRKIQADGA ... Y LAEP (disulfide bridges: 36-42, 64-74) (modified residues : 133 F=4-(methoxyPEGcarbonylaminoethoxyiminoethyl) ...

  4. Science and Technology Teachers' Opinions about Problems Faced While Teaching 8th Grade Science Unit "Force and Motion" and Suggestions for Solutions

    Science.gov (United States)

    Bozdogan, Aykut Emre; Uzoglu, Mustafa

    2015-01-01

    The aim of this study is to explore the problems encountered while teaching force and motion unit in 8th grade science and technology course from teachers' perspectives and offer solutions to eliminate these problems. The study was conducted with 248 science and technology teachers working in 7 regions in Turkey in 2012-2013 academic year.…

  5. Influence of Polyurethane Geocomposite Architecture on its Physical-Mechanical Properties - Model Study

    Czech Academy of Sciences Publication Activity Database

    Ščučka, Jiří

    Ostrava : VŠB-TU, 2007 - (Frydrýšek, K.). s. 203-204 ISBN 978-80-248-1389-9. [Applied Mechanics 2007/9./. 16.04.2007-19.04.2007, Malenovice] Institutional research plan: CEZ:AV0Z30860518 Keywords : polyurethane geocomposites * physical-mechanical properties Subject RIV: JI - Composite Materials

  6. Go4Life

    Medline Plus

    Full Text Available ... CC 2:48 Play next Play now Go4Life Exercise--Back Of Leg Stretch - Duration: 2 minutes, 48 ... CC 2:27 Play next Play now Go4Life Exercise--Ankle Stretch - Duration: 2 minutes, 27 seconds. National ...

  7. The Holy Logos in the Writings of Philo of Alexandria

    Czech Academy of Sciences Publication Activity Database

    Hoblík, Jiří

    2014-01-01

    Roč. 56, č. 3 (2014), s. 248-266. ISSN 0010-3713 R&D Projects: GA ČR(CZ) GBP401/12/G168 Institutional support: RVO:67985955 Keywords : Philo of Alexandria * Ancient Jewish philosophy * Logos * holiness Subject RIV: AA - Philosophy ; Religion

  8. A Model of Reading Comprehension in Chinese Elementary School Children

    Science.gov (United States)

    Yeung, Pui-sze; Ho, Connie Suk-han; Chan, David Wai-ock; Chung, Kevin Kien-hoa; Wong, Yau-kai

    2013-01-01

    The relationships of reading-related skills (rapid naming, morphological awareness, syntactic skills, discourse skills, and verbal working memory) and word reading to reading comprehension were examined among 248 Chinese fourth graders in Hong Kong. Multiple regression analysis results showed that syntactic skills (word order knowledge,…

  9. Photoluminescence and Scintulation properties of Pb2+ based quantum dots in CsCl host crystal

    Czech Academy of Sciences Publication Activity Database

    Nikl, Martin; Nitsch, Karel; Dafinei, T.; Lecoque, P.; Pazzi, G.P.; Fabeni, P.; Gurioli, M.

    Pittsburh : Materials Research Society, 1994 - (Weber, M.; Lecoq, P.; Ruchti, R.; Wiidy, C.; Yen, W.; Zhu, R.), s. 6-12 ISBN 1-55899-248-0. - (Materials Research Society Symposium Proceedings.. 348). [MRS Spring Meeting 1994. San Francisco (US), 04.04.1994-08.04.1994] Grant ostatní: EC Network (EU) CIPDCT940037

  10. Photoluminescence and scintillation properties of Pb2+ based quantum dots in CsCl host crystal

    Czech Academy of Sciences Publication Activity Database

    Nikl, Martin; Nitsch, Karel; Dafinei, I.; Lecoq, P.; Pazzi, G.P.; Fabeni, P.; Gurioli, M.

    Pittsburgh : Materials Research Society, 1994 - (Weber, M.; Lecog, P.; Ruchti, R.), s. 155-160 ISBN 1-55899-248-0. - (Materials Research Society Symposium Proceedings.. 348). [Scintillator and Phosphor Materials. San Francisco (US), 06.04.1994-08.04.1994] R&D Projects: GA ČR 02/93/2033 Grant ostatní: EC Network (EU) CIPDCT940037

  11. Bacterial populations within copper mine tailings: long-term effects of amendment with Class A biosolids

    Science.gov (United States)

    This study evaluates the effect of surface application of dried Class A biosolids on microbial populations within copper mine tailings. Methods and Results: Mine tailing sites were established at ASARCO Mission Mine close to Sahuarita, Arizona. Site 1 (Dec. 1998) was amended with 248 tons ha-1 of C...

  12. EST Table: FS766417 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available FS766417 E_FL_fcaL_42N22_F_0 10/09/28 98 %/245 aa ref|NP_001161755.1| integrin beta subunit 2 [B ... 30 %/248 aa ZK1058.2#CE01102#WBGene00003930#locus:pat -3#beta integrin#status:Confirmed#UniProt:Q27874#pr ...

  13. Seventieth birthday of Ivo Marek?

    Czech Academy of Sciences Publication Activity Database

    Blaheta, Radim

    Ostrava : VŠB TU, 2003 - (Blaheta, R.; Starý, J.), s. 7-9 ISBN 80-248-0255-4. [Numerical Analysis. Ostrava (CZ), 17.02.2003-18.02.2003] Institutional research plan: CEZ:AV0Z3086906 Keywords : Ivo Marek * numerical mathematics Subject RIV: BA - General Mathematics

  14. Hnízdní a zpěvní aktivita ptáků afrotropického deštného lesa podél gradientu nadmořské výšky

    Czech Academy of Sciences Publication Activity Database

    Zenklová, T.; Vokurková, J.; Motombi, F. N.; Ferenc, M.; Albrecht, Tomáš; Hořák, D.; Sedláček, O.

    Brno : Ústav biologie obratlovců AV ČR, 2016 - (Bryja, J.; Sedláček, F.; Fuchs, R.). s. 248 ISBN 978-80-87189-20-7. [Zoologické dny. 11.02.2016-12.02.2016, České Budějovice] Institutional support: RVO:68081766 Keywords : African birds Subject RIV: EG - Zoology

  15. Thermally controlled association in aqueous solutions of poly(L-lysine) grafted with poly(N-isopropylacrylamide)

    Czech Academy of Sciences Publication Activity Database

    Koňák, Čestmír; Reschel, Tomáš; Oupický, David; Ulbrich, Karel

    2002-01-01

    Roč. 18, č. 21 (2002), s. 8217-8222. ISSN 0743-7463 R&D Projects: GA AV ČR IAA1050201; GA AV ČR IAA1050101 Institutional research plan: CEZ:AV0Z4050913 Keywords : graft copolymers * poly(L- lysine ) * poly(N-isopropylacrylamide) Subject RIV: BJ - Thermodynamics Impact factor: 3.248, year: 2002

  16. Identification of phosphorylation sites in Hansenula polymorpha Pex14p by mass spectrometry.

    Science.gov (United States)

    Tanaka, Katsuhiro; Soeda, Maiko; Hashimoto, Yoichiro; Takenaka, Shigeo; Komori, Masayuki

    2013-01-01

    Pex14p is a peroxisomal membrane protein that is involved in both peroxisome biogenesis and selective peroxisome degradation. Previously, we showed that Hansenula polymorpha Pex14p was phosphorylated in vivo. In this study, we identified its phosphorylation site by mass spectrometry. Recombinant His-tagged Pex14p (H6-Pex14p) was overexpressed and purified from the yeast. The protein band corresponding to H6-Pex14p was in-gel digested with trypsin and subjected to LC/MS. As a result of LC/MS, Thr(248) and Ser(258) were identified as the phosphorylated sites. To confirm the phosphorylation sites and explore its functions, we made Ala mutants of the candidate amino acids. In the western blot analysis with anti-Pex14p, S258A mutant gave doublet bands while wild type (WT) and T248A mutants gave triplet bands. Moreover, the double mutant (T248A/S258A) gave a single band. WT and all mutant Pex14p labeled with [(32)P] orthophosphate were immunoprecipitated and analyzed by autoradiography. The phosphorylation of Pex14p was suppressed in S258A mutant, but enhanced in T248A mutant compared to WT. Moreover, the phosphorylated Pex14p was not detected in the T248A/S258A double mutant. All mutants were able to grow on methanol and their matrix proteins (alcohol oxidase and amine oxidase) were mostly localized in peroxisomes. Furthermore all mutants showed selective degradation of peroxisome like WT during the glucose-induced macropexophagy. PMID:23847754

  17. Laser-induced UV photodissociation of 2-bromo-2-nitropropane: dynamics of OH and Br formation.

    Science.gov (United States)

    Saha, Ankur; Kawade, Monali; Upadhyaya, Hari P; Kumar, Awadhesh; Naik, Prakash D

    2011-01-28

    Photoexcitation of 2-bromo-2-nitropropane (BNP) at 248 and 193 nm generates OH, Br, and NO(2) among other products. The OH fragment is detected by laser-induced fluorescence spectroscopy, and its translational and internal state distributions (vibration, rotation, spin-orbit, and Λ-doubling components) are probed. At both 248 and 193 nm, the OH fragment is produced translationally hot with the energy of 10.8 and 17.2 kcal∕mol, respectively. It is produced vibrationally cold (v" = 0) at 248 nm, and excited (v" = 1) at 193 nm with a vibrational temperature of 1870 ± 150 K. It is also generated with rotational excitation, rotational populations of OH(v" = 0) being characterized by a temperature of 550 ± 50 and 925 ± 100 K at 248 and 193 nm excitation of BNP, respectively. The spin-orbit components of OH(X(2)Π) are not in equilibrium on excitation at 193 nm, but the Λ-doublets are almost in equilibrium, implying no preference for its π lobe with respect to the plane of rotation. The NO(2) product is produced electronically excited, as detected by measuring UV-visible fluorescence, at 193 nm and mostly in the ground electronic state at 248 nm. The Br product is detected employing resonance-enhanced multiphoton ionization with time-of-flight mass spectrometer for better understanding of the dynamics of dissociation. The forward convolution analysis of the experimental data has provided translational energy distributions and anisotropy parameters for both Br((2)P(3∕2)) and Br∗((2)P(1∕2)). The average translational energies for the Br and Br∗ channels are 5.0 ± 1.0 and 6.0 ± 1.5 kcal∕mol. No recoil anisotropies were observed for these products. Most plausible mechanisms of OH and Br formation are discussed based on both the experimental and the theoretical results. Results suggest that the electronically excited BNP molecules at 248 and 234 nm relax to the ground state, and subsequently dissociate to produce OH and Br through different channels. The

  18. CD151 promotes proliferation of and eNOS expression in human umbilical endothelial cell%CD151蛋白促内皮细胞增殖和eNOS蛋白表达

    Institute of Scientific and Technical Information of China (English)

    彭丹; 左后娟; 秦瑾; 刘正湘; 汪道文

    2011-01-01

    目的 研究CD151及其突变体CD151-ARSA245-248对人脐静脉内皮细胞(HUVEC)增殖及eNOS 表达的影响,探讨CD151促血管生成的机制.方法 构建pAAV-CD151及其突变体CD151-ARSA245-248(囊泡运输缺陷突变体),并转染HUVEC.CCK-8法测定HUVEC增殖的能力,Western Blot检测CD151及eNOS蛋白的表达.结果 pAAV-CD151组及pAAV- CD151-ARSA245-248组CD151蛋白表达均增加,显著高于正常对照组和pAAV-GFP组(P<0.05),但pAAV-CD151组及pAAV- CD151-ARSA245-248组之间CD151蛋白表达没有统计学意义(P>0.05).CCK-8法测定HUVEC增殖能力亦无统计学意义(P>0.05).正常对照组,pAAV-GFP组,pAAV-CD151组及pAAV-CD151-ARSA245-248突变体组的OD值分别为1.393±1.68、1.498±1.746、2.346±2.52和1.71±1.863,pAAV-CD151组较pAAV-GFP组和正常对照组细胞增殖能力明显增强(P<0.01),pAAV-CD151 -ARSA245-248组较pAAV-CD151组细胞增殖能力减弱(P<0.05).此外,pAAV-CD151组eNOS蛋白表达较pAAV-GFP组和正常对照组明显增加(P<0.01),pAAV-CD151 -ARSA245-248组较pAAV-CD151组eNOS蛋白表达降低(P<0.05).结论 CD151是促细胞增殖的重要蛋白质,CD151影响eNOS信号通路的激活.上述机制可能为CD151促血管生成的重要机制之一.%Objective To investigate the effect of CD151 and CD151- ARSA245-248 mutant on the proliferation of human umbilical vein endothelial cells (HUVEC) and eNOS phosphorylation. Methods We constructed pAAV-CD151 and pAAV-CD151 pAAV_CD151_ARSA245-248 mutant, and transfected HUVECs mediated with Fugene HD. After transfection, the expressions of CD 151 , eNOS and phospho-eNOS were measured by western blot. Proliferation of HUVECs was measured by Cell Counting Kit-8 assay. Results The expression of CD151 protein in pAAV-CD151, pAAV_CD151_ARSAp245-248 groups were significantly higher than in the control group and pAAV-GFP group (P<0. 05). The OD values in control, pAAV-GFP, pAAV-CD151, pAAV-CD151-ARSA245-248 groups were 1. 393 ±1. 685 , 1. 498

  19. She will givebirth easily: therapeutic approaches to childbirth in 1st millennium BCE cuneiform sources.

    Science.gov (United States)

    Couto-Ferreira M Erica

    2014-01-01

    This article offers, in the first place, an overview on women's healthcare in relation to childbirth in ancient Mesopotamia, as an introduction that helps to evaluate the meaning of the 7th century Assur text BAM 248 within therapeutic cuneiform texts on childbirth. We proceed to analyse the variety of therapeutic approaches to childbirth present in BAM 248, which brings together various healing devices to help a woman give birth quickly and safely. We analyse the text in its entirety as an example of intersection between different medical approaches to childbirth, given the number of differences in the complexity of remedies, in the materia medica employed, in the methods of preparation and application, even in the technical knowledge required and also, most probably, in the social origin and/or use of the remedies in question. PMID:25508816

  20. A Survey and Analysis on Dietary Behavior of Children Aged 3-6 in a Community of Shanghai%上海市某社区3~6岁儿童饮食行为调查分析

    Institute of Scientific and Technical Information of China (English)

    汤红梅; 何丹丹; 严玉洁; 方红; 周洁

    2012-01-01

    [Objective] To understand the dietary behavior of children aged 3-6 years old and the relevant family factors to provide scientific basis for developing effective intervention programs. [ Methods ] A total of 254 parents of kindergarten children in Minhang district were selected by random cluster sampling, and the information of dietary behavior issues and influencing factors was collected through questionnaire, with 248 questionnaires available. [ Results ] According to the questionnaire, 36.3% of the children (90/248) rendered problematic dietary habits, 4,8% of them (12/248) did not have breakfast every morning, and the top three unhealthy dietary habits were eating snacks (76.6%), being half-hearted during meals (62.1%), and picky eating (48.0%). In addition, 38.7% of them (96/248) took breakfast in poor quality. They mostly consumed traditional cereals for break fast instead of food with high quality protein. There was a significant positive correlation between children's dietary habits and parents'(r=0.262, r = 0.309; P<0.01). [ Conclusion ] Among the children aged 3-6 years old in this community, the overall quality of breakfast was not high, and more than 1/3 of them rendered unhealthy eating habits. The direct factor influencing children's dietary habits is derived from their parents, so the education of dietary behavior delivered to parents is critical and need to be strengthened.%[目的]了解上海市某社区3~6岁儿童的饮食行为及其父母对儿童饮食行为的影响,为制定有效的干预措施提供科学依据.[方法]采用整群抽样方法,抽取闵行区某幼儿园254名儿童家长进行问卷调查,回收合格问卷248份,收集儿童饮食行为及影响因素的信息. [结果] 36.3%( 90/248)的儿童饮食行为习惯差,4.8%( 12/248)的儿童不能坚持每天吃早餐;不良饮食行为占前3位的为喜欢吃零食(76.6%)、不专心吃饭(62.1%)和挑食( 48.0%);38.7%( 96/248)的儿童早餐质量较

  1. Possibility of methane conversion into heavier hydrocarbons using nanosecond lasers

    Science.gov (United States)

    Navid, H. A.; Irani, E.; Sadighi-Bonabi, R.

    2016-03-01

    Effect of nanosecond lasers on the methane dissociation is experimentally studied by using three different laser wavelengths at 248 nm, 355 nm and 532 nm. C2H2 generation is measured as a major reaction product in experiments and the energy consumptions in production of this component are measured as 5.8 MJ/mol, 3.1 MJ/mol and 69.0 MJ/mol, for 355 nm, 532 nm and 248 nm wavelengths, respectively. The mechanism of conversion and production of new stable hydrocarbons is also theoretically investigated. It is found that in theoretical calculations, the ion-molecule reactions should be included and this leads to a unique approach in proper explanation of the experimental measurements.

  2. AcEST: DK947025 [AcEST

    Lifescience Database Archive (English)

    Full Text Available . 32 1.3 sp|O51710|GCP_BORBU Probable O-sialoglycoprotein endopeptidase O... 32 1.3 sp|Q4LBB9|OCTB2_DROME Octopamine recepto...WY+ S+S +T C H+ ++FKS+ KN+ +A F+ FEN Sbjct: 204 ENWYDFSYSGLKTACIHQLEKFKSKDNPTTKNNIAASFQKAAFEN 248 >sp|Q4LBB9|OCTB2_DROME Octopamine...idase O... 30 2.9 sp|Q9ZE28|Y120_RICPR Uncharacterized protein RP120 OS=Rickettsi...N 248 >sp|Q9ZE28|Y120_RICPR Uncharacterized protein RP120 OS=Rickettsia prowazekii GN=RP120 PE=4 SV=1 Length...1997), Gapped BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res.

  3. UV and RIR matrix assisted pulsed laser deposition of organic MEH-PPV films

    International Nuclear Information System (INIS)

    A comparative study of thin film production based on gentle laser-ablation techniques has been carried out with the luminescent polymer poly[2-methoxy-5-(2'-ethylhexyloxy)-1,4-phenylene vinylene]. Using a free-electron laser films were made by resonant infrared pulsed laser deposition (RIR-PLD). For the first time resonant infrared matrix assisted pulsed laser evaporation (RIR-MAPLE) was successfully demonstrated on a luminescent polymer system. In addition to this, an excimer laser has been used for UV-MAPLE depositions at 193 and 248-nm irradiation. Films deposited onto NaCl and quartz substrates were analyzed by Fourier transform infrared spectroscopy, UV-visible absorbance and photoluminescence. Photoluminescent material was deposited by RIR-MAPLE and 248-nm MAPLE, while the RIR-PLD and 193-nm-MAPLE depositions displayed the smoothest surfaces but did not show photoluminescence

  4. Dicty_cDB: Contig-U15614-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available e-15 2 ( BJ402334 ) Dictyostelium discoideum cDNA clone:dds16k10, 3' ... 84 2e-11 1 ( FE265176 ) CAZO4316.fwd CAZO Naegleria gruberi...4 ) PL06001X1B11 cDNA from juvenile hermaphodites Sch... 52 0.009 2 ( L33848 ) Dictyostelium discoideum G pr...ideum vegetative cDNA clone:VS... 56 0.005 1 ( BJ428322 ) Dictyostelium discoideum cDNA... AZ526940 ) 261PbE04 Pb MBN #21 Plasmodium berghei genomic 3'... 34 3.8 3 ( BJ415960 ) Dictyostelium discoid...... 248 7e-64 AF011496_1( AF011496 |pid:none) Homo sapiens GTP-binding protein a... 248 7e-64 EU057176_1( EU057176 |pid:none) Helicov

  5. Effects of pH on the Structure and Function of Carboxypeptidase A: Crystallographic Studies

    OpenAIRE

    Shoham, G; Rees, D. C.; Lipscomb, W N

    1984-01-01

    High-resolution crystal structures are described for carboxypeptidase A (EC 3.4.17.1) in crystals grown at pH 8.5, 9.0, and 9.5 and compared with the structure at pH 7.5. The comparison shows that in the pH range of 7.5-9.5 the enzyme structure is practically unchanged, and, most importantly, that the flexible side chain of Tyr-248 remains exclusively in the "up" position, away from the Zn atom, throughout the pH range. There is no evidence for binding of Tyr-248 to Zn at any of these pH valu...

  6. Nanosecond and femtosecond ablation of La0.6Ca0.4CoO3: a comparison between plume dynamics and composition of the films

    DEFF Research Database (Denmark)

    Canulescu, Stela; Papadopoulou, E.; Anglos, D.;

    2011-01-01

    Thin films of La0.6Ca0.4CoO3 were grown by pulsed laser ablation with nanosecond and femtosecond pulses. The films deposited with femtosecond pulses (248 nm, 500 fs pulse duration) exhibit a higher surface roughness and deficiency in the cobalt content compared to the films deposited with...... nanosecond pulses (248 nm, 20 ns pulse duration). The origin of these pronounced differences between the films grown by ns and fs ablation has been studied in detail by time-resolved optical emission spectroscopy and imaging. The plumes generated by nanosecond and femtosecond ablation were analyzed in vacuum...... similar velocities of the plume species are observed for fs and ns laser ablation. The different film compositions are therefore not related to different kinetic energies and different distributions of various species in the plasma plume which has been identified as the origin of the deficiency of species...

  7. High prevalence of Pneumocystis jirovecii colonization in Brazilian cystic fibrosis patients.

    Science.gov (United States)

    Pederiva, Marco A; Wissmann, Gustavo; Friaza, Vicente; Morilla, Rubem; de La Horra, Carmen; Montes-Cano, Marco A; Goldani, Luciano Z; Calderón, Enrique J; Prolla, João C

    2012-07-01

    A high rate of Pneumocystis jirovecii colonization was observed in Brazilian cystic fibrosis (CF) patients (13 out of 34; 38.2%) who underwent bronchoscopy between March 2006 and August 2009 at the Hospital de Clinicas de Porto Alegre, Brazil. Bronchoalveolar lavage samples were collected from these patients and studied by nested PCR amplification of the mitochondrial gene coding for the large subunit ribosomal RNA (mtLSUrDNA). The observed rate of colonization was higher than that reported in European populations. Genotypic characterization of the mtLSUrDNA locus revealed a predominance of the polymorphisms 85C/248C (genotype 1) and 85T/248C (genotype 3), with all samples possessing the wild-type genotype of dihydropteroate synthase. These findings suggest that cystic fibrosis patients could be an important reservoir and source of P. jirovecii infection. Further studies are required to elucidate the role of this common fungal colonization in the evolution of CF patients. PMID:22206262

  8. Effects in heavy-ion radiation damage on target lifetimes in UNILAC experiments

    International Nuclear Information System (INIS)

    This work is mainly the result of a literature research on effects of radiation damage occurring in targets commonly used in heavy-ion bombardments. Concepts and models for the description of radiation damage effects in solids as well as experimental methods for the quantitative characterization of such effects are reviewed. Some of these concepts are applied to the practical case of bombardments of 248Cm-metal targets or refractory element substrates with high-intensity beams of approx. equal to 7 MeV/n 238U-ions. Experimental observations during these bombardments, evaluation of macroscopic properties of the bombarded targets, as well as results from simulations of the bombarding conditions by electron-beams and low-energy heavy-ion beams are reported. This results in several conclusions concerning the limited life-time of the 248Cm-targets and suggestions for future tests and target modifications. (orig.)

  9. Band-gap narrowing of TiO2 films induced by N-doping

    International Nuclear Information System (INIS)

    N-doped TiO2 films were deposited on n + -GaN/Al2O3 substrates by reactive magnetron sputtering and subsequently crystallized by annealing at 550 oC in flowing N2 gas. The N-doping concentration was ∼8.8%, as determined from X-ray photoelectron spectroscopy measurements. Deep-level optical spectroscopy measurements revealed two characteristic deep levels located at 1.18 and 2.48 eV below the conduction band. The 1.18 eV level is probably attributable to the O vacancy state and can be active as an efficient generation-recombination center. Additionally, the 2.48 eV band is newly introduced by the N-doping and contributes to band-gap narrowing by mixing with the O 2p valence band

  10. Excimer laser-induced material modification to create nanometer high smooth patterns in glass using mask projection

    Energy Technology Data Exchange (ETDEWEB)

    Rudolph, Thomas; Zimmer, Klaus; Boehme, Rico; Ruthe, David [Leibniz-Institut fuer Oberflaechenmodifizierung e.V., Permoserstrasse 15, D-04318 Leipzig (Germany)

    2007-04-15

    Laser swelling of borosilicate and soda-lime glass is shown for wavelengths of 193 and 248 nm. Very smooth patterns up to 45 nm high were generated by KrF laser (248 nm) irradiation of borosilicate glass at a fluence of 1.5 J/cm{sup 2}. At 193 nm laser wavelength, lower heights (up to 13 nm) and lower swelling threshold fluences (0.1 J/cm{sup 2}) were observed due to higher material absorption. For the less absorbing soda-lime glass higher fluences than for the borosilicate glass are needed to establish elevated structures. Gratings in borosilicate glass with sub-micron periodicity demonstrate the high resolution of the method. The results can be explained by a thermo-physical model based on the change of the glass transition temperature due to fast cooling after the pulsed laser irradiation.

  11. Epigallocatechin-3-gallate rapidly remodels PAP85-120, SEM1(45-107, and SEM2(49-107 seminal amyloid fibrils

    Directory of Open Access Journals (Sweden)

    Laura M. Castellano

    2015-09-01

    Full Text Available Semen harbors amyloid fibrils formed by proteolytic fragments of prostatic acid phosphatase (PAP248-286 and PAP85-120 and semenogelins (SEM1 and SEM2 that potently enhance HIV infectivity. Amyloid but not soluble forms of these peptides enhance HIV infection. Thus, agents that remodel these amyloid fibrils could prevent HIV transmission. Here, we confirm that the green tea polyphenol, epigallocatechin-3-gallate (EGCG, slowly remodels fibrils formed by PAP248-286 termed SEVI (semen derived enhancer of viral infection and also exerts a direct anti-viral effect. We elucidate for the first time that EGCG remodels PAP85-120, SEM1(45-107, and SEM2(49-107 fibrils more rapidly than SEVI fibrils. We establish EGCG as the first small molecule that can remodel all four classes of seminal amyloid. The combined anti-amyloid and anti-viral properties of EGCG could have utility in preventing HIV transmission.

  12. AcEST: DK946621 [AcEST

    Lifescience Database Archive (English)

    Full Text Available |A7TCL2|A7TCL2_NEMVE Predicted protein (Fragment) OS=Nematoste... 72 1e-11 tr|A7TAG1|...A7TAG1_NEMVE Predicted protein (Fragment) OS=Nematoste... 72 1e-11 tr|A7T248|A7T2...48_NEMVE Predicted protein (Fragment) OS=Nematoste... 72 1e-11 tr|A7SUL8|A7SUL8_NEMVE Predicted protein (Fragment) OS=Nematos...te... 72 1e-11 tr|A7SPY6|A7SPY6_NEMVE Predicted protein (Fragment) OS=Nematoste... 72 1e-11 tr...|A8DVI0|A8DVI0_NEMVE Predicted protein (Fragment) OS=Nematoste... 72 1e-11 tr|A7SWL7|A7SWL7_NEMVE Predicted protein (Fra

  13. AcEST: DK947788 [AcEST

    Lifescience Database Archive (English)

    Full Text Available 8DWE6_NEMVE Predicted protein (Fragment) OS=Nematoste... 74 4e-12 tr|A9U5J8|A9U5J8_PHYPA Predicted protein OS=Physcomitrella pat...ne protein oxaA OS=Paracoccus denitrificans (strain Pd 1222) GN=oxaA ...|A7T248|A7T248_NEMVE Predicted protein (Fragment) OS=Nematoste... 81 2e-14 tr...|A7TCL2|A7TCL2_NEMVE Predicted protein (Fragment) OS=Nematoste... 81 3e-14 tr|A7TAG1|A7TAG1_NEMVE Predicted protein (Fra...gment) OS=Nematoste... 81 3e-14 tr|A7SUL8|A7SUL8_NEMVE Predicted protein (Fragment) OS=Nematoste... 81 3e-14 tr

  14. AcEST: DK946347 [AcEST

    Lifescience Database Archive (English)

    Full Text Available A8DWE6_NEMVE Predicted protein (Fragment) OS=Nematoste... 69 9e-11 tr|A9TBN2|A9TBN2_PHYPA Predicted protein (Fragment) OS=Physcomit...|A7TCL2|A7TCL2_NEMVE Predicted protein (Fragment) OS=Nematoste... 76 7e-13 tr|A7TAG1|A7TAG1_NEMVE Predicted protein (Fra...gment) OS=Nematoste... 76 7e-13 tr|A7T248|A7T248_NEMVE Predicted protein (Fra...gment) OS=Nematoste... 76 7e-13 tr|A7SUL8|A7SUL8_NEMVE Predicted protein (Fragment) OS=Nematoste... 76 7e-13 tr...|A7SPY6|A7SPY6_NEMVE Predicted protein (Fragment) OS=Nematoste... 76 7e-13 tr|A8DVI0|A8DVI0_

  15. AcEST: DK946393 [AcEST

    Lifescience Database Archive (English)

    Full Text Available gment) OS=Nematoste... 59 1e-07 tr|A9TBN2|A9TBN2_PHYPA Predicted protein (Fragment) OS=Physcomit... 54 3e-06 tr...IEGSYSA 171 TrEMBL (release 39.9) Link to BlastX Result : TrEMBL tr_hit_id A5BKB8 Definition tr|A5BKB8|A5BKB8_VITVI Putative unchara...ella paten... 67 3e-10 tr|A7T248|A7T248_NEMVE Predicted protein (Fragment) OS=Nematoste... 66 7e-10 tr...|A7TCL2|A7TCL2_NEMVE Predicted protein (Fragment) OS=Nematoste... 66 1e-09 tr|A7TAG1|A7TAG1..._NEMVE Predicted protein (Fragment) OS=Nematoste... 66 1e-09 tr|A7SUL8|A7SUL8_NEMVE Predicted protein (Fragment) OS=Nematos

  16. AcEST: DK947806 [AcEST

    Lifescience Database Archive (English)

    Full Text Available |A7T248|A7T248_NEMVE Predicted protein (Fragment) OS=Nematoste... 78 2e-13 tr|A7TCL2|...A7TCL2_NEMVE Predicted protein (Fragment) OS=Nematoste... 78 3e-13 tr|A7TAG1|A7TA...G1_NEMVE Predicted protein (Fragment) OS=Nematoste... 78 3e-13 tr|A7SUL8|A7SUL8_NEMVE Predicted protein (Fragment) OS=Nematos...te... 78 3e-13 tr|A7SPY6|A7SPY6_NEMVE Predicted protein (Fragment) OS=Nematoste... 78 3e-13 tr...|A8DVI0|A8DVI0_NEMVE Predicted protein (Fragment) OS=Nematoste... 77 3e-13 tr|A7SWL7|A7SWL7_NEMVE Predicted protein (Fra

  17. Comparison of the lithographic properties of positive resists upon exposure to deep- and extreme-ultraviolet radiation

    International Nuclear Information System (INIS)

    Nineteen chemically amplified ultrathin resists were imaged using exposure to extreme-ultraviolet (EUV) (13.4 nm) and deep-ultraviolet (DUV) (248 nm) radiation. Direct comparisons were made of photospeed, resolution, and line edge roughness (LER). The photospeed of these resists at 248 nm shows a good correlation with photospeed at EUV for three polymer types, but appears independent of photoacid generator type. This result underscores the importance of the polymer in photoacid generation at EUV. Resolution showed poor correlation between DUV and EUV. Correlations were made between the line edge roughness of EUV-imaged features and unexposed film thickness loss, resist contrast, image log slope (ILS), and LER of resists exposed at DUV. Both contrast and image log slope play important roles in defining LER performance--where the best LER is achieved at high contrast and high ILS. (c) 1999 American Vacuum Society

  18. Validation Thin Layer Chromatography for the Determination of Acetaminophen in Tablets and Comparison with a Pharmacopeial Method

    OpenAIRE

    Alina Pyka; Marika Budzisz; Małgorzata Dołowy

    2013-01-01

    Adsorption thin layer chromatography (NP-TLC) with densitometry has been established for the identification and the quantification of acetaminophen in three leading commercial products of pharmaceutical tablets coded as brand: P1 (Product no. 1), P2 (Product no. 2), and P3 (Product no. 3). Applied chromatographic conditions have separated acetaminophen from its related substances, namely, 4-aminophenol and and 4′-chloroacetanilide. UV densitometry was performed in absorbance mode at 248 nm. T...

  19. WCM component importance ranking order by SMEs: financial directors perspective

    OpenAIRE

    Afrifa, G.

    2014-01-01

    This paper reports the results of an investigation into the ranking order of Working Capital Management (WCM) components of Small and Medium Enterprises (SMEs) listed on the Alternative Investment Market (AIM), from the perspective of financial directors. The analyses are based on questionnaire distributed to 248 AIM listed SMEs. The paper employs the one-way ANOVA and post hoc test on responses from 72 managers of AIM listed SMEs. The results show differences in the importance of each com...

  20. Probabilistic reliability assessment of a pipe with a stress-corrosion crack using the SBRA method

    Czech Academy of Sciences Publication Activity Database

    Václavek, L.; Marek, Pavel; Gajdoš, Lubomír

    Ostrava : VŠB TU, 2008 - (Strnadel, B.), s. 261-268 ISBN 978-80-248-1813-9. [Grand workshop New methods of damage and failure analysis of structural parts. Ostrava (CZ), 08.09.2008-12.09.2008] R&D Projects: GA ČR(CZ) GA103/07/0557 Institutional research plan: CEZ:AV0Z20710524 Keywords : pipe * stress -corrosion crack * probability of failure * SBRA method Subject RIV: JM - Building Engineering