WorldWideScience

Sample records for berkelium 247

  1. New berkelium isotope: 242Bk

    International Nuclear Information System (INIS)

    A new isotope of berkelium, 242Bk, was produced with a cross section of approx. 10 μb in reactions of boron on uranium and nitrogen on thorium. It decays by electron capture with a half-life of 7 +- 1.3 minutes. The branching ratio for this isotope for alpha decay is less than 1% and that for spontaneous fission is less than 0.03%. 2 figures, 2 tables

  2. Characterization of berkelium(III) dipicolinate and borate compounds in solution and the solid state.

    Science.gov (United States)

    Silver, Mark A; Cary, Samantha K; Johnson, Jason A; Baumbach, Ryan E; Arico, Alexandra A; Luckey, Morgan; Urban, Matthew; Wang, Jamie C; Polinski, Matthew J; Chemey, Alexander; Liu, Guokui; Chen, Kuan-Wen; Van Cleve, Shelley M; Marsh, Matthew L; Eaton, Teresa M; van de Burgt, Lambertus J; Gray, Ashley L; Hobart, David E; Hanson, Kenneth; Maron, Laurent; Gendron, Frédéric; Autschbach, Jochen; Speldrich, Manfred; Kögerler, Paul; Yang, Ping; Braley, Jenifer; Albrecht-Schmitt, Thomas E

    2016-08-26

    Berkelium is positioned at a crucial location in the actinide series between the inherently stable half-filled 5f(7) configuration of curium and the abrupt transition in chemical behavior created by the onset of a metastable divalent state that starts at californium. However, the mere 320-day half-life of berkelium's only available isotope, (249)Bk, has hindered in-depth studies of the element's coordination chemistry. Herein, we report the synthesis and detailed solid-state and solution-phase characterization of a berkelium coordination complex, Bk(III)tris(dipicolinate), as well as a chemically distinct Bk(III) borate material for comparison. We demonstrate that berkelium's complexation is analogous to that of californium. However, from a range of spectroscopic techniques and quantum mechanical calculations, it is clear that spin-orbit coupling contributes significantly to berkelium's multiconfigurational ground state. PMID:27563098

  3. 32 CFR 247.5 - Responsibilities.

    Science.gov (United States)

    2010-07-01

    ... 32 National Defense 2 2010-07-01 2010-07-01 false Responsibilities. 247.5 Section 247.5 National... DEPARTMENT OF DEFENSE NEWSPAPERS, MAGAZINES AND CIVILIAN ENTERPRISE PUBLICATIONS § 247.5 Responsibilities. (a... Commands shall: (1) Publish Combatant Command newspapers, if authorized. In discharging this...

  4. 7 CFR 247.27 - Financial management.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 4 2010-01-01 2010-01-01 false Financial management. 247.27 Section 247.27... AGRICULTURE CHILD NUTRITION PROGRAMS COMMODITY SUPPLEMENTAL FOOD PROGRAM § 247.27 Financial management. (a) What are the Federal requirements for State and local agencies with regard to financial...

  5. 7 CFR 247.18 - Nutrition education.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 4 2010-01-01 2010-01-01 false Nutrition education. 247.18 Section 247.18 Agriculture... CHILD NUTRITION PROGRAMS COMMODITY SUPPLEMENTAL FOOD PROGRAM § 247.18 Nutrition education. (a) What are the State agency's responsibilities in ensuring that nutrition education is provided? The State...

  6. Dicty_cDB: SSI247 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSI247 (Link to dictyBase) - - - Contig-U12269-1 SSI247Z (Link... to Original site) - - SSI247Z 692 - - - - Show SSI247 Library SS (Link to library) Clone ID SSI247 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/SS/SSI2-B/SSI247Q.Seq.d/ Representative seq. ID SSI24...7Z (Link to Original site) Representative DNA sequence >SSI247 (SSI247Q) /CSM/SS/SSI2-B/SSI247Q.Seq.d/ XXXXX...f*kgrsitifsccsfw yrfvayfwlhckgilqdnqqsnrqshrrfsssllpm*wfrlvakwwfnafhysihfishy as**eitiqrt*ylc**yssiigsmg*itf

  7. 7 CFR 247.4 - Agreements.

    Science.gov (United States)

    2010-01-01

    ... provide, or cause to be provided, nutrition education to participants, as required in § 247.18; (2) An... Regulations of the Department of Agriculture (Continued) FOOD AND NUTRITION SERVICE, DEPARTMENT OF AGRICULTURE CHILD NUTRITION PROGRAMS COMMODITY SUPPLEMENTAL FOOD PROGRAM § 247.4 Agreements. (a) What agreements...

  8. Dicty_cDB: CFD247 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CF (Link to library) CFD247 (Link to dictyBase) - - - Contig-U16273-1 CFD247P (Link to Original site) CFD...247F 623 CFD247Z 396 CFD247P 1019 - - Show CFD247 Library CF (Link to library) Clone ID CFD...e URL http://dictycdb.biol.tsukuba.ac.jp/CSM/CF/CFD2-B/CFD247Q.Seq.d/ Representative seq. ID CFD...247P (Link to Original site) Representative DNA sequence >CFD247 (CFD247Q) /CSM/CF/CFD2-B/CFD... Homology vs CSM-cDNA Score E Sequences producing significant alignments: (bits) Value CFD247 (CFD247Q) /CSM/CF/CFD2-B/CFD

  9. Erythroderma: analysis of 247 cases

    Directory of Open Access Journals (Sweden)

    Cidia Vasconcellos

    1995-06-01

    Full Text Available The profile of 247 patients with erythroderma during a 23 year period from January, 1962 through March, 1985, with a follow-up period ranging from 1 to 26 years were analysed. The patients presented with diffuse erythema, scaling and pruritus of more than 2 months' duration, and the age ranged from 16 to 60 years. Psoriasis was the most frequent underlying disease with an estimated frequency of 44.9%, the reaction to the use of drugs appeared in 7.3% of total cases and association with reticulosis showed a frequency of 4.1%. The cause of the erythroderma could not be determined in 29.2% of the cases. Sex differences in terms of underlying diseases were not observed. One or more skin biopsies along with the clinical findings were diagnostic or suggestive of the underlying disease in 63.6% of the cases. Repeated skin biopsies are recommended as the best method for etiologic diagnosis of erythroderma. At P=0.05 significance level, masculine/feminine ratio of 2 : 1 was found. The question arises wether causal agent of erythroderma may not be somehow related to different exposure by sex to environmental antigens.

  10. Dicty_cDB: AFM247 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available AF (Link to library) AFM247 (Link to dictyBase) - - - - - (Link to Original site) - - AFM...247Z 829 - - - - Show AFM247 Library AF (Link to library) Clone ID AFM247 (Link to dictyBase) Atlas ID... - NBRP ID - dictyBase ID - Link to Contig - Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/AF/AFM2-B/AFM...247Q.Seq.d/ Representative seq. ID - (Link to Original site) Representative DNA sequence >AFM...247 (AFM247Q) /CSM/AF/AFM2-B/AFM247Q.Seq.d/ XXXXXXXXXXTCCCTTTAGTCCTANATAANAGGTGGTACCAATTT

  11. 48 CFR 247.572 - Policy.

    Science.gov (United States)

    2010-10-01

    ...) DoD contractors must transport supplies, as defined in the clause at 252.247-7023, Transportation of... Army determines that the proposed freight charges are excessive or unreasonable in accordance with...

  12. Dicty_cDB: SSC247 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSC247 (Link to dictyBase) - - - Contig-U16341-1 SSC247F (Link to Original site) SSC...247F 326 - - - - - - Show SSC247 Library SS (Link to library) Clone ID SSC247 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/SS/SSC2-B/SSC247Q.Seq.d/ Representative seq. ID SSC24...7F (Link to Original site) Representative DNA sequence >SSC247 (SSC247Q) /CSM/SS/SSC2-B/SSC247Q.Seq.d/ CTATG...cell wall 4.0 %: cytoskeletal 4.0 %: vacuolar 4.0 %: plasma membrane >> prediction for SSC

  13. 40 CFR 247.12 - Construction products.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 24 2010-07-01 2010-07-01 false Construction products. 247.12 Section... Construction products. (a) Building insulation products, including the following items: (1) Loose-fill... ash, recovered rubber, recovered steel, recovered wood, or recovered plastic. (k) Modular...

  14. 48 CFR 247.301-70 - Definition.

    Science.gov (United States)

    2010-10-01

    ..., DEPARTMENT OF DEFENSE CONTRACT MANAGEMENT TRANSPORTATION Transportation in Supply Contracts 247.301-70 Definition. “Integrated logistics managers” or “third-party logistics providers” means providers of multiple logistics services. Some examples of logistics services are the management of transportation,...

  15. 7 CFR 247.6 - State Plan.

    Science.gov (United States)

    2010-01-01

    ... serving women, infants, and children, program outreach, and nutrition education. (Collaboration with the... commodities; (7) A description of plans for providing nutrition education to participants; (8) A description... CHILD NUTRITION PROGRAMS COMMODITY SUPPLEMENTAL FOOD PROGRAM § 247.6 State Plan. (a) What is the...

  16. 25 CFR 247.18 - What are the sanitation prohibitions?

    Science.gov (United States)

    2010-04-01

    ... 25 Indians 1 2010-04-01 2010-04-01 false What are the sanitation prohibitions? 247.18 Section 247.18 Indians BUREAU OF INDIAN AFFAIRS, DEPARTMENT OF THE INTERIOR FISH AND WILDLIFE USE OF COLUMBIA RIVER TREATY FISHING ACCESS SITES § 247.18 What are the sanitation prohibitions? (a) You cannot...

  17. 48 CFR 52.247-57 - Transportation Transit Privilege Credits.

    Science.gov (United States)

    2010-10-01

    ... Privilege Credits. 52.247-57 Section 52.247-57 Federal Acquisition Regulations System FEDERAL ACQUISITION... Clauses 52.247-57 Transportation Transit Privilege Credits. As prescribed in 47.305-13(b)(4), insert the... of the trade, that offerors may have potential transit credits available and the Government...

  18. 48 CFR 52.247-60 - Guaranteed Shipping Characteristics.

    Science.gov (United States)

    2010-10-01

    ... Characteristics. 52.247-60 Section 52.247-60 Federal Acquisition Regulations System FEDERAL ACQUISITION REGULATION....247-60 Guaranteed Shipping Characteristics. As prescribed in 47.305-16(b)(1), insert the following clause: Guaranteed Shipping Characteristics (DEC 1989) (a) The offeror is requested to...

  19. 47 CFR 90.247 - Mobile repeater stations.

    Science.gov (United States)

    2010-10-01

    ... 47 Telecommunication 5 2010-10-01 2010-10-01 false Mobile repeater stations. 90.247 Section 90.247... MOBILE RADIO SERVICES Non-Voice and Other Specialized Operations § 90.247 Mobile repeater stations. A... repeater to extend the communications range of hand-carried units subject to the following: (a)...

  20. 43 CFR 2.47 - Records subject to Privacy Act.

    Science.gov (United States)

    2010-10-01

    ... 43 Public Lands: Interior 1 2010-10-01 2010-10-01 false Records subject to Privacy Act. 2.47 Section 2.47 Public Lands: Interior Office of the Secretary of the Interior RECORDS AND TESTIMONY; FREEDOM OF INFORMATION ACT Privacy Act § 2.47 Records subject to Privacy Act. The Privacy Act applies to...

  1. The Dusty Disc of NGC 247

    Science.gov (United States)

    2011-03-01

    This image of NGC 247, taken by the Wide Field Imager on the MPG/ESO 2.2-metre telescope at ESO's La Silla Observatory in Chile, reveals the fine details of this highly inclined spiral galaxy and its rich backdrop. Astronomers say this highly tilted orientation, when viewed from Earth, explains why the distance to this prominent galaxy was previously overestimated. The spiral galaxy NGC 247 is one of the closest spiral galaxies of the southern sky. In this new view from the Wide Field Imager on the MPG/ESO 2.2-metre telescope in Chile large numbers of the galaxy's component stars are clearly resolved and many glowing pink clouds of hydrogen, marking regions of active star formation, can be made out in the loose and ragged spiral arms. NGC 247 is part of the Sculptor Group, a collection of galaxies associated with the Sculptor Galaxy (NGC 253, also shown in eso0902 and eso1025). This is the nearest group of galaxies to our Local Group, which includes the Milky Way, but putting a precise value on such celestial distances is inherently difficult. To measure the distance from the Earth to a nearby galaxy, astronomers have to rely on a type of variable star called a Cepheid to act as a distance marker. Cepheids are very luminous stars, whose brightness varies at regular intervals. The time taken for the star to brighten and fade can be plugged into a simple mathematical relation that gives its intrinsic brightness. When compared with the measured brightness this gives the distance. However, this method isn't foolproof, as astronomers think this period-luminosity relationship depends on the composition of the Cepheid. Another problem arises from the fact that some of the light from a Cepheid may be absorbed by dust en route to Earth, making it appear fainter, and therefore further away than it really is. This is a particular problem for NGC 247 with its highly inclined orientation, as the line of sight to the Cepheids passes through the galaxy's dusty disc. However, a

  2. 14 CFR 125.247 - Inspection programs and maintenance.

    Science.gov (United States)

    2010-01-01

    ... 14 Aeronautics and Space 3 2010-01-01 2010-01-01 false Inspection programs and maintenance. 125.247 Section 125.247 Aeronautics and Space FEDERAL AVIATION ADMINISTRATION, DEPARTMENT OF... CAPACITY OF 6,000 POUNDS OR MORE; AND RULES GOVERNING PERSONS ON BOARD SUCH AIRCRAFT Maintenance §...

  3. 7 CFR 247.12 - Rights and responsibilities.

    Science.gov (United States)

    2010-01-01

    ... § 247.33(a); (2) The local agency will make nutrition education available to all adult participants, and... Agriculture Regulations of the Department of Agriculture (Continued) FOOD AND NUTRITION SERVICE, DEPARTMENT OF AGRICULTURE CHILD NUTRITION PROGRAMS COMMODITY SUPPLEMENTAL FOOD PROGRAM § 247.12 Rights and...

  4. 48 CFR 952.247-70 - Foreign travel.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 5 2010-10-01 2010-10-01 false Foreign travel. 952.247-70... SOLICITATION PROVISIONS AND CONTRACT CLAUSES Text of Provisions and Clauses 952.247-70 Foreign travel. As prescribed in 947.7002, insert the following clause: Foreign Travel (JUN 2010) Contractor foreign...

  5. 48 CFR 3452.247-70 - Foreign travel.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 7 2010-10-01 2010-10-01 false Foreign travel. 3452.247... 3452.247-70 Foreign travel. As prescribed in 3447.7000, insert the following clause in all solicitations and resultant cost-reimbursement contracts: Foreign Travel (AUG 1987) Foreign travel shall not...

  6. 48 CFR 252.247-7025 - Reflagging or repair work.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Reflagging or repair work... of Provisions And Clauses 252.247-7025 Reflagging or repair work. As prescribed in 247.574(d), use the following clause: Reflagging or Repair Work (JUN 2005) (a) Definition. Reflagging or repair...

  7. 40 CFR 247.14 - Park and recreation products.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 24 2010-07-01 2010-07-01 false Park and recreation products. 247.14 Section 247.14 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) SOLID WASTES... and recreation products. (a) Playground surfaces and running tracks containing recovered rubber...

  8. 7 CFR 247.28 - Storage and inventory of commodities.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 4 2010-01-01 2010-01-01 false Storage and inventory of commodities. 247.28 Section..., DEPARTMENT OF AGRICULTURE CHILD NUTRITION PROGRAMS COMMODITY SUPPLEMENTAL FOOD PROGRAM § 247.28 Storage and inventory of commodities. (a) What are the requirements for storage of commodities? State and local...

  9. 40 CFR 247.10 - Paper and paper products.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 24 2010-07-01 2010-07-01 false Paper and paper products. 247.10... COMPREHENSIVE PROCUREMENT GUIDELINE FOR PRODUCTS CONTAINING RECOVERED MATERIALS Item Designations § 247.10 Paper and paper products. Paper and paper products, excluding building and construction paper grades....

  10. 8 CFR 247.14 - Surrender of documents.

    Science.gov (United States)

    2010-01-01

    ... 8 Aliens and Nationality 1 2010-01-01 2010-01-01 false Surrender of documents. 247.14 Section 247.14 Aliens and Nationality DEPARTMENT OF HOMELAND SECURITY IMMIGRATION REGULATIONS ADJUSTMENT OF... I-551 or any other form of Permanent Resident Card, immigrant identification card, resident...

  11. 48 CFR 252.247-7023 - Transportation of supplies by sea.

    Science.gov (United States)

    2010-10-01

    ... by sea. 252.247-7023 Section 252.247-7023 Federal Acquisition Regulations System DEFENSE ACQUISITION... of Provisions And Clauses 252.247-7023 Transportation of supplies by sea. As prescribed in 247.573(b)(1), use the following clause: Transportation of Supplies by Sea (MAY 2002) (a) Definitions. As...

  12. Evidence for live 247Cm in the early solar system

    Science.gov (United States)

    Tatsumoto, M.; Shimamura, T.

    1980-01-01

    Variations of the 238U/235U ratio in the Allende meteorite, ranging from -35% to + 19%, are interpreted as evidence of live 247Cm in the early Solar System. The amounts of these and other r-products in the Solar System indicate values of (9,000??3,000) Myr for the age of the Galaxy and ??? 8 Myr for the time between the end of nucleosynthesis and the formation of meteoritic grains. Three possible explanations are presented for the different values of the latter time period which are indicated by the decay products of 247Cm, 26Al, 244Pu and 129I. ?? 1980 Nature Publishing Group.

  13. 48 CFR 52.247-51 - Evaluation of Export Offers.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 2 2010-10-01 2010-10-01 false Evaluation of Export....247-51 Evaluation of Export Offers. As prescribed in 47.305-6(e), insert the following provision: Evaluation of Export Offers (JAN 2001) (a) Port handling and ocean charges—other than DOD water...

  14. CDC 24/7: Saving Lives, Protecting People

    Centers for Disease Control (CDC) Podcasts

    2012-06-04

    24/7, CDC provides health information, responds to public health emergencies and natural disasters, and monitors disease.  Created: 6/4/2012 by Office of the Associate Director of Communciation (OADC).   Date Released: 6/4/2012.

  15. 48 CFR 52.247-12 - Supervision, Labor, or Materials.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 2 2010-10-01 2010-10-01 false Supervision, Labor, or....247-12 Supervision, Labor, or Materials. As prescribed in 47.207-5(b), insert a clause substantially... when the contractor is required to furnish supervision, labor, or materials: Supervision, Labor,...

  16. 7 CFR 247.5 - State and local agency responsibilities.

    Science.gov (United States)

    2010-01-01

    ... providing nutrition education to participants; (10) Establishing appeals and fair hearing procedures for...) Providing nutrition education and information on the availability of other nutrition and health assistance..., DEPARTMENT OF AGRICULTURE CHILD NUTRITION PROGRAMS COMMODITY SUPPLEMENTAL FOOD PROGRAM § 247.5 State...

  17. 9 CFR 354.247 - Table showing types of materials.

    Science.gov (United States)

    2010-01-01

    ... 9 Animals and Animal Products 2 2010-01-01 2010-01-01 false Table showing types of materials. 354... Sanitary Conditions and Precautions Against Contamination of Products § 354.247 Table showing types of materials. Equipment, utensils, and facilities Iron Stainless steel and monel metal Aluminum Galvanized...

  18. 48 CFR 247.301-71 - Evaluation factor or subfactor.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Evaluation factor or... Contracts 247.301-71 Evaluation factor or subfactor. For contracts that will include a significant requirement for transportation of items outside CONUS, include an evaluation factor or subfactor that...

  19. 48 CFR 1852.247-71 - Protection of the Florida manatee.

    Science.gov (United States)

    2010-10-01

    ... manatee. 1852.247-71 Section 1852.247-71 Federal Acquisition Regulations System NATIONAL AERONAUTICS AND... and Clauses 1852.247-71 Protection of the Florida manatee. As prescribed in 1847.7001, insert the following clause: Protection of the Florida Manatee (MAR 1989) (a) Pursuant to the Endangered Species Act...

  20. 48 CFR 252.247-7024 - Notification of transportation of supplies by sea.

    Science.gov (United States)

    2010-10-01

    ... transportation of supplies by sea. 252.247-7024 Section 252.247-7024 Federal Acquisition Regulations System... supplies by sea. As prescribed in 247.574(c), use the following clause: Notification of Transportation of Supplies by Sea (MAR 2000) (a) The Contractor has indicated by the response to the solicitation...

  1. 48 CFR 252.247-7022 - Representation of extent of transportation by sea.

    Science.gov (United States)

    2010-10-01

    ... of transportation by sea. 252.247-7022 Section 252.247-7022 Federal Acquisition Regulations System... transportation by sea. As prescribed in 247.574(a), use the following provision: Representation of Extent of Transportation By Sea (AUG 1992) (a) The Offeror shall indicate by checking the appropriate blank in paragraph...

  2. 48 CFR 52.247-40 - Ex Dock, Pier, or Warehouse, Port of Importation.

    Science.gov (United States)

    2010-10-01

    ... Warehouse, Port of Importation. 52.247-40 Section 52.247-40 Federal Acquisition Regulations System FEDERAL... Provisions and Clauses 52.247-40 Ex Dock, Pier, or Warehouse, Port of Importation. As prescribed in 47.303-12..., pier, or warehouse, port of importation: Ex Dock, Pier, or Warehouse, Port of Importation (APR 1984)...

  3. Property Enrichment of Aged Nickel Base Superalloy Supercast 247A

    Directory of Open Access Journals (Sweden)

    Lavakumar Avala

    2013-12-01

    Full Text Available The commercial nickel-base superalloy Supercast 247A can be used for applications in which is required high mechanical strength and corrosion resistance at elevated temperatures, such as turbine blades and automotive turbocharger rotors. The mechanical properties are totally connected to the morphology, size and distribution of γ' phase and carbides. In order to improve the mechanical properties, the material is subjected to solution and aging heat treatment, to raise the volume fraction of γ' phase in the matrix and to form carbides at grain boundaries. In the present study the Supercast 247A superalloy was remelted and cast to obtain the desired polycrystalline test bars by controlling casting parameters, followed by the investigation of precipitation morphology and mechanical properties with respect to solution treatment and aging treatment. The experimental results show that by well controlled casting parameters the Supercast 247A owns excellent castability to form a superalloy with fine grain structure, resistance to indentation as well as superior strength.

  4. 24 CFR 247.10 - Inapplicability to substantial rehabilitation or demolition; right of disposition unimpaired.

    Science.gov (United States)

    2010-04-01

    ... rehabilitation or demolition; right of disposition unimpaired. 247.10 Section 247.10 Housing and Urban... FOR HOUSING-FEDERAL HOUSING COMMISSIONER, DEPARTMENT OF HOUSING AND URBAN DEVELOPMENT MORTGAGE AND... or demolition; right of disposition unimpaired. This subpart shall not apply in any case in which...

  5. 32 CFR Appendix D to Part 247 - AFIS Print Media Directorate

    Science.gov (United States)

    2010-07-01

    ... 32 National Defense 2 2010-07-01 2010-07-01 false AFIS Print Media Directorate D Appendix D to.... 247, App. D Appendix D to Part 247—AFIS Print Media Directorate A. General. The Print Media Directorate (PMD), an element of AFIS, develops, publishes, and distributes a variety of print media...

  6. 7 CFR 247.10 - Distribution and use of CSFP commodities.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 4 2010-01-01 2010-01-01 false Distribution and use of CSFP commodities. 247.10... SERVICE, DEPARTMENT OF AGRICULTURE CHILD NUTRITION PROGRAMS COMMODITY SUPPLEMENTAL FOOD PROGRAM § 247.10 Distribution and use of CSFP commodities. (a) What are the requirements for distributing CSFP commodities...

  7. 32 CFR Appendix E to Part 247 - DoD Command Newspaper and Magazine Review System

    Science.gov (United States)

    2010-07-01

    ... 32 National Defense 2 2010-07-01 2010-07-01 false DoD Command Newspaper and Magazine Review System... OF DEFENSE (CONTINUED) MISCELLANEOUS DEPARTMENT OF DEFENSE NEWSPAPERS, MAGAZINES AND CIVILIAN ENTERPRISE PUBLICATIONS Pt. 247, App. E Appendix E to Part 247—DoD Command Newspaper and Magazine...

  8. 25 CFR 247.15 - May I reserve a campsite or drying shed?

    Science.gov (United States)

    2010-04-01

    ... 25 Indians 1 2010-04-01 2010-04-01 false May I reserve a campsite or drying shed? 247.15 Section... RIVER TREATY FISHING ACCESS SITES § 247.15 May I reserve a campsite or drying shed? No. You may not reserve a campsite, drying shed, or other facility. (a) You must use campsites, drying sheds, and...

  9. Protective effect of CV247 against cisplatin nephrotoxicity in rats.

    Science.gov (United States)

    Máthé, C; Szénási, G; Sebestény, A; Blázovics, A; Szentmihályi, K; Hamar, P; Albert, M

    2014-08-01

    CV247 (CV), an aqueous mixture of copper (Cu) and manganese (Mn) gluconates, vitamin C and sodium salicylate increased the antitumour effects of cisplatin (CDPP; cis-diamminedichloroplatinum) in vitro. We hypothesized that the antioxidant and cyclooxygenase-2 (COX-2; prostaglandin-endoperoxide synthase 2) inhibitory components of CV can protect the kidneys from CDPP nephrotoxicity in rats. CDPP (6.5 mg/kg, intraperitoneally) slightly elevated serum creatinine (Crea) and blood urea nitrogen (BUN) 12 days after treatment. Kidney histology demonstrated extensive tubular epithelial damage and COX-2 immunoreactivity increased 14 days after treatment. A large amount of platinum (Pt) accumulated in the kidney of CDPP-treated rats. Furthermore, CDPP decreased renal iron (Fe), molybdenum (Mo), zinc (Zn), Cu and Mn concentrations and increased plasma Fe and Cu concentrations. CDPP elevated plasma free radical concentration. Treatment with CV alone for 14 days (twice 3 ml/kg/day orally) did not influence these parameters. Chronic CV administration after CDPP reduced renal histological damage and slightly decreased COX-2 immunoreactivity, while failed to prevent the increase in Crea and BUN levels. Blood free radical concentration was reduced, that is, CV improved redox homeostasis. CV restored plasma Fe and renal Fe, Mo and Zn, while decreased Pt and elevated Cu and Mn concentrations in the kidney. Besides the known synergistic antitumour effects with CDPP, CV partially protected the kidneys from CDPP nephrotoxicity probably through its antioxidant effect.

  10. Radiology 24/7 In-House Attending Coverage: Do Benefits Outweigh Cost?

    Science.gov (United States)

    Coleman, Stephanie; Holalkere, Nagaraj Setty; O׳Malley, Julie; Doherty, Gemma; Norbash, Alexander; Kadom, Nadja

    2016-01-01

    Many radiology practices, including academic centers, are moving to in-house 24/7 attending coverage. This could be costly and may not be easily accepted by radiology trainees and attending radiologists. In this article, we evaluated the effects of 24/7 in-house attending coverage on patient care, costs, and qualitative aspects such as trainee education. We retrospectively collected report turnaround times (TAT) and work relative value units (wRVU). We compared these parameters between the years before and after the implementation of 24/7 in-house attending coverage. The cost to provide additional attending coverage was estimated from departmental financial reports. A qualitative survey of radiology residents and faculty was performed to study perceived effects on trainee education. There were decreases in report TAT following 24/7 attending implementation: 69% reduction in computed tomography, 43% reduction in diagnostic radiography, 7% reduction in magnetic resonance imaging, and 43% reduction in ultrasound. There was an average daytime wRVU decrease of 9%, although this was compounded by a decrease in total RVUs of the 2013 calendar year. The financial investment by the institution was estimated at $850,000. Qualitative data demonstrated overall positive feedback from trainees and faculty in radiology, although loss of independence was reported as a negative effect. TAT and wRVU metrics changed with implementation of 24/7 attending coverage, although these metrics do not directly relate to patient outcomes. Additional clinical benefits may include fewer discrepancies between preliminary and final reports that may improve emergency and inpatient department workflows and liability exposure. Radiologists reported the impression that clinicians appreciated 24/7 in-house attending coverage, particularly surgical specialists. Loss of trainee independence on call was a perceived disadvantage of 24/7 attending coverage and raised a concern that residency education

  11. Association of CD247 polymorphisms with rheumatoid arthritis: a replication study and a meta-analysis.

    Directory of Open Access Journals (Sweden)

    María Teruel

    Full Text Available Given the role of CD247 in the response of the T cells, its entailment in autoimmune diseases and in order to better clarify the role of this gene in RA susceptibility, we aimed to analyze CD247 gene variants previously associated with other autoimmune diseases (rs1052237, rs2056626 and rs864537 in a large independent European Caucasian population. However, no evidence of association was found for the analyzed CD247 single-nucleotide polymorphisms (SNPs with RA and with the presence/absence of anti-cyclic citrullinated polypeptide. We performed a meta-analysis including previously published GWAS data from the rs864537 variant, revealing an overall genome-wide significant association between this CD247 SNP and RA with anti-CCP (OR = 0.90, CI 95% = 0.87-0.93, Poverall = 2.1×10(-10. Our results show for first time a GWAS-level association between this CD247 polymorphism and RA risk.

  12. Library open 24/7: A study of user needs and library management concerns

    Institute of Scientific and Technical Information of China (English)

    BAO; Xueming

    2009-01-01

    Facing competition from Web-based information service development,academic librarians need to find ways to attract more users to the physical library buildings.This study investigated user needs and library management concerns for a 24/7 service through two surveys:1)User feedback survey at Seton Hall University Library,and 2)Survey of Academic Library Deans and Directors in the USA.Based on these two surveys,the paper not only discussed the current status of libraries open 24/7 in the USA and showed the demographics of users of the 24/7 service at Seton Hall University,it also stated reasons to use the 24/7 service.In addition,the paper revealed library management concerns of the24/7 service.Three implications,which have been guided by Scott Bennett’s theory of learning commons for planning library space,were drawn from the findings in this paper.

  13. 17 CFR 247.722 - Exemption allowing banks to calculate trust and fiduciary compensation on a bank-wide basis.

    Science.gov (United States)

    2010-04-01

    ... calculate trust and fiduciary compensation on a bank-wide basis. 247.722 Section 247.722 Commodity and... calculate trust and fiduciary compensation on a bank-wide basis. (a) General. A bank is exempt from meeting... for the bank's trust and fiduciary business is at least 70 percent. (b) Aggregate...

  14. 12 CFR 303.247 - Continue or resume status as an insured institution following termination under section 8 of the...

    Science.gov (United States)

    2010-01-01

    ... institution following termination under section 8 of the FDI Act. 303.247 Section 303.247 Banks and Banking... the FDI Act. (a) Scope. This section relates to an application by a depository institution whose insured status has been terminated under section 8 of the FDI Act (12 U.S.C. 1818) for permission...

  15. 40 CFR 408.247 - Effluent limitations guidelines representing the degree of effluent reduction attainable by the...

    Science.gov (United States)

    2010-07-01

    ... control technology (BCT). 408.247 Section 408.247 Protection of Environment ENVIRONMENTAL PROTECTION... 40 Protection of Environment 28 2010-07-01 2010-07-01 true Effluent limitations guidelines... degree of effluent reduction attainable by the application of the best conventional pollutant...

  16. Switching Investigations on a SiC MOSFET in a TO-247 Package

    DEFF Research Database (Denmark)

    Anthon, Alexander; Hernandez Botella, Juan Carlos; Zhang, Zhe;

    2014-01-01

    package, has a major influence on the switching energy. Crucial design guidelines for an improved double pulse test circuit are introduced which are used for practical investigations on the switching behavior. Switching energies of a SiC MOSFET in a TO-247 package is measured depending on varying gate...

  17. 48 CFR 247.372 - DD Form 1654, Evaluation of Transportation Cost Factors.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false DD Form 1654, Evaluation... Transportation in Supply Contracts 247.372 DD Form 1654, Evaluation of Transportation Cost Factors. Contracting personnel may use the DD Form 1654 to furnish information to the transportation office for development...

  18. 48 CFR 247.371 - DD Form 1653, Transportation Data for Solicitations.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false DD Form 1653... Supply Contracts 247.371 DD Form 1653, Transportation Data for Solicitations. The transportation specialist prepares the DD Form 1653 to accompany requirements for the acquisition of supplies. The...

  19. 48 CFR 247.370 - DD Form 1384, Transportation Control and Movement Document.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false DD Form 1384... Transportation in Supply Contracts 247.370 DD Form 1384, Transportation Control and Movement Document. The transportation office of the shipping activity prepares the DD Form 1384 to accompany all shipments made...

  20. 7 CFR 247.13 - Provisions for non-English or limited-English speakers.

    Science.gov (United States)

    2010-01-01

    ... significant proportion of the population in an area is comprised of non-English or limited-English speaking... 7 Agriculture 4 2010-01-01 2010-01-01 false Provisions for non-English or limited-English speakers... § 247.13 Provisions for non-English or limited-English speakers. (a) What must State and local...

  1. 48 CFR 3052.247-72 - F.o.b. destination only.

    Science.gov (United States)

    2010-10-01

    ... CLAUSES Text of Provisions and Clauses 3052.247-72 F.o.b. destination only. As prescribed in (HSAR) 48 CFR 3047.305-70(c), insert the following provision: F.O.B. Destination Only (DEC 2003) Offers are invited... 48 Federal Acquisition Regulations System 7 2010-10-01 2010-10-01 false F.o.b. destination...

  2. 48 CFR 52.247-8 - Estimated Weights or Quantities Not Guaranteed.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 2 2010-10-01 2010-10-01 false Estimated Weights or... Provisions and Clauses 52.247-8 Estimated Weights or Quantities Not Guaranteed. As prescribed in 47.207-3(e... transportation-related services when weights or quantities are estimates: Estimated Weights or Quantities...

  3. Formation and characterization of Y:247 film through spray pyrolysis technique

    Indian Academy of Sciences (India)

    Suman Anand; O N Srivastava

    2004-04-01

    The synthesis of high temperature superconducting films of Y:247 (c ∼ K) have been successfully achieved. The difficulty in synthesis owing to narrow range of stability of Y:247 has been taken care of through several quenching modes, e.g. quenching of the films synthesized at ∼ 850°C, in air or in liquid nitrogen. The energy dispersive analysis of X-rays (EDAX) and transmission electron microscopy (TEM) studies of the as processed film, Y2Ba4Cu7O14+, exhibit nearly correct cationic stoichiometry of 2 : 4 : 7; also narrow regions (< 50 Å) of minority Y:124 phase and stacking faults capable of working as flux pinning sites have been invariably found to be present. In addition to Y:247, Ag admixed films have also been investigated. The c here is ∼ 70–75 K which is similar to that of the film without silver. Representative estimates of transport critical current density (c) for Y:247 films is ∼ 103 A/cm2, and with silver corresponding to Y2Ba4Cu7O14+ (Ag0.1) is found to be ∼ 104 A/cm2.

  4. Prevalence of Plasmodium vivax VK210 and VK247 subtype in Myanmar

    Directory of Open Access Journals (Sweden)

    Kang Yoon-Joong

    2010-07-01

    Full Text Available Abstract Background Plasmodium vivax is divided into two subtypes, a dominant form, VK210 and a variant form, VK247. This division is dependent on the amino acid composition of the circumsporozoite (CS protein. In this study, the prevalence of the VK247 variant form of P. vivax was investigated in Myanmar. Methods The existence of malaria parasites in blood samples was determined by microscopic examination, polymerase chain reaction (PCR and DNA hybridization assays. To test for antibodies against P. vivax and Plasmodium falciparum in blood samples, an indirect immunofluorescence antibody test (IFAT was performed using asexual blood antigens. An enzyme-linked immunosorbent assay with synthetic VK210 and VK247 antigens was carried out to discriminate between the P. vivax subtypes. Results By thick smear examination, 73 (n = 100 patients were single infected with P. vivax, one with P. falciparum and 13 with both species. By thin smear, 53 patients were single infected with P. vivax, eight with only P. falciparum and 16 with both. Most of the collected blood samples were shown to be P. vivax positive (n = 95 by PCR. All cases that were positive for P. falciparum by PCR (n = 43 were also positive for P. vivax. However, 52 cases were single infected with P. vivax. IFAT showed antibody titres from 1:32 to 1:4,096. Additionally, using specific antibodies for VK210 and VK247, ELISA showed that 12 patients had antibodies for only the VK210 subtype, 4 patients had only VK247 subtype antibodies and 21 patients had antibodies for both subtypes. Using a DNA hybridization test, 47 patients were infected with the VK210 type, one patient was infected with VK247 and 23 patients were infected with both subtypes. Conclusions The proportion of the VK247 subtype in Myanmar was 43.1% (n = 25 among 58 positive cases by serodiagnosis and 25.6% (n = 24 among 94 positive cases by genetic diagnosis. In both diagnostic methods, the infection status of malaria patients is

  5. Prediction of fatigue lives of MAR-M247 LC based on the crack closure concept

    Energy Technology Data Exchange (ETDEWEB)

    Gelmedin, Domnin; Lang, Karl-Heinz [Karlsruhe Institute of Technology, Institute for Applied Materials - Materials Science and Engineering (IAM-WK) Campus Sued, Engelbert-Arnold-Strasse 4, 76131 Karlsruhe (Germany); Newman, James C. Jr. [Department of Aerospace Engineering, Mississippi State University, 314C Walker Engineering Building P. O. Box A Mississippi State, MS 39762 (United States)

    2012-10-15

    Low cycle fatigue (LCF), high cycle fatigue (HCF), and combined LCF and HCF tests are carried out on MAR-M247 LC at 650 C in air environment. Under combined LCF and HCF loading, block striations form on the fracture surface which are used to complete an effective crack growth curve by using the linear summation model. Crack growth lives starting from equivalent initial flaw sizes are calculated by the crack closure code FASTRAN and compared with experimental fatigue lives. Under HCF loading, predicted and experimental fatigue lives agree well for lifetimes above 10{sup 5} cycles. Lower lifetimes are overestimated indicating that the linear summation model is not valid for MAR-M247 LC in this loading range. Interactions between the non-crystallographic HCF crack growth and striated crack growth that is caused by the LCF loading are probably responsible for this behavior. (Copyright copyright 2012 WILEY-VCH Verlag GmbH and Co. KGaA, Weinheim)

  6. Evaluation of Cm-247 neutron cross sections in the resonance region

    International Nuclear Information System (INIS)

    The neutron cross sections of Cm-247 are evaluated in the resonance (resolved and unresolved) region up to 10 keV. Average resonance parameters (i.e. spacing D, fission and radiative widths, neutron strength functions) are determined for unresolved region calculations. Moreover for a better comparison with the experimental data, fission cross section is calculated up to 10 MeV. In addition, the average number of neutrons emitted per fission as a function of energy is estimated

  7. 48 CFR 3052.247-71 - F.o.b. origin only.

    Science.gov (United States)

    2010-10-01

    ... CLAUSES Text of Provisions and Clauses 3052.247-71 F.o.b. origin only. As prescribed in (HSAR) 48 CFR 3047.305-70(b), insert the following provision: F.O.B. Origin Only (DEC 2003) Offers are invited on the... 48 Federal Acquisition Regulations System 7 2010-10-01 2010-10-01 false F.o.b. origin only....

  8. A novel thymoma-associated immunodeficiency with increased naive T cells and reduced CD247 expression.

    Science.gov (United States)

    Christopoulos, Petros; Dopfer, Elaine P; Malkovsky, Miroslav; Esser, Philipp R; Schaefer, Hans-Eckart; Marx, Alexander; Kock, Sylvia; Rupp, Nicole; Lorenz, Myriam R; Schwarz, Klaus; Harder, Jan; Martin, Stefan F; Werner, Martin; Bogdan, Christian; Schamel, Wolfgang W A; Fisch, Paul

    2015-04-01

    The mechanisms underlying thymoma-associated immunodeficiency are largely unknown, and the significance of increased blood γδ Τ cells often remains elusive. In this study we address these questions based on an index patient with thymoma, chronic visceral leishmaniasis, myasthenia gravis, and a marked increase of rare γδ T cell subsets in the peripheral blood. This patient showed cutaneous anergy, even though he had normal numbers of peripheral blood total lymphocytes as well as CD4(+) and CD8(+) T cells. Despite his chronic infection, analyses of immunophenotypes and spectratyping of his lymphocytes revealed an unusual accumulation of naive γδ and αβ T cells, suggesting a generalized T cell activation defect. Functional studies in vitro demonstrated substantially diminished IL-2 and IFN-γ production following TCR stimulation of his "untouched" naive CD4(+) T cells. Biochemical analysis revealed that his γδ and αβ T cells carried an altered TCR complex with reduced amounts of the ζ-chain (CD247). No mutations were found in the CD247 gene that encodes the homodimeric ζ protein. The diminished presence of CD247 and increased numbers of γδ T cells were also observed in thymocyte populations obtained from three other thymoma patients. Thus, our findings describe a novel type of a clinically relevant acquired T cell immunodeficiency in thymoma patients that is distinct from Good's syndrome. Its characteristics are an accumulation of CD247-deficient, hyporresponsive naive γδ and αβ T cells and an increased susceptibility to infections. PMID:25732729

  9. Estimation of Al, Hf, Ta in 247Cm-alloy by ICP-AES

    International Nuclear Information System (INIS)

    The present paper discusses a new method developed for analysis of Al, Hf and Ta in Nickel based 247Cm super alloy by Inductively Coupled Plasma Atomic Emission Spectrometer (ICP-AES). The procedure employs the dissolution of alloy in a mixture of Sulphuric acid, Nitric acid and Hf and subsequent analysis by sequential ICP-AES (Model JY Ultima 2C HR, France). A Relative Standard Deviation of less than ± 5% has been achieved for all the elements. (author)

  10. Draft Genome Sequences of Three Northern German Epidemic Staphylococcus aureus (ST247) Strains Containing Multiple Copies of IS256

    Science.gov (United States)

    Kleinert, Franziska; Kallies, René; Zweynert, Annegret

    2016-01-01

    We report the draft genome sequences of three multiresistant Staphylococcus aureus strains of sequence type 247 (ST247). The methicillin-resistant S. aureus (MRSA) SA1450/94 is vancomycin susceptible, while the clinical MRSA isolate S. aureus SA137/93A and its spontaneous laboratory mutant SA137/93G are characterized by intermediate vancomycin susceptibility. PMID:27609917

  11. Deep Fabry-Perot Hα observations of two Sculptor group galaxies, NGC 247 and 300

    Science.gov (United States)

    Hlavacek-Larrondo, J.; Marcelin, M.; Epinat, B.; Carignan, C.; de Denus-Baillargeon, M.-M.; Daigle, O.; Hernandez, O.

    2011-09-01

    It has been suggested that diffuse ionized gas can extend all the way to the end of the H I disc, and even beyond, such as in the case of the warped galaxyNGC 253 (Bland-Hawthorn et al.). Detecting ionized gas at these radii could carry significant implications as to the distribution of dark matter in galaxies. With the aim of detecting this gas, we carried out a deep Hα kinematical analysis of two Sculptor group galaxies, NGC 247 and 300. The Fabry-Perot data were taken at the 36-cm Marseille Telescope in La Silla, Chile, offering a large field of view. With almost 20 hours of observations for each galaxy, very faint diffuse emission is detected. Typical emission measures of 0.1 cm-6 pc are reached. For NGC 247, emission extending up to a radius comparable with that of the H I disc (r˜ 13 arcmin) is found, but no emission is seen beyond the H I disc. For NGC 300, we detect ionized gas on the entirety of our field of view (rmax˜ 14 arcmin), and find that the bright H II regions are embedded in a diffuse background. Using the deep data, extended optical rotation curves are obtained, as well as mass models. These are the most extended optical rotation curves thus far for these galaxies. We find no evidence suggesting that NGC 247 has a warped disc, and to account for our non-detection of Hα emission beyond its H I disc, as opposed to the warped galaxy NGC 253, our results favour the model in which, only through a warp, ionization by hot young stars in the central region of a galaxy can let photons escape and ionize the interstellar medium in the outer parts.

  12. Búsqueda y análisis de asociaciones estelares en NGC247

    Science.gov (United States)

    Rodríguez, M. J.; Baume, G.; Feinstein, C.

    2016-08-01

    From ACS/HST observations, available in the Space Telescope database, the search and analysis of young stellar associations in the galaxy NGC247 have been carried out. The Path Linkage Criterion was used for the detection, identifying 147 young stellar groups. Thanks to the ACS high spatial resolution, it was possible to detect the individual components of each groups allowing the construction of the radial density profiles, the photometric diagrams decontaminated by field stars, and the initial mass function. Thus it has been possible to identify some basic properties of the groups, such as sizes, masses, etc. We also performed a global study of the behavior of these associations in the galaxy.

  13. Mesotelioma maligno: Experiencia clínico-patológica de 247 casos Malignant mesothelioma: Clinical and pathological features from 247 cases

    Directory of Open Access Journals (Sweden)

    RAÚL BARRERA R

    2010-09-01

    Full Text Available Objetivo: Este estudio describe la frecuencia, características patológicas, ocupación y exposición a asbesto en una cohorte grande de casos de mesotelioma maligno (MM admitidos en el Instituto Nacional de Enfermedades Respiratorias (INER, en México. Método: Se llevó a cabo un estudio retrospectivo y transversal en los registros médicos de pacientes diagnosticados con MM entre los años 1991-2007. Resultados: De los 247pacientes, 184 fueron hombres y 63 fueron mujeres con un promedio de edad de 51 y 60 años. Disnea y dolor torácico fueron los principales síntomas observados. Exposición a fibras de asbesto fue referida sólo en 34% de los casos, aunque una exposición directa sólo puedo ser documentada en cinco de ellos. Las características clínicas de los pacientes con MM fueron similares en aquellos con y sin exposición a asbesto reconocida. Conclusión: Aunque se observa una tendencia creciente en el número de casos con MM, en muchos de ellos no fue posible establecer una fuente de exposición a asbesto como la causa de contaminación para el desarrollo de la enfermedad.Objective: This study describes the frequency, occupational, clinical, and pathological features in a large cohort of cases of Malignant Mesothelioma (MM from the National Institute of Respiratory Diseases (INER, in México. Methods: A retrospective and transversal study was carried out in medical records of patients diagnosed with MM between the years 1991 to 2007. Results: Of the 247 patients, 184 were male and 63 were female with an average age of 51-60 years. Dyspnea and chest pain were the presenting symptoms in most of the patients. Exposure to asbestos was referred only in 34% of cases but direct exposition only was documented in five of them. Clinical features of MM patients were similar in asbestos related and non-asbestos related malignant mesothelioma. Conclusion: Although a growing tendency is observed in, the number of cases with MM, in many of them

  14. Strain-Life Assessment of Grainex Mar-M 247 for NASA's Turbine Seal Test Facility

    Science.gov (United States)

    Delgado, Irebert R.; Halford, Gary R.; Steinetz, Bruce M.; Rimnac, Clare M.

    2004-01-01

    NASA s Turbine Seal Test Facility is used to test air-to-air seals for use primarily in advanced jet engine applications. Combinations of high temperature, high speed, and high pressure limit the disk life, due to the concern of crack initiation in the bolt holes of the Grainex Mar-M 247 disk. The primary purpose of this current work is to determine an inspection interval to ensure safe operation. The current work presents high temperature fatigue strain-life data for test specimens cut from an actual Grainex Mar-M 247 disk. Several different strain-life models were compared to the experimental data including the Manson-Hirschberg Method of Universal Slopes, the Halford-Nachtigall Mean Stress Method, and the Modified Morrow Method. The Halford-Nachtigall Method resulted in only an 18 percent difference between predicted and experimental results. Using the experimental data at a 99.95 percent prediction level and the presence of 6 bolt holes it was found that the disk should be inspected after 665 cycles based on a total strain of 0.5 percent at 649 C.

  15. Microstructure and oxidation performance of a –' Pt-aluminide bond coat on directionally solidified superalloy CM-247LC

    Indian Academy of Sciences (India)

    Md Zafir Alam; N Hazari; Dipak K Das

    2014-10-01

    The microstructure of a Pt-modified -' bond coat on CM-247LC Ni-base superalloy has been examined and its cyclic oxidation performance at 1100 °C in air is comparatively evaluated with that of a conventional -(Ni, Pt)Al bond coat. The -' bond coat was effective in imparting oxidation resistance to the CM-247LC alloy for about 100 h, whereas the coating imparted oxidation resistance for significantly longer duration of about 1000 h. The nature of surface damage that occurred to the -' coating during oxidation has been compared with that reported in the case of coating.

  16. QCW diode-side-pumped Nd:YAG ceramic laser with 247 W output power at 1123 nm

    Science.gov (United States)

    Li, C. Y.; Peng, Q. J.; Wang, B. S.; Bo, Y.; Cui, D. F.; Xu, Z. Y.; Feng, X. Q.; Pan, Y. B.

    2011-05-01

    We demonstrate for the first time a diode-side-pumped quasi-continuous-wave (QCW) operation of a 1123 nm Nd:YAG ceramic laser. The single 1123 nm wavelength is acquired through precise coating. With a pump power of 1000 W, an output power of 247 W is obtained, corresponding to an optical-optical conversion efficiency of 24.7%. At the maximal output power, the pulse repetition rate and pulse width are measured to be 1.1 kHz and 180 μs, respectively. The numerical simulations for wavelength selectivity from 1112, 1116 and 1123 nm are discussed in detail.

  17. 32 CFR Appendix C to Part 247 - Mailing of DoD Newspapers, Magazines, CE Guides, and Installation Maps; Sales and Distribution of...

    Science.gov (United States)

    2010-07-01

    ... 32 National Defense 2 2010-07-01 2010-07-01 false Mailing of DoD Newspapers, Magazines, CE Guides...) MISCELLANEOUS DEPARTMENT OF DEFENSE NEWSPAPERS, MAGAZINES AND CIVILIAN ENTERPRISE PUBLICATIONS Pt. 247, App. C Appendix C to Part 247—Mailing of DoD Newspapers, Magazines, CE Guides, and Installation Maps; Sales...

  18. Help at 3:00 AM! Providing 24/7 Timely Support to Online Students via a Virtual Assistant

    Science.gov (United States)

    Vu, Phu; Fredrickson, Scott; Meyer, Richard

    2016-01-01

    With a dearth of research on human-robot interaction in education and relatively high non-completion rates of online students, this study was conducted to determine the feasibility of using a virtual assistant (VA) to respond to questions and concerns of students and provide 24/7 online course content support. During a 16 week-long academic…

  19. 40 CFR 174.524 - Glyphosate Oxidoreductase GOX or GOXv247 in all plants; exemption from the requirement of a...

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 23 2010-07-01 2010-07-01 false Glyphosate Oxidoreductase GOX or... REQUIREMENTS FOR PLANT-INCORPORATED PROTECTANTS Tolerances and Tolerance Exemptions § 174.524 Glyphosate... Glyphosate Oxidoreductase GOX or GOXv247 enzyme in all plants are exempt from the requirement of a...

  20. 48 CFR 52.247-46 - Shipping Point(s) Used in Evaluation of F.o.b. Origin Offers.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 2 2010-10-01 2010-10-01 false Shipping Point(s) Used in... Text of Provisions and Clauses 52.247-46 Shipping Point(s) Used in Evaluation of F.o.b. Origin Offers... when price evaluation for shipments from various shipping points is contemplated: Shipping...

  1. Phosphorylation of HOX11/TLX1 on Threonine-247 during mitosis modulates expression of cyclin B1

    Directory of Open Access Journals (Sweden)

    Chesney Alden

    2010-09-01

    Full Text Available Abstract Background The HOX11/TLX1 (hereafter referred to as HOX11 homeobox gene was originally identified at a t(10;14(q24;q11 translocation breakpoint, a chromosomal abnormality observed in 5-7% of T cell acute lymphoblastic leukemias (T-ALLs. We previously reported a predisposition to aberrant spindle assembly checkpoint arrest and heightened incidences of chromosome missegregation in HOX11-overexpressing B lymphocytes following exposure to spindle poisons. The purpose of the current study was to evaluate cell cycle specific expression of HOX11. Results Cell cycle specific expression studies revealed a phosphorylated form of HOX11 detectable only in the mitotic fraction of cells after treatment with inhibitors to arrest cells at different stages of the cell cycle. Mutational analyses revealed phosphorylation on threonine-247 (Thr247, a conserved amino acid that defines the HOX11 gene family and is integral for the association with DNA binding elements. The effect of HOX11 phosphorylation on its ability to modulate expression of the downstream target, cyclin B1, was tested. A HOX11 mutant in which Thr247 was substituted with glutamic acid (HOX11 T247E, thereby mimicking a constitutively phosphorylated HOX11 isoform, was unable to bind the cyclin B1 promoter or enhance levels of the cyclin B1 protein. Expression of the wildtype HOX11 was associated with accelerated progression through the G2/M phase of the cell cycle, impaired synchronization in prometaphase and reduced apoptosis whereas expression of the HOX11 T247E mutant restored cell cycle kinetics, the spindle checkpoint and apoptosis. Conclusions Our results demonstrate that the transcriptional activity of HOX11 is regulated by phosphorylation of Thr247 in a cell cycle-specific manner and that this phosphorylation modulates the expression of the target gene, cyclin B1. Since it is likely that Thr247 phosphorylation regulates DNA binding activity to multiple HOX11 target sequences, it is

  2. Energy levels of 247Cm populated in the α decay of 98251Cf

    International Nuclear Information System (INIS)

    α -Particle, conversion-electron, and γ -ray singles spectra of 251Cf sources containing few Bq activities were measured with high-resolution semiconductor detectors. α-γ coincidence and level half-life measurements were also performed. On the basis of these measurements the following single-particle states have been identified in 247Cm : 9/2 - [734] , 0 keV; 5/2 + [622] , 227.4 keV; 7/2 + [624] , 285.4 keV; 1/2 + [620] , 404.9 keV; 1/2 + [631] , 518.6 keV . The measured single-particle energies are in good agreement with energies calculated with a Woods-Saxon single-particle potential. From the measured half-life of the 227.4-keV level and the E3 branching ratio, a B(E3) value of 5 W.u. has been deduced between the 5/2 + [622] and 9/2 - [734] bands. The large B(E3) value is an indication of octupole mixing in the 227.4-keV level

  3. Genome-wide association study of systemic sclerosis identifies CD247 as a novel susceptibility locus

    Science.gov (United States)

    Radstake, Timothy R.D.J.; Gorlova, Olga; Rueda, Blanca; Martin, Jose-Ezequiel; Alizadeh, Behrooz Z.; Palomino-Morales, Rogelio; Coenen, Marieke J.; Vonk, Madelon C.; Voskuyl, Alexandre E.; Scheurwegh, Annemie J.; Broen, Jasper C.; van Riel, Piet L.C.M.; van ‘t Slot, Ruben; Italiaander, Annet; Ophoff, Roel A.; Riemekasten, Gabriela; Hunzelmann, Nico; Simeon, Carmen P.; Ortego-Centeno, Norberto; González-Gay, Miguel A.; González-Escribano, María F.; Airo, Paolo; van Laar, Jaap; Herrick, Ariane; Worthington, Jane; Hesselstrand, Roger; Smith, Vanessa; de Keyser, Filip; Houssiau, Fredric; Chee, Meng May; Madhok, R; Shiels, Paul; Westhovens, Rene; Kreuter, Alexander; Kiener, Hans; de Baere, Elfride; Witte, Torsten; Padykov, Leonid; Klareskog, Lars; Beretta, Lorenzo; Scorza, Rafaella; Lie, Benedicte A.; Hoffman-Vold, Anna-Maria; Carreira, P; Varga, J.; Hinchcliff, M.; Gregersen, Peter; Lee, Annette T.; Ying, Jun; Han, Younghun; Weng, Shih-Feng; Amos, Christopher I.; Wigley, Fredrick M.; Hummers, Laura; Nelson, J. Lee; Agarwal, Sandeep K.; Assassi, Shervin; Gourh, Pravitt; Tan, Filemon K.; Koeleman, Bobby P.C.; Arnett, Frank C; Martin, Javier; Mayes, Maureen D.

    2010-01-01

    Systemic sclerosis (SSc) is an autoimmune disease characterized by fibrosis of the skin and internal organs that leads to profound disability and premature death. To identify novel SSc susceptibility loci we conducted the first genome wide association study (GWAS) in a population of Caucasian ancestry including a total of 2296 SSc patients and 5171 controls. Analysis of 279,621 autosomal single nucleotide polymorphisms (SNPs) followed by replication testing in an independent case-control set of European ancestry (2,753 SSc patients / 4,569 controls) identified a new susceptibility locus for systemic sclerosis at CD247 (1q22-23; rs2056626, P = 2.09 × 10−7 in the discovery samples, P = 3.39 × 10−9 in the combined analysis). Additionally, we confirm and firmly establish the role of MHC (2.31 × 10−18), IRF5 (P =1.86 × 10−13) and STAT4 (P =3.37 × 10−9) gene regions as SSc genetic risk factors. PMID:20383147

  4. Study on Application of Grey Prediction Model in Superalloy MAR-247 Machining

    Directory of Open Access Journals (Sweden)

    Chen Shao-Hsien

    2015-01-01

    Full Text Available Superalloy MAR-247 is mainly applied in the space industry and die industry. With its characteristics of mechanical property, fatigue resistance, and high temperature corrosion resistance, therefore, it is mainly applied in machine parts of high temperature and corrosion resistance, such as turbine blades and rotor of the aeroengine and turbine assembly in the nuclear power plant. However, considering that its properties of high strength, low thermal conductivity, being difficult to soften, and work hardening may reduce the life of cutting-tool and weaken the surface accuracy, the study provided minimizing experiment occurring during milling process for superalloy material. As a statistical approach used to analyse experiment data, this study used GM(1,1 in the grey prediction model to conduct simulation and then predict and analyze its characteristics based on the experimental data, focusing on the tool life and surface accuracy. Moreover, with the superalloy machining parameters of the current effective application improved grey prediction model, it can decrease the errors, extend the tool life, and improve the prediction precision of surface accuracy.

  5. P247 and p523: two in vivo-expressed megalocytivirus proteins that induce protective immunity and are essential to viral infection.

    Directory of Open Access Journals (Sweden)

    Jian Zhang

    Full Text Available Megalocytivirus is a DNA virus with a broad host range among teleost fish. Although the complete genome sequences of a number of megalocytivirus isolates have been reported, the functions of most of the genes of this virus are unknown. In this study, we selected two megalocytivirus immunogens, P247 and P523, which were expressed during host infection and, when in the form of DNA vaccines (pCN247 and pCN523 respectively, elicited strong protectivity against lethal megalocytivirus challenge in a turbot (Scophthalmus maximus model. Compared to control fish, fish vaccinated with pCN247 and pCN523 exhibited drastically reduced viral loads in tissues and high levels of survival rates. Immune response analysis showed that pCN247 and pCN523 (i induced production of specific serum antibodies, (ii caused generation of cytotoxic immune cells and specific memory immune cells that responded to secondary antigen stimulation, and (iii upregulated the expression of genes involved in innate and adaptive immunity. To examine the potential role of P247 and P523 in viral infection, the expression of P247 and P523 was knocked down by siRNA. Subsequent in vivo infection study showed that P247 and P523 knockdown significantly impaired viral replication. Furthermore, whole-genome transcriptome analysis revealed that P247 and P523 knockdown altered the expression profiles of 26 and 41 viral genes, respectively, putatively participating in diverse aspects of viral infection. Taken together, these results indicate that P247 and P523 induce protective immunity in teleost and play fundamental roles essential to viral replication. These observations provide the first evidence that suggests a likely link between the protectivity of viral immunogens and their biological significance in viral replication.

  6. Selective Cathepsin S Inhibition with MIV-247 Attenuates Mechanical Allodynia and Enhances the Antiallodynic Effects of Gabapentin and Pregabalin in a Mouse Model of Neuropathic Pain.

    Science.gov (United States)

    Hewitt, Ellen; Pitcher, Thomas; Rizoska, Biljana; Tunblad, Karin; Henderson, Ian; Sahlberg, Britt-Louise; Grabowska, Urszula; Classon, Björn; Edenius, Charlotte; Malcangio, Marzia; Lindström, Erik

    2016-09-01

    Cathepsin S inhibitors attenuate mechanical allodynia in preclinical neuropathic pain models. The current study evaluated the effects when combining the selective cathepsin S inhibitor MIV-247 with gabapentin or pregabalin in a mouse model of neuropathic pain. Mice were rendered neuropathic by partial sciatic nerve ligation. MIV-247, gabapentin, or pregabalin were administered alone or in combination via oral gavage. Mechanical allodynia was assessed using von Frey hairs. Neurobehavioral side effects were evaluated by assessing beam walking. MIV-247, gabapentin, and pregabalin concentrations in various tissues were measured. Oral administration of MIV-247 (100-200 µmol/kg) dose-dependently attenuated mechanical allodynia by up to approximately 50% reversal when given as a single dose or when given twice daily for 5 days. No behavioral deficits were observed at any dose of MIV-247 tested. Gabapentin (58-350 µmol/kg) and pregabalin (63-377 µmol/kg) also inhibited mechanical allodynia with virtually complete reversal at the highest doses tested. The minimum effective dose of MIV-247 (100 µmol/kg) in combination with the minimum effective dose of pregabalin (75 µmol/kg) or gabapentin (146 µmol/kg) resulted in enhanced antiallodynic efficacy without augmenting side effects. A subeffective dose of MIV-247 (50 µmol/kg) in combination with a subeffective dose of pregabalin (38 µmol/kg) or gabapentin (73 µmol/kg) also resulted in substantial efficacy. Plasma levels of MIV-247, gabapentin, and pregabalin were similar when given in combination as to when given alone. Cathepsin S inhibition with MIV-247 exerts significant antiallodynic efficacy alone, and also enhances the effect of gabapentin and pregabalin without increasing side effects or inducing pharmacokinetic interactions.

  7. Who Should Be at the Bedside 24/7: Doctors, Families, Nurses?

    Science.gov (United States)

    Gershengorn, Hayley B; Garland, Allan

    2016-02-01

    Critical illness does not keep to regular, daytime business hours; we must provide high-quality care and support for intensive care unit (ICU) patients 24 hours per day, 7 days per week. Whether this mandates the presence of similar numbers and types of personnel throughout all hours of the day, however, has been the subject of much debate and substantial research. In this article, we review the available literature on the consequences of having three groups of care providers at a patient's bedside overnight: physicians, visitors, and nurses. Though few of the studies on this topic are randomized and prospective, several themes have emerged from the existing data. First, there is dramatic variation in practice between and within countries. Second, the weight of evidence does not indicate that patient outcomes are improved by having an intensivist present overnight in ICUs that are staffed by intensivists during the daytime hours. Third, although visitation is highly restricted in many ICUs-out of concerns for disruption of care and a negative physiological or psychological impact on patients-the available data suggest that patients and their families generally benefit from open visitation policies. And finally, although there is little debate that nurses are (and should be) available in the ICU 24/7, existing data do not provide much of a consensus about the details. Uncertainties include whether outcomes are better when each nurse is assigned only one patient (or, more generally, the optimal patient:nurse ratio), who these nurses should be (e.g., registered nurses vs. other personnel), and what their roles should entail (e.g., managing ventilators). As such, we cannot yet identify the optimal overnight nurse staffing strategy. What is clear is that the critical care community needs more and better data to further define these aspects of the relationship between ICU structure and ICU outcomes. PMID:26820278

  8. LCF- and LCF/HCF-behaviour of the superalloy MAR-M247LC

    Energy Technology Data Exchange (ETDEWEB)

    Gelmedin, Domnin; Lang, Karl-Heinz [Karlsruhe Institute of Technology (KIT), Karlsruhe (Germany). Inst. fuer Werkstoffkunde I

    2010-07-01

    The fatigue behaviour of the Nickel-base superalloy Mar-M247LC was investigated at 650 C in air environment under total strain control. Pure low cycle fatigue (LCF) loading, pure high cycle fatigue (HCF) loading and superimposed LCF/HCF loading were realised. In LCF tests with a strain ratio of zero and a hold time of 60 seconds the cyclic deformation and the lifetime behaviour was investigated. The dependence of the fatigue limit on the mean strain was estimated in HCF tests at a frequency of 60 Hz using an ultimate number of cycles of ten million. Finally the influence of superimposed HCF and LCF loadings was examined. At high total strain ranges of the HCF loading the lifetime of the superalloy as reduced about more than one magnitude compared to the lifetime under pure LCF loading. With decreasing HCF loadings the reduction of the lifetime decreases. This life time reduction can be explained by the interaction of the LCF and the superimposed HCF loading. Crack initiation and first crack propagation is predominantly induced by the LCF loading. After reaching an adequate long fatigue crack length the superimposed HCF loading contributes considerably to the crack growth. This contribution can be determined evaluating the distance between the LCF marking lines which form on the fracture surface. The higher the superimposed HCF loading was the longer the distance between the LCF marking lines and the lower the crack length were when first LCF marking lines could be recognized. On the basis of this cognition the life time under superimposed LCF/HCF loading was modelled using a model basing on fracture mechanics. (orig.)

  9. Construction of recombinants between molecular clones of murine retrovirus MCF 247 and Akv: determinant of an in vitro host range property that maps in the long terminal repeat.

    OpenAIRE

    Holland, C A; Wozney, J; Chatis, P A; Hopkins, N.; Hartley, J W

    1985-01-01

    The leukemogenic mink cell focus-forming (MCF) retroviruses such as MCF 247 have biological properties distinct from those of their ecotropic progenitors. Nucleotide sequences encoding portions of gp70, Prp15E, and the long terminal repeat differ between the two types of viruses. To investigate the role of each of these genetic elements in determining the biological properties of MCF viruses, we prepared infectious molecular clones of MCF 247 and generated a set of recombinants between these ...

  10. 24/7 Solar Minimum Polar Cap and Auroral Ion Temperature Observations

    Science.gov (United States)

    Sojka, Jan J.; Nicolls, Michael; van Eyken, Anthony; Heinselman, Craig; Bilitza, Dieter

    2011-01-01

    During the International Polar Year (IPY) two Incoherent Scatter Radars (ISRs) achieved close to 24/7 continuous observations. This presentation describes their data sets and specifically how they can provide the International Reference Ionosphere (IRI) a fiduciary E- and F-region ionosphere description for solar minimum conditions in both the auroral and polar cap regions. The ionospheric description being electron density, ion temperature and electron temperature profiles from as low as 90 km extending to several scale heights above the F-layer peak. The auroral location is Poker Flat in Alaska at 65.1 N latitude, 212.5 E longitude where the NSF s new Poker Flat Incoherent Scatter Radar (PFISR) is located. This location during solar minimum conditions is in the auroral region for most of the day but is at midlatitudes, equator ward of the cusp, for about 4-8 h per day dependent upon geomagnetic activity. In contrast the polar location is Svalbard, at 78.2 N latitude, 16.0 E longitude where the EISCAT Svalbard Radar (ESR) is located. For most of the day the ESR is in the Northern Polar Cap with a noon sector passage often through the dayside cusp. Of unique relevance to IRI is that these extended observations have enabled the ionospheric morphology to be distinguished between quiet and disturbed geomagnetic conditions. During the IPY year, 1 March 2007 - 29 February 2008, about 50 solar wind Corotating Interaction Regions (CIRs) impacted geospace. Each CIR has a two to five day geomagnetic disturbance that is observed in the ESR and PFISR observations. Hence, this data set also enables the quiet-background ionospheric climatology to be established as a function of season and local time. These two separate climatologies for the ion temperature at an altitude of 300 km are presented and compared with IRI ion temperatures. The IRI ion temperatures are about 200-300 K hotter than the observed values. However, the MSIS neutral temperature at 300 km compares favorably

  11. Curium-245 and curium-247 neutron cross sections between 10 keV and 10 MeV

    International Nuclear Information System (INIS)

    The optical model code 2PLUS and the statistical model codes COMNUC and CASCADE were used to compute neutron cross sections for Cm-245 and Cm-247 between 10 keV and 10 MeV. Cross sections for elastic and inelastic scattering, radiative capture, fission, and the (n,2n) reactions were computed. The parameters for the fission model were selected to yield agreement with the cross sections from the Physics-8 bomb shot. Pu-239 cross sections were calculated and compared with existing cross section evaluations to demonstrate the validity of the calculational methods

  12. A Luminous X-Ray Flare from the Nucleus of the Dormant Bulgeless Spiral Galaxy NGC 247

    OpenAIRE

    FENG, HUA; Ho, Luis C.; Kaaret, Philip; Tao, Lian; Yamaoka, Kazutaka; Zhang, Shuo; Grisé, Fabien

    2015-01-01

    NGC 247 is a nearby late-type bulgeless spiral galaxy that contains an inactive nucleus. We report a serendipitous discovery of an X-ray flare from the galaxy center with a luminosity of up to 2 x 10^(39) erg s^(−1) in the 0.3–10 keV band with XMM-Newton. A Chandra observation confirms that the new X-ray source is spatially coincident with the galaxy nucleus. The XMM-Newton data revealed a hard power-law spectrum with a spectral break near 3–4 keV, no pulsations on timescales longer than 150 ...

  13. Clinical analysis of laparoscopic cholecystectomy with improved trocar position in 247 cases%改良戳卡位置腹腔镜胆囊切除术247例临床分析

    Institute of Scientific and Technical Information of China (English)

    范智峰

    2015-01-01

    目的:探讨改良戳卡位置腹腔镜胆囊切除术的临床效果.方法:收治胆囊疾病患者247例,采用改良戳卡位置腹腔镜胆囊切除术治疗,观察治疗效果.结果:所有患者均顺利完成手术,术后恢复迅速,无严重并发症.结论:改良戳卡位置腹腔镜胆囊切除术的临床效果显著.%Objective:To explore the clinical effect of laparoscopic cholecystectomy with improved trocar position trocar.Methods:247 patients with gallbladder disease were selected.They were treated by laparoscopic cholecystectomy with improved trocar position.We observed the effect of treatment.Results:The operation of all patients were successfully completed.The postoperative recovery was rapid.There was no serious complications.Conclusion:The clinical effect of laparoscopic cholecystectomy with improved trocar position trocar was significant.

  14. Vibrational spectra, theoretical calculations, and two-dimensional potential energy surface for the ring-puckering vibrations of 2,4,7-trioxa[3.3.0]octane.

    Science.gov (United States)

    Chun, Hye Jin; Meinander, Niklas; Villarreal, John R; Laane, Jaan

    2015-01-15

    2,4,7-Trioxa[3.3.0]octane (247TOO) is an unusual bicyclic molecule which can exist in four different conformational forms which are determined by the directions of the two ring- puckering motions. The vibrational assignments of 247TOO have been made based on its infrared and Raman spectra and theoretical density functional theory (DFT) calculations. The two ring-puckering motions (in-phase and out-of-phase) were observed in the Raman spectra of the liquid at 249 and 205 cm(-1) and these values correspond well to the DFT values of 247 and 198 cm(-1). Ab initio calculations were utilized to calculate the structures and conformational energies for the four energy minima and the barriers to interconversion and the data was utilized to generate a two-dimensional potential energy surface (PES) for the two ring-puckering motions. The resulting quantum state energies for this PES were then calculated in order to better understand the patterns that are produced when the PES has four energy minima at different energy values. The wave functions corresponding to the different quantum states were also calculated. The NMR spectrum of 247TOO showed the presence of the two lowest energy conformations, consistent with the results of the ab initio calculations. PMID:25514365

  15. Spatially conserved regulatory elements identified within human and mouse Cd247 gene using high-throughput sequencing data from the ENCODE project

    DEFF Research Database (Denmark)

    Pundhir, Sachin; Hannibal, Tine Dahlbæk; Bang-Berthelsen, Claus Heiner;

    2014-01-01

    The Cd247 gene encodes for a transmembrane protein important for the expression and assembly of TCR/CD3 complex on the surface of T lymphocytes. Down-regulation of CD247 has functional consequences in systemic autoimmunity and has been shown to be associated with Type 1 Diabetes in NOD mouse....... In this study, we have utilized the wealth of high-throughput sequencing data produced during the Encyclopedia of DNA Elements (ENCODE) project to identify spatially conserved regulatory elements within the Cd247 gene from human and mouse. We show the presence of two transcription factor binding sites...... from the GENCODE project in human and our expression quantification analysis performed in NOD and B6 mice using qRT-PCR. Furthermore, 17 of the 23 SNPs already known to be implicated with T1D were observed within the long non-coding RNA region in mouse. The spatially conserved regulatory elements...

  16. Fission cross section measurements of Cm-247, Cf-250 and Es-254 from 0.1 eV to 80 keV

    International Nuclear Information System (INIS)

    Fission cross section measurements were made with the RINS system over the neutron energy range from approximately 0.1 eV to 80 keV upon samples of Cm-247, Cf-250 and Es-254. The Cm-247 measurement was undertaken to complete the RINS fission cross section measurement sequence of the curium isotopes, Es-254 was measured because it is a very heavy odd-odd nucleus which might show interesting nuclear structure effects in its fission cross section, and Cf-250 was measured to account for its buildup as a daughter product from the 276-day halflife Es-254. 6 refs., 3 figs

  17. TREATMENT OF 247 CASES OF PROLAPSE OF LUMBAR INTERVERTEBRAL DISC WITH COMPREHENSIVE PLUM-BLOSSOM MAGNETIC NEEDLE THERAPY

    Institute of Scientific and Technical Information of China (English)

    张保平; 周日清; 周登芳

    2004-01-01

    Objective: To observe the therapeutic effect of comprehensive plum-blossom magnetic needle therapy on prolapse of lumbar intervertebral disc. Methods: 247 cases of prolapse of lumbar intervertebral disc were treated first with manual treatment and then with plum-blossom magnetic needle therapy and effect-increasing pad therapy at specified points and reactive points. Results: After treatment for 2 therapeutic courses,153 cases were cured accounting for 61.94%, 71 cases were markedly effective accounting for 28.75%, 22 cases were improved accounting for8.91% and the rest one failed,accounting for 0.45%. Conclusion: The comprehensive plum-blossom magnetic needle therapy has a better therapeutic effect on prolapse of lumbar intervertebral disc.

  18. Effect of Process Variables on the Inertia Friction Welding of Superalloys LSHR and Mar-M247

    Science.gov (United States)

    Mahaffey, D. W.; Senkov, O. N.; Shivpuri, R.; Semiatin, S. L.

    2016-06-01

    The effect of inertia friction welding process parameters on microstructure evolution, weld plane quality, and the tensile behavior of welds between dissimilar nickel-base superalloys was established. For this purpose, the fine-grain, powder metallurgy alloy LSHR was joined to coarse-grain cast Mar-M247 using a fixed level of initial kinetic energy, but different combinations of the flywheel moment of inertia and initial rotation speed. It was found that welds made with the largest moment of inertia resulted in a sound bond with the best microstructure and room-temperature tensile strength equal to or greater than that of the parent materials. A relationship between the moment of inertia and weld process efficiency was established. The post-weld tensile behavior was interpreted in the context of observed microstructure gradients and weld-line defects.

  19. Effect of Process Variables on the Inertia Friction Welding of Superalloys LSHR and Mar-M247

    Science.gov (United States)

    Mahaffey, D. W.; Senkov, O. N.; Shivpuri, R.; Semiatin, S. L.

    2016-08-01

    The effect of inertia friction welding process parameters on microstructure evolution, weld plane quality, and the tensile behavior of welds between dissimilar nickel-base superalloys was established. For this purpose, the fine-grain, powder metallurgy alloy LSHR was joined to coarse-grain cast Mar-M247 using a fixed level of initial kinetic energy, but different combinations of the flywheel moment of inertia and initial rotation speed. It was found that welds made with the largest moment of inertia resulted in a sound bond with the best microstructure and room-temperature tensile strength equal to or greater than that of the parent materials. A relationship between the moment of inertia and weld process efficiency was established. The post-weld tensile behavior was interpreted in the context of observed microstructure gradients and weld-line defects.

  20. Failure behaviour of the superalloy MAR-M247 LC under LCF, HCF and combined LCF/HCF loading

    Energy Technology Data Exchange (ETDEWEB)

    Gelmedin, Domnin; Lang, Karl-Heinz [Karlsruher Institut fuer Technologie (KIT), Karlsruhe (DE). Inst. fuer Angewandte Materialien (IAM-WK)

    2012-01-15

    Materials for turbine blades experience in service a combined loading of low and high cycle fatigue at high temperatures. In order to understand the failure behaviour under these loading conditions, systematic investigations were carried out. Low cycle fatigue, high cycle fatigue and combined low and high cycle fatigue tests were realised on MAR-M247 LC at 650 C in an air environment under total strain control. Surface damage and fracture surfaces were analysed. Under combined low and high cycle fatigue, the lifetime is reduced if the low cycle fatigue leads to a degradation of the high cycle fatigue strength caused by crack initiation and crack growth. By analysing the fracture surface, the crack growth rate under combined cycle fatigue loading could be determined and it was significantly higher than under pure low cycle fatigue loading. The accelerated crack growth mainly causes the lifetime reduction. (orig.)

  1. A Gene Encoding a DUF247 Domain Protein Cosegregates with the S Self-Incompatibility Locus in Perennial Ryegrass

    DEFF Research Database (Denmark)

    Manzanares, Chloe; Barth, Susanne; Thorogood, Daniel;

    2016-01-01

    genes cosegregating with the S-locus, a highly polymorphic gene encoding for a protein containing a DUF247 was fully predictive of known S-locus genotypes at the amino acid level in the seven mapping populations. Strikingly, this gene showed a frameshift mutation in self-compatible darnel (Lolium...

  2. Expression of the benign HEXA mutations, Arg247Trp and Arg249Trp, associated with beta-hexosaminidase A pseudodeficiency

    Energy Technology Data Exchange (ETDEWEB)

    Cao, Z.; Petroulakis, E.; Salo, T. [Univ. of Manitoba (Canada)] [and others

    1994-09-01

    {beta}-Hexosaminidase (Hex A) is a heterodimer of {alpha} and {beta} subunits encoded by the HEXA and HEXB genes, respectively. Mutations in the HEXA gene typically cause Tay-Sachs disease or less severe forms of G{sub M2} gangliosidosis. However, two benign mutations (Arg247Trp and Arg249Trp) in the {alpha}-subunit of Hex A account for Hex A deficiency in {approximately}36% of non-Jewish enzyme-defined Tay-Sachs disease carriers. These mutations do not result in any apparent clinical phenotype in individuals who are genetic compounds with a second disease-causing mutation. We expressed the {alpha}-subunit harboring each of the benign mutations separately to study activity toward the synthetic substrate, 4-MUGS, for comparison to activity from enzymes containing mutations associated with other forms of G{sub M2} gangliosidosis. The C739T (Arg247Trp;benign), C745T (Arg 249Trp; benign), G805A (Gly269Ser; adult-onset), G749A (Gly250Asp; juvenile), and C508T (Arg170Trp; infantile) mutations were introduced into the {alpha}-subunit cDNA. These were transfected alone, or with the {beta}-subunit cDNA, to generate Hex S ({alpha}{alpha}) or Hex A ({alpha}{beta}), respectively. The activities were monitored using 4-MUGS, and the levels of {alpha}-subunit protein were assessed by Western blotting. Repeated experiments show that the benign mutations produce approximately 35% of normal Hex S and 40% of normal Hex A activity. This level is much higher than that of Hex A harbouring the Gly169Ser adult-onset mutation (12%). A sequential decrease in expressed Hex A activity is observed as mutations associated with more severe phenotypes are expressed. The benign mutations also result in lower levels of mature {alpha}-subunit protein compared to normal, and slightly reduced levels of {alpha}-subunit precursor protein. The Hex A deficiency resulting from benign mutations is not as great as that associated with disease-causing mutations.

  3. Effects of the Hot Isostatic Pressing Process on Crack Healing of the Laser Repair-Welded CM247LC Superalloy

    Directory of Open Access Journals (Sweden)

    Keng-Tu Hsu

    2016-10-01

    Full Text Available This study investigated the effects of the hot isostatic pressing process on the crack healing, microstructure, and mechanical properties of the laser repair-welded CM247LC precipitation-hardened superalloy. To ensure the strength of the repair-welded area, this study used the direct re-melting approach, and simulated the repair welding with the filler addition, which has a chemical composition matching that of the base superalloy. As expected, different types of cracks, including the solidification crack in the weld fusion zone and various types of liquidation cracks in the heat-affected zone, were observed. Through a proper hot isostatic pressing healing process, all cracks in the weld fusion zone and the heat-affected zone of the repair-welded pieces were healed. At the same time, some nano- and micro-sized carbides tended to form discontinuously along the healed crack trace. A micro-hardness test was conducted in the repair-welded area, and the results were similar to that of the as-cast material.

  4. A massive, distant proto-cluster at z=2.47 caught in a phase of rapid formation?

    CERN Document Server

    Casey, C M; Capak, P; Fu, H; Kovac, K; Lilly, S; Sanders, D B; Scoville, N Z; Treister, E

    2015-01-01

    Numerical simulations of cosmological structure formation show that the Universe's most massive clusters, and the galaxies living in those clusters, assemble rapidly at early times (2.5 2 based on associations of 5-40 galaxies around rare sources, the observational evidence for rapid cluster formation is weak. Here we report observations of an asymmetric, filamentary structure at z = 2.47 containing seven starbursting, submillimeter-luminous galaxies and five additional AGN within a volume of 4000 Mpc$^{3}$. As the expected lifetime of both the luminous AGN and starburst phase of a galaxy is ~100 Myr, we conclude that these sources were likely triggered in rapid succession by environmental factors, or, alternatively, the duration of these cosmologically rare phenomena is much longer than prior direct measurements suggest. The stellar mass already built up in the structure is $\\sim10^{12}M_{\\odot}$ and we estimate that the cluster mass will exceed that of the Coma supercluster at $z \\sim 0$. The filamentary s...

  5. Alfa247®: Un modelo de aprendizaje diferenciado para la enseñanza del Nordic Walking

    Directory of Open Access Journals (Sweden)

    Rodolfo Iván Martínez Lemos

    2010-03-01

    Full Text Available La técnica alfa y el método de los 7 pasos constituyen un modelo de aprendizaje diferenciado para la enseñanza del Nordic Walking (NW. NW consiste en caminar con bastones especialmente diseñados y utilizando una técnica precisa que moviliza una gran parte de la masa muscular total y tiene efectos beneficiosos probados sobre la salud. Alfa247® hace posible que cualquier persona, con independencia de su nivel de habilidad o condición física, pueda familiarizarse y aprender la técnica de caminar con bastones. Este nuevo concepto de movimiento saludable está todavía dando sus primeros pasos en España y es probable que en un futuro próximo pueda jugar un papel importante dentro del currículo de la Educación Física Escolar, como ya ha hecho en otros países del entorno.

  6. Towards low-friction and wear-resistant plasma sintering dies via plasma surface co-alloying CM247 nickel alloy with V/Ag and N

    Directory of Open Access Journals (Sweden)

    Zhang Zhenxue

    2015-01-01

    Full Text Available Nickel based superalloys have good oxidation and creep resistance and hence they can function under high mechanical stress and high temperatures. However, their undesirable tribological behaviour is the major technical barrier to the challenging high-temperature, lubricant-free plasma sintering tool application. In this study, nickel based CM247 superalloy surfaces were co-alloyed using innovative active screen plasma technology with both interstitial element (e.g. N and substitutional alloying elements (e.g. V and Ag to provide a synergy effect to enhance its tribological properties. The tribological behaviour of the plasma co-alloyed CM247 superalloy surfaces were fully evaluated using reciprocal and pin-on-disc tribometers at temperatures from room temperature to 600 ∘C. The experimental results demonstrate that the co-alloyed surface with N, Ag and V can effectively lower the friction coefficient, which is expected to help demoulding during lubricant-free plasma sintering.

  7. SIA:6月全球芯片销售额247亿美元同比降0.4%

    Institute of Scientific and Technical Information of China (English)

    2011-01-01

    美国半导体行业协会(SIA)发布的最新数据显示,今年6月全球芯片销售额达到247亿美元。比5月份的250亿美元减少1.2%,然而却较去年同期下降0.4%。

  8. HPLC MS/MS method for quantification of meprobamate in human plasma: application to 24/7 clinical toxicology.

    Science.gov (United States)

    Delavenne, Xavier; Gay-Montchamp, Jean Pierre; Basset, Thierry

    2011-01-15

    We described the development and full validation of rapid and accurate liquid chromatography method, coupled with tandem mass spectrometry detection, for quantification of meprobamate in human plasma with [(13)C-(2)H(3)]-meprobamate as internal standard. Plasma pretreatment involved a one-step protein precipitation with acetonitrile. Separation was performed by reversed-phase chromatography on a Luna MercuryMS C18 (20 mm×4 mm×3 μm) column using a gradient elution mode. The mobile phase was a mix of distilled water containing 0.1% formic acid and acetonitrile containing 0.1% formic acid. The selected reaction monitoring transitions, in electrospray positive ionization, used for quantification were 219.2→158.2 m/z and 223.1→161.1m/z for meprobamate and internal standard, respectively. Qualification transitions were 219.2→97.0 and 223.1→101.1 m/z for meprobamate and internal standard, respectively. The method was linear over the concentration range of 1-300 mg/L. The intra- and inter-day precision values were below 6.4% and accuracy was within 95.3% and 103.6% for all QC levels (5, 75 and 200 mg/L). The lower limit of quantification was 1 mg/L. Total analysis time was reduced to 6 min including sample preparation. The present method is successfully applied to 24/7 clinical toxicology and demonstrated its usefulness to detect meprobamate poisoning. PMID:21185792

  9. Clinical analysis of 247 children with whooping cough and the risk factors of severe cases%儿童百日咳247例临床特点及重症百日咳危险因素分析

    Institute of Scientific and Technical Information of China (English)

    胡云鸽; 刘泉波

    2015-01-01

    Objective To summarize the clinical characteristics of whooping cough in children and analyze the risk factors for severe whooping cough.Method A retrospective analysis was made on the clinical data of 247 children with whooping cough in Children's Hospital of Chongqing Medical University between Jan 2013 and Dec 2014.Of these patients,126 were male,121 were female,the median age was 3.1 months (23 days-4 years and eight months old).The patients were divided into two groups,group 1 had infants less than 3 months of age (n =120) and group 2 had infants and young children older than 3 months (n =127) according to their age.On the other hand,the patients were also divided into two groups according to vaccination status:vaccinated group (received diphtheria toxoid,tetanus toxoid,and acellular pertussis,DTP) (n =31) and unvaccinated group (n =188).Pure Bordetella pertussis infection was seen in 106 cases,and 141 cases had mixed infection.Severe disease was seen in 13 cases,and the other 234 cases had the modest disease.Clinical data were retrospectively analyzed and compared.Result (1) Bordetella pertussis was identified in 57/680 cases (8.4%) in 2013,and 190/1 856 cases (10.2%) in 2014.The disease could be seen throughout the year,but 182 cases (73.7%) occurred in summer or autumn;202 cases (81.8%) were less than 6 months.(2) Paroxysmal cough was seen in 238 cases (96.4%),61 cases (24.7%) had inspiratory whoop.Infants in group 1 often had episodes of cyanosis,apnea and suffocation (x2 =19.999,12.081,6.508,P < 0.05),persistent cough was often seen in group 2 (x2 =9.885,P < 0.05).Complications such as severe pneumonia,pulmonary consolidation and encephalopathy were more common in the group 1 than in group 2 (x2 =17.340,6.080,11.030,23.545,P < 0.05).(3) The length of stay of group 1,and of unvaccinated group was significantly longer than that of group 2 and of vaccinated group (t =19.331,26.741,P < 0.05).(4) Leukocytosis was found in 224 cases (90.7

  10. The multifaceted effects of agmatine on functional recovery after spinal cord injury through Modulations of BMP-2/4/7 expressions in neurons and glial cells.

    Directory of Open Access Journals (Sweden)

    Yu Mi Park

    Full Text Available Presently, few treatments for spinal cord injury (SCI are available and none have facilitated neural regeneration and/or significant functional improvement. Agmatine (Agm, a guanidinium compound formed from decarboxylation of L-arginine by arginine decarboxylase, is a neurotransmitter/neuromodulator and been reported to exert neuroprotective effects in central nervous system injury models including SCI. The purpose of this study was to demonstrate the multifaceted effects of Agm on functional recovery and remyelinating events following SCI. Compression SCI in mice was produced by placing a 15 g/mm(2 weight for 1 min at thoracic vertebra (Th 9 segment. Mice that received an intraperitoneal (i.p. injection of Agm (100 mg/kg/day within 1 hour after SCI until 35 days showed improvement in locomotor recovery and bladder function. Emphasis was made on the analysis of remyelination events, neuronal cell preservation and ablation of glial scar area following SCI. Agm treatment significantly inhibited the demyelination events, neuronal loss and glial scar around the lesion site. In light of recent findings that expressions of bone morphogenetic proteins (BMPs are modulated in the neuronal and glial cell population after SCI, we hypothesized whether Agm could modulate BMP- 2/4/7 expressions in neurons, astrocytes, oligodendrocytes and play key role in promoting the neuronal and glial cell survival in the injured spinal cord. The results from computer assisted stereological toolbox analysis (CAST demonstrate that Agm treatment dramatically increased BMP- 2/7 expressions in neurons and oligodendrocytes. On the other hand, BMP- 4 expressions were significantly decreased in astrocytes and oligodendrocytes around the lesion site. Together, our results reveal that Agm treatment improved neurological and histological outcomes, induced oligodendrogenesis, protected neurons, and decreased glial scar formation through modulating the BMP- 2/4/7 expressions following

  11. Nature of the soft ULX in NGC 247: super-Eddington outflow and transition between the supersoft and soft ultraluminous regimes

    CERN Document Server

    Feng, Hua; Kaaret, Philip; Grise, Fabien

    2016-01-01

    We report on XMM-Newton/Chandra/Swift/HST observations of the ultraluminous X-ray source (ULX) in NGC 247, which is found to make transitions between the supersoft ultraluminous (SSUL) regime with a spectrum dominated by a cool ($\\sim 0.1$ keV) blackbody component and the soft ultraluminous (SUL) regime with comparable luminosities shared by the blackbody and power-law components. Multi-epoch observations revealed an anti-correlation between the blackbody radius and temperature, $R_{\\rm bb} \\propto T_{\\rm bb}^{-2.8 \\pm 0.3}$, ruling out a standard accretion disk as the origin of the soft X-ray emission. The soft X-ray emission is much more variable on both short and long timescales in the SSUL regime than in the SUL regime. We suggest that the SSUL regime may be an extension of the ultraluminous state toward the high accretion end, being an extreme case of the SUL regime, with the blackbody emission arising from the photosphere of thick outflows and the hard X-rays being emission leaked from the embedded accr...

  12. Spectroscopy and single-particle structure of the odd- Z heavy elements {sup 255}Lr, {sup 251}Md and {sup 247}Es

    Energy Technology Data Exchange (ETDEWEB)

    Chatillon, A.; Theisen, C.; Bouchez, E.; Clement, E.; Dayras, R.; Goergen, A.; Korten, W.; Le Coz, Y.; Simenel, C.; Bender, M. [CEA Saclay, DSM/DAPNIA/SPhN, Gif-sur-Yvette Cedex (France); Greenlees, P.T.; Eeckhaudt, S.; Grahn, T.; Jones, P.; Julin, R.; Juutinen, S.; Kettunen, H.; Leino, M.; Perkowski, J.; Rahkila, P.; Saren, J.; Scholey, C.; Uusitalo, J. [University of Jyvaeskylae, Department of Physics, P.O. Box 35 (Finland); Auger, G.; Bouriquet, B.; Casandjian, J.M.; Cee, R.; France, G. de; Toureil, R. de; Rejmund, M.; Saint-Laurent, M.G.; Stodel, C.; Villari, A. [GANIL, Boulevard Henri Becquerel, B.P. 55027, Caen Cedex 5 (France); Bastin, J.E.; Herzberg, R.D.; Ikin, P.J.C.; Jones, G.D.; Pritchard, A. [University of Liverpool, Oliver Lodge Laboratory, Department of Physics, Liverpool (United Kingdom); Grevy, S. [LPC, CAEN Cedex (France); Hauschild, K.; Korichi, A.; Lopez-Martens, A.; Siem, S. [CSNSM, Orsay (France); Lukyanov, S.M.; Penionzhkevich, Yu.E.; Sobolev, Yu.G. [Joint Institute for Nuclear Research, Dubna (Russian Federation); Bonche, P. [CEA Saclay, DSM/SPhT, Gif-sur-Yvette Cedex (France)

    2006-11-15

    The odd-Z isotope {sup 255}Lr, its daughter {sup 251}Md and grand-daughter {sup 247}Es were studied in two experiments performed at GANIL and the University of Jyvaeskylae. The {sup 255}Lr nuclei were produced using the cold fusion-evaporation reaction {sup 209}Bi({sup 48}Ca, 2n){sup 255}Lr at a bombarding energy of 217MeV. The single-particle structure and decay properties were investigated using {alpha}, {gamma} and electron spectroscopy. The ground-state spin and parity could be assigned for {sup 255}Lr (1/2{sup -}) and {sup 251}Md (7/2{sup -}). States corresponding to the 7/2{sup +}[633], 7/2{sup -}[514] and 1/2{sup -}[521] Nilsson orbitals were observed. Results are compared to experimental data obtained in neighbouring isotopes and to Hartree-Fock-Bogoliubov calculations using the Skyrme interaction SLy4 and a density-dependent pairing interaction. The position of the 1/2{sup -}[521] orbital from the spherical 2f{sub 5/2} shell is discussed. (orig.)

  13. Assessment of the influence of interdendritic shrinkage cavities on the thermo-mechanical fatigue behaviour of the nickel-base superalloy MAR-M247LC

    Energy Technology Data Exchange (ETDEWEB)

    Beck, M.; Lang, K.H.; Loehe, D. [Inst. fuer Werkstoffkunde 1, Univ. Karlsruhe (TH), Karlsruhe (Germany)

    2002-07-01

    Precision cast high-temperature components often contain specific imperfections like micropores or microcavities. The influence of the position, size and distribution of such micro cavities as well as of the parameters of the thermomechanical fatigue loading on the lifetime behaviour of the superalloy MAR-M247LC was investigated using two specimen series, containing a high and a low amount of microcavities and a state from which any microcavity was removed by hot isostatic pressing. Thermo-mechanical fatigue (TMF) tests with zero (''in phase'') and -135 phase shift between temperature and mechanical strain were performed. The different damage behaviour at in-phase and -135 TMF requires different methods of the assessment of microcavities. For the in-phase loading, they are regarded as cracks and their effect on the local strain distribution is determined by the crack opening displacement. This leads to very good results for both specimen states investigated. For the -135 cycle, it is taken into account that the microcavities in the core of the specimens increase the loading in the microcavity-free shell of the specimen. This method corresponds closely to the effective damage mechanism and yields good results for both microcavity contents investigated. (orig.)

  14. Structural Benchmark Creep Testing for Microcast MarM-247 Advanced Stirling Convertor E2 Heater Head Test Article SN18

    Science.gov (United States)

    Krause, David L.; Brewer, Ethan J.; Pawlik, Ralph

    2013-01-01

    This report provides test methodology details and qualitative results for the first structural benchmark creep test of an Advanced Stirling Convertor (ASC) heater head of ASC-E2 design heritage. The test article was recovered from a flight-like Microcast MarM-247 heater head specimen previously used in helium permeability testing. The test article was utilized for benchmark creep test rig preparation, wall thickness and diametral laser scan hardware metrological developments, and induction heater custom coil experiments. In addition, a benchmark creep test was performed, terminated after one week when through-thickness cracks propagated at thermocouple weld locations. Following this, it was used to develop a unique temperature measurement methodology using contact thermocouples, thereby enabling future benchmark testing to be performed without the use of conventional welded thermocouples, proven problematic for the alloy. This report includes an overview of heater head structural benchmark creep testing, the origin of this particular test article, test configuration developments accomplished using the test article, creep predictions for its benchmark creep test, qualitative structural benchmark creep test results, and a short summary.

  15. Identification of gamma-ray emission from BZB J1450+5201: the most distant gamma-ray BL Lacertae object at z=2.47

    CERN Document Server

    Liao, N H; Liu, H T; Jiang, Ning; Yuan, Z L; Chen, Liang

    2013-01-01

    $\\gamma$-ray BL Lacertae objects (BL Lacs) with high redshifts ($z\\geq2$) are rarely detected. We report on an analysis of \\fermi data from five-year observation of 2FGL J1451.0+5159 whose $\\gamma$-ray emission is doubtful in the second \\fermi catalog (2FGL). It is detected at a higher energy, 3-10 GeV, with 6.7$\\sigma$ from our analysis than at 1-3 GeV from the 2FGL. The $\\gamma$-ray emission of the source is identified to be valid. Association presented in the 2FGL, between 2FGL J1451.0+5159 and BZB J1450+5201 whose redshift is suggested as 2.47, has been confirmed. BZB J1450+5201 appears to be the most distant $\\gamma$-ray BL Lac discovered to date. Multi-wavelength data from radio to $\\gamma$-ray energies are analyzed, indicating that this intermediate synchrotron peaked (ISP) source seems to be no difference from other ISP sources at lower redshifts in the second LAT AGN catalog. The pure SSC model is likely ruled out due to the extreme value of Doppler factor. Scattering of weak external emission plus S...

  16. Hydra—The National Earthquake Information Center’s 24/7 seismic monitoring, analysis, catalog production, quality analysis, and special studies tool suite

    Science.gov (United States)

    Patton, John M.; Guy, Michelle R.; Benz, Harley M.; Buland, Raymond P.; Erickson, Brian K.; Kragness, David S.

    2016-08-18

    This report provides an overview of the capabilities and design of Hydra, the global seismic monitoring and analysis system used for earthquake response and catalog production at the U.S. Geological Survey National Earthquake Information Center (NEIC). Hydra supports the NEIC’s worldwide earthquake monitoring mission in areas such as seismic event detection, seismic data insertion and storage, seismic data processing and analysis, and seismic data output.The Hydra system automatically identifies seismic phase arrival times and detects the occurrence of earthquakes in near-real time. The system integrates and inserts parametric and waveform seismic data into discrete events in a database for analysis. Hydra computes seismic event parameters, including locations, multiple magnitudes, moment tensors, and depth estimates. Hydra supports the NEIC’s 24/7 analyst staff with a suite of seismic analysis graphical user interfaces.In addition to the NEIC’s monitoring needs, the system supports the processing of aftershock and temporary deployment data, and supports the NEIC’s quality assurance procedures. The Hydra system continues to be developed to expand its seismic analysis and monitoring capabilities.

  17. Oxidation-reduction properties of americium, curium, berkelium, californium, einsteinium and fermium, and thermodynamic consequences for the 5f series

    International Nuclear Information System (INIS)

    The amalgamation of 5f elements from Am to Fm has been studied by using 241Am, 244Cm, 249Bk, 249Cf, 252Cf, 253Es, 254Es, 252Fm and 255Fm with two electrochemical methods, radiocoulometry and radiopolarography, perfectly adapted to investigate extremely diluted solutions when the concentration of electroactive species is as low as 10-16M. The theory of radiocoulometry has been developed in the general cases of reversible and irreversible electrode process. It has been used to interpret the experimental data on the kinetic curves of amalgamation, and to estimate the standard rate constant of the electrode process in complexing medium (citric). On the other hand the radiopolarographic method has been applied to study the mechanism of reduction at the dropping mercury electrode of cations M3+ in aqueous medium to the metal M with formation of amalgam. The results are exploited into two directions: 1- Acquisition of some data concerning the oxidation-reduction properties of elements from Am to Fm. Therefore the standard electrode E0 [M(III-0)] potentials for Bk, Cf and Es, and the standard electrode E0 [M(II-0)] potential for Fm are estimated and the relative stability of each oxidation state (from II to VII) of 5f elements is discussed; 2- Acquisition of unknown thermodynamic data on transcalifornium elements. Correlations between 4f and 5f elements are precised and some divergences appear for the second half of 4f and 5f series (i.e. for 65<=Z<=71 and 97<=Z<=103)

  18. Biological, chemical and other data collected aboard the THOMAS G. THOMPSON during cruise TN247 in the Coastal Waters of SE Alaska, North Pacific Ocean and South Pacific Ocean from 2010-03-11 to 2010-04-27 (NODC Accession 0104408)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — NODC accession 0104408 includes biological, chemical, optical, physical and underway data collected aboard the THOMAS G. THOMPSON during cruise TN247 in the Coastal...

  19. Effects of MAR-M247 substrate (modified) composition on coating oxidation coating/substrate interdiffusion. M.S. Thesis. Final Report; [protective coatings for hot section components of gas turbine engines

    Science.gov (United States)

    Pilsner, B. H.

    1985-01-01

    The effects of gamma+gamma' Mar-M247 substrate composition on gamma+beta Ni-Cr-Al-Zr coating oxidation and coating/substrate interdiffusion were evaluated. These results were also compared to a prior study for a Ni-Cr-Al-Zr coated gamma Ni-Cr-Al substrate with equivalent Al and Cr atomic percentages. Cyclic oxidation behavior at 1130 C was investigated using change in weight curves. Concentration/distance profiles were measured for Al, Cr, Co, W, and Ta. The surface oxides were examined by X-ray diffraction and scanning electron microscopy. The results indicate that variations of Ta and C concentrations in the substrate do not affect oxidation resistance, while additions of grain boundary strengthening elements (Zr, Hf, B) increase oxidation resistance. In addition, the results indicate that oxidation phenomena in gamma+beta/gamma+gamma' Mar-M247 systems have similar characteristics to the l gamma+beta/gamma Ni-Cr-Al system.

  20. Microstructure and transformation behavior of Ni{sub 24.7}Ti{sub 50.3}Pd{sub 25} high temperature shape-memory alloy with Sc micro-addition

    Energy Technology Data Exchange (ETDEWEB)

    Ramaiah, K.V., E-mail: kvramaiah@nal.res.in [Materials Science Division, CSIR-National Aerospace Laboratories, Bangalore 560 017 (India); Saikrishna, C.N. [Materials Science Division, CSIR-National Aerospace Laboratories, Bangalore 560 017 (India); Gouthama [Department of Materials Science and Engineering, Indian Institute of Technology, Kanpur 208 016 (India); Bhaumik, S.K. [Materials Science Division, CSIR-National Aerospace Laboratories, Bangalore 560 017 (India)

    2015-08-15

    NiTiPd shape-memory alloys (SMAs) are potential functional materials for use as solid-state actuators in the temperature range 100–250 °C. The present study investigates the effect of 1.0 at.% Sc micro-addition to Ni{sub 24.7}Ti{sub 50.3}Pd{sub 25} alloy, Sc replacing either Ti or Ni. Results show that all the three alloys studied have stable transformation behavior on stress-free thermal cycling and hence, are suitable for cyclic actuation applications. However, the addition of Sc to NiTiPd alloy leads to decrease of transformation temperatures, the magnitude of decrease being greater for the alloy with Sc replacing Ni. The martensite finish (M{sub f}) temperature of 181 °C for the NiTiPd alloy decreased to 139 °C for Sc replacing Ti and 83 °C for Sc replacing Ni. Also, the indentation modulus of NiTiPdSc (Sc replacing Ni) alloy is found to be significantly low compared to the other alloys. Analysis indicates that the observed differences in the alloy properties are related to the solubility of Sc in the NiTiPd matrix. While the quaternary NiTiPdSc alloy, Sc replacing Ti, has a single phase microstructure, the alloy with Sc replacing Ni shows the presence of Sc-rich and TiPd-type second phases in the microstructure. TEM examination revealed that the TiPd-type phase has a distinct rod-like morphology (30–50 nm) arranged in a grid-like structure. The transformation and indentation behavior of the alloys is elucidated using thermodynamic calculations of frictional energy and an electronic structure based analysis. - Highlights: • TEM of Ni{sub 23.7}Ti{sub 50.3}Pd{sub 25}Sc{sub 1} showed distinct grid of TiPd-type phase nanorods < 50 nm. • Stress-free thermal cycling of all the three alloys showed stable transformation behavior. • Ni{sub 24.7}Ti{sub 49.3}Pd{sub 25}Sc{sub 1} and Ni{sub 23.7}Ti{sub 50.3}Pd{sub 25}Sc{sub 1} showed single and multiphase structures. • Sc micro-addition (1 at.%) to Ni{sub 24.7}Ti{sub 50.3}Pd{sub 25} alloy decreased TTs

  1. 肺结核患者抗结核药物治疗不良反应%The monitoring of adverse reaction in patients with pulmonary tuberculosis treated by anti-tuberculosis drugs (a report of 247cases)

    Institute of Scientific and Technical Information of China (English)

    曾安津; 董霞

    2012-01-01

    目的 探讨肺结核在抗结核药物治疗过程中发生的不良反应.方法 对247例行抗结核药物治疗的肺结核患者出现不良反应进行分类分析.结果 不良反应主要表现为肝肾功能损害,消化道症状和中枢神经症状等;年龄超过50岁者不良反应发生率明显高于年龄低于50岁者(P<0.05).结论 肺结核患者使用抗结核药治疗应加强督导和随访,定期复查肝肾功能,及时有效处理药物不良反应.%Objective To investigate the adverse reaction of patients with pulmonary tuberculosis during the processes of anti-tu berculosis drug treatment, and provide the evidence for the development of effective prevention and treatment measures. Method The ad verse reactions of 247 patients with pulmonary tuberculosis treated with anti-tuberculosis drug therapy were classified and statistical ana lyzed. Results The main adverse reactions were liver and kidney dysfunction, gastrointestinal symptoms and nervous symptoms. The in cidence of adverse reactions in patients over the age of 50 years was significantly higher than that of patients under the age of 50 years ( P < 0. 05 ). Conclusion The treatment of anti-tuberculosis drug in patients with pulmonary tuberculosis should be strengthened supervision and follow-up, reviewing the function of liver and kidney regularly, adverse and drug reactions should be treated timely and effective, par ticularly patients over the age of 50 years.

  2. Missense mutations in PBP2A Affecting ceftaroline susceptibility detected in epidemic hospital-acquired methicillin-resistant Staphylococcus aureus clonotypes ST228 and ST247 in Western Switzerland archived since 1998.

    Science.gov (United States)

    Kelley, William L; Jousselin, Ambre; Barras, Christine; Lelong, Emmanuelle; Renzoni, Adriana

    2015-04-01

    The development and maintenance of an arsenal of antibiotics is a major health care challenge. Ceftaroline is a new cephalosporin with activity against methicillin-resistant Staphylococcus aureus (MRSA); however, no reports concerning MRSA ceftaroline susceptibility have been reported in Switzerland. We tested the in vitro activity of ceftaroline against an archived set of 60 MRSA strains from the University Hospital of Geneva collected from 1994 to 2003. Our results surprisingly revealed ceftaroline-resistant strains (MIC, >1 μg/ml in 40/60 strains; EUCAST breakpoints, susceptible [S], ≤1 μg/ml; resistant [R], >1 μg/ml) were present from 1998 to 2003. The detected resistant strains predominantly belonged to sequence type 228 (ST228) (South German clonotype) but also to ST247 (Iberian clonotype). A sequence analysis of these strains revealed missense mutations in the penicillin-binding protein 2A (PBP2A) allosteric domain (N146K or E239K and N146K-E150K-G246E). The majority of our ST228 PBP2A mutations (N146K or E150K) were distinct from ST228 PBP2A allosteric domain mutations (primarily E239K) recently described for MRSA strains collected in Thailand and Spain during the 2010 Assessing Worldwide Antimicrobial Resistance Evaluation (AWARE) global surveillance program. We also found that similar allosteric domain PBP2A mutations (N146K) correlated with ceftaroline resistance in an independent external ST228 MRSA set obtained from the nearby University Hospital of Lausanne, Lausanne, Switzerland, collected from 2003 to 2008. Thus, ceftaroline resistance was observed in our archived strains (including two examples of an MIC of 4 µg/ml for the Iberian ST247 clonotype with the triple mutation N146K/E150K/G246E), at least as far back as 1998, considerably predating the commercial introduction of ceftaroline. Our results reinforce the notion that unknown parameters can potentially exert selective pressure on PBP2A that can subsequently modulate ceftaroline

  3. Did CDM particles of mass 2.47 x 10(-3) eV interact with precursor biopolymers and nucleic acids to initiate and boost lifeforms on Earth?

    Science.gov (United States)

    Rosen, Gerald

    2011-06-01

    Recent observations and theoretical studies have shown that non-baryonic Cold Dark Matter (CDM), which constitutes about 84% of all matter in the Universe, may feature a complex-scalar-field that carries particles of mass ≅ 2.47 x 10(-3)eV with the associated Compton range m(-1) ≅8.02 x 10(-3) cm, a distance on the scale of extended bionucleic acids and living cells. Such a complex-scalar-field can enter a weak-isospin Lorentz-invariant interaction that generates the flow of right-handed electrons and induces a chirality-imbued quantum chemistry on the m (-1) scale. A phenomenological Volterra-type equation is proposed for the CDM-impacted time development of N, the number of base pairs in the most advanced organism at Earth-age t. The solution to this equation suggests that the boosts in N at t ≅ 1.1 Gyr (advent of the first living prokaryotic cells), at t ≅ 2.9 Gyr (advent of eukaryotic single-celled organisms) and finally at t ≅ 4.0 Gyr (the Cambrian explosion) may be associated with three multi-Myr-duration cosmic showers of the complex-scalar-field CDM particles. If so, the signature of the particles may be detectible in Cambrian rocks. PMID:21057875

  4. Did CDM Particles of Mass 2.47 × 10-3 eV Interact with Precursor Biopolymers and Nucleic Acids to Initiate and Boost Lifeforms on Earth?

    Science.gov (United States)

    Rosen, Gerald

    2011-06-01

    Recent observations and theoretical studies have shown that non-baryonic Cold Dark Matter (CDM), which constitutes about 84% of all matter in the Universe, may feature a complex-scalar-field that carries particles of mass m ≅ 2.47 × {10^{{ - 3}}}eV with the associated Compton range {m^{{ - 1}}} ≅ 8.02 × {10^{{ - 3}}}cm, a distance on the scale of extended bionucleic acids and living cells. Such a complex-scalar-field can enter a weak-isospin Lorentz-invariant interaction that generates the flow of right-handed electrons and induces a chirality-imbued quantum chemistry on the m -1 scale. A phenomenological Volterra-type equation is proposed for the CDM-impacted time development of N, the number of base pairs in the most advanced organism at Earth-age t. The solution to this equation suggests that the boosts in N at t ≅ 1.1 Gyr (advent of the first living prokaryotic cells), at t ≅ 2.9 Gyr (advent of eukaryotic single-celled organisms) and finally at t ≅ 4.0 Gyr (the Cambrian explosion) may be associated with three multi-Myr-duration cosmic showers of the complex-scalar-field CDM particles. If so, the signature of the particles may be detectible in Cambrian rocks.

  5. 40 CFR 247.17 - Miscellaneous products.

    Science.gov (United States)

    2010-07-01

    ..., or plastic. (e) Mats containing recovered rubber and/or plastic. (f)(1) Non-road signs containing recovered plastic or aluminum and road signs containing recovered aluminum. (2) Sign supports and posts... Miscellaneous products. (a) Pallets containing recovered wood, plastic, or paperboard. (b) Sorbents...

  6. 32 CFR 247.6 - Procedures.

    Science.gov (United States)

    2010-07-01

    ... attitudes and increase knowledge. (B) News reports and feature stories on individuals and organizational... the majority of the host installation audience from publishing a separate newspaper, when...

  7. 7 CFR 247.20 - Program violations.

    Science.gov (United States)

    2010-01-01

    ...) Selling commodities obtained in the program, or exchanging them for non-food items; (4) Physical abuse, or threat of physical abuse, of program staff; or (5) Committing dual participation. (b) What are...

  8. 32 CFR 247.4 - Policy.

    Science.gov (United States)

    2010-07-01

    ..., marital status, physical handicap, political affiliation, or any other nonmerit factor of the purchaser... national and world news may include coverage of U.S. political campaign news from commercial news sources. Presentation of such political campaign news shall be made on a balanced, impartial, and nonpartisan basis....

  9. 40 CFR 247.3 - Definitions.

    Science.gov (United States)

    2010-07-01

    ... period of time, and maintenance of a satisfactory level of competition; Printer ribbon means a nylon fabric designed to hold ink and used in dot matrix and other types of impact printers; Procurement item... inventories of paper and paperboard manufacturers, merchants, wholesalers, dealers, printers, converters,...

  10. 32 CFR 247.3 - Definitions.

    Science.gov (United States)

    2010-07-01

    ...; commanders' comments; letters to the editor; editorials; commentaries; features; sports; entertainment items... and installation maps and may contain supplements or inserts. They become the property of the command..., including digital printing. Supplements. Features, advertising sections, or morale, welfare and...

  11. Dicty_cDB: SHI247 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available emediation Malus x domestica cDNA clone ABNB001773, mRNA sequence. 78 1e-12 2 CN939...e-13 2 CN914665 |CN914665.1 030110ABNB001773HT (ABNB) Braeburn cultured fruit cells, boron exposed, phytor

  12. Dicty_cDB: SFJ247 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available AAAGCCAAGATCCAAGATAAAGAA GGTATTCCACCAGATCAACAAAGATTAATCT sequence update 2001. 6. 1 Translated Amino Acid sequence ---m*xqxpxxxrf...kinxcr*tir rwsysf*lqyskrihspfsfkikrwyanlc*nshw*nnhfrs*rf**h*kc*sqdpr*rr ystrstkin Frame B: ---m*xqxpxxxrfppd

  13. 24/7 Negotiation in couples' transition to parenthood

    NARCIS (Netherlands)

    Wiesmann, S.M.

    2010-01-01

    How do couples negotiate about their division of paid and unpaid work when they become parents? The division of work among couples has significantly changed in the past decades. This study focused on the underlying processes that lead couples to a certain division of paid and unpaid work. To unravel

  14. 40 CFR 247.16 - Non-paper office products.

    Science.gov (United States)

    2010-07-01

    ...-paper office products. (a) Office recycling containers and office waste receptacles. (b) Plastic desktop accessories. (c) Toner cartridges. (d) Plastic-covered binders containing recovered plastic; chipboard and pressboard binders containing recovered paper; and solid plastic binders containing recovered plastic....

  15. Dicty_cDB: SSK247 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available .. 34 9.7 AB049544_1( AB049544 |pid:none) Porcine enterovirus 10 gene for RN... 3...4 9.7 AF363453_1( AF363453 |pid:none) Porcine enterovirus 9 strain UKG/4... 34 9.7 protein update 2009. 6.14

  16. 32 CFR Appendix B to Part 247 - CE Publications

    Science.gov (United States)

    2010-07-01

    ... publication any advertising of the following types: (1) paid political advertisements for a candidate, party... publication. CE publishers sell advertising to cover costs and secure earnings, print the publications, and... staff who produce the non-advertising content of the CE publication may perform certain...

  17. Maintaining Mission Critical Systems in a 247 Environment

    CERN Document Server

    Curtis, Peter M

    2011-01-01

    "This book is meant to offer Architects, Property Mangers, Facility Managers, Building Engineers, Information Technology Professionals, Data Center Personnel, Electrical & Mechanical Technicians and students in undergraduate, graduate, or continuing education programs relevant insight into the Mission Critical Environment with an emphasis on business resiliency, data center efficiency, and green power technology. Industry improvements, standards, and techniques have been incorporated into the text and address the latest issues prevalent in the Mission Critical Industry. An emphasis on green technologies and certifications is presented throughout the book. In addition, a description of the United States energy infrastructure's dependency on oil, in relation to energy security in the mission critical industry, is discussed. In conjunction with this, either a new chapter will be created on updated policies and regulations specifically related to the mission critical industry or updates to policies and regula...

  18. Web Based Prognostics and 24/7 Monitoring

    Science.gov (United States)

    Strautkalns, Miryam; Robinson, Peter

    2013-01-01

    We created a general framework for analysts to store and view data in a way that removes the boundaries created by operating systems, programming languages, and proximity. With the advent of HTML5 and CSS3 with JavaScript the distribution of information is limited to only those who lack a browser. We created a framework based on the methodology: one server, one web based application. Additional benefits are increased opportunities for collaboration. Today the idea of a group in a single room is antiquated. Groups will communicate and collaborate with others from other universities, organizations, as well as other continents across times zones. There are many varieties of data gathering and condition-monitoring software available as well as companies who specialize in customizing software to individual applications. One single group will depend on multiple languages, environments, and computers to oversee recording and collaborating with one another in a single lab. The heterogeneous nature of the system creates challenges for seamless exchange of data and ideas between members. To address these limitations we designed a framework to allow users seamless accessibility to their data. Our framework was deployed using the data feed on the NASA Ames' planetary rover testbed. Our paper demonstrates the process and implementation we followed on the rover.

  19. 7 CFR 2.47 - Administrator, Rural Utilities Service.

    Science.gov (United States)

    2010-01-01

    ...) of the Food, Agriculture, Conservation, and Trade Act of 1990 (7 U.S.C. 2279-1(e)) (b) Reservations... and programs related to watershed facilities, resource and conservation facilities, and water and.... (ix) Section 310A (7 U.S.C. 1931), relating to watershed and resource conservation and development....

  20. 7 CFR 247.37 - Civil rights requirements.

    Science.gov (United States)

    2010-01-01

    ... against should file a discrimination complaint with the USDA Director, Office of Civil Rights, Room 326W, Whitten Building, 1400 Independence Avenue, SW., Washington, DC 20250-9410, or telephone (202) 720-5964....

  1. Dicty_cDB: SFG247 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available t alignments: (bits) Value N AW759959 |AW759959.1 sl56c07.y1 Gm-c1027 Glycine max cDNA clone GENOME SYSTEM...nce. 56 9e-10 2 BF071471 |BF071471.1 st59b09.y1 Gm-c1053 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-...nce. 48 1e-08 3 BI974435 |BI974435.1 saj01e10.y1 Gm-c1065 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm...E12 5', mRNA sequence. 48 2e-08 3 AI966749 |AI966749.1 sc57c05.y1 Gm-c1016 Glycine max cDNA clone GENOME SYSTEMS

  2. 8 CFR 247.12 - Disposition of case.

    Science.gov (United States)

    2010-01-01

    ... Aliens and Nationality DEPARTMENT OF HOMELAND SECURITY IMMIGRATION REGULATIONS ADJUSTMENT OF STATUS OF... and shall constitute notice to him of such adjustment. The alien's nonimmigrant status shall be for... retain his status as an immigrant and files with the district director Form I-508 and, if...

  3. ED 'vending machine' sells patient meds 24/7.

    Science.gov (United States)

    2008-05-01

    A vending machine stocked with your most commonly used drugs can be a relatively inexpensive investment in patient and staff satisfaction. Rice Memorial Hospital in Willmar, MN, has installed such a machine, which includes several safeguards: * It has several internal cameras, serving as backup systems to ensure the proper drug is being dispensed to the proper patient. * The machine cannot be accessed by anyone unless they have received a magnetic swipe card from the prescribing physician. * The code is only given to a physician authorized to enter the web portal of the prescription vendor. PMID:18686529

  4. 7 CFR 247.31 - Audits and investigations.

    Science.gov (United States)

    2010-01-01

    .... (a) What is the purpose of an audit? The purpose of an audit is to ensure that: (1) Financial... are maintained; and (4) Applicable laws, regulations, and administrative requirements are followed. (b) When may the Department conduct an audit or investigation of the program? The Department may conduct...

  5. Use of trioctylphosphine oxide for transplutonium element extraction and purification

    International Nuclear Information System (INIS)

    Investigated was extraction of tri-valent curium, berkelium, californium, einsteinium as well as cerium and europium with trioctylphosphin oxide from lactic acid solutions, containing DTPA and aluminium nitrate depending on the aluminium nitrate and TOPO concentrations and nitric acid solutions of variable concentration as well. Under optimum conditions of extraction chromatography of berkelium studied was the distribution of cobalt, nickel, chromium, iron, aluminium, titanium, zirconium and niobium ions, and the coefficients of berkelium purification from cations investigated were determined. The effect of weight quantities of cation impurities on extraction chromatographic yield of berkelium has been investigated. Examples of practice application of the extraction chromatography with the use of TOPO are given

  6. Actinide production in the reaction of heavy ions with curium-248

    International Nuclear Information System (INIS)

    Chemical experiments were performed to examine the usefulness of heavy ion transfer reactions in producing new, neutron-rich actinide nuclides. A general quasi-elastic to deep-inelastic mechanism is proposed, and the utility of this method as opposed to other methods (e.g. complete fusion) is discussed. The relative merits of various techniques of actinide target synthesis are discussed. A description is given of a target system designed to remove the large amounts of heat generated by the passage of a heavy ion beam through matter, thereby maximizing the beam intensity which can be safely used in an experiment. Also described is a general separation scheme for the actinide elements from protactinium (Z=91) to mendelevium (Z=101), and fast specific procedures for plutonium, americium and berkelium. The cross sections for the production of several nuclides from the bombardment of 248Cm with 18O, 86Kr and 136Xe projectiles at several energies near and below the Coulomb barrier were determined. The results are compared with yields from 48Ca and 238U bombardments of 248Cm. Simple extrapolation of the product yields into unknown regions of charge and mass indicates that the use of heavy ion transfer reactions to produce new, neutron-rich above-target species is limited. The substantial production of neutron-rich below-target species, however, indicates that with very heavy ions like 136Xe and 238U the new species 248Am, 249Am and 247Pu should be produced with large cross sections from a 248Cm target. A preliminary, unsuccessful attempt to isolate 247Pu is outlined. The failure is probably due to the half life of the decay, which is calculated to be less than 3 minutes. The absolute gamma ray intensities from 251Bk decay, necessary for calculating the 251Bk cross section, are also determined

  7. 25 CFR 247.1 - What definitions apply to this part?

    Science.gov (United States)

    2010-04-01

    ... least 50 years of age, and the physical site, location, or context in which they are found. Area..., personal warmth, lighting, ceremonial or aesthetic purposes. Damage means to injure, mutilate,...

  8. 27 CFR 24.247 - Materials authorized for the treatment of distilling material.

    Science.gov (United States)

    2010-04-01

    ... 184.1733 (GRAS). Enzyme activity The enzyme preparation used shall be prepared from nontoxic and... fermentable carbohydrates The amylase enzyme activity shall be derived from Aspergillus niger, Aspergillus... convent starches to fermentable carbohydrates The amylase enzyme activity shall be derived from...

  9. 17 CFR 247.741 - Exemption for banks effecting transactions in money market funds.

    Science.gov (United States)

    2010-04-01

    ... (15 U.S.C. 78c(a)(4)) to the extent that it effects transactions on behalf of a customer in securities issued by a money market fund, provided that: (1) The bank either (i) Provides the customer, directly or..., the other bank described in paragraph (a)(1)(B) of this section provides the customer, not later...

  10. Mission Overview STS-107: Providing 24/7 Space Science Research

    Science.gov (United States)

    2002-12-01

    Columbia's 16-day mission is dedicated to a mixed complement of competitively selected and commercially sponsored research in the space, life and physical sciences. An international crew of seven, including the first Israeli astronaut, will work 24 hours a day in two alternating shifts to carry out experiments in the areas of astronaut health and safety; advanced technology development; and Earth and space sciences.

  11. 48 CFR 52.247-42 - C.i.f. Destination.

    Science.gov (United States)

    2010-10-01

    ... vessel to the specified point of destination, with the cost of transportation and marine insurance paid... insurance policy or certificate providing the amount and extent of marine insurance coverage specified...

  12. 48 CFR 52.247-64 - Preference for Privately Owned U.S.-Flag Commercial Vessels.

    Science.gov (United States)

    2010-10-01

    ... deployed in connection with United Nations or North Atlantic Treaty Organization humanitarian or... operations; (B) Exercises; or (C) Forces deployed in connection with United Nations or North Atlantic Treaty... connection with United Nations or North Atlantic Treaty Organization humanitarian or peacekeeping operations.)...

  13. 32 CFR Appendix A to Part 247 - Funded Newspapers and Magazines

    Science.gov (United States)

    2010-07-01

    ... magazines support the command communication requirements of the DoD Components and their subordinate..., and other Government Agencies. Civilian community service news and announcements of benefit to... that are part of the business activities or contractual responsibilities of the contract...

  14. 49 CFR 173.247 - Bulk packaging for certain elevated temperature materials.

    Science.gov (United States)

    2010-10-01

    ... 101 and IM 102 portable tanks; UN portable tanks; marine portable tanks conforming to 46 CFR part 64... or bitumen are subject to the following requirements: (1) Low stability kettles. Kettles with a ratio... temperature likely to be encountered if the packaging were engulfed in a fire. When pressure control...

  15. Design of Motor Servo System with Multi-Channel Switching Power Based on TOP247Y%基于TOP247Y的电机伺服系统用多路开关电源设计

    Institute of Scientific and Technical Information of China (English)

    李君; 曾岳南

    2012-01-01

    文中设计了一种基于TOPSwitch-GX系列的电机伺服系统用多路单端反激式开关电源。该电源给系统控制板以及功率器件驱动电路提供5路+15 V、1路-15 V、1路+5 V独立电源,输出功率达到46 W。主要介绍了TOPS-witch-GX系列芯片的特点、开关电源辅助电路设计依据,着重分析了高频变压器的设计步骤,最后设计了基于TL431和光耦PC817的反馈补偿网络保证输出电压的稳定性。%A multi-channel single-end flyback switching power supply is designed for a motor servo system based on TOPSwitch-GX.The power supply to the system control panel and power device driving circuit 5 roads,+15 V,1 road-15V,1 road,+5 V separated power supplies and output power of 46 W.This paper mainly introduced the TOPSwitch-GX series chips feature,switching power supply auxiliary circuit design basis,focus on analyzes the design procedure of high frequency transformer,finally designes feedback compensation network based on TL431 and PC817 to ensure the stability of the output voltage.

  16. 17 CFR 247.700 - Defined terms relating to the networking exception from the definition of “broker.”

    Science.gov (United States)

    2010-04-01

    ... multiple factors or variables and: (A) Those factors or variables include multiple significant factors or...) Such measure of overall profitability or revenue is only one of multiple factors or variables used to... security; or whether it results in multiple securities transactions; provided, however, that a referral...

  17. Beverage consumption habits “24/7” among British adults: association with total water intake and energy intake

    Directory of Open Access Journals (Sweden)

    Gibson Sigrid

    2013-01-01

    Full Text Available Abstract Background Various recommendations exist for total water intake (TWI, yet it is seldom reported in dietary surveys. Few studies have examined how real-life consumption patterns, including beverage type, variety and timing relate to TWI and energy intake (EI. Methods We analysed weighed dietary records from the National Diet and Nutrition Survey of 1724 British adults aged 19–64 years (2000/2001 to investigate beverage consumption patterns over 24 hrs and 7 days and associations with TWI and EI. TWI was calculated from the nutrient composition of each item of food and drink and compared with reference values. Results Mean TWI was 2.53 L (SD 0.86 for men and 2.03 L (SD 0.71 for women, close to the European Food Safety Authority “adequate Intake” (AI of 2.5 L and 2 L, respectively. However, for 33% of men and 23% of women TWI was below AI and TWI:EI ratio was In multi-variable regression (adjusted for sex, age, body weight, smoking, dieting, activity level and mis-reporting, replacing 100 g of caloric beverages (milk, fruit juice, caloric soft drinks and alcohol with 100 g non-caloric drinks (diet soft drinks, hot beverages and water was associated with a reduction in EI of 15 kcal, or 34 kcal if food energy were unchanged. Using within-person data (deviations from 7-day mean each 100 g change in caloric beverages was associated with 29 kcal change in EI or 35 kcal if food energy were constant. By comparison the calculated energy content of caloric drinks consumed was 47 kcal/100 g. Conclusions TWI and beverage consumption are closely related, and some individuals appeared to have low TWI. Compensation for energy from beverages may occur but is partial. A better understanding of interactions between drinking and eating habits and their impact on water and energy balance would give a firmer basis to dietary recommendations.

  18. SU-E-J-247: A Simulation of X-Ray Emission with Gold Nanoparticle Irradiated by Energetic Proton Beam

    Energy Technology Data Exchange (ETDEWEB)

    Newpower, M; Ahmad, S; Chen, Y [University of Oklahoma Health Sciences Center, Oklahoma City, OK (United States)

    2014-06-01

    Purpose: To investigate the proton induced X-ray emissions in gold-water mixture materials. Methods: In this study a Monte Carlo simulation was created using the GEANT4 toolkit (version 4.9.6). The geometry in this setup includes a 2 cm × 2 cm × 2 cm target, a scoring sphere (radius = 10 cm) and a 65 MeV planar proton source (2 cm × 2 cm). Four concentrations of a gold-water solution were irradiated with 5×10{sup 5} incident protons at a distance of 0.5 cm perpendicular to the surface of the target. The solutions of gold-water mixture had 10%, 5%, 1% and 0.5% of gold by mass, respectively. The number of photon emitting for the target was counted in the scoring sphere for the energy range of 0-86.0 keV in 0.1 keV bins. For this study the reference physics list PhysListEmStandard was used together with the x-ray fluorescence, Auger electron and PIXE (particle induced xray emission) options enabled. The range cuts for photons and electrons were set at 0.5 mm and 1.0 mm, respectively. Results: In the energy spectra of emitting X-ray fluorescence, peaks from gold K shell characteristic x-rays (68.8 and 66.9 keV) were observed. The number of counts under the peaks of Ka1 and Ka2 was found to increase with the increasing of the gold concentrations in the mixture materials. The X-ray yields (for both Ka1 and Ka2) when fitted with least-square method as a function of gold concentration demonstrate a linear dependency with R{sup 2} > 0.96. The Ka1yield per incident proton was found to be 0.0016 for 10% gold-water mixture solutions. Conclusion: This preliminary study with PIXE technique with gold nanoparticle has demonstrated potentials for its utilization in the development of range and dose verification methodology that is currently of great interest in the field of proton radiation therapy.

  19. 17 CFR 247.760 - Exemption from definition of “broker” for banks accepting orders to effect transactions in...

    Science.gov (United States)

    2010-04-01

    ... a plan under 17 CFR 270.12b-1, from the bank, the executing broker or dealer, or any other person...) Advertisement means any material that is published or used in any electronic or other public media, including any Web site, newspaper, magazine or other periodical, radio, television, telephone or tape...

  20. 48 CFR 247.573-1 - Ocean transportation incidental to a contract for supplies, services, or construction.

    Science.gov (United States)

    2010-10-01

    ... Business Management Directorate, MSC; or (ii) The Commander, Military Surface Deployment and Distribution (SDDC), through the SDDC global e-mailbox sddc.ops.ffw@us.army.mil and the Principal Assistant... Commander, MSC, through the Contracts and Business Management Directorate, MSC; or (B) The...

  1. SU-E-J-247: Time Evolution of Radiation-Induced Lung Injury After Stereotactic Proton Therapy

    International Nuclear Information System (INIS)

    Purpose: Quantitative metrics to assess patient-specific radiation-induced lung injury have the potential to guide individualization of therapy and be early indicators of recurrence. Here we investigate computed tomography (CT) density changes in normal lung after stereotactic Proton Therapy. Methods: Participants in a phase-I clinical trial for stereotactic body radiation therapy (SBRT) with protons are analyzed on a rolling basis. The dataset includes 9 patients with 34 CT images to date. Follow-up images are registered to the planning CT using deformable image registration and the change in CT density is correlated to the dose to examine the time-evolution of Hounsfield Unit (HU) changes after large doses of proton radiation. Results: The lung density observed on the follow-up images increases significantly with dose for all dose levels above 5 Gy(RBE) (p<0.001) for 8/9 patients. The change per unit dose [HU/Gy] varies significantly among the patients, from 0.1 (for the one patient without significant correlation) to 5.7 ΔHU/Gy(RBE). The current population average of ΔHU/Gy(RBE) is 2.1, i.e. a 1 Gy(RBE) increase in dose leads on average to a 2.1 HU increase in CT density. The slope of the dose-response curve is constant for all timepoints investigated (from 3–24+ months). Additionally a pronounced non-linearity in the dose response curve is noted for long follow-up times (>18 months). Conclusion: CT density changes have a robust correlation with proton dose, quantitatively similar to photon dose, and may allow estimation of a patient’s intrinsic radiosensitivity after proton therapy. The stability of the correlation with time however diverges from what is known about CT response after photon irradiation. This could have important implications for clinical decision-making during proton therapy for lung cancer, especially for scheduling of follow-up CT/PET imaging and diagnosis of recurrence

  2. 78 FR 46315 - Foreign-Trade Zone (FTZ) 247-Erie, Pennsylvania, Notification of Proposed Production Activity, GE...

    Science.gov (United States)

    2013-07-31

    ...; engine cab assemblies; floor assemblies; frame assemblies; gutter assemblies; handrails; heat shield...; socket head screws; fasteners; nuts; plates; weld nuts; locknuts; washers; retaining rings; pins; shafts...; inverter sockets; connection strips; connector kits; copper bars; junction boxes; terminal...

  3. 78 FR 42451 - Listing of Color Additives Exempt From Certification; Reactive Blue 246 and Reactive Blue 247...

    Science.gov (United States)

    2013-07-16

    ... HUMAN SERVICES Food and Drug Administration 21 CFR Part 73 Listing of Color Additives Exempt From... color additive regulations in Sec. Sec. 73.3100 and 73.3106 (21 CFR 73.3100 and 73.3106), respectively... Blue 246), as color additives in contact lenses. We also corrected the nomenclature for Reactive...

  4. 17 CFR 247.701 - Exemption from the definition of “broker” for certain institutional referrals.

    Science.gov (United States)

    2010-04-01

    ... customer to the broker or dealer for investment banking services. (3) Investment banking services includes... the broker or dealer for investment banking services provided to the customer. (e) Inflation... by the rules of any self-regulatory organization; (B) Predominantly engaged in banking...

  5. 49 CFR 40.247 - What procedures does the BAT or STT follow after a screening test result?

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 1 2010-10-01 2010-10-01 false What procedures does the BAT or STT follow after a... What procedures does the BAT or STT follow after a screening test result? (a) If the test result is an alcohol concentration of less than 0.02, as the BAT or STT, you must do the following: (1) Sign and...

  6. Beverage consumption habits “24/7” among British adults: association with total water intake and energy intake

    OpenAIRE

    Gibson Sigrid; Shirreffs Susan M

    2013-01-01

    Abstract Background Various recommendations exist for total water intake (TWI), yet it is seldom reported in dietary surveys. Few studies have examined how real-life consumption patterns, including beverage type, variety and timing relate to TWI and energy intake (EI). Methods We analysed weighed dietary records from the National Diet and Nutrition Survey of 1724 British adults aged 19–64 years (2000/2001) to investigate beverage consumption patterns over 24 hrs and 7 days and associations wi...

  7. Book Buzz: Online 24/7: Virutal Reading Clubs and What We've Learned About Them

    Directory of Open Access Journals (Sweden)

    Catherine AuYeung

    2007-09-01

    Full Text Available This presentation, originally given at the Ontario Library Association 2007 SuperConference, was based on our experience at Toronto Public Library in developing the online book club site, Book Buzz. We have described our actual experience and what we have learned from it that may be useful for other start-ups. The presentation has been adapted here for a reading audience.Taking part in the presentation were a manager, an electronic services specialist, and a moderator - all librarians. We covered the project’s planning stages, the design phase, and, lastly, what is involved in the day-to-day running of the book club.

  8. Book Buzz: Online 24/7: Virutal Reading Clubs and What We've Learned About Them

    OpenAIRE

    Catherine AuYeung; Sheila Dalton; Sandra Gornall

    2007-01-01

    This presentation, originally given at the Ontario Library Association 2007 SuperConference, was based on our experience at Toronto Public Library in developing the online book club site, Book Buzz. We have described our actual experience and what we have learned from it that may be useful for other start-ups. The presentation has been adapted here for a reading audience.Taking part in the presentation were a manager, an electronic services specialist, and a moderator - all librarians. We cov...

  9. SU-E-J-247: Time Evolution of Radiation-Induced Lung Injury After Stereotactic Proton Therapy

    Energy Technology Data Exchange (ETDEWEB)

    Grassberger, C; Sharp, G; Fintelmann, F; Paganetti, H; Willers, H [Massachusetts General Hospital, Boston, MA (United States)

    2015-06-15

    Purpose: Quantitative metrics to assess patient-specific radiation-induced lung injury have the potential to guide individualization of therapy and be early indicators of recurrence. Here we investigate computed tomography (CT) density changes in normal lung after stereotactic Proton Therapy. Methods: Participants in a phase-I clinical trial for stereotactic body radiation therapy (SBRT) with protons are analyzed on a rolling basis. The dataset includes 9 patients with 34 CT images to date. Follow-up images are registered to the planning CT using deformable image registration and the change in CT density is correlated to the dose to examine the time-evolution of Hounsfield Unit (HU) changes after large doses of proton radiation. Results: The lung density observed on the follow-up images increases significantly with dose for all dose levels above 5 Gy(RBE) (p<0.001) for 8/9 patients. The change per unit dose [HU/Gy] varies significantly among the patients, from 0.1 (for the one patient without significant correlation) to 5.7 ΔHU/Gy(RBE). The current population average of ΔHU/Gy(RBE) is 2.1, i.e. a 1 Gy(RBE) increase in dose leads on average to a 2.1 HU increase in CT density. The slope of the dose-response curve is constant for all timepoints investigated (from 3–24+ months). Additionally a pronounced non-linearity in the dose response curve is noted for long follow-up times (>18 months). Conclusion: CT density changes have a robust correlation with proton dose, quantitatively similar to photon dose, and may allow estimation of a patient’s intrinsic radiosensitivity after proton therapy. The stability of the correlation with time however diverges from what is known about CT response after photon irradiation. This could have important implications for clinical decision-making during proton therapy for lung cancer, especially for scheduling of follow-up CT/PET imaging and diagnosis of recurrence.

  10. 17 CFR 247.721 - Defined terms relating to the trust and fiduciary activities exception from the definition of...

    Science.gov (United States)

    2010-04-01

    ... investment guidelines or restrictions; (iii) A fee based on a percentage of assets under management... shareholder accounts; (C) Based on a percentage of assets under management for any of the following services... section if paid based on a percentage of assets under management; (iv) A flat or capped per...

  11. 17 CFR 247.775 - Exemption from the definition of “broker” for banks effecting certain excepted or exempted...

    Science.gov (United States)

    2010-04-01

    .... (2) Interdealer quotation system has the same meaning as in 17 CFR 240.15c2-11. (3) Insurance company... 17 Commodity and Securities Exchanges 3 2010-04-01 2010-04-01 false Exemption from the definition of âbrokerâ for banks effecting certain excepted or exempted transactions in investment...

  12. 17 CFR 247.776 - Exemption from the definition of “broker” for banks effecting certain excepted or exempted...

    Science.gov (United States)

    2010-04-01

    ... 17 Commodity and Securities Exchanges 3 2010-04-01 2010-04-01 false Exemption from the definition of âbrokerâ for banks effecting certain excepted or exempted transactions in a company's securities... AND EXCHANGE COMMISSION (CONTINUED) REGULATION R-EXEMPTIONS AND DEFINITIONS RELATED TO THE...

  13. Synthesis of new heterocyclic compounds using 2-(4,7-dichloro-3,3-dimethyl-indolin-2-ylidenemalonaldehyde

    Directory of Open Access Journals (Sweden)

    Razieh Mohammadnejad Aghdam

    2013-01-01

    Full Text Available 1-(2,5-Dichlorophenylhydrazine was converted via Fischer synthesis with isopropylmethylketone into 4,7-dichloro-2,3,3-trimethyl-3H-indole. Exposure of the indolenine to the vilsmeier reagent produced amino methylene malondialdehyde which reacted with hydrazine, arylhydrazine, urea, cyanoacetamide and thiourea to give pyrazols, pyrimidones and thiopyrimidone, respectively.

  14. Discovery of Isotopes of the Transuranium Elements with 93 <= Z <= 98

    CERN Document Server

    Fry, C

    2012-01-01

    One hundred and five isotopes of the transuranium elements neptunium, plutonium, americium, curium, berkelium and californium have so far been observed; the discovery of these isotopes is discussed. For each isotope a brief summary of the first refereed publication, including the production and identification method, is presented.

  15. 47 CFR 15.247 - Operation within the bands 902-928 MHz, 2400-2483.5 MHz, and 5725-5850 MHz.

    Science.gov (United States)

    2010-10-01

    .... In addition, a system employing short transmission bursts must comply with the definition of a... specified in this section. (h) The incorporation of intelligence within a frequency hopping spread...

  16. A 24.7-kDa copper-containing oxidase, secreted by Thermobifida fusca, significantly increasing the xylanase/cellulase-catalyzed hydrolysis of sugarcane bagasse.

    Science.gov (United States)

    Chen, Cheng-Yu; Hsieh, Zhi-Shen; Cheepudom, Jatuporn; Yang, Chao-Hsun; Meng, Menghsiao

    2013-10-01

    Thermobifida fusca is a moderately thermophilic soil bacterium belonging to Actinobacteria. It has been known for its capability to degrade plant cell wall polymers except lignin and pectin. To know whether it can produce enzymes to facilitate lignin degradation, the extracellular proteins bound to sugarcane bagasse were harvested and identified by liquid chromatography tandem mass spectrometry. Among the identified proteins, a putative copper-containing polyphenol oxidase of 241 amino acids, encoded by the locus Tfu_1114, was thought to presumably play a role in lignin degradation. This protein (Tfu1114) was thus expressed in E. coli and characterized. Similarly to common laccases, Tfu1114 is able to catalyze the oxidation reaction of phenolic and nonphenolic lignin related compounds such as 2,6-dimethoxyphenol and veratryl alcohol. More interestingly, it can significantly enhance the enzymatic hydrolysis of bagasse by xylanase and cellulase. Tfu1114 is stable against heat, with a half-life of 4.7 h at 90 °C, and organic solvents. It is sensitive to ethylenediaminetetraacetic acid and reducing agents but resistant to sodium azide, a potent inhibitor of laccases. Atomic absorption spectroscopy indicated that the ratio of copper to the protein monomer is 1, instead of 4, a feature of classical laccases. All these data suggest that Tfu1114 is a novel oxidase with laccase-like activity, potentially useful in biotechnology application. PMID:23377789

  17. The results of sentinel lymph node imaging and biopsy with a novel lymphoscintigraphy agent 99Tcm-Rituximab in 247 breast cancer patients

    International Nuclear Information System (INIS)

    Objective: The feasibility, reliability and influence factors of sentinel lymph node (SLN) imaging and biopsy with a new imaging agent 99Tcm-Rituximab were investigated in 467 breast cancer patients. Methods: The SLN imaging was taken after peritumoral and subdermal injection of 99Tcm-Rituximab guided by ultrasound. Based on the image, the SLN were identified by a gamma probe and removed, the resected SLN were examined pathologically with both HE and immunohistochemical staining. Results: The success rate of SLN imaging was 99.14% (463/467). A total 837 SLN (1.79 per case) were visualized, which located in axilla, internal mammary, subraclavicular and breast region. The success rate of SLN biopsy (SLNB) was 99.57% (465/467), a total 1182 SLN (2.53 per case) were identified. Pathological examination showed that there were 131 patients with 194 metastatic axillary SLN; one case of micrometastases was confirmed by immunohistochemical staining, whose result of HE staining was negative. The following factors, such as age, image time, biopsy history, pathologic type and clinical stage, had no effect on the results of SLN imaging and SLNB. But the SLN metastasis rates were different in patients with different pathologic type and clinical stage(χ2=14.134, 29.184, all P99Tcm-Rituximab showed potential in both SLN imaging and identification in breast cancer patients. (authors)

  18. "I'm on it 24/7 at the moment": A qualitative examination of multi-screen viewing behaviours among UK 10-11 year olds

    Directory of Open Access Journals (Sweden)

    Cillero Itziar

    2011-08-01

    Full Text Available Abstract Background Screen-viewing has been associated with increased body mass, increased risk of metabolic syndrome and lower psychological well-being among children and adolescents. There is a shortage of information about the nature of contemporary screen-viewing amongst children especially given the rapid advances in screen-viewing equipment technology and their widespread availability. Anecdotal evidence suggests that large numbers of children embrace the multi-functionality of current devices to engage in multiple forms of screen-viewing at the same time. In this paper we used qualitative methods to assess the nature and extent of multiple forms of screen-viewing in UK children. Methods Focus groups were conducted with 10-11 year old children (n = 63 who were recruited from five primary schools in Bristol, UK. Topics included the types of screen-viewing in which the participants engaged; whether the participants ever engaged in more than one form of screen-viewing at any time and if so the nature of this multiple viewing; reasons for engaging in multi-screen-viewing; the room within the house where multi-screen-viewing took place and the reasons for selecting that room. All focus groups were transcribed verbatim, anonymised and thematically analysed. Results Multi-screen viewing was a common behaviour. Although multi-screen viewing often involved watching TV, TV viewing was often the background behaviour with attention focussed towards a laptop, handheld device or smart-phone. There were three main reasons for engaging in multi-screen viewing: 1 tempering impatience that was associated with a programme loading; 2 multi-screen facilitated filtering out unwanted content such as advertisements; and 3 multi-screen viewing was perceived to be enjoyable. Multi-screen viewing occurred either in the child's bedroom or in the main living area of the home. There was considerable variability in the level and timing of viewing and this appeared to be a function of whether the participants attended after-school clubs. Conclusions UK children regularly engage in two or more forms of screen-viewing at the same time. There are currently no means of assessing multi-screen viewing nor any interventions that specifically focus on reducing multi-screen viewing. To reduce children's overall screen-viewing we need to understand and then develop approaches to reduce multi-screen viewing among children.

  19. "I'm on it 24/7 at the moment" : A qualitative examination of multi-screen viewing behaviours among UK 10-11 year olds

    OpenAIRE

    Cillero Itziar; Gorely Trish; Sebire Simon J; Jago Russell; Biddle Stuart JH

    2011-01-01

    Abstract Background Screen-viewing has been associated with increased body mass, increased risk of metabolic syndrome and lower psychological well-being among children and adolescents. There is a shortage of information about the nature of contemporary screen-viewing amongst children especially given the rapid advances in screen-viewing equipment technology and their widespread availability. Anecdotal evidence suggests that large numbers of children embrace the multi-functionality of current ...

  20. (2012 30 Windsor Y B Access Just 247 SO LONG AS YOU HAVE YOUR HEALTH: HEALTH CARE DISTRIBUTION IN CANADA AND PROCEDURALIST HUMAN RIGHTS

    Directory of Open Access Journals (Sweden)

    Alana Klein

    2015-05-01

    Full Text Available Health resource distribution in Canada has been criticized for being opaque and increasingly inequitable, with its disproportionate emphasis on curative over preventive care. Yet there has been relatively little scrutiny of priority-setting in publicly funded health care in Canada from bodies monitoring the international human right to health. Recently, however, domestic health governance on the one hand, and international health and human rights on the other, have converged around the promotion of evidence-based policy, accountability, transparency and participation as drivers of more equitable distribution of health care resources. This paper tracks the paths toward this convergence. The emphasis in health policy was largely driven by cost containment and service integration concerns, while democratic and institutional concerns around socio-economic rights protection are at the root of the health and human rights shift toward proceduralist approaches. This shared emphasis nonetheless opens new terrains of struggle for human rights approaches to health care distribution in Canada, around (i managing indeterminacy in social determinants of health; (ii addressing power imbalances that shape how health information is produced, communicated, and acted upon and (iii the role of fundamental normative values that limit substantive policy around health. La distribution des ressources en santé au Canada a été critiquée en raison de son caractère opaque et de plus en plus inéquitable, et de l’importance disproportionnée accordée aux soins curatifs par rapport aux mesures préventives. De plus, relativement peu d’études concernant les priorités établies en matière de services de santé publics au Canada ont été faites par des organismes de contrôle du droit, reconnu dans des instruments internationaux, de tout être humain à la santé. Cela dit, récemment, la gouvernance nationale de la santé, d’une part, et le droit à la santé et les droits de la personne au niveau international, d’autre part, ont convergé et mis l’accent sur la nécessité de promouvoir des politiques fondées sur des données probantes, la responsabilisation, la transparence et la participation, facteurs qui sont aptes à assurer une distribution plus équitable des ressources en santé. Le document suit le cheminement vers cette convergence. Les politiques en matière de santé étaient largement fondées sur des préoccupations liées à la limitation des coûts et à l’intégration des services, alors que les préoccupations démocratiques et institutionnelles à l’égard de la protection des droits socio-économiques sont à l’origine du virage du droit à la santé et des droits de la personne vers des approches procéduralistes. Ces priorités communes ouvrent néanmoins la porte à de nouvelles luttes visant des approches axées sur les droits de la personne en ce qui a trait à la distribution des services de santé au Canada, luttes qui impliqueront les actions suivantes : (i gérer l’indétermination dans les déterminants sociaux de la santé; (ii corriger les déséquilibres de pouvoir qui déterminent la façon dont l’information en matière de santé est produite et communiquée et les réactions qu’elle entraîne, et (iii éclaircir le rôle des valeurs normatives fondamentales qui limitent les politiques de fond en matière de santé.

  1. Development of Abrasion-Resistant Coating for Solar Reflective Films. Cooperative Research and Development Final Report, CRADA Number CRD-07-247

    Energy Technology Data Exchange (ETDEWEB)

    Gray, Matthew [National Renewable Energy Lab. (NREL), Golden, CO (United States)

    2015-10-01

    The purpose of this CRADA is to develop an abrasion-resistant coating, suitable for use on polymeric-based reflective films (e.g., the ReflecTech reflective film), that allows for improved scratch resistance and enables the use of aggressive cleaning techniques (e.g., direct contact methods like brushing) without damaging the specular reflectance properties of the reflective film.

  2. Unveiling stomata 24/7: can we use carbonyl sulfide (COS) and oxygen isotopes (18O) to constrain estimates of nocturnal transpiration across different evolutionary plant forms?

    Science.gov (United States)

    Gimeno, Teresa E.; Ogee, Jerome; Bosc, Alexander; Genty, Bernard; Wohl, Steven; Wingate, Lisa

    2015-04-01

    Numerous studies have reported a continued flux of water through plants at night, suggesting that stomata are not fully closed. Growing evidence indicates that this nocturnal flux of transpiration might constitute an important fraction of total ecosystem water use in certain environments. However, because evaporative demand is usually low at night, nocturnal transpiration fluxes are generally an order of magnitude lower than rates measured during the day and perilously close to the measurement error of traditional gas-exchange porometers. Thus estimating rates of stomatal conductance in the dark (gnight) precisely poses a significant methodological challenge. As a result, we lack accurate field estimates of gnight and how it responds to different atmospheric drivers, indicating the need for a different measurement approach. In this presentation we propose a novel method to obtain detectable and robust estimates of gnight. We will demonstrate using mechanistic theory how independent tracers including the oxygen isotope composition of CO2 (δ18O) and carbonyl sulfide (COS) can be combined to obtain robust estimates of gnight. This is because COS and CO18O exchange within leaves are controlled by the light insensitive enzyme carbonic anhydrase. Thus, if plant stomata are open in the dark we will continue to observe COS and CO18O exchange. Using our theoretical model we will demonstrate that the exchange of these tracers can now be measured using advances in laser spectrometry techniques at a precision high enough to determine robust estimates of gnight. We will also present our novel experimental approach designed to measure simultaneously the exchange of CO18O and COS alongside the conventional technique that relies on measuring the total water flux from leaves in the dark. Using our theoretical approach we will additionally explore the feasibility of our proposed experimental design to detect variations in gnight during drought stress and across a variety of plant types that have evolved diverse strategies to control water loss from leaf tissues.

  3. Child Abuse Prevention and Treatment Act, 1974. Public Law 93-247 (S. 1191): Questions and Answers, Analysis, and Text of the Act.

    Science.gov (United States)

    Congress of the U.S., Washington, DC. Senate Committee on Labor and Public Welfare.

    This booklet contains questions and answers concerning the Child Abuse Prevention and Treatment Act, an analysis of the Act by the Congressional Research Service, and a copy of the actual text. The question and answer section provides information about the rationale for the Act, the amount of money available for its implementation, as well as its…

  4. Campylobacter-like organisms and Candida in peptic ulcers and similar lesions of the upper gastrointestinal tract: a study of 247 cases.

    OpenAIRE

    Kalogeropoulos, N K; Whitehead, R.

    1988-01-01

    Campylobacter-like organisms were detected by light microscopy in association with 57 of 102 (56%) of gastric ulcers, all the gastric erosions associated with gastritis, three of five (60%) of gastric erosions without gastritis, five of 13 (39%) of mild superficial gastritis and two of 36 (6%) of normal gastric mucosa. They were also seen in four of 20 (20%) of duodenal ulcers, but not in duodenal erosions with duodenitis or normal duodenal biopsy specimens. They were seen in association with...

  5. 17 CFR 247.740 - Defined terms relating to the sweep accounts exception from the definition of “broker.”

    Science.gov (United States)

    2010-04-01

    ... sales load has the same meaning as in 17 CFR 270.6c-10. (b) Money market fund means an open-end company... securities for sales or sales promotion expenses, for personal service, or for the maintenance of shareholder... investment company's securities for sales or sales promotion expenses, for personal service, or for...

  6. Measuring Gender (In)Equality: Introducing the Gender, Institutions and Development Data Base (GID). OECD Development Centre Working Paper No. 247

    Science.gov (United States)

    Jutting, Johannes P.; Morrisson, Christian; Dayton-Johnson, Jeff; Drechsler, Denis

    2006-01-01

    Efforts to establish, test and analyse hypotheses regarding cross-country variations in women's economic status are hampered by the lack of a readily accessible and easily used information resource on the various dimensions of gender inequality. Addressing this gap, this paper introduces the Gender, Institutions and Development data base (GID)…

  7. Improvement activities to soil stabilization near Bolivia-Brazil gas pipeline crossing through an embankment over a corrugated drainage pipe, at Km 247 in Mato Grosso do Sul, Brazil; Melhorias para estabilidade do gasoduto Bolivia-Brasil em cruzamento de aterro sobre tubo de drenagem tipo ARMCO, no km 247 em Mato Grosso do Sul

    Energy Technology Data Exchange (ETDEWEB)

    Jorge, Kemal Vieira [TBG - Transportadora Brasileira Gasoduto Bolivia Brasil S.A., Rio de Janeiro, RJ (Brazil); Costa, Cesar Augusto [TBG - Transportadora Brasileira Gasoduto Bolivia Brasil S.A., Campo Grande, MS (Brazil). Gerencia Regional Centro Oeste (CRGO)

    2005-07-01

    A hundred and seventy kilometers from Campo Grande city, on Mato Grosso do Sul State, the Brasil-Bolivia Gas Pipeline crosses a 8,5 meters high landfill, over a drainage systems made of a 2,8 meters of diameter corrugated pipe. This drainage pipe was installed to allow the drainage of the valley, and the landfill above it was built so the Gas pipeline could cross easier the 80 meters deep and 30 degree vertices valley. This paper illustrates the work tasks and solutions taken to monitor and guarantee the integrity of the drainage and landfill structures, as well as the integrity of the Gas Pipeline. Some of the work tasks illustrated are the investigation of the support conditions of the Gas Pipeline, the analysis of a drainage system under the pipeline, on a rocky soil, the analysis of the stability of the landfill, the construction of a gravity retaining walls and the monitoring of the deformations on the drainage pipe. (author)

  8. Exigência de cálcio para codornas japonesas (coturnix coturnix japonica em postura - DOI: 10.4025/actascianimsci.v29i1.247 Calcium requirement for japanese quails (Coturnix coturnix japonica in the laying phase - DOI: 10.4025/actascianimsci.v29i1.247

    Directory of Open Access Journals (Sweden)

    Jocelyn Santiago Brandão

    2007-11-01

    Full Text Available Realizou-se este experimento com o objetivo de determinar as exigências de cálcio de codornas japonesas em postura. Foram utilizadas 105 codornas, distribuídas em sete tratamentos, com três repetições. Os tratamentos consistiram em uma ração basal suplementada com calcário calcítico para alcançar sete níveis de cálcio (2,95; 3,10; 3,25; 3,40; 3,55; 3,70 e 3,85%. As variáveis avaliadas foram: consumo de ração (CR, produção de ovos (PD, massa de ovos (MO, conversão por massa de ovos (CMO, conversão por dúzia de ovos (CDO, peso do ovo (PO, peso e percentagem de gema, albúmem e casca e gravidade específica. O CR e CMO não foram influenciados pelos níveis de cálcio na dieta. A PD, MO e CDO sofreram efeito quadrático dos níveis de cálcio, sendo os valores máximos para estas variáveis estimados com os níveis de 3,45; 3,51 e 3,34% de cálcio. O PO aumentou linearmente com os níveis de cálcio na dieta. Foi verificado efeito quadrático dos níveis de cálcio sobre o peso e percentagem do albúmem e gema e gravidade específica. Recomendase para codornas japonesas o nível de 3,51% de cálcio da ração para a otimização dos índices de desempenho sem afetar negativamente a qualidade interna e externa dos ovos.This trial was performed to determine the requirements of calcium for Japanese quails during the laying period. A hundred and five quails were distributed in seven treatments and three repetitions. The treatments consisted of a basal diet supplemented with limestone in order to produce seven calcium levels (2.95; 3.10; 3.25; 3.40; 3.55; 3.70 and 3.85%. The following variables were evaluated: feed intake (CR, egg production (PD, egg mass (MO, conversion per egg mass (CMO, conversion per egg dozen (CDO, egg weight (PO, the weights and percentages of yolk, albumen and shell, and specific gravity. Calcium levels in the diet had no effect on CR and CMO. On the other hand, there was quadratic effect on PD, MO and CDO, and the maximum levels for these variables were estimated with calcium levels of 3.45; 3.51 and 3.34%, respectively. PO increased linearly with calcium levels in the diet. A quadratic effect of calcium levels was seen on the specific gravity and on weight and percentage of albumen and yolk. Calcium levels of 3.51% are recommended for Japanese quails during the laying period in order to optimize performance indexes without affecting negatively the internal and external egg quality.

  9. Neutron multiplicities for the transplutonium nuclides

    International Nuclear Information System (INIS)

    This paper continues, with respect to the transplutonium nuclides, earlier efforts to collate and evaluate data from the scientific literature on the prompt neutron multiplicity distribution from fission and its first moment = ΣnuPnu. The isotopes considered here for which P/sub nu/ and or data (or both) were found in the literature are of americium (Am), curium (Cm), berkelium (Bk), californium (Cf), einsteinium (Es), fermium (Fm), and nobelium (No)

  10. Erratum to "Effect of the time-dependent coupling on a superconducting qubit-field system under decoherence: Entanglement and Wehrl entropy" [Ann. Physics 361 (2015) 247-258

    Science.gov (United States)

    Abdel-Khalek, S.; Berrada, K.; Eleuch, H.

    2016-09-01

    The dynamics of a superconducting (SC) qubit interacting with a field under decoherence with and without time-dependent coupling effect is analyzed. Quantum features like the collapse-revivals for the dynamics of population inversion, sudden birth and sudden death of entanglement, and statistical properties are investigated under the phase damping effect. Analytic results for certain parametric conditions are obtained. We analyze the influence of decoherence on the negativity and Wehrl entropy for different values of the physical parameters. We also explore an interesting relation between the SC-field entanglement and Wehrl entropy behavior during the time evolution. We show that the amount of SC-field entanglement can be enhanced as the field tends to be more classical. The studied model of SC-field system with the time-dependent coupling has high practical importance due to their experimental accessibility which may open new perspectives in different tasks of quantum formation processing.

  11. Missense mutations in PBP2A Affecting ceftaroline susceptibility detected in epidemic hospital-acquired methicillin-resistant Staphylococcus aureus clonotypes ST228 and ST247 in Western Switzerland archived since 1998

    OpenAIRE

    Kelley, William; Jousselin, Ambre; Barras, Christine; Lelong, Emmanuelle; Renzoni, Adriana Maria

    2015-01-01

    The development and maintenance of an arsenal of antibiotics is a major health care challenge. Ceftaroline is a new cephalosporin with activity against methicillin-resistant Staphylococcus aureus (MRSA); however, no reports concerning MRSA ceftaroline susceptibility have been reported in Switzerland. We tested the in vitro activity of ceftaroline against an archived set of 60 MRSA strains from the University Hospital of Geneva collected from 1994 to 2003. Our results surprisingly revealed cef...

  12. Multibeam collection for TN247: Multibeam data collected aboard Thomas G. Thompson from 2010-03-11 to 2010-04-17, departing from Punta Arenas, Chile and returning to Seattle, WA

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — This data set is part of a larger set of data called the Multibeam Bathymetry Database (MBBDB) where other similar data can be found at...

  13. Composition containing transuranic elements for use in the homeopathic treatment of aids

    Energy Technology Data Exchange (ETDEWEB)

    Lustig, D.

    1996-04-18

    A homeopathic remedy consisting of a composition containing one or more transuranic elements, particularly plutonium, for preventing and treating acquired immunodeficiency syndrome (AIDS) in humans, as well as seropositivity for human immunodeficiency virus (HIV). Said composition is characterized in that it uses any chemical or isotopic form of one or more transuranic elements (neptunium, plutonium, americium, curium, berkelium, californium or einsteinium), particularly plutonium, said form being diluted and dynamized according to conventional homeopathic methods, particularly the so-called Hahnemann and Korsakov methods, and provided preferably but not exclusively in the form of lactose and/or saccharose globules or granules impregnated with the active principle of said composition. (author).

  14. TOWARD AN IMPROVED UNDERSTANDING OF STRUCTURE AND MAGNETISM IN NEPTUNIUM AND PLUTONIUM PHOSPHONATES AND SULFONATES

    Energy Technology Data Exchange (ETDEWEB)

    Albrecht-Schmitt, Thomas

    2012-03-01

    This grant supported the exploratory synthesis of new actinide materials with all of the actinides from thorium to californium with the exceptions of protactinium and berkelium. We developed detailed structure-property relationships that allowed for the identification of novel materials with selective ion-exchange, selective oxidation, and long-range magnetic ordering. We found novel bonding motifs and identified periodic trends across the actinide series. We identified structural building units that would lead to desired structural features and novel topologies. We also characterized many different spectroscopic trends across the actinide series. The grant support the preparation of approximately 1200 new compounds all of which were structurally characterized.

  15. Detection of rare earth elements in Powder River Basin sub-bituminous coal ash using laser-induced breakdown spectroscopy (LIBS)

    Energy Technology Data Exchange (ETDEWEB)

    Tran, Phuoc [National Energy Technology Lab. (NETL), Pittsburgh, PA, (United State; Mcintyre, Dustin [National Energy Technology Lab. (NETL), Pittsburgh, PA, (United State

    2015-10-01

    We reported our preliminary results on the use of laser-induced breakdown spectroscopy to analyze the rare earth elements contained in ash samples from Powder River Basin sub-bituminous coal (PRB-coal). We have identified many elements in the lanthanide series (cerium, europium, holmium, lanthanum, lutetium, praseodymium, promethium, samarium, terbium, ytterbium) and some elements in the actinide series (actinium, thorium, uranium, plutonium, berkelium, californium) in the ash samples. In addition, various metals were also seen to present in the ash samples

  16. Composition containing transuranic elements for use in the homeopathic treatment of aids

    International Nuclear Information System (INIS)

    A homeopathic remedy consisting of a composition containing one or more transuranic elements, particularly plutonium, for preventing and treating acquired immunodeficiency syndrome (AIDS) in humans, as well as seropositivity for human immunodeficiency virus (HIV). Said composition is characterized in that it uses any chemical or isotopic form of one or more transuranic elements (neptunium, plutonium, americium, curium, berkelium, californium or einsteinium), particularly plutonium, said form being diluted and dynamized according to conventional homeopathic methods, particularly the so-called Hahnemann and Korsakov methods, and provided preferably but not exclusively in the form of lactose and/or saccharose globules or granules impregnated with the active principle of said composition. (author)

  17. PROCEEDINGS OF THE SYMPOSIUM COMMEMORATING THE 25th ANNIVERSARY OF ELEMENTS 97 and 98 HELD ON JAN. 20, 1975

    Energy Technology Data Exchange (ETDEWEB)

    Seaborg, Glenn T.; Street Jr., Kenneth; Thompson, Stanley G.; Ghiorso, Albert

    1976-07-01

    This volume includes the talks given on January 20, 1975, at a symposium in Berkeley on the occasion of the celebration of the 25th anniversary of the discovery of berkelium and californium. Talks were given at this symposium by the four people involved in the discovery of these elements and by a number of people who have made significant contributions in the intervening years to the investigation of their nuclear and chemical properties. The papers are being published here, without editing, in the form in which they were submitted by the authors in the months following the anniversary symposium, and they reflect rather faithfully the remarks made on that occasion.

  18. An atomic beam source for actinide elements: concept and realization

    International Nuclear Information System (INIS)

    For ultratrace analysis of actinide elements and studies of their atomic properties with resonance ionization mass spectroscopy (RIMS), efficient and stable sources of actinide atomic beams are required. The thermodynamics and kinetics of the evaporation of actinide elements and oxides from a variety of metals were considered, including diffusion, desorption, and associative desorption. On this basis various sandwich-type filaments were studied. The most promising system was found to consist of tantalum as the backing material, an electrolytically deposited actinide hydroxide as the source of the element, and a titanium covering layer for its reduction to the metal. Such sandwich sources were experimentally proven to be well suited for the production of atomic beams of plutonium, curium, berkelium and californium at relatively low operating temperatures and with high and reproducible yields. (orig.)

  19. Nuclear fission and the transuranium elements

    Energy Technology Data Exchange (ETDEWEB)

    Seaborg, G.T.

    1989-02-01

    Many of the transuranium elements are produced and isolated in large quantities through the use of neutrons furnished by nuclear fission reactions: plutonium (atomic number 94) in ton quantities; neptunium (93), americium (95), and curium (96) in kilogram quantities; berkelium (97) in 100 milligram quantities; californium (98) in gram quantities; and einsteinium (99) in milligram quantities. Transuranium isotopes have found many practical applications---as nuclear fuel for the large-scale generation of electricity, as compact, long-lived power sources for use in space exploration, as means for diagnosis and treatment in the medical area, and as tools in numerous industrial processes. Of particular interest is the unusual chemistry and impact of these heaviest elements on the periodic table. This account will feature these aspects. 9 refs., 5 figs.

  20. Production of transuranium elements

    International Nuclear Information System (INIS)

    The Radiochemical Engineering Development Center (REDC) has the programmatic responsibility for the Department of Energy's Transuranium Element Program. Principle elements from the program are einsteinium, berkelium, and fermium. Targets containing curium oxide mixed with aluminum powder are fabricated by the REDC and irradiated in the Oak Ridge National Laboratory (ORNL) High Flux Isotope Reactor. Following an irradiation period of 6-12 months, targets are returned to the REDC for chemical processing. Processing operations consists of aluminum dejacketing in a caustic-nitrate solution, filtration, acid dissolution, solvent extraction, anion exchange, and finally a cation exchange to recover the actinides. The processing operations take place in heavily shielded hot cell facilities and all operations are carried out remotely. The chemistry for the separations has been well established over the 26-yr. operating life of the facility

  1. Antonio Maria Baggio (ed.), Adriana Cossedu, Paolo Giusta, Rodrigo Mardones Z. y Antonio Márquez Prieto, Caino e i suoi fratelli. Il fondamento relazionale nella politica e nel diritto, Città Nuova, Roma, 2012, 247 págs.

    OpenAIRE

    María Salas Porras

    2013-01-01

    Los estudios recogidos en este volumen intentan reinterpretar los fundamentos de la Política y del Derecho, enmarcados en el horizonte relacional que la fraternidad les abre. Desde esta perspectiva, la fraternidad asume una relevancia política y jurídica en la medida en que se la entienda sustancialmente ligada a la libertad y a la igualdad. Cada una de las tres categorías, en la medida en que sean consideradas conjuntamente, llegan a adquirir su propio significado a través de la relación con...

  2. Antonio Maria Baggio (ed., Adriana Cossedu, Paolo Giusta, Rodrigo Mardones Z. y Antonio Márquez Prieto, Caino e i suoi fratelli. Il fondamento relazionale nella politica e nel diritto, Città Nuova, Roma, 2012, 247 págs.

    Directory of Open Access Journals (Sweden)

    María Salas Porras

    2013-03-01

    Full Text Available Los estudios recogidos en este volumen intentan reinterpretar los fundamentos de la Política y del Derecho, enmarcados en el horizonte relacional que la fraternidad les abre. Desde esta perspectiva, la fraternidad asume una relevancia política y jurídica en la medida en que se la entienda sustancialmente ligada a la libertad y a la igualdad. Cada una de las tres categorías, en la medida en que sean consideradas conjuntamente, llegan a adquirir su propio significado a través de la relación con las otras. El redescubrimiento de la fraternidad significa por tanto volver a proponer el "tríptico" entero, para recuperar, a través del mismo, el proyecto humanísitico de la modernidad, y liberarnos del destino del conflicto radical al que nuestro tiempo parece condenado: Caín no sólo ha matado a su hermano, sino que también ha fundado la primera ciudad, es decir, el lugar donde la violencia se ve confinada por el gobierno y por las leyes. Abrir el Derecho al horizonte de la fraternidad significa, hoy, llevar la racionalidad jurídica más allá de la mera racionalidad técnica; permitir renovar la relación jurídica, volver a encontrar sus fundamentos humanísticos, redescubriendo una justicia que reconcilia y reconstruye, fortificando el vínculo social. Considerar la fraternidad una categoría política significa poder emitir juicios políticos, capaces de producir un pensamiento político a través de la óptica de la fraternidad; se abandonan así las lógicas de la ideología, para intentar construir una forma de pensamiento en disposición de pasar, de una idea intuitiva de fraternidad, a una definición que la haga operativa, "operacionalizable". Es una tarea que no corresponde hoy a una sola disciplina, sino que interesa a todo el conjunto de los ya numerosos estudiosos que se han enrolado en este frente, interactuando entre sí de manera interdisiciplinar y abriendo un camino en el cual resulte posible, a todos los que han abrazado un humanismo y un ideal político, encontrar las mejores razones de su esperanza.

  3. ‘A dialogue about the art of portraiture’ Originally published as ‘Gespräch von der Bildniskunst’, Österreichische Rundschau, Volume 6, 1906, 502—516, and republished: Julius Schlosser, Präludien Vorträge und Aufsätze, Berlin: Bard 1927, 227—247. Translated with an introduction by Karl Johns

    OpenAIRE

    Julius Schlosser

    2011-01-01

    In an unusually popular and readable dialogue form, Schlosser alludes to the classical education he takes for granted in any reader approaching his favourite ‘thorny’ questions from aesthetics and history. These involve the problems of naturalism, impressionism, portrait likeness, psychology of perception and numerous others being bandied around academic circles at the turn of the century. It is of further interest in directly referring critically to his recently deceased friend (Alois Riegl)...

  4. Dicty_cDB: [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VF (Link to library) VFC247 (Link to dictyBase) - - - Contig-U16444-1 VFC247P (Link... to Original site) VFC247F 353 VFC247Z 590 VFC247P 943 - - Show VFC247 Library VF (Link to library) Clone ID VFC247 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16444-1 Original site URL http://dict...ences producing significant alignments: (bits) Value N AC116978 |AC116978.1 Dicty...ostelium discoideum chromosome 2 map 4846697-4874480 strain AX4, *** SEQUENCING IN PROGRESS ***. 1049 0.0 3 AC117076 |AC117076.2 Dict

  5. 24 CFR 886.128 - Termination of tenancy.

    Science.gov (United States)

    2010-04-01

    ... violence, dating violence, or stalking is involved or claimed to be involved, the provisions of 24 CFR part... this title (24 CFR part 247) applies to the termination of tenancy and eviction of a family assisted... citizenship or eligible immigration status, the procedures of 24 CFR parts 247 and 5 shall apply. For...

  6. 78 FR 52562 - Outer Continental Shelf (OCS), Gulf of Mexico (GOM), Oil and Gas Lease Sales, Central Planning...

    Science.gov (United States)

    2013-08-23

    ... Bureau of Ocean Energy Management Outer Continental Shelf (OCS), Gulf of Mexico (GOM), Oil and Gas Lease Sales, Central Planning Area (CPA) Lease Sales 235, 241, and 247 AGENCY: Bureau of Ocean Energy... EIS for proposed Central Planning Area (CPA) Lease Sales 235, 241 and 247 in the Gulf of Mexico...

  7. 48 CFR 52.213-4 - Terms and Conditions-Simplified Acquisitions (Other Than Commercial Items)

    Science.gov (United States)

    2010-10-01

    ... information.) (xii) 52.247-64, Preference for Privately Owned U.S.-Flag Commercial Vessels (FEB 2006) (46 U.S... provide for the provision, the service, or the sale of food in the United States.) (iv) 52.247-29, F.o.b... Federal Register citations affecting 52.213-4, see the List of CFR Sections Affected, which appears in...

  8. 77 FR 3742 - India Infrastructure Business Development Mission-Clarification and Amendment

    Science.gov (United States)

    2012-01-25

    ... Mission, 76 FR, No. 247, December 23, 2011, to amend the Notice to revise the dates of the application... Infrastructure Business Development Mission, 76 FR, No. 247, December 23, 2011, is amended to read as follows... International Trade Administration India Infrastructure Business Development Mission--Clarification...

  9. 76 FR 49787 - Rural Water Supply Program Approved Appraisal Reports; Availability

    Science.gov (United States)

    2011-08-11

    ... North, Billings, MT 59101, (406) 247-7300 Douglas County Rural Water Project Appraisal Report, Bureau of... System Appraisal Report, Bureau of Reclamation, Montana Area Office, 2900 Fourth Avenue North, Billings, MT 59101, (406) 247-7300 Southern Black Hills Regional Water System Appraisal Report, Bureau...

  10. Cultural Economy, Capitalism and the Logic of the Public Sphere

    DEFF Research Database (Denmark)

    Schwarzkopf, Stefan

    2015-01-01

    Review essay: Promotional Cultures: The Rise and Spread of Advertising, Public Relations, Marketing and Branding/ by Aeron Davis. (Polity, 2013, ISBN 978-0-7456-3983-3, 247 + xi pp.......Review essay: Promotional Cultures: The Rise and Spread of Advertising, Public Relations, Marketing and Branding/ by Aeron Davis. (Polity, 2013, ISBN 978-0-7456-3983-3, 247 + xi pp....

  11. Nuclear Chemistry Institute, Mainz University. Annual Report 1995

    International Nuclear Information System (INIS)

    The annual report of the Institut fuer Kernchemie addresses inter alia three main research activities. The first belongs to the area of basic research, covering studies in the fields of nuclear fission, chemistry of the super-heavy elements and of heavy-ion reactions extending from the Coulomb barrier to relativistic energies, and nuclear astrophysics in connection with the ''r process''. By means of laser technology, high-precision data could be measured of the ionization energies of berkelium and californium. Studies of atomic clusters in the vacuum of an ionization trap revealed interesting aspects. The second major activity was devoted to the analysis of environmental media, applying inter alia neutron activation analysis and resonance ionization mass spectroscopy (RIMS). The third activity resulted in the development of novel processes, or the enhancement of existing processes or methods, for applications in basic research work and in environmental analytics. Another item of interest is the summarizing report on the operation of the TRIGA research reactor. (orig./SR)

  12. Extraction studies of selected actinide ions from aqueous solutions with 4-benzoyl-2,4-dihydro-5-methyl-2-phenyl-3H-pyrazol-3-thione and tri-n-octylphosphine oxide

    Energy Technology Data Exchange (ETDEWEB)

    Hannink, N.J.; Hoffman, D.C. [Lawrence Berkeley Lab., CA (United States)]|[California Univ., Berkeley, CA (United States). Dept. of Chemistry; Smith, B.F. [Los Alamos National Lab., NM (United States)

    1991-11-01

    The first measurements of distribution coefficients (K{sub d}) for Cm(III), Bk(III), Cf(III), Es(III), and Fm(III) between aqueous perchlorate solutions and solutions of 4-benzoyl-2,4-dihydro-5-methyl-2-phenyl-3H-pyrazol-3-thione (BMPPT) and the synergist tri-n-octylphosphine oxide (TOPO) in toluene are reported. Curium-243, berkelium-250, californium-249, einsteinium-254, and fermium-253 were used in these studies. The K{sub d} for {sup 241}Am was also measured and is in agreement with previously published results. Our new results show that the K{sub d}`s decrease gradually with increasing atomic number for the actinides with a dip at Cf. In general, the K{sub d}`s for these actinides are about a factor of 5 to 10 greater than the K{sub d}`s for the homologous lanthanides at a pH of 2.9, a BMPPT concentration of 0.2 M, and a TOPO concentration of 0.04 M. The larger K{sub d}`s for the actinides are consistent with greater covalent bonding between the actinide metal ion and the sulfur bonding site in the ligand.

  13. Extraction studies of selected actinide ions from aqueous solutions with 4-benzoyl-2,4-dihydro-5-methyl-2-phenyl-3H-pyrazol-3-thione and tri-n-octylphosphine oxide

    Energy Technology Data Exchange (ETDEWEB)

    Hannink, N.J.; Hoffman, D.C. (Lawrence Berkeley Lab., CA (United States) California Univ., Berkeley, CA (United States). Dept. of Chemistry); Smith, B.F. (Los Alamos National Lab., NM (United States))

    1991-11-01

    The first measurements of distribution coefficients (K{sub d}) for Cm(III), Bk(III), Cf(III), Es(III), and Fm(III) between aqueous perchlorate solutions and solutions of 4-benzoyl-2,4-dihydro-5-methyl-2-phenyl-3H-pyrazol-3-thione (BMPPT) and the synergist tri-n-octylphosphine oxide (TOPO) in toluene are reported. Curium-243, berkelium-250, californium-249, einsteinium-254, and fermium-253 were used in these studies. The K{sub d} for {sup 241}Am was also measured and is in agreement with previously published results. Our new results show that the K{sub d}'s decrease gradually with increasing atomic number for the actinides with a dip at Cf. In general, the K{sub d}'s for these actinides are about a factor of 5 to 10 greater than the K{sub d}'s for the homologous lanthanides at a pH of 2.9, a BMPPT concentration of 0.2 M, and a TOPO concentration of 0.04 M. The larger K{sub d}'s for the actinides are consistent with greater covalent bonding between the actinide metal ion and the sulfur bonding site in the ligand.

  14. Extraction studies of selected actinide ions from aqueous solutions with 4-benzoyl-2,4-Dihydro-5-methyl-2-phenyl-3H-pyrazol-3-thione and Tri-n-octylphosphine oxide

    Energy Technology Data Exchange (ETDEWEB)

    Hannink, N.J.; Hoffman, D.C. [Lawrence Berkeley Lab., CA (United States); Smith, B.F. [Los Alamos National Lab., NM (United States)

    1992-07-01

    The first measurements of distribution coefficients (k{sub d}) for Cm(III), Bk(III), Cf(III), Es(III), and Fm(III) between aqueous perchlorate solutions and solutions of 4-benzoyl-2,4-dihydro-5-methyl-2-phenyl-3H-pyrazol-3-thione (BMPPT) and the synergist tri-n-octylphosphine oxide (TOPO) in toluene are reported. Curium-243, berkelium-250, californium-249, einsteinium-254, and fermium-253 were used in these studies. The K{sub d} for {sup 241}Am was also measured and is in agreement with previously published results. Our new results show that the K{sub d}`s decrease gradually with increasing atomic number for the actinides with a dip at Cf. In general, the K{sub d}`s for these actinides are about about a factor of 10 greater than the K{sub d}`s for the homologous lanthanides at a pH of 2.9, a BMPPT concentration of 0.2 M, and a TOPO concentration of 0.04 M. The larger K{sub d}`s for the actinides are consistent with greater covalent bonding between the actinide metal ion and the sulfur bonding site in the ligand. 9 refs., 2 figs., 1 tab.

  15. Characterization of a Viking Blade Fabricated by Traditional Forging Techniques

    Science.gov (United States)

    Vo, H.; Frazer, D.; Bailey, N.; Traylor, R.; Austin, J.; Pringle, J.; Bickel, J.; Connick, R.; Connick, W.; Hosemann, P.

    2016-09-01

    A team of students from the University of California, Berkeley, participated in a blade-smithing competition hosted by the Minerals, Metals, and Materials Society at the TMS 2015 144th annual meeting and exhibition. Motivated by ancient forging methods, the UC Berkeley team chose to fabricate our blade from historical smithing techniques utilizing naturally-occurring deposits of iron ore. This approach resulted in receiving the "Best Example of a Traditional Blade Process/Ore Smelting Technique" award for our blade named "Berkelium." First, iron-enriched sand was collected from local beaches. Magnetite (Fe3O4) was then extracted from the sand and smelted into individual high- and low-carbon steel ingots. Layers of high- and low-carbon steels were forge-welded together, predominantly by hand, to form a composite material. Optical microscopy, energy dispersive spectroscopy, and Vickers hardness mechanical testing were conducted at different stages throughout the blade-making process to evaluate the microstructure and hardness evolution during formation. It was found that the pre-heat-treated blade microstructure was composed of ferrite and pearlite, and contained many nonmetallic inclusions. A final heat treatment was performed, which caused the average hardness of the blade edge to increase by more than a factor of two, indicating a martensitic transformation.

  16. Paul Scherrer Institute Scientific Report 1999. Volume I: Particles and Matter

    International Nuclear Information System (INIS)

    Although originally planned for fundamental research in nuclear physics, the particle beams of pions, muons, protons and neutrons are now used in a large variety of disciplines in both natural science and medicine. The beams at PSI have the world's highest intensities and therefore allow certain experiments to be performed, which would not be possible elsewhere. The highlight of research this year was the first-ever determination of the chemical properties of the superheavy element 107 Bohrium. This was undertaken, by an international team led by H. Gaeggeler of PSI's Laboratory for Radiochemistry. Bohrium was produced by bombarding a Berkelium target with Neon ions from the Injector I cyclotron and six atoms were detected after having passed through an online gas chromatography device. At the Laboratory for Particle Physics the focus has shifted from nuclear physics to elementary particle physics with about a fifty-fifty split between investigations of rare processes or particle decays using the high intensity muon, pion and recently also polarized neutron beams of PSI, and research at the highest energy frontier at CERN (Geneva) and DESY (Hamburg). Important space instrumentation has been contributed by the Laboratory for Astrophysics to the European Space Agency and NASA satellite programmes. The Laboratory for Micro and Nanotechnology continued to focus on research into molecular nanotechnology and SiGeC nanostructures, the latter with the aim of producing silicon based optoelectronics. Progress in 1999 in these topical areas is described in this report. A list of scientific publications in 1999 is also provided

  17. Retinitis Pigmentosa Mutations in Bad Response to Refrigeration 2 (Brr2) Impair ATPase and Helicase Activity.

    Science.gov (United States)

    Ledoux, Sarah; Guthrie, Christine

    2016-06-01

    Brr2 is an RNA-dependent ATPase required to unwind the U4/U6 snRNA duplex during spliceosome assembly. Mutations within the ratchet helix of the Brr2 RNA binding channel result in a form of degenerative human blindness known as retinitis pigmentosa (RP). The biochemical consequences of these mutations on Brr2's RNA binding, helicase, and ATPase activity have not yet been characterized. Therefore, we identified the largest construct of Brr2 that is soluble in vitro, which truncates the first 247 amino acids of the N terminus (Δ247-Brr2), to characterize the effects of the RP mutations on Brr2 activity. The Δ247-Brr2 RP mutants exhibit a gradient of severity of weakened RNA binding, reduced helicase activity, and reduced ATPase activity compared with wild type Δ247-Brr2. The globular C-terminal Jab1/Mpn1-like domain of Prp8 increases the ability of Δ247-Brr2 to bind the U4/U6 snRNA duplex at high pH and increases Δ247-Brr2's RNA-dependent ATPase activity and the extent of RNA unwinding. However, this domain of Prp8 does not differentially affect the Δ247-Brr2 RP mutants compared with the wild type Δ247-Brr2. When stimulated by Prp8, wild type Δ247-Brr2 is able to unwind long stable duplexes in vitro, and even the RP mutants capable of binding RNA with tight affinity are incapable of fully unwinding short duplex RNAs. Our data suggest that the RP mutations within the ratchet helix impair Brr2 translocation through RNA helices. PMID:27072132

  18. Dicty_cDB: Contig-U04879-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available length 5062330 Start point 2616612 End point 2616050 Strand (PLUS/MINUS) MINUS Nu...ig-U04879-1Q.Seq.d Length = 562 Score = 490 bits (247), Expect = e-139 Identities = 247/247 (100%) Strand = ...||| Sbjct: 346 ccaacaa 352 Score = 289 bits (146), Expect = 2e-78 Identities = 146/146 (100%) Strand = Plus ...||||||||||||||| Sbjct: 537 aatagagcaaacaagtgtaatgataa 562 Score = 30.2 bits (15), Expect = 2.4 Identities = 15/15 (100%) Strand... = 521 Score = 42.1 bits (21), Expect = 6e-04 Identities = 21/21 (100%) Strand = Plus / Plus Query: 332 taat

  19. Achados Ultra-Sonográficos em Pacientes com Ameaça de Abortamento no Primeiro Trimestre da Gestação Ultrasound Findings in First-trimester Threatened Abortion

    Directory of Open Access Journals (Sweden)

    Luiz Carlos Watanabe

    2000-06-01

    Full Text Available Objetivo: avaliar os achados ultra-sonográficos nas gestantes com ameaça de abortamento no primeiro trimestre da gestação. Métodos: exames de ultra-som obstétrico transabdominal e transvaginal foram realizados nas pacientes com sangramento vaginal e teste de gravidez positivo. Foram incluídas as gestantes entre 6 a 14 semanas de gestação pela data da última menstruação ou pelo exame ultra-sonográfico, que apresentavam colo do útero impérvio ao exame clínico. Foram excluídas as gestações múltiplas ou aquelas que realizaram tentativa de abortamento por meio de drogas ou manipulação. Resultados: em 132 dos 247 casos (53.4% foi diagnosticada gestação viável e em 46.6% (115/247, gestação inviável. Abortamento incompleto foi identificado em 19% (47/247, abortamento completo em 8,5% (21/247, abortamento retido em 7,7% (19/247, gestação anembrionada em 6,1% (15/247, gestação ectópica em 4,5% (11/247 e mola hidatiforme em 0,8% (2/247. Conclusão: aproximadamente metade (46,6% das gestações com ameaça de abortamento no primeiro trimestre apresentaram diagnóstico de inviabilidade da gestação. O exame ultra-sonográfico pode ajudar a definir esta condição e a conduta obstétrica.Objective: to evaluate ultrasound findings in pregnant women with threatened abortion in the first trimester of pregnancy. Methods: transabdominal and transvaginal ultrasound scans were performed in patients with vaginal bleeding with previous positive pregnancy test. Patients with 6-14-week gestation (by the last menstrual period or ultrasound scan, with closed cervix on clinical evaluation were included. Multiple pregnancies and those patients who have tried abortion by using abortive drugs or manipulation were excluded. Results: in 132 of 247 (53.4% the pregnancy was viable and in 46.6% (115/247 the pregnancy was nonviable. Incomplete miscarriage was found in 19% (47/247, complete miscarriage in 8.5% (21/247, missed abortion in 7.7% (19/247

  20. Taxonomy and distribution of benthic foraminifera from the sediments of Palk Strait, Tamil Nadu, east coast of India

    Digital Repository Service at National Institute of Oceanography (India)

    Gandhi, S.; Rajamanickam, G.V.; Nigam, R.

    Institute Nacional de Investigacion de las Ciencias Naturates. ?Bernardino Rivadavia> (Sea Geologicas), 3 : 247-300. Brady, II.B. 1879. Notes on some Retieularian Rhizopoda of the 'Challenger' expedition. Part II. Additions to the knowledge of porcellanous...

  1. Nitrogen oxide air pollution: atmospheric chemistry. 1964-1978 (citations from the NTIS data base). Report for 1964-78

    Energy Technology Data Exchange (ETDEWEB)

    Cavagnaro, D.M.

    1980-10-01

    Research reports on photochemical air pollution models, smog chemistry and reactivity, and SSt exhaust effects are cited in the bibliography. Auroral and upper atmospheric in chemistry, and photochemistry of naturally occurring nitrogen oxides are excluded. (Contains 247 citations)

  2. 77 FR 46948 - The Commerce Control List

    Science.gov (United States)

    2012-08-07

    ... rate sensors, having any of the following see List of Items Controlled) and specially designed... refer to dynamic or servo stability.) (IEEE STD 528-2001 paragraph 2.247) * * * * * BILLING CODE...

  3. Ilmus väärt artiklikogumik / Arvo Tering

    Index Scriptorium Estoniae

    Tering, Arvo, 1949-

    2008-01-01

    Arvustus: Ajalookirjutaja aeg = Aetas historicum / Eesti Rahvusraamatukogu ; koost. Piret Lotman. - Tallinn, 2008. - 247 lk. - (Eesti Rahvusraamatukogu toimetised. A, Raamat ja aeg, 1736-6984 ; nr. 1) ; (Eesti Rahvusraamatukogu toimetised ; 11)

  4. Gclust Server: 154498 [Gclust Server

    Lifescience Database Archive (English)

    Full Text Available 154498 SCE_YMR247W-A Cluster Sequences - 47 Identified by expression profiling and mass spectrometry...annotation Identified by expression profiling and mass spectrometry Number of Seq

  5. Data of evolutionary structure change: 1BFVH-1QLRB [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1BFVH-1QLRB 1BFV 1QLR H B QVQLQESGGGLVNLGGSMTLSCVASGFTFNTYYMSWVRQ...--------------------------------VSS---------------------------- EVQLQQWGAGLLKPSETLSLTCAVYGGSFSD...Y CA 247 1QLR B... 1QLRB CARPPHDTSGHY EEE 1 1QLR B 1QLRB

  6. Drug: D00247 [KEGG MEDICUS

    Lifescience Database Archive (English)

    Full Text Available 247.gif Diuretic Therapeutic category: 2139 ATC code: C03CA02 Loop diuretics Na-K-Cl cotransporter 1 inhibit...A:9376] map07017 Sulfonamide derivatives - diuretics map07233 Ion transporter inh

  7. Pediatric Palliative Care: A Personal Story

    Medline Plus

    Full Text Available ... count__/__total__ Find out why Close Pediatric Palliative Care: A Personal Story NINRnews Subscribe Subscribed Unsubscribe 247 ... and her family. The story demonstrates how palliative care can positively influence a patient's and family's experience ...

  8. Rheumatic heart disease

    Institute of Scientific and Technical Information of China (English)

    1992-01-01

    920657 The relationship between atrialnatriuretic factor and hemodynamics inrheumatic mitral stenosis. XU Zhimin(须志敏), et al. Dept Cardiol, Affil Hosp, Shand-ong Med Univ, Jinan. 25000 Chin Cir J1992; 7(3): 247-250.

  9. 75 FR 81365 - Call for Information: Information on Inputs to Emission Equations Under the Mandatory Reporting...

    Science.gov (United States)

    2010-12-27

    ... information pertaining to reporting of inputs to emission equations under the Mandatory Greenhouse Gas... Mandatory Reporting of Greenhouse Gases Rule; Proposed Rule #0;#0;Federal Register / Vol. 75 , No. 247... EPA's greenhouse gas reporting rule Web site at...

  10. SALINITY, WATER TEMPERATURE, FLUORESCENCE, PHOTOSYNTHETIC ACTIVE RADIATION (PAR) and other profile data collected in the Gulf of Alaska on the ALPHA HELIX cruises HX242, HX244 and others as part of the NEP project from 2001-04-18 to 2003-08-11 (NODC Accession 0115255)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — NODC Accession 0115255 includes profile, biological and physical data collected aboard the ALPHA HELIX during cruises HX242, HX244, HX247, HX271 and HX275 in the...

  11. Cypripediquinone A, a new phenanthraquinone from Cypripedium macranthum (Orchidaceae)

    Institute of Scientific and Technical Information of China (English)

    2000-01-01

    A new phenanthraquinone, cypripediquinone A, was isolated from the rhizome of Cypripedium macranthum ( Orchidaceae ) and its structure was established as 2,4,7-trimethoxy-9, 10- phenanthraquinone mainly by spectroscopic analysis.

  12. Proceedings of the Second Environmental Physics Conference (EPC-2006)

    International Nuclear Information System (INIS)

    The publication has been set up as proceedings of the environmental physics conference. the conference consistes of atmospere and climate; the ecosystem; radiation and radioactivity; activity review; environmental issues. This conference consistes of 247p., figs., tabs., refs

  13. 78 FR 49756 - Notification of a Cooperative Agreement Award to the World Health Organization

    Science.gov (United States)

    2013-08-15

    ... the Public Health Service Act, (42 U.S.C. 241 and 247d-7e). Estimated Amount of Award: $290,000 USD... chicken pox, may cause clinical diagnostic confusion. Over the past 10 years, clinical virology...

  14. 78 FR 49757 - Notification of an Expansion to the Cooperative Agreement Award to the World Health Organization

    Science.gov (United States)

    2013-08-15

    ...: Sections 301 and 319L of the Public Health Service Act, (42 U.S.C. 241 and 247d-7e) Estimated Amount of..., such as chicken pox, may cause clinical diagnostic confusion. Over the past 10 years, clinical...

  15. Drug: D01953 [KEGG MEDICUS

    Lifescience Database Archive (English)

    Full Text Available sts Therapeutic category of drugs in Japan [BR:br08301] 2 Agents affecting individual organs 24 Hormones 247...monal Agents, Stimulant/Replacement/Modifying (Sex Hormones/Modifiers) Estrogens

  16. Drug: D00105 [KEGG MEDICUS

    Lifescience Database Archive (English)

    Full Text Available 8301] 2 Agents affecting individual organs 24 Hormones 247 Estrogen and progesterone preparations 2473 Estra...(JAN/USP/INN) USP drug classification [BR:br08302] Hormonal Agents, Stimulant/Replacement/Modifying (Sex Hormones

  17. Drug: D00189 [KEGG MEDICUS

    Lifescience Database Archive (English)

    Full Text Available ng individual organs 24 Hormones 247 Estrogen and progesterone preparations 2479 Others D00189 Pregnanediol ...e as: C05484 Therapeutic category: 2479 Therapeutic category of drugs in Japan [BR:br08301] 2 Agents affecti

  18. Design, synthesis and characterization of bioinspired nanomaterials for engineering and biomedicine

    OpenAIRE

    Ceylan, Hakan

    2014-01-01

    Ankara : The Materials Science and Nanotechnology Program and the Graduate School of Engineering and Science of Bilkent University, 2014. Thesis (Ph. D.) -- Bilkent University, 2014. Includes bibliographical references leaves 227-247. Ceylan, Hakan Ph. D.

  19. Towards a methodology for educational modelling: a case in educational assessment

    OpenAIRE

    Giesbers, Bas; Van Bruggen, Jan; Hermans, Henry; Joosten-ten Brinke, Desirée; Burgers, Jan; Koper, Rob; Latour, Ignace

    2005-01-01

    Giesbers, B., van Bruggen, J., Hermans, H., Joosten-ten Brinke, D., Burgers, J., Koper, R., & Latour, I. (2007). Towards a methodology for educational modelling: a case in educational assessment. Educational Technology & Society, 10 (1), 237-247.

  20. 48 CFR 1652.000 - Applicable clauses.

    Science.gov (United States)

    2010-10-01

    ...-5Covenant Against Contingent Fees. 52.203-7Anti-Kickback Procedures. 52.203-12Limitation on Payments to... Items and Commercial Components. 52.246-25Limitation of Liability—Services. 52.247-63Preference for...

  1. Report on progress of researches by common utilization of JAERI nuclear facilities, for fiscal 1992

    International Nuclear Information System (INIS)

    The results of the joint researches by utilizing the facilities of JAERI in 1992 fiscal year were summarized. The number of research themes in 1992 was 247 cases. In this book, 166 reports are collected. (J.P.N.)

  2. CHLOROPHYLL A, growth rate and graze rate (or grazing rate) site samples data collected in the Gulf of Alaska on the ALPHA HELIX cruises HX242, HX244 and others as part of the NEP project from 2001-04-18 to 2003-08-10 (NODC Accession 0114241)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — NODC Accession 0114241 includes site samples and biological data collected aboard the ALPHA HELIX during cruises HX242, HX244, HX247, HX271 and HX275 in the Gulf of...

  3. К вопросу об объекте нарушения правил обращения экологически опасных веществ и отходов (ст. 247 УК)

    OpenAIRE

    ИВАНЦОВА НАТАЛЬЯ ВЛАДИМИРОВНА; ТОЛСТОВ П.В.

    2015-01-01

    Статья посвящена вопросам определения понятия и сущности объекта нарушения правил обращения экологически опасных веществ и отходов, а также места этого посягательства в системе экологических преступлений. В ходе исследования автор приходит к выводу о том, что данное преступление является однообъектным и его непосредственным объектом выступают отношения в сфере экологической безопасности, обеспечивающие соблюдение порядка обращения экологически опасных веществ и отходов....

  4. Alpha1a-Adrenoceptor Genetic Variant Triggers Vascular Smooth Muscle Cell Hyperproliferation and Agonist Induced Hypertrophy via EGFR Transactivation Pathway.

    Directory of Open Access Journals (Sweden)

    Irina Gradinaru

    Full Text Available α1a Adrenergic receptors (α1aARs are the predominant AR subtype in human vascular smooth muscle cells (SMCs. α1aARs in resistance vessels are crucial in the control of blood pressure, yet the impact of naturally occurring human α1aAR genetic variants in cardiovascular disorders remains poorly understood. To this end, we present novel findings demonstrating that 3D cultures of vascular SMCs expressing human α1aAR-247R (247R genetic variant demonstrate significantly increased SMC contractility compared with cells expressing the α1aAR-WT (WT receptor. Stable expression of 247R genetic variant also triggers MMP/EGFR-transactivation dependent serum- and agonist-independent (constitutive hyperproliferation and agonist-dependent hypertrophy of SMCs. Agonist stimulation reduces contractility Using pathway-specific inhibitors we determined that the observed hyperproliferation of 247R-expressing cells is triggered via β-arrestin1/Src/MMP-2/EGFR/ERK-dependent mechanism. MMP-2-specific siRNA inhibited 247R-triggered hyperproliferation indicating MMP-2 involvement in 247R-triggered hyperproliferation in SMCs. β-arrestin1-specific shRNA also inhibited 247R-triggered hyperproliferation but did not affect hypertrophy in 247R-expressing SMCs, indicating that agonist-dependent hypertrophy is independent of β-arrestin1. Our data reveal that in different cardiovascular cells the same human receptor genetic variant can activate alternative modulators of the same signaling pathway. Thus, our findings in SMCs demonstrate that depending on the type of cells expressing the same receptor (or receptor variant, different target-specific inhibitors could be used to modulate aberrant hyperproliferative or hypertrophic pathways in order to restore normal phenotype.

  5. Circulating cell-free DNA and its integrity as a prognostic marker for breast cancer

    OpenAIRE

    Iqbal, Sobuhi; Vishnubhatla, Sreenivas; Raina, Vinod; Sharma, Surabhi; Gogia, Ajay; Suryanarayana S.V. Deo; Mathur, Sandeep; Shukla, Nutan Kumar

    2015-01-01

    The aim of our study was to look for alternative predictive biomarkers for breast cancer management in limited resource setup. A comprehensive analysis of circulating cell-free DNA (CCFD) in serum at baseline was performed to assess its prognostic potential. Quantitative polymerase chain reaction (qPCR) of ALU sequences using ALU115 and ALU247 primers was carried out in patients (N: baseline 148, postoperative 47) and 51 healthy controls. Mean serum DNA integrity, levels of ALU 247 and levels...

  6. Improvement of Soil Carbon Determination using laser-induced breakdown spectroscopy

    Science.gov (United States)

    Moon, S. J.

    2014-12-01

    The increase of atmospheric greenhouse gases such as CO2 has caused noticeable climate change. Since increased CO2 may contribute to carbon storage in terrestrial ecosystems through the CO2 cycle between the atmosphere and vegetation, it is necessary to improve methods for measuring C in soil. In this study, we determined the total carbon concentrations of soils using a laser-induced breakdown spectroscopy (LIBS). The LIBS is a minimally destructive measurement technique that uses an ultra-short laser pulse to create plasma on the sample surface via the process of laser ablation. Compared with the traditional C measurements methods techniques such as wet oxidation and dry combustion, LIBS is known as a potentially elegant and promising solution for measuring C in soils. Although previous studies suggested the advantages of LIBS for measuring the C in soils, there are still challenging obstacles to be solved in measuring C. Previous studies have shown that the C in soil can be detected at wavelengths of 193.03 and 247.86 nm. The C line at 247.86 nm shows strong interference with Fe lines at 247.86 nm and 247.95 nm due to overlapping or self-absorption. To dismiss the problem of measuring the C line at 247.86 nm, the C line at 193.03 nm has been used to observe C emission. The C line at 193.03 nm can be quantified without interference from other elements, however, the ratio of Al line (198.90 nm) and Si line (212.40 nm) were used as standardizing factors to develop a significant calibration curve for soils. Although the wavelengths of both 193.03 and 247.86 nm presented the potential to measure C in soils, there has still been a lack of studies comparing the accuracy and effectiveness between the 193.03- and 247.8-nm C lines to analyze soil samples with different chemical and textural characteristics. In this study, we conducted extensive measurements of the C lines at 193.03 and 247.86 nm using LIBS to evaluate the C concentrations of Korean soils with different

  7. Minor Actinide Burning in Thermal Reactors. A Report by the Working Party on Scientific Issues of Reactor Systems

    International Nuclear Information System (INIS)

    The actinides (or actinoids) are those elements in the periodic table from actinium upwards. Uranium (U) and plutonium (Pu) are two of the principal elements in nuclear fuel that could be classed as major actinides. The minor actinides are normally taken to be the triad of neptunium (Np), americium (Am) and curium (Cm). The combined masses of the remaining actinides (i.e. actinium, thorium, protactinium, berkelium, californium, einsteinium and fermium) are small enough to be regarded as very minor trace contaminants in nuclear fuel. Those elements above uranium in the periodic table are known collectively as the transuranics (TRUs). The operation of a nuclear reactor produces large quantities of irradiated fuel (sometimes referred to as spent fuel), which is either stored prior to eventual deep geological disposal or reprocessed to enable actinide recycling. A modern light water reactor (LWR) of 1 GWe capacity will typically discharge about 20-25 tonnes of irradiated fuel per year of operation. About 93-94% of the mass of uranium oxide irradiated fuel is comprised of uranium (mostly 238U), with about 4-5% fission products and ∼1% plutonium. About 0.1-0.2% of the mass is comprised of neptunium, americium and curium. These latter elements accumulate in nuclear fuel because of neutron captures, and they contribute significantly to decay heat loading and neutron output, as well as to the overall radio-toxic hazard of spent fuel. Although the total minor actinide mass is relatively small - approximately 20-25 kg per year from a 1 GWe LWR - it has a disproportionate impact on spent fuel disposal, and thus the longstanding interest in transmuting these actinides either by fission (to fission products) or neutron capture in order to reduce their impact on the back end of the fuel cycle. The combined masses of the trace actinides actinium, thorium, protactinium, berkelium and californium in irradiated LWR fuel are only about 2 parts per billion, which is far too low for

  8. Paul Scherrer Institute Scientific Report 1999. Volume I: Particles and Matter

    Energy Technology Data Exchange (ETDEWEB)

    Gobrecht, J.; Gaeggeler, H.; Herlach, D.; Junker, K.; Kettle, P.-R.; Kubik, P.; Zehnder, A. [eds.

    2000-07-01

    lthough originally planned for fundamental research in nuclear physics, the particle beams of pions, muons, protons and neutrons are now used in a large variety of disciplines in both natural science and medicine. The beams at PSI have the world's highest intensities and therefore allow certain experiments to be performed, which would not be possible elsewhere. The highlight of research this year was the first-ever determination of the chemical properties of the superheavy element {sup 107} Bohrium. This was undertaken, by an international team led by H. Gaeggeler of PSI's Laboratory for Radiochemistry. Bohrium was produced by bombarding a Berkelium target with Neon ions from the Injector I cyclotron and six atoms were detected after having passed through an online gas chromatography device. At the Laboratory for Particle Physics the focus has shifted from nuclear physics to elementary particle physics with about a fifty-fifty split between investigations of rare processes or particle decays using the high intensity muon, pion and recently also polarized neutron beams of PSI, and research at the highest energy frontier at CERN (Geneva) and DESY (Hamburg). Important space instrumentation has been contributed by the Laboratory for Astrophysics to the European Space Agency and NASA satellite programmes. The Laboratory for Micro and Nanotechnology continued to focus on research into molecular nanotechnology and SiGeC nanostructures, the latter with the aim of producing silicon based optoelectronics. Progress in 1999 in these topical areas is described in this report. A list of scientific publications in 1999 is also provided.

  9. Transuranium Processing Plant semiannual report of production, status, and plans for period ending December 31, 1975

    Energy Technology Data Exchange (ETDEWEB)

    King, L.J.; Bigelow, J.E.; Collins, E.D.

    1976-10-01

    Between July 1, 1975, and December 31, 1975, maintenance was conducted at TRU for a period of three months, 295 g of curium oxide (enough for approximately 26 HFIR targets) were prepared, 100 mg of high-purity /sup 248/Cm, were separated from /sup 252/Cf that had been purified during earlier periods, 11 HFIR targets were fabricated, and 28 product shipments were made. No changes were made in the chemical processing flowsheets normally used at TRU during this report period. However, three equipment racks were replaced (with two new racks) during this time. In Cubicle 6, the equipment replaced was that used to decontaminate the transplutonium elements from rare earth fission products and to separate curium from the heavier elements by means of the LiCl-based anion-exchange process. In Cubicle 5, the equipment used to separate the transcurium elements by high-pressure ion exchange and to purify berkelium by batch solvent extraction was replaced. Two neutron sources were fabricated, bringing the total fabricated to 79. One source that had been used in a completed project was returned to the TRU inventory and is available for reissue. Three sources, for which no further use was foreseen, were processed to isolate and recover the ingrown /sup 248/Cm and the residual /sup 252/Cf. Eight pellets, each containing 100 ..mu..g of high-purity /sup 248/Cm were prepared for irradiation in HFIR to study the production of /sup 250/Cm. The values currently being used for transuranium element decay data and for cross-section data in planning irradiation-processing cycles, calculating production forecasts, and assaying products are tabulated.

  10. Analysis of the contribution of the hinge region of human neutrophil collagenase (HNC, MMP-8) to stability and collagenolytic activity by alanine scanning mutagenesis.

    Science.gov (United States)

    Knäuper, V; Docherty, A J; Smith, B; Tschesche, H; Murphy, G

    1997-03-17

    Analysis of the hinge region of neutrophil collagenase by alanine scanning mutagenesis revealed that this sequence motif has a pronounced effect on the stability and collagenolytic activity of the active enzyme. The mutagenesis of the amino acid residues in the P1' position of the two autoproteolytically cleaved peptide bonds (Leu243 and Ile248) to Ala showed that the mutant enzymes were more resistant to autoproteolysis. However, these mutants were not completely stable and autoproteolysis occurred mainly at the Ala239-Ile240 peptide bond and the half-life of the active enzyme was increased by 50%. In contrast, mutagenesis of Pro247 --> Ala (P1 of the minor cleavage site Pro247-Ile248) lead to increased susceptibility of the enzyme to autoproteolysis. However, when the other P1 position Gly242 was altered to Ala no effect on stability was observed. The analysis of the ability of the mutant active enzymes to hydrolyse 14C-type I collagen was assessed and our results demonstrate that the hinge sequence motif of neutrophil collagenase is important for collagenolytic activity. The alteration of the Gly242-Leu-Ser-Ser-Asn-Pro-Ile-Gln-Pro247 sequence motif to Gly242-Ala-Ala-Ala-Ala-Pro-Ala-Ala-Pro247 showed that the collagenolytic activity was reduced by 68.4%. In addition, mutagenesis of the downstream sequence motif Pro247-Thr-Gly-Pro-Ser-Thr-Pro-Lys-Pro258 to Pro247-Ala-Ala-Pro-Ala-Ala-Pro-Ala-Pro258 had an even more marked effect on the collagenolytic activity, which was reduced by 87.4%. When the Pro residues in the hinge motif (Pro247, Pro250, Pro253 and Pro256) were altered to Ala the collagenolytic activity dropped to 1.5% of the value observed for wild-type enzyme.

  11. Percutaneous vertebroplasty - the role of osseous phlebography; Die perkutane Vertebroplastie - Rolle der ossaeren Phlebographie

    Energy Technology Data Exchange (ETDEWEB)

    Hierholzer, J.; Fuchs, H.; Westphalen, K.; Venz, S. [Diagnostische und Interventionelle Radiologie, Klinikum Ernst-von-Bergmann gGmbH, Potsdam (Germany); Pappert, D. [Klinik fuer Anaesthesiologie und Intensivtherapie, Klinikum Ernst-von-Bergmann gGmbH, Potsdam (Germany); Depriester, C. [Clinique DuBois, Lille (France)

    2005-03-01

    Purpose: To evaluate the usefulness of osseous phlebography preceding percutaneous vertebroplasty. Materials and Methods: Seventy-five patients with painful osteoporotic (57) or malignant (18) vertebral fractures were treated by percutaneous vertebroplasty under fluoroscopic control. Prior to cement injection, osseous phlebography was performed, with 247 phlebographic studies included in the retrospective correlation with radiographic and CT images. Clinical results were assessed by standardized questionnaire. Results: In 69/75 (92%) patients, pain and mobility improved and medication needed for pain control decreased significantly after vertebroplasty. Two clinically apparent complications occurred. The results of osseous phlebography prompted correction of the needle position in 34/247 (14%) of the procedures and cancellation of the cement injection in 19/247 (8%). No complications occurred related to osseous phlebography. CT was superior to conventional radiography in detecting extra-osseous cement leakage (106/247 by CT vs. 63/247 by conventional radiography). The cement leakage was asymptomatic in 104/106 (98%) cases for the duration of follow-up. Discussion: Osseous phlebography prior to percutaneous vertebroplasty had a significant impact on the procedure in our retrospective study and was able to predict the cement distribution in the majority of cases. However, phlebography was unable to foresee and therefore prevent 2 clinically relevant complications. Complications related to phlebography did not occur. (orig.)

  12. Origin of uranium isotope variations in early solar nebula condensates

    CERN Document Server

    Tissot, Francois L H; Grossman, Lawrence

    2016-01-01

    High temperature condensates found in meteorites display uranium isotopic variations (235U/238U) that complicate dating of the formation of the Solar System and whose origin remains mysterious. It is possible that these variations are due to decay of the short-lived radionuclide 247Cm (t1/2=15.6 Myr) into 235U but they could also be due to uranium kinetic isotopic fractionation during condensation. We report uranium isotope measurements of meteoritic refractory inclusions that reveal excesses of 235U reaching ~+6 % relative to average solar system composition, which can only be due to decay of 247Cm. This allows us to constrain the 247Cm/235U ratio at Solar System formation to (1.1 +- 0.3) x 10-4. This value provides new clues on the universality of nucleosynthetic r-process of rapid neutron capture.

  13. Single crystal growth of YBa2Cu4O8 and Y2Ba4Cu7O15 under high oxygen pressure

    International Nuclear Information System (INIS)

    In this paper, the authors investigate the crystal growth of YBa2Cu4O8 (124) and Y2Ba4Cu7O15 (247) in Al2O3 crucibles at an oxygen partial pressure of 10 MPa employing an O2-HIP apparatus in a mixed gas environment of Ar-20% O2. Various melts compositions, rich in Ba and Cu, are explored to optimize crystal growth of 124. Large 124 single crystals up to a size of 1 x 0.5 x 0.05 mm3 are obtained from compositions with about 65 ∼ 67% CuO. 247 crystals having a maximum size of 3 x 1.5 x 0.05 mm3 are grown from the same composition of melts. 124 crystals exhibit superconductivity at 75K. 247 crystals show Tc of 20K

  14. Origin of uranium isotope variations in early solar nebula condensates.

    Science.gov (United States)

    Tissot, François L H; Dauphas, Nicolas; Grossman, Lawrence

    2016-03-01

    High-temperature condensates found in meteorites display uranium isotopic variations ((235)U/(238)U), which complicate dating the solar system's formation and whose origin remains mysterious. It is possible that these variations are due to the decay of the short-lived radionuclide (247)Cm (t 1/2 = 15.6 My) into (235)U, but they could also be due to uranium kinetic isotopic fractionation during condensation. We report uranium isotope measurements of meteoritic refractory inclusions that reveal excesses of (235)U reaching ~+6% relative to average solar system composition, which can only be due to the decay of (247)Cm. This allows us to constrain the (247)Cm/(235)U ratio at solar system formation to (1.1 ± 0.3) × 10(-4). This value provides new clues on the universality of the nucleosynthetic r-process of rapid neutron capture.

  15. Origin of uranium isotope variations in early solar nebula condensates.

    Science.gov (United States)

    Tissot, François L H; Dauphas, Nicolas; Grossman, Lawrence

    2016-03-01

    High-temperature condensates found in meteorites display uranium isotopic variations ((235)U/(238)U), which complicate dating the solar system's formation and whose origin remains mysterious. It is possible that these variations are due to the decay of the short-lived radionuclide (247)Cm (t 1/2 = 15.6 My) into (235)U, but they could also be due to uranium kinetic isotopic fractionation during condensation. We report uranium isotope measurements of meteoritic refractory inclusions that reveal excesses of (235)U reaching ~+6% relative to average solar system composition, which can only be due to the decay of (247)Cm. This allows us to constrain the (247)Cm/(235)U ratio at solar system formation to (1.1 ± 0.3) × 10(-4). This value provides new clues on the universality of the nucleosynthetic r-process of rapid neutron capture. PMID:26973874

  16. Drug: D08343 [KEGG MEDICUS

    Lifescience Database Archive (English)

    Full Text Available D08343 Drug Pethidine (INN); Meperidine; Pethidine DBL (TN) C15H21NO2 247.1572 247.3327 D08343.gif Opioi...d analgesic Same as: C07128 ATC code: N02AB02 Synthesis opioid mu-opioid receptor agoni...st [HSA:4988] [KO:K04215] hsa04080(4988) Neuroactive ligand-receptor interaction map07028 Antipsychotics map07039 Opioi...d analgesics map07224 Opioid receptor agonists/antagonists Anatomical ...Therapeutic Chemical (ATC) classification [BR:br08303] N NERVOUS SYSTEM N02 ANALGESICS N02A OPIOIDS N02AB Ph

  17. Cell Persistence of Allogeneic Keratinocytes and Fibroblasts Applied in a Fibrin Matrix to Acute, Full Thickness Wounds

    OpenAIRE

    Dickerson, Jaime E; Planz, John V.; Reece, Barry T.; Weedon, Kathy A.; Kirkpatrick, Sandy D.; Slade, Herbert B

    2012-01-01

    HP802-247 is a living cell suspension of cultured allogeneic growth-arrested human male keratinocytes and fibroblasts (1:9 ratio), intended for spray application to chronic wounds. In this study, a small wound was created on the arms of 28 healthy female volunteers (3-mm punch), followed by a single application of HP802-247. At each subsequent week for 8 weeks, a punch excision of the wounds was performed on a cohort of three subjects. Excised specimens were analyzed for allogeneic fibroblast...

  18. Drug: D08100 [KEGG MEDICUS

    Lifescience Database Archive (English)

    Full Text Available D08100 Drug Ketobemidone (INN) C15H21NO2 247.1572 247.3327 D08100.gif Opioid Analge... NERVOUS SYSTEM N02 ANALGESICS N02A OPIOIDS N02AB Phenylpiperidine derivatives N02AB01 Ketobemidone D08100 K...04 2905 2906] [KO:K05208 K05209 K05210 K05211 K05212] Ketobemidone [ATC:N02AB01] D08100 Ketobemidone (INN) C...AS: 469-79-4 PubChem: 96024790 LigandBox: D08100 NIKKAJI: J5.929C ATOM 18 1 C1z C

  19. 12-core x 3-mode Dense Space Division Multiplexed Transmission over 40 km Employing Multi-carrier Signals with Parallel MIMO Equalization

    DEFF Research Database (Denmark)

    Mizuno, T.; Kobayashi, T.; Takara, H.;

    2014-01-01

    We demonstrate dense SDM transmission of 20-WDM multi-carrier PDM-32QAM signals over a 40-km 12-core x 3-mode fiber with 247.9-b/s/Hz spectral efficiency. Parallel MIMO equalization enables 21-ns DMD compensation with 61 TDE taps per subcarrier.......We demonstrate dense SDM transmission of 20-WDM multi-carrier PDM-32QAM signals over a 40-km 12-core x 3-mode fiber with 247.9-b/s/Hz spectral efficiency. Parallel MIMO equalization enables 21-ns DMD compensation with 61 TDE taps per subcarrier....

  20. Mothers’ non-standard working and childcare-related challenges : A comparison between lone and coupled mothers

    OpenAIRE

    Moilanen, Sanna; May, Vanessa; Räikkönen, Eija; Sevón, Eija; Laakso, Marja-Leena

    2016-01-01

    Purpose – The purpose of this paper is to particularly focus on lone-mother families, comparing the childcare-related challenges experienced by working lone mothers and coupled mothers in three European countries in the context of a 24/7 economy and non-standard working hours (e.g. evening, night and weekend work). Design/methodology/approach – This study utilises survey data from Finnish, Dutch and British working mothers (n=1,106) collected as part of the “Families 24/7” research ...

  1. Carbon isotope systematics of individual hydrocarbons in hydrothermal petroleum from Escanaba Trough, Northeastern Pacific Ocean

    Science.gov (United States)

    Simoneit, B.R.T.; Schoell, M.; Kvenvolden, K.A.

    1997-01-01

    We submitted individual aliphatic and polycyclic aromatic hydrocarbons in samples of hydrothermal petroleum from Escanaba trough to compound specific isotope analysis to trace their origins. The carbon isotope compositions of the alkanes and polycyclic aromatic hydrocarbons (means -27.5 and -24.7%, respectively) reflect a primarily terrestrial organic matter source.We submitted individual aliphatic and polycyclic aromatic hydrocarbons in samples of hydrothermal petroleum from Escanaba Trough to compound specific isotope analysis to trace their origins. The carbon isotope compositions of the alkanes and polycyclic aromatic hydrocarbons (means -27.5 and -24.7 per mill, respectively) reflect a primarily terrestrial organic matter source.

  2. New Antioxidative Secondary Metabolites from the Fruits of a Beibu Gulf Mangrove, Avicennia marina

    Directory of Open Access Journals (Sweden)

    Cheng-Hai Gao

    2014-07-01

    Full Text Available Further chemical investigation of the fruits of the mangrove, Avicennia marina, afforded three new phenylethyl glycosides, marinoids J–L (1–3, and a new cinnamoyl glycoside, marinoid M (4. The structures of isolates were elucidated on the basis of extensive spectroscopic analysis and by comparison of the data with those of related secondary metabolites. The antioxidant activity of the isolates was evaluated using the cellular antioxidant assay (CAA, and compounds 1–4 showed antioxidant activities, with EC50 values ranging from 23.0 ± 0.71 μM to 247.8 ± 2.47 μM.

  3. TET2 mutations in secondary acute myeloid leukemias: a French retrospective study

    OpenAIRE

    Kosmider, Olivier; Delabesse, Eric; Mas, Véronique Mansat-De; Cornillet-Lefebvre, Pascale; Blanchet, Odile; Delmer, Alain; Recher, Christian; Raynaud, Sophie; Bouscary, Didier; Viguié, Franck; Lacombe, Catherine; Bernard, Olivier A.; Ifrah, Norbert; Dreyfus, François; Fontenay, Michaëla

    2011-01-01

    Ten-eleven translocation 2 (TET2) mutations have been involved in myeloid malignancies. This retrospective study aims at evaluating the frequency and impact of TET2 mutations in 247 secondary acute myeloid leukemia cases referred to as myelodysplasia-related changes (n=201) or therapy-related (n=46) leukemias. Mutation of at least one copy of the TET2 gene was detected in 49 of 247 (19.8%) patients who presented with older age, higher hemoglobin level, higher neutrophil and monocyte counts, a...

  4. 脑胶质瘤患者血清及脑脊液中游离DNA的检测%Diagnostic value of the content and integrity of free DNA in patients with glioma

    Institute of Scientific and Technical Information of China (English)

    陈建; 施炜; 吕成林; 夏亮; 戚青; 景蓉蓉; 鞠少卿

    2012-01-01

    目的 检测不同级别脑胶质瘤患者血清及脑脊液中游离DNA的含量及完整性,探讨其对脑胶质瘤的诊断及预后判断的意义.方法 术前采集70例脑胶质瘤患者和22例健康对照的外周血;其中30例胶质瘤患者同时采集脑脊液.通过实时荧光定量聚合酶链反应( RT-qPCR)方法检测血清及脑脊液中游离DNA短串联重复序列(ALU)的长片段(247 bp)与短片段(115 bp)的含量以及DNA完整性.结果 血清中ALU-247 bp与115 bp含量以及游离DNA完整性在胶质瘤组与对照组间差异无统计学意义(P>0.05).脑脊液中游离DNA ALU-247 bp与115 bp含量均较非肿瘤对照组高,DNA完整性(ALU-247/ALU-115 bp)较对照组也显著增高.ROC曲线分析ALU-247 bp,ALU-115 bp含量与DNA完整性的AUC分别为0.775、0.875和0.912.结论 胶质瘤患者术前脑脊液中游离DNA ALU-247 bp、ALU-115 bp的含量以及DNA完整性对胶质瘤的术前诊断具有一定价值.%Objective To detect the content of free DNA and the DNA integrity in serum and cerebrospinal fluid (CSF) from glioma patients in order to assess their diagnostic value for the glioma.Methods Serum samples were obtained from 70 patients with glioma and 22 healthy volunteers as controls,and CSF samples from 20 patients with glioma and 8 nonneoplastic controls with hydrocephalus or arachnoid cyst.Free DNA concentration and integrity were detected by using real-time quantitative polymerase chain reaction (RT-qPCR) before operation.With 2 primers sets amplifying short and long free DNA fragments ( ALU115 and ALU247 ),free DNA integrity was determined by ratio of the concentration of ALU247 over ALU115 (ALU 247/115).Results The concentration of serum ALU had no significant differences between glioma patients and healthy controls.ALU115 and ALU247 contents,and free DNA integrity in CSF were significantly higher in glioma patients than in the controls ( all P<0.05 ).Area under curve of ROC curve analysis for the CSF

  5. Marijuana

    Science.gov (United States)

    ... J Drug Policy . 2015;26(2):135-142. doi:10.1016/j.drugpo.2014.07.011. Panlilio LV, Zanettini ... Alcohol Depend . 2008;92(1-3):239-247. doi:10.1016/j.drugalcdep.2007.08.005. This publication is ...

  6. Data of evolutionary structure change: 1YLJA-3BLMA [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1YLJA-3BLMA 1YLJ 3BLM A A QTSAVQQKLAALEKSSGGRLGVALIDTADNTQVLYRGDE... 194 LEU CA 258 LEU CA 327 ASN CA 247 3BLM... A 3BLMA LLEQVPYNKL... CA 338 THR CA 465 THR CA 490 3BLM... A 3BLMA KSGQ

  7. Contrasts and Similarities in Attitudes toward Death of Health Care Providers.

    Science.gov (United States)

    Clair, Jeffrey Michael; Hashimoto, Shige

    Although death and the circumstances surrounding it are inevitable for all people, open discussions of this subject are considered morbid and thus taboo. The fear of death, however, greatly affects the care administered to dying patients in a health care setting by professionals, family, and friends. A mail survey was administered to 247

  8. Teachers' Job Characteristics and Motivation.

    Science.gov (United States)

    Barnabe, Clermont; Burns, Mildred

    1994-01-01

    To test the Job Characteristics Model of Motivation, 247 Quebec teachers completed the Job Diagnostic Survey. Results demonstrated the utility of the model and the instrument for the teaching profession. Psychological states influenced the relationship between job characteristics and motivation/satisfaction outcomes. (SK)

  9. 48 CFR 3447.7000 - Foreign travel clause.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 7 2010-10-01 2010-10-01 false Foreign travel clause... REGULATION CONTRACT MANAGEMENT TRANSPORTATION Foreign Travel 3447.7000 Foreign travel clause. The contracting officer shall insert the clause in 3452.247-70, Foreign Travel, in all solicitations and resultant...

  10. 25 CFR 700.245 - Time limits on processing of initial requests.

    Science.gov (United States)

    2010-04-01

    ... public holidays) after receipt of a request. This determination shall be communicated immediately to the..., but in no case may the time limit be extended for more than ten (10) working days: (1) The need to... of the running of the twenty (20) working-day appeal period set out in § 700.247. If a...

  11. Understanding Elementary Astronomy by Making Drawing-Based Models

    Science.gov (United States)

    van Joolingen, W. R.; Aukes, Annika V.; Gijlers, H.; Bollen, L.

    2015-01-01

    Modeling is an important approach in the teaching and learning of science. In this study, we attempt to bring modeling within the reach of young children by creating the SimSketch modeling system, which is based on freehand drawings that can be turned into simulations. This system was used by 247 children (ages ranging from 7 to 15) to create a…

  12. The Contribution of the Library to the Reputation of a University

    Science.gov (United States)

    Weiner, Sharon

    2009-01-01

    This paper explores the relationship between a peer-assessed reputation rating for each of the 247 doctoral universities and cross-institutional performance indicators for universities and their libraries. Using multiple regression, the variable of library expenditures, was the only consistently significant one using combinations of variables.…

  13. Utilfredsstillende langtidsresultater efter konservativ behandling af patellofemoralt smertesyndrom

    DEFF Research Database (Denmark)

    Rathleff, Michael Skovdal; Rasmussen, Sten; Olesen, Jens Lykkegaard

    2012-01-01

    This review overviews the long-term prognosis of conservatively treated patients with patellofemoral pain syndrome (PFPS). Median values of the 16 included studies show that 29% of soldiers, 27.8% of sports active and 24,7% of the general public will become pain free after they are diagnosed...

  14. The Modes of Communication Used by Children with Cochlear Implants and the Role of Sign in Their Lives

    Science.gov (United States)

    Hyde, Merv; Punch, Renee

    2011-01-01

    In a mixed-methods study, which included surveys of 247 parents and 151 teachers, the researchers investigated the modes of communication used by children with cochlear implants and the role of signed communication in the children's lives. Findings indicated that 15%-20% of the children in the parent surveys and approximately 30% of the children…

  15. Deme accounts and the meaning of hosios money in fifth-century Athens

    NARCIS (Netherlands)

    Blok, J.H.

    2010-01-01

    Comparing the accounts of the deme Ikarion (IG I3 253) with those of Rhamnous (IG I3 247 bis and 253; IRhamnous 181 and 182) and Plotheia (IG I3 258), this article argues that the adjective hosios applied to a fund in Ikarion indicates that this money was dêmosios and to be used in a way pleasing to

  16. 7 CFR 2902.22 - Fertilizers.

    Science.gov (United States)

    2010-01-01

    ... Procurement Guideline, 40 CFR 247.15. EPA provides recovered materials content recommendations for fertilizers... 7 Agriculture 15 2010-01-01 2010-01-01 false Fertilizers. 2902.22 Section 2902.22 Agriculture... Fertilizers. (a) Definition. Products formulated or processed to provide nutrients for plant growth...

  17. Attachment, Autonomy, and Emotional Reliance: A Multilevel Model

    Science.gov (United States)

    Lynch, Martin F.

    2013-01-01

    This article reports a test of a multilevel model investigating how attachment security and autonomy contribute to emotional reliance, or the willingness to seek interpersonal support. Participants ("N" = 247) completed online measures of attachment, autonomy, emotional reliance, and vitality with respect to several everyday…

  18. The Relationships between Shyness and Unsociability and Peer Difficulties: The Moderating Role of Insecure Attachment

    Science.gov (United States)

    Chen, Bin-Bin; Santo, Jonathan Bruce

    2016-01-01

    The main purpose of the study was to examine the moderating role of the insecure mother-child attachment in the relations between social withdraw and peer difficulties. Participants were 487 urban children (247 boys, 240 girls) in elementary schools in Shanghai, the People's Republic of China. Data on attachment-relevant coping styles in insecure…

  19. The DNA methylome of human peripheral blood mononuclear cells

    DEFF Research Database (Denmark)

    Li, Yingrui; Zhu, Jingde; Tian, Geng;

    2010-01-01

    DNA methylation plays an important role in biological processes in human health and disease. Recent technological advances allow unbiased whole-genome DNA methylation (methylome) analysis to be carried out on human cells. Using whole-genome bisulfite sequencing at 24.7-fold coverage (12.3-fold per...

  20. Reactivity of Alkyldibenzothiophenes Using Theoretical Descriptors

    Directory of Open Access Journals (Sweden)

    Jose Luis Rivera

    2014-01-01

    Full Text Available Theoretical calculations of the reactivity of dibenzothiophene and its methyl, dimethyl, and trimethyl derivatives show that local reactivity descriptors reproduce their experimental desulfurization reactivity trend if the first desulfurization step involves directly the sulfur atom, which only occurs if the sulfur atom is blocked at most by one methyl group. In the series of molecules {4,7-dimethyldibenzothiophene, x,4,7-trimethyldibenzothiophene (x=1,2,3}, the most reactive molecule is 2,4,7-trimethyldibenzothiophene, and local descriptors show that the reactivity is linked to the activity of the sulfur atom, which is higher in 2,4,7-trimethyldibenzothiophene due to the position of the third methyl substitute, located in the para position with respect to the carbon bonded to the sulfur atom. The electrostatic potential of 2,4,7-trimethyldibenzothiophene shows one effective adsorption site, while 1,4,7-trimethyldibenzothiophene and 3,4,7-trimethyldibenzothiophene have more sites, contributing to the higher reactivity of 2,4,7-trimethyldibenzothiophene. The index of reactivity of other descriptors was evaluated and the effect of the position of the methyl substituents on adsorption parameters, as the dipole moment and the atomic charges were also studied.

  1. Examining Gender with General Creativity and Preferences for Creative Persons in College Students within the Sciences and the Arts

    Science.gov (United States)

    Charyton, Christine; Basham, Kimberly M.; Elliott, John O.

    2008-01-01

    The purpose of the research was to investigate gender similarities and differences in general creativity constructs with their preferences for creative persons. Data were collected from 247 participants (87 engineering, 24 psychology students with a psychology major, 51 psychology students with a major other than psychology, 30 English, and 55…

  2. 49 CFR 174.86 - Maximum allowable operating speed.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 2 2010-10-01 2010-10-01 false Maximum allowable operating speed. 174.86 Section... operating speed. (a) For molten metals and molten glass shipped in packagings other than those prescribed in § 173.247 of this subchapter, the maximum allowable operating speed may not exceed 24 km/hour (15...

  3. The Role of Individualism-Collectivism in the Individual Creative Process

    Science.gov (United States)

    Yao, Xiang; Wang, Shuhong; Dang, Junhua; Wang, Lei

    2012-01-01

    This study is among the first to examine how individuals' cultural value orientations impact 2 separate stages of creativity: idea generation and idea implementation. A total of 247 Chinese employees completed questionnaires including individualism-collectivism culture orientation and their idea generation behavior. Supervisor ratings of idea…

  4. 78 FR 6056 - Designation of Payor as Agent To Perform Acts Required of an Employer

    Science.gov (United States)

    2013-01-29

    ... Federal Register on January 13, 2010, (75 FR 1735-01). Pursuant to section 3504 and the regulations, the.... United States, 419 U.S. 43, 95 S. Ct. 247, 42 L. Ed. 2d 212 (1974); In re Armadillo Corp., 410 F....

  5. Microstress evolution during in situ loading of a superalloy containing high volume fraction of {gamma}{sup '} phase

    Energy Technology Data Exchange (ETDEWEB)

    Ma, S.; Rangaswamy, P.; Majumdar, B.S

    2003-03-03

    Pulsed neutron diffraction under in situ mechanical loading was used to monitor microstrain evolution in individual phases of a polycrystalline {gamma}/{gamma}{sup '} superalloy, CM 247 LC. The load partitioning and yielding of differently oriented grains and phases were evaluated. The critical resolved shear stresses of individual phases were obtained and are compared with dislocation models.

  6. Prevalence and diversity of Campylobacter jejuni in pig herds on farms with and without cattle or poultry

    DEFF Research Database (Denmark)

    Boes, J.; Nersting, L.; Nielsen, Eva;

    2005-01-01

    The prevalence and diversity of Campylobacter jejuni was investigated in pig herds on farms with and without cattle or poultry production. A bacteriological screening of pig cecal samples from 247 finisher herds was carried out at the slaughterhouse. Subsequently, a follow-up study was conducted ...

  7. Work Design, Role Conflict, and Role Ambiguity: The Case of Elementary and Secondary Schools.

    Science.gov (United States)

    Bacharach, Samuel B.; And Others

    1990-01-01

    Work design outcomes (role conflict, role ambiguity, stress symptomatology, turnover, and militancy) were assessed in New York State. Out of 3,200 mailed surveys, 2,247 teacher questionnaires were returned and analyzed. Managerial and educational policy implications of the findings for elementary school and secondary schools are discussed. (SLD)

  8. "You Cannot Talk with All of the Strangers in a Pub": A Longitudinal Case Study of International Postgraduate Students' Social Ties at a British University

    Science.gov (United States)

    Schartner, Alina

    2015-01-01

    The formation of social ties is a major factor in the international student experience (Ramsay et al. in High Educ 54(2):247-265, 2007), influencing student wellbeing and adjustment to the new academic and sociocultural environment (Ward et al. in The psychology of culture shock. Routledge, Hove, 2001). Although a significant body of research in…

  9. Evaluating Career Success of African American Males: It's What You Know and Who You Are that Matters

    Science.gov (United States)

    Johnson, C. Douglas; Eby, Lillian T.

    2011-01-01

    The objectives of the present study were to identify the factors related to career success of college educated, African American men and to explore the relative importance of human capital, social capital, individual differences, and demographic attributes in predicting career success. Using a sample of 247 African American males, we found some…

  10. Genetic variants of the human dipeptide transporter PEPT1

    DEFF Research Database (Denmark)

    Anderle, Pascale; Nielsen, Carsten Uhd; Pinsonneault, Julia;

    2006-01-01

    We tested whether genetic polymorphisms affect activity of the dipeptide transporter PEPT1, which mediates bioavailability of peptidomimetic drugs. All 23 exons and adjoining intronic sections of PEPT1 (SLC15A1) were sequenced in 247 individuals of various ethnic origins (Coriell collection). Of ...

  11. Ethnic Microaggressions and the Depressive and Somatic Symptoms of Latino and Asian American Adolescents

    Science.gov (United States)

    Huynh, Virginia W.

    2012-01-01

    Ethnic microaggressions are a form of everyday, interpersonal discrimination that are ambiguous and difficult to recognize as discrimination. This study examined the frequency and impact of microaggressions among Latino (n = 247) and Asian American (n = 113) adolescents (M[subscript age] = 17.18, SD = 0.75; 57% girls). Latino adolescents reported…

  12. The Teaching of the Code of Ethics and Standard Practices for Texas Educator Preparation Programs

    Science.gov (United States)

    Davenport, Marvin; Thompson, J. Ray; Templeton, Nathan R.

    2015-01-01

    The purpose of this descriptive quantitative research study was to answer three basic informational questions: (1) To what extent ethics training, as stipulated in Texas Administrative Code Chapter 247, was included in the EPP curriculum; (2) To what extent Texas public universities with approved EPP programs provided faculty opportunities for…

  13. The Role of Biographical Characteristics in Preservice Classroom Teachers' School Physical Activity Promotion Attitudes

    Science.gov (United States)

    Webster, Collin A.; Monsma, Eva; Erwin, Heather E.

    2010-01-01

    Recommendations for increasing children's daily physical activity (PA) call on classroom teachers to assume an activist role at school. This study examined relationships among preservice classroom teachers' (PCT; n = 247) biographical characteristics, perceptions and attitudes regarding school PA promotion (SPAP). Results indicated participants…

  14. Antibiotic susceptibility profiles of oral pathogens

    NARCIS (Netherlands)

    Veloo, A. C. M.; Seme, K.; Raangs, E.; Rurenga, P.; Singadji, Z.; Wekema-Mulder, G.; van Winkelhoff, A. J.

    2012-01-01

    Periodontitis is a bacterial disease that can be treated with systemic antibiotics. The aim of this study was to establish the antibiotic susceptibility profiles of five periodontal pathogens to six commonly used antibiotics in periodontics. A total of 247 periodontal bacterial isolates were tested

  15. 24 CFR 982.310 - Owner termination of tenancy.

    Science.gov (United States)

    2010-04-01

    ... with fair housing and equal opportunity provisions of 24 CFR 5.105, and with the provisions for protection of victims of domestic violence, dating violence, and stalking in 24 CFR part 5, subpart L... applicable. 24 CFR part 247 (concerning evictions from certain subsidized and HUD-owned projects) does...

  16. Self-help treatment for insomnia through television and book: A randomized trial.

    NARCIS (Netherlands)

    Straten, van A.; Cuijpers, P.; Smit, H.F.E.; Spermon, M.; Verbeek, I.

    2009-01-01

    Abstract Objective Recently, a Dutch educational broadcasting company developed a 6 week self-help course for insomnia, which consists of a book and television programmes. In this study we examined its effects. Methods 247 subjects with sleep problems were recruited through the media and randomized

  17. Industrial Maintenance, Volume II-B. Post Secondary Curriculum Guide.

    Science.gov (United States)

    Butler, Raymond H.; And Others

    This volume is the third of four volumes that comprise a curriculum guide for a postsecondary industrial maintenance program. It contains part of section 3 of the guide which contains the unit guides for 10 of the 12 duties included in the course. Each of the 247 tasks included in these 10 duties is presented on a separate page and contains the…

  18. 48 CFR 47.104-2 - Fixed-price contracts.

    Science.gov (United States)

    2010-10-01

    ... contractor shall use a commercial bill of lading and be reimbursed for the direct and actual transportation cost as a separate item in the invoice. The clause at 52.247-1, Commercial Bill of Lading Notations, will ensure that the Government in this type of arrangement obtains the benefit of 49 U.S.C. 10721...

  19. Peer Relations of Bullies, Bully-Victims, and Victims: The Two Social Worlds of Bullying in Second-Grade Classrooms

    Science.gov (United States)

    Farmer, Thomas W.; Petrin, Robert A.; Robertson, Dylan L.; Fraser, Mark W.; Hall, Cristin M.; Day, Steven H.; Dadisman, Kimberly

    2010-01-01

    This study examined the social relations of bullies, victims, and bully-victims in second-grade classrooms. Bully-victims are identified as both bullies and victims. The sample consisted of 537 ethnically diverse second-grade students (247 boys, 290 girls) from 37 classrooms across 11 participating schools. Bullies, bully-victims, and victims…

  20. 75 FR 49938 - Proposed Collection; Comment Request; NIH NCI Central Institutional Review Board (CIRB...

    Science.gov (United States)

    2010-08-16

    ... Review (FR) 1450 1 10/60 (.17 hour)......... 247 Acceptance Form (Attachment 2L). Participants Study... requested to serve as a reviewer for a study. CIRB helpdesk surveys measure satisfaction of helpdesk users and is conducted occasionally or each time the person contacts the helpdesk. Frequency of...

  1. The Properties of Large Amplitude Whistler Mode Waves in the Magnetosphere: Propagation and Relationship with Geomagnetic Activity

    Science.gov (United States)

    Wilson, L. B., III; Cattell, C. A.; Kellogg, P. J.; Wygant, J. R.; Goetz, K.; Breneman, A.; Kersten, K.

    2011-01-01

    Wepresent resultsof a studyof the characteristicsof very large amplitude whistler mode waves inside the terrestrial magnetosphere at radial distances of less than 15 RE using waveform capture data from the Wind spacecraft. We observed 247 whistler mode waves with at least one electric field component (105/247 had !80 mV/m peak!to!peak amplitudes) and 66 whistler mode waves with at least one search coil magnetic field component (38/66 had !0.8 nT peak!to!peak amplitudes). Wave vectors determined from events with three magnetic field components indicate that 30/46 propagate within 20 of the ambient magnetic field, though some are more oblique (up to "50 ). No relationship was observed between wave normal angle and GSM latitude. 162/247 of the large amplitude whistler mode waves were observed during magnetically active periods (AE > 200 nT). 217 out of 247 total whistler mode waves examined were observed inside the radiation belts. We present a waveform capture with the largest whistler wave magnetic field amplitude (^8 nT peak!to!peak) ever reported in the radiation belts. The estimated Poynting flux magnitude associated with this wave is ^300 mW/m2, roughly four orders of magnitude above estimates from previous satellite measurements. Such large Poynting flux values are consistent with rapid energization of electrons.

  2. 75 FR 76022 - Agency Information Collection Activities: Cost Submission

    Science.gov (United States)

    2010-12-07

    ... published in the Federal Register (75 FR 57284) on September 20, 2010, allowing for a 60-day comment period... SECURITY Customs and Border Protection Agency Information Collection Activities: Cost Submission AGENCY: U... approval in accordance with the Paperwork Reduction Act: Cost Submission (CBP Form 247). This is a...

  3. Calculating foraging area using gloal navigation satellite system (GNSS) technology

    Science.gov (United States)

    Adjusting stocking rate to changing forage conditions is a critical part of pro-active range management. In general stocking rate approaches tend to assume more optimal landscape use patterns than will actually occur. Today we can monitor spatio-temporal landscape use on a 24/7 basis using animals...

  4. File list: Pol.Epd.50.RNA_polymerase_II.AllCell [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available Pol.Epd.50.RNA_polymerase_II.AllCell hg19 RNA polymerase RNA polymerase II Epidermi...247,SRX080162,SRX807622 http://dbarchive.biosciencedbc.jp/kyushu-u/hg19/assembled/Pol.Epd.50.RNA_polymerase_II.AllCell.bed ...

  5. Introduction to the special section: Designing a better user experience for self-service systems

    NARCIS (Netherlands)

    Geest, van der T.M.; Ramey, J.; Rosenbaum, S.; Velsen, van L.S.

    2013-01-01

    June 2013 issue of IEEE Transactions on Professional Communication features a special section on 'Designing a Better User Experience for Self-Service Systems'. Self-service systems offers the users the benefit of 24/7 access to an ever-growing range of services and perhaps also a strong sense of aut

  6. 7 CFR 2003.22 - Functional organization of RUS.

    Science.gov (United States)

    2010-01-01

    ... Administrator. According to 7 CFR 2.47, the Administrator has responsibility for managing and administering the... 7 Agriculture 15 2010-01-01 2010-01-01 false Functional organization of RUS. 2003.22 Section 2003... Area § 2003.22 Functional organization of RUS. (a) General. The Secretary established RUS pursuant...

  7. Mobile Learning: At the Tipping Point

    Science.gov (United States)

    Franklin, Teresa

    2011-01-01

    Mobile technologies are interfacing with all aspects of our lives including Web 2.0 tools and applications, immersive virtual world environments, and online environments to present educational opportunities for 24/7 learning at the learner's discretion. Mobile devices are allowing educators to build new community learning ecosystems for and by…

  8. 75 FR 11154 - Marseilles Land and Water Company; Notice of Application Ready for Environmental Analysis and...

    Science.gov (United States)

    2010-03-10

    ... Energy Regulatory Commission Marseilles Land and Water Company; Notice of Application Ready for...-13351-000. c. Date filed: December 30, 2008. d. Applicant: Marseilles Land and Water Company. e. Name of... President, Marseilles Land & Water Company, 4132 S. Rainbow Blvd., 247, Las Vegas, NV 89103, (702)...

  9. 75 FR 142 - Marseilles Land and Water Company; Notice Soliciting Scoping Comments

    Science.gov (United States)

    2010-01-04

    ... Energy Regulatory Commission Marseilles Land and Water Company; Notice Soliciting Scoping Comments... No.: P-13351-000. c. Date filed: December 30, 2008. d. Applicant: Marseilles Land and Water Company... and Vice President, Marseilles Land & Water Company, 4132 S. Rainbow Blvd., 247, Las Vegas, NV...

  10. Gclust Server: 141414 [Gclust Server

    Lifescience Database Archive (English)

    Full Text Available 141414 NpunA_pNPAF087 Cluster Sequences - 247 - 1 1.00e-99 0.0 0.0 4.0 0.0 0.0 0.0 Show 141414... Cluster ID 141414 Sequence ID NpunA_pNPAF087 Link to cluster sequences Cluster Sequences Link to

  11. Different for Girls? An Exploration of the Impact of "Playing for Success."

    Science.gov (United States)

    Sharp, Caroline; Kendall, Lesley; Schagen, Ian

    2003-01-01

    A program providing study support to underachieving youth using British football as a motivator was evaluated by comparing 1,247 participants and 244 controls. The program helped raise achievement and seemed equally effective for males and females. There was no evidence that the sports emphasis marginalized girls or ethnic minorities. (Contains 25…

  12. Dicty_cDB: CFG349 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available its) Value N AF305060 |AF305060.1 Dictyostelium discoideum Wiscott-Aldrich syndrome protein (wasA) gene, com...060_1( AF305060 |pid:none) Dictyostelium discoideum Wiscott-A... 247 4e-64 DQ985464_1( DQ985464 |pid:none) S

  13. Multimodal Surveillance: Behavior analysis for recognizing stress and aggression

    NARCIS (Netherlands)

    Lefter, I.

    2014-01-01

    Nowadays, camera systems are installed in military areas as well as in public spaces like schools, shopping malls, airports, and football stadiums. Human operators are monitoring the screens, looking for any signs of unwanted behavior and negative incidents. The task requires working personnel 24/7.

  14. Incidence of inguinal hernia in children with congenital cerebral palsy

    DEFF Research Database (Denmark)

    Reimers, J I; Latocha, J E

    1990-01-01

    The incidence of inguinal hernia among 247 children with cerebral palsy was ascertained. During the first year of life, 20 of the 153 boys developed hernia, as did one of the 94 girls. Among boys with birthweights of 1000 to 2000g the incidence was 31 per cent, which is twice the rate for normal...

  15. Sleep Disturbances and Glucose Homeostasis

    NARCIS (Netherlands)

    Barf, R. Paulien; Scheurink, Anton J.W.

    2011-01-01

    Sleep disturbances, induced by either lifestyle, shift work or sleeping disorders, have become more prevalent in our 24/7 Western society. Sleep disturbances are associated with impaired health including metabolic diseases such as obesity and type 2 diabetes. The question remains whether there is a

  16. Health and Quality of Life in Northern Plains Indians

    Science.gov (United States)

    Quality of life and standard of living are consistently depicted as indigent among American Indian and Alaska Native (AI/AN) populations. American Indians (AI) are among the most heterogeneous and impoverished ethnic groups in the U.S.,have the highest per capita suicide rate at 247% of the national...

  17. Gender Differences in Academic Self-Efficacy: A Meta-Analysis

    Science.gov (United States)

    Huang, Chiungjung

    2013-01-01

    A meta-analysis of 187 studies containing 247 independent studies (N = 68,429) on gender differences in academic self-efficacy identified an overall effect size of 0.08, with a small difference favoring males. Moderator analysis demonstrated that content domain was a significant moderator in explaining effect size variation. Females displayed…

  18. 24 CFR 886.127 - Lease requirements.

    Science.gov (United States)

    2010-04-01

    ... the tenancy for “other good cause” under 24 CFR 247.3(a)(3), unless the termination is based on family... 24 Housing and Urban Development 4 2010-04-01 2010-04-01 false Lease requirements. 886.127 Section... for Projects With HUD-Insured and HUD-Held Mortgages § 886.127 Lease requirements. (a) Term of...

  19. 24 CFR 886.327 - Lease requirements.

    Science.gov (United States)

    2010-04-01

    ... tenancy for “other good cause” under 24 CFR 247.3(a)(3), unless the termination is based on family... 24 Housing and Urban Development 4 2010-04-01 2010-04-01 false Lease requirements. 886.327 Section... Program for the Disposition of HUD-Owned Projects § 886.327 Lease requirements. (a) Term of lease. (1)...

  20. Determinant of Mobile Devices Acceptance for Learning among Students in Developing Country

    Science.gov (United States)

    Tajudeen, Shittu Ahmed; Basha, Madarsha Kamal; Michael, Fakomogbon O.; Mukthar, Alhaji Liman

    2013-01-01

    This study was conducted to understand the determinant of mobile devices for learning among students in the developing world. A sample of 247 undergraduate students from Malaysia and Nigeria were involved in the study. An adapted but modified survey instrument was used to gather the data of the study. The variable of the study are perceived…

  1. 32 CFR 246.1 - Purpose.

    Science.gov (United States)

    2010-07-01

    ... establish and maintain a S&S board of directors to address S&S business operations in their Unified Commands. ... STRIPES (S&S) NEWSPAPER AND BUSINESS OPERATIONS § 246.1 Purpose. This part: (a) Establishes policy... Commands consistent with 32 CFR part 372. (b) Supersedes policies and procedures in 32 CFR part 247...

  2. Propuesta de implantación de ITIL en GXI S.A.

    OpenAIRE

    Aguilar, Marc; García, Eduardo; Navarro, Javier; Sàmper Marbà, Joel

    2006-01-01

    Implantamos un sistema de gestion de redes y servicios de una empresa de seguros. Tras analizar la situacion de la empresa, nuestro departamento especifica un servicio de help desk, gestion de incidencias estructurada en 4 niveles con servicio 24/7, gestion de problemas y gestion de cambios; todo ello basado en ITIL.

  3. Date Violence and Date Rape among Adolescents: Associations with Disordered Eating Behaviors and Psychological Health.

    Science.gov (United States)

    Ackard, Diann M.; Neumark-Sztainer, Dianne

    2002-01-01

    A study assessed prevalence of date violence and rape in 81,247 adolescents. Approximately 9% of girls and 6% of boys had experienced date violence or rape. Date violence and rape was associated with higher rates of disordered eating behaviors and suicidal thoughts and attempts, and lower emotional well-being and self-esteem. (Contains…

  4. Phenotypic and genetic variation in two North American arctic charr (Salvelinus alpinus) stocks cultured in recirculating aquaculture systems

    Science.gov (United States)

    Arctic charr were obtained as eggs from two North American sources, an eastern (Fraser River, Canada) and a western (Bristol Bay, Alaska) stock. Fish from each family (n=38) were pit tagged at approximately 12 months post-hatch (eastern mean+SE=247+/-13g, western mean+SE=220+/-g) and stocked commun...

  5. Network Monitoring with Zabbix

    OpenAIRE

    Shokhin, Anatolii

    2015-01-01

    Network monitoring became an essential part of any network size. It brings monitoring of network components 24/7. This provides clarity and transparency of network infrastructure and performance. With on time alert notification, network administrator may start failure troubleshooting immediately. As a result, end users may not even notice the issue.

  6. 7 CFR 2902.17 - Plastic insulating foam for residential and commercial construction.

    Science.gov (United States)

    2010-01-01

    ... Comprehensive Procurement Guideline, 40 CFR 247.12. EPA provides recovered materials content recommendations for... 7 Agriculture 15 2010-01-01 2010-01-01 false Plastic insulating foam for residential and... BIOBASED PRODUCTS FOR FEDERAL PROCUREMENT Designated Items § 2902.17 Plastic insulating foam...

  7. Predictors of Science Subject Discipline Identities: A Statistical Analysis

    Science.gov (United States)

    Nieswandt, Martina; Barrett, Sarah E.; McEneaney, Elizabeth H.

    2013-01-01

    This quantitative study (n = 247) explores whether preservice science teachers express science-specific identities that reflect multiple areas of their beliefs (e.g., purpose for science teaching, inclusion of science-technology-society-environment issues into science teaching, and nature of science) as well as other individual characteristics…

  8. Fluorinated Polyurethanes, Synthesis and Properties.

    Science.gov (United States)

    Smirnova, Olga; Glazkov, Alexey; Yarosh, Alexander; Sakharov, Alexey

    2016-01-01

    Fluorinated polyurethanes with a glass transition temperature as low as -139 °C and a decomposition onset temperature of 247-330 °C were prepared by a reaction of fluorinated alcohols with aromatic and cycloaliphatic diisocyanates in solution or melt. PMID:27420039

  9. What to Do about Being Overwhelmed: Graduate Students, Stress and University Services

    Science.gov (United States)

    Oswalt, Sara B.; Riddock, Christina C.

    2007-01-01

    Few studies have examined graduate students and stress. At a large, Southeastern university, 223 graduate students completed a survey about factors contributing their stress, current coping strategies and related university services. A majority felt stressed (48.9%) or very stressed (24.7%). There were significant differences in coping strategies…

  10. Discovery of a transient U-band dropout in a Lyman break survey : A tidally disrupted star at z=3.3?

    NARCIS (Netherlands)

    Stern, D; van Dokkum, PG; Nugent, P; Sand, DJ; Ellis, RS; Sullivan, M; Bloom, JS; Frail, DA; Kneib, JP; Koopmans, LVE; Treu, T

    2004-01-01

    We report the discovery of a transient source in the central regions of galaxy cluster A267. The object, which we call "PALS-1,'' was found in a survey aimed at identifying highly magnified Lyman break galaxies in the fields of intervening rich clusters. At discovery, the source had U(n)>24.7 (2 sig

  11. 38 CFR 21.3333 - Rates.

    Science.gov (United States)

    2010-07-01

    ... $860.00 If costs for tuition and fees average in excess of $268.00 per month, rate may be increased by... charges Special restorative training $788.00 If costs for tuition and fees average in excess of $247.00... Monthly rate Accelerated charges Special restorative training $803.00 If costs for tuition and...

  12. The Relation between Different Facets of Creativity and the Dark Side of Personality

    Science.gov (United States)

    Dahmen-Wassenberg, Phoebe; Kämmerle, Monika; Unterrainer, Human-Friedrich; Fink, Andreas

    2016-01-01

    This study examined the relation between different facets of creativity and personality, focusing on the dark side of personality. In a sample of 247 students, psychometric measures for the assessment of the dark triad of personality (subclinical narcissism, Machiavellianism, subclinical psychopathy), personality organization (structural deficit:…

  13. 76 FR 61279 - Defense Federal Acquisition Regulation Supplement; Defense Cargo Riding Gang Member (DFARS Case...

    Science.gov (United States)

    2011-10-04

    ... published an interim rule at 75 FR 65437 on October 25, 2010, to implement section 3504 of the National..., 247, and 252, which was published at 75 FR 65437 on October 25, 2010, is adopted as a final rule with... Acquisition Regulation Supplement; Defense Cargo Riding Gang Member (DFARS Case 2007-D002) AGENCY:...

  14. Unrecognized circulation of SAT 1 foot-and-mouth disease virus in cattle herds around Queen Elizabeth National Park in Uganda

    DEFF Research Database (Denmark)

    Dhikusooka, Moses Tefula; Ayebazibwe, Chrisostom; Namatovu, Alice;

    2016-01-01

    understand the epidemiology of FMD at the livestock-wildlife-interface, samples were collected from young, unvaccinated cattle from 24 pastoral herds that closely interact with wildlife around Queen Elizabeth National Park in Uganda, and analysed for evidence of FMDV infection. In total, 37 (15 %) of 247...

  15. Innovative collection development for e-books at the TU Delft Library

    NARCIS (Netherlands)

    Brinkman Dzwig, Z.E.

    2013-01-01

    Thanks to new technologies libraries worldwide go digital and are accessible 24/7 from remote locations. The innovation is even more visible in traditional library tasks such as collection development and acquisitions. Those tasks are undergoing rapid transformation as well. One of the reasons is t

  16. Thought-Experiments about Gravity in the History of Science and in Research into Children's Thinking

    Science.gov (United States)

    Blown, E. J.; Bryce, T. G. K.

    2013-01-01

    This article examines the main strands of thinking about gravity through the ages and the continuity of thought-experiments, from the early Greeks, through medieval times, to Galileo, Newton and Einstein. The key ideas are used to contextualise an empirical study of 247 children's ideas about falling objects carried out in China and New Zealand,…

  17. EST Table: FS914333 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available FS914333 E_FL_fufe_31P15_F_0 10/09/28 83 %/247 aa ref|NP_001040506.1| bmp-2 protein... [Bombyx mori] gb|ABF60228.1| bmp-2 [Bombyx mori] 10/09/12 low homology 10/08/29 n.h 10/09/10 42 %/150 aa AG

  18. EST Table: FS918053 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available FS918053 E_FL_fufe_43C23_F_0 10/09/28 83 %/247 aa ref|NP_001040506.1| bmp-2 protein... [Bombyx mori] gb|ABF60228.1| bmp-2 [Bombyx mori] 10/09/12 low homology 10/08/29 n.h 10/09/10 42 %/150 aa AG

  19. Drug: D01426 [KEGG MEDICUS

    Lifescience Database Archive (English)

    Full Text Available 0627 247.2715 D01426.gif Antiprotozoal [DS:H00812] Therapeutic category: 2529 6419 ATC code: J01XD02 P01AB02...P/INN) 6 Agents against pathologic organisms and parasites 64 Parasitics (systemic) 641 Antiprotozoans 6419 ...nidazole (JP16/USP/INN) Antiinfectives [BR:br08307] Antiparasitics Agents against Amebiasis and other antiprotozoa

  20. Disease: H00142 [KEGG MEDICUS

    Lifescience Database Archive (English)

    Full Text Available I: a 10-year follow-up study. J Neurol Sci 247:65-9 (2006) PMID:19568825 Caciotti A, Di Rocco M, Filocamo M...u RK, Ro LS, Chang HS First report of two Taiwanese siblings with sialidosis type

  1. The use of the psychological contract to explain self-perceived employability

    NARCIS (Netherlands)

    Sok, J.; Blomme, R.J.; Tromp, D.M.

    2013-01-01

    This study examines the relationship between the psychological contract and self-perceived employability (intra-organizational mobility intentions, employee development and perceived labor market opportunities). A survey was completed by 247 alumni of the Hotelschool The Hague, a hotel management sc

  2. Written on the Writer's Face: Facial Width-to-Height Ratio among Nominees and Laureates of the Nobel Prize in Literature

    Science.gov (United States)

    Lebuda, Izabela; Karwowski, Maciej

    2016-01-01

    This study examined the relationship between facial width-to-height ratio (fWHR), an established marker of testosterone level and dominance, and eminent writers' achievement. The fWHR of laureates (N = 39) and nominees (N = 247) of the Nobel Prize in Literature 1901-1950 was measured together with historiometric data. It was demonstrated that…

  3. 40 CFR 63.775 - Reporting requirements.

    Science.gov (United States)

    2010-07-01

    ... requirements specified in 40 CFR 61.247, except that the Periodic Reports shall be submitted on the schedule... 40 Protection of Environment 10 2010-07-01 2010-07-01 false Reporting requirements. 63.775 Section 63.775 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) AIR PROGRAMS...

  4. Meta-Analysis of Correlations Among Usability Measures

    DEFF Research Database (Denmark)

    Hornbæk, Kasper Anders Søren; Effie Lai Chong, Law

    2007-01-01

    are generally low: effectiveness measures (e.g., errors) and efficiency measures (e.g., time) has a correlation of .247 ± .059 (Pearson's product-moment correlation with 95% confidence interval), efficiency and satisfaction (e.g., preference) one of .196 ± .064, and effectiveness and satisfaction one of .164...

  5. 7 CFR 2902.28 - Stationary equipment hydraulic fluids.

    Science.gov (United States)

    2010-01-01

    ... designation can be found in the Comprehensive Procurement Guideline, 40 CFR 247.11. EPA provides recovered... 7 Agriculture 15 2010-01-01 2010-01-01 false Stationary equipment hydraulic fluids. 2902.28... PROCUREMENT Designated Items § 2902.28 Stationary equipment hydraulic fluids. (a) Definition....

  6. 7 CFR 2902.10 - Mobile equipment hydraulic fluids.

    Science.gov (United States)

    2010-01-01

    ... Comprehensive Procurement Guideline, 40 CFR 247.11. ... 7 Agriculture 15 2010-01-01 2010-01-01 false Mobile equipment hydraulic fluids. 2902.10 Section... PROCUREMENT Designated Items § 2902.10 Mobile equipment hydraulic fluids. (a) Definition. Hydraulic...

  7. Speciallægen er ikke i front på de danske akutafdelinger (The use of consultants in the Emergency Department)

    DEFF Research Database (Denmark)

    Mackenhauer, Julie; Møller, Marianne Cecilie Markvard; Fjældstad, Alexander;

    2013-01-01

    are not staffed by consultants 24/7, 51% report difficulties in recruiting qualified personnel and 33% report problems connected to retaining them. 71% believe that a specialty in emergency medicine could help solve these problems. Danish EDs do not comply with the visions of the reorganisation plan....

  8. 50 CFR 216.3 - Definitions.

    Science.gov (United States)

    2010-10-01

    ... to the labeling requirements of 50 CFR part 247 and that only contain fish harvested by vessels of... vessel operator's or vessel owner's control that could not be avoided by the exercise of due care. FSA... enrolled in the Metlaktla Indian Community), Eskimo, or Aleut blood or combination thereof. The...

  9. 7 CFR 2902.27 - Films.

    Science.gov (United States)

    2010-01-01

    ... Comprehensive Procurement Guideline, 40 CFR 247.16. EPA provides recovered materials content recommendations for... 7 Agriculture 15 2010-01-01 2010-01-01 false Films. 2902.27 Section 2902.27 Agriculture... Films. (a) Definition. (1) Products that are used in packaging, wrappings, linings, and other...

  10. 7 CFR 2902.21 - Disposable containers.

    Science.gov (United States)

    2010-01-01

    ... Guideline, 40 CFR 247.10. EPA provides recovered materials content recommendations for paper and paper... 7 Agriculture 15 2010-01-01 2010-01-01 false Disposable containers. 2902.21 Section 2902.21... Items § 2902.21 Disposable containers. (a) Definition. Products designed to be used for...

  11. Carbon isotope systematics of individual hydrocarbons in hydrothermal petroleum from Escanaba Trough, northeastern Pacific Ocean.

    Science.gov (United States)

    Simoneit, B R; Schoell, M; Kvenvolden, K A

    1997-01-01

    We submitted individual aliphatic and polycyclic aromatic hydrocarbons in samples of hydrothermal petroleum from Escanaba Trough to compound specific isotope analysis to trace their origins. The carbon isotope compositions of the alkanes and polycyclic aromatic hydrocarbons (means -27.5 and -24.7%, respectively) reflect a primarily terrestrial organic matter source. PMID:11541391

  12. Perceptions of Retirement Affect Career Commitment: The Mediating Role of Retirement System Satisfaction for Two Teacher Age Groups

    Science.gov (United States)

    Smith, Justin L.; Conley, Sharon; You, Sukkyung

    2015-01-01

    This study investigated a sample of California elementary, intermediate, and high school employed teachers (N = 247) to assess the effects of retirement perceptions on career commitment among teachers who are in different age groupings. Using path analysis, the influence of five retirement perceptions variables was examined: concerns about…

  13. Cyber Worlds: New Playgrounds for Bullying

    Science.gov (United States)

    Mark, Lauren; Ratliffe, Katherine T.

    2011-01-01

    The experiences of 247 middle school children around cyberbullying were examined through in-class questionnaires. Their use of different media, their experiences with cyberbullying, and the relationships among school type, gender, and grade level were analyzed. Of the students in this sample 33% of female and 20% of male students reported being a…

  14. NATIONAL CHILD ABUSE AND NEGLECT DATA SYSTEM (NCANDS)

    Science.gov (United States)

    NCANDS collects data on child maltreatment from the States. It was developed in response to the Child Abuse Prevention and Treatment Act (Public Law 93-247), as amended, which called for the creation of a coordinated national data collection and analysis program, both universal a...

  15. Lost in transition: Media innovations in the Netherlands

    NARCIS (Netherlands)

    M.C. van Kerkhoven

    2016-01-01

    Original news production is a costly business. News production that lives up to a high quality standard has become even costlier. Due to a new attitude of both news consumers and advertisers - people living in the media, with its 24/7 online free news environments, rather than with the media - most

  16. Ubiquitous Versus One-to-One

    Science.gov (United States)

    McAnear, Anita

    2006-01-01

    When we planned the editorial calendar with the topic ubiquitous computing, we were thinking of ubiquitous computing as the one-to-one ratio of computers to students and teachers and 24/7 access to electronic resources. At the time, we were aware that ubiquitous computing in the computer science field had more to do with wearable computers. Our…

  17. Physical activity energy expenditure and sarcopenia in black South African urban women

    NARCIS (Netherlands)

    Kruger, Herculina S.; Havemann-Nel, Lize; Ravyse, Chrisna; Moss, Sarah J.; Tieland, Michael

    2016-01-01

    Background: Black women are believed to be genetically less predisposed to age-related sarcopenia. The objective of this study was to investigate lifestyle factors associated with sarcopenia in black South African (SA) urban women. Methods: In a cross-sectional study, 247 women (mean age 57 y) we

  18. Corganiser: a web-based software tool for planning time-sensitive sampling of whole rounds during scientific drilling

    DEFF Research Database (Denmark)

    Marshall, Ian

    2014-01-01

    with a wide range of core and section configurations and can thus be used in future drilling projects. Corganiser is written in the Python programming language and is implemented both as a graphical web interface and command-line interface. It can be accessed online at http://130.226.247.137/....

  19. Fluorinated Polyurethanes, Synthesis and Properties

    Directory of Open Access Journals (Sweden)

    Olga Smirnova

    2016-07-01

    Full Text Available Fluorinated polyurethanes with a glass transition temperature as low as −139 °C and a decomposition onset temperature of 247–330 °C were prepared by a reaction of fluorinated alcohols with aromatic and cycloaliphatic diisocyanates in solution or melt.

  20. Fluorinated Polyurethanes, Synthesis and Properties.

    Science.gov (United States)

    Smirnova, Olga; Glazkov, Alexey; Yarosh, Alexander; Sakharov, Alexey

    2016-07-12

    Fluorinated polyurethanes with a glass transition temperature as low as -139 °C and a decomposition onset temperature of 247-330 °C were prepared by a reaction of fluorinated alcohols with aromatic and cycloaliphatic diisocyanates in solution or melt.

  1. Team Sports Achievement and Self-Esteem Development among Urban Adolescent Girls

    Science.gov (United States)

    Pedersen, Sara; Seidman, Edward

    2004-01-01

    In this study we investigate the contribution of achievement in team sports to adolescent girls' self-esteem development. Adolescent girls (N = 247) from racially and ethnically diverse backgrounds were surveyed as part of a larger study investigating the development of poor urban youth. Participants responded to items tapping global self-esteem,…

  2. Math-Gender Stereotypes in Elementary School Children

    Science.gov (United States)

    Cvencek, Dario; Meltzoff, Andrew N.; Greenwald, Anthony G.

    2011-01-01

    A total of 247 American children between 6 and 10 years of age (126 girls and 121 boys) completed Implicit Association Tests and explicit self-report measures assessing the association of (a) "me" with "male" (gender identity), (b) "male" with "math" (math-gender stereotype), and (c) "me" with "math" (math self-concept). Two findings emerged.…

  3. Pain phenotype as a predictor for drug response in painful polyneuropathy A retrospective analysis of data from controlled clinical trials

    DEFF Research Database (Denmark)

    Holbech, Jakob V; Bach, Flemming W; Finnerup, Nanna B;

    2016-01-01

    better effect in patients with preserved large fiber function with a mean difference in total pain reduction 1.31 (CI: 0.15 to 2.47). No phenotype-specific effects were found for venlafaxine, escitalopram, oxcarbazepine, valproic acid, levetiracetam or St. john's wort. Thus, this post-hoc analysis of 8...

  4. Paternity testing with VNTR DNA systems. I. Matching criteria and population frequencies of the VNTR systems D2S44, D5S43, D7S21, D7S22, and D12S11 in Danes

    DEFF Research Database (Denmark)

    Morling, N; Hansen, Hanna Elsebeth

    1993-01-01

    of the putative father as an exclusion in paternity testing. This matching criterion was used for the comparisons of 1,197 DNA fragment differences in 247 pairs of children and putative fathers who had not been excluded by conventional marker systems. In all of these cases, the migration differences between...

  5. Gestational Alcohol Exposure and Other Factors Associated with Continued Teenage Drinking

    Science.gov (United States)

    Cornelius, Marie D.; Goldschmidt, Lidush; Day, Nancy L.

    2016-01-01

    Purpose: A longitudinal cohort of adolescents who initiated drinking before age 15 were studied to determine which factors distinguished between early initiators who continued to drink (persisters) from those who stopped drinking (desisters). There were 308 early initiators in the total sample (n = 917); 247 were persisters, and 61 were desisters.…

  6. Drug: D01159 [KEGG MEDICUS

    Lifescience Database Archive (English)

    Full Text Available tic category of drugs in Japan [BR:br08301] 2 Agents affecting individual organs 24 Hormones 247 Estrogen an...G03DA01] D01159 Gestonorone caproate (JAN/USAN) Antineoplastics [BR:br08308] Hormones and hormone antagonist

  7. Drug: D00554 [KEGG MEDICUS

    Lifescience Database Archive (English)

    Full Text Available an [BR:br08301] 2 Agents affecting individual organs 24 Hormones 247 Estrogen and progesterone preparations ...USP drug classification [BR:br08302] Hormonal Agents, Stimulant/Replacement/Modifying (Sex Hormones/Modifier...ntineoplastics [BR:br08308] Hormones and hormone antagonist Estrogen Ethinylestradiol [ATC:L02AA03] D00554 E

  8. Drug: D00182 [KEGG MEDICUS

    Lifescience Database Archive (English)

    Full Text Available drugs in Japan [BR:br08301] 2 Agents affecting individual organs 24 Hormones 247 Estrogen and progesterone p...P) USP drug classification [BR:br08302] Hormonal Agents, Stimulant/Replacement/Modifying (Sex Hormones/Modif

  9. The Distribution of Dropout and Turnover Rates among Urban and Suburban High Schools.

    Science.gov (United States)

    Rumberger, Russell W.; Thomas, Scott L.

    2000-01-01

    Examines the distribution of dropout and turnover rates among 247 U.S. urban and suburban high schools to study school effectiveness. Finds that dropout and turnover rates can be attributed to student background, student composition, school resources, and school processes. (Contains references.) (CMK)

  10. The Parallel Information Universe

    Science.gov (United States)

    Eisenberg, Mike

    2008-01-01

    The Web 2.0 "buzz" starts with new technologies such as virtual worlds, cell phones and handheld devices that offer 24/7 web access, tagging, social networks, and blogs and brings together various web capabilities in unique combinations. Web 2.0, however, is about much more than the technology--it is about a change in focus to participation, user…

  11. Thinking Styles and Preferred Teacher Interpersonal Behavior among Hong Kong Students

    Science.gov (United States)

    Yu, Tak-ming; Chen, Chen

    2012-01-01

    This study investigated the relationship between thinking styles and preferred teacher interpersonal behavior based on the Model for Interpersonal Teacher Behavior (MITB, Wubbels, Creton, & Hooymayers, 1985) among 247 Hong Kong secondary school female students. The Thinking Style Inventory Revised (TSI-R, Sternberg, Wagner, & Zhang, 2003) and the…

  12. Moving the Law School into the Twenty-First Century--Embedding Technology into Teaching and Learning

    Science.gov (United States)

    Steventon, Beverley; Panesar, Sukhninder; Wood, Jane

    2014-01-01

    Over the past twenty years phenomenal developments in technology have changed the nature of education. Students now have access to a vast range of resources 24/7. This instant access has created a certain expectation on the part of the student and there must now be very few, if any, courses taught in higher education where the lecturer does not…

  13. The Erd(o)s-Sós Conjecture for Graphs Whose Complements Contain No C4

    Institute of Scientific and Technical Information of China (English)

    Jian-hua Yin; Jiong-sheng Li

    2004-01-01

    Erd(o)s and Sós conjectured in 1963 (see [1], Problem 12 in 247) that every graph G on n vertices with size e(G) > 12 n(k - 1) contains every tree T of size k. In this paper, we prove the conjecture for graphs whose complements contain no cycles of length 4.

  14. 75 FR 22611 - Renewal of Agency Information Collection for Acquisition of Trust Land; Request for Comments

    Science.gov (United States)

    2010-04-29

    ... Services, 316 N. 26th Street, Billings, MT 59601; facsimile: (406) 247- 7991; e-mail: Darryl.LaCounte@bia..., Billings, MT 59601, during the hours of 9 a.m.-5 p.m., Local Time, Monday through Friday except for legal... renewal of this information collection on February 18, 2010. See 75 FR 7285. Two commenters responded...

  15. 75 FR 1616 - Post-2010 Resource Pool, Pick-Sloan Missouri Basin Program-Eastern Division

    Science.gov (United States)

    2010-01-12

    ... Administration, 2900 4th Avenue North, Billings, MT 59101-1266. FOR FURTHER INFORMATION CONTACT: John A. Pankratz... Avenue North, Billings, MT 59101-1266, telephone (406) 247-7392, e-mail pankratz@wapa.gov . SUPPLEMENTARY... with the January 2011 billing period through the December 2020 billing period. DATES: The...

  16. Underneath Hypercapitalism

    Science.gov (United States)

    Luke, Allan

    2007-01-01

    As Joel Spring's (2007/this issue) description of Singapore's Orchard Road suggests, Benetton, Zara, Nike, BMW, LG, and Microsoft dominate the visual and textual landscape where signage, advertising, packaging, labeling, and the environments of the connected underground malls and walkways merge into a wall-to-wall, 24/7 print and visual…

  17. Good agreement of conventional and gel-based direct agglutination test in immune-mediated haemolytic anaemia

    NARCIS (Netherlands)

    Piek, C.J.; Teske, E.; van Leeuwen, M.W.; Day, M.J.

    2012-01-01

    Abstract Background The aim of this study was to compare a gel-based test with the traditional direct agglutination test (DAT) for the diagnosis of immune-mediated haemolytic anaemia (IMHA). Methods Canine (n = 247) and feline (n = 74) blood samples were submitted for DAT testing to two laboratories

  18. "Something's Gotta Give:" Advanced-Degree Seeking Women's Experiences of Sexism, Role Overload, and Psychological Distress

    Science.gov (United States)

    West, Lindsey M.

    2014-01-01

    With the rise in advanced-degree seeking women and the minimal research on the dual impact of sexism and role overload, the current study aims to better understand the impact of sexism and role overload on psychological distress in a particular sample of advanced-degree seeking women. Seventy-six female medical student participants (mean age 24.7)…

  19. 78 FR 61161 - Airworthiness Directives; The Boeing Company Airplanes

    Science.gov (United States)

    2013-10-03

    ...-247-AD; Amendment 39-17602; AD 2013-19-20] RIN 2120-AA64 Airworthiness Directives; The Boeing Company... new airworthiness directive (AD) for certain The Boeing Company Model DC-10-10 and MD-10-10F airplanes... MLG and consequent damage to airplane structure, which could adversely affect the airplane's...

  20. Teachers' Level of Awareness of 21st Century Occupational Roles in Rivers State Secondary Schools

    Science.gov (United States)

    Uche, Chineze M.; Kaegon, Leesi E. S. P.; Okata, Fanny Chiemezie

    2016-01-01

    This study investigated the teachers' level of awareness of 21st century occupational roles in Rivers state secondary schools. Three research questions and three hypotheses guided the study. The population of study comprised of 247 public secondary schools and 57 private secondary schools in Port Harcourt metropolis of Rivers state which gave a…

  1. 78 FR 803 - Revisions to Electric Reliability Organization Definition of Bulk Electric System and Rules of...

    Science.gov (United States)

    2013-01-04

    ... Procedure, Notice of Proposed Rulemaking, 77 FR 39857 (July 5, 2012) 139 FERC ] 61,247 (2012) (NOPR). I... to Electric Reliability Organization Definition of Bulk Electric System and Rules of Procedure; Final...; ] DEPARTMENT OF ENERGY Federal Energy Regulatory Commission 18 CFR Part 40 Revisions to Electric...

  2. Embedding Resilience within the Tertiary Curriculum: A Feasibility Study

    Science.gov (United States)

    Stallman, Helen M.

    2011-01-01

    Mental health problems can significantly impact on the ability of university students to both meet their individual potential and contribute positively within society. This study evaluates the feasibility of embedding a strength-focused resilience-building seminar within a university curriculum. Participants were 247 students enrolled in an…

  3. Reasoning about Family Honour among Two Generations of Hindu Indian-Americans

    Science.gov (United States)

    Kay, Adam

    2012-01-01

    To investigate reasoning about family honour, 128 first generation (mean age = 27.2 years) and second generation Hindu Indian-American adults (mean age = 24.7 years) were presented hypothetical scenarios in which male or female protagonists defied common Hindu customs (e.g., arranged marriage, intra-religion marriage and premarital sexual…

  4. Designing robots with care: creating an ethical framework for the future design and implementation of care robots

    NARCIS (Netherlands)

    Wynsberghe, van A.

    2012-01-01

    This book begins by highlighting the range of positive and negative aspects associated with the initiative to design and use care robots. The positive aspects vary from; the reality that care is required 24/7 and a human caregiver cannot possibly meet such a standard, the reality that patients are a

  5. Hand Hygiene Saves Lives

    Medline Plus

    Full Text Available ... or call 1-800-CDC-INFO, 24/7. File Formats Help: How do I view different file formats (PDF, DOC, PPT, MPEG) on this site? Adobe PDF file Microsoft PowerPoint file Microsoft Word file Microsoft Excel ...

  6. AcEST: DK955242 [AcEST

    Lifescience Database Archive (English)

    Full Text Available inase 1 OS=Arabidopsis ... 158 1e-38 sp|Q94B08|GCP1_ARATH Germination-specific cysteine protease 1 OS... 157...STGGLHKEDDYPYLM---EEGICQEQKEDVER-VTI 245 Query: 528 DG 533 G Sbjct: 246 SG 247 >sp|Q94B08|GCP1_ARATH Germination

  7. EST Table: FY016706 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available FY016706 rbmov17i21 11/12/09 n.h 11/11/04 45 %/247 aa ref|XP_970998.1| PREDICTED: similar to Evolution...1094187|ref|XP_970998.1| PREDICTED: similar to Evolutionarily conserved signaling intermediate in Toll pathway, mitochondrial [Tribolium castaneum] FY016706 bmov ...

  8. 76 FR 62835 - Notice of Inventory Completion: Fort Lewis College, Durango, CO

    Science.gov (United States)

    2011-10-11

    ... Anthropology, Fort Lewis College, 1000 Rim Dr., Durango, CO 81301, telephone (970) 247-7500. SUPPLEMENTARY... these groups. However, the body of evidence does not collectively support a common Ute and Puebloan..., Department of Anthropology, Fort Lewis College, 1000 Rim Dr., Durango, CO 81301, telephone (970)...

  9. FOLLOW-UP OF ASTHMA FROM CHILDHOOD TO ADULTHOOD - INFLUENCE OF POTENTIAL CHILDHOOD RISK-FACTORS ON THE OUTCOME OF PULMONARY-FUNCTION AND BRONCHIAL RESPONSIVENESS IN ADULTHOOD

    NARCIS (Netherlands)

    ROORDA, RJ; GERRITSEN, J; VANAALDEREN, WMC; SCHOUTEN, JP; VELTMAN, JC; WEISS, ST; KNOL, K

    1994-01-01

    The outcome of asthma in 406 children, aged 8 to 12 years, was studied. Follow-up in adulthood was 86%, with a mean age of 24.7 years and a mean interval of follow-up of 14.8 years. The predictive value of gender and various childhood variables on the adult level of pulmonary function (forced expira

  10. NCI launches smoking cessation support for teens

    Science.gov (United States)

    A new effort to help teens quit smoking will use one of today’s teen’s most constant companions—the mobile phone. Developed by smoking cessation experts, SmokefreeTXT is a free text message cessation service that provides 24/7 encouragement, advice, and

  11. 76 FR 3843 - Final Guidance for Federal Departments and Agencies on the Appropriate Use of Mitigation and...

    Science.gov (United States)

    2011-01-21

    ..., Establishing, Revising and Using Categorical Exclusions, 75 FR 75628, Dec. 6, 2010. In a Federal Register... Guidance for NEPA Mitigation and Monitoring, 75 FR 8046, Feb. 23, 2010. Mitigation Planning Some commenters... (NEPA), 42 U.S.C. 4344, and Executive Order No. 11,514, 35 FR 4,247 (Mar. 5, 1970), as amended...

  12. Preservice Teachers' Internet Addiction in Terms of Gender, Internet Access, Loneliness and Life Satisfaction

    Science.gov (United States)

    Demirer, Veysel; Bozoglan, Bahadir; Sahin, Ismail

    2013-01-01

    The aim of this study is to investigate pre-service teachers' Internet addiction in terms of gender, Internet accessibility, loneliness and life satisfaction. Statistical analyses were completed on the data by the 247 preservice teachers that filled the surveys completely. According to findings, pre-service teachers' level of loneliness and…

  13. Gas dynamic lasers (a bibliography with abstracts). Report for 1964-July 1979

    Energy Technology Data Exchange (ETDEWEB)

    Carrigan, B.

    1979-08-01

    The citations cover research on kinetic and energy transfer processes, design, optics, nozzles, and performance of gas and chemical lasers relying on gas dynamic effects for lasing enhancement. Diffusion and flow studies specifically applicable to such lasers are also included. (This updated bibliography contains 247 abstracts, 11 of which are new entries to the previous edition.)

  14. 24 CFR 886.328 - Termination of tenancy.

    Science.gov (United States)

    2010-04-01

    ... this title (24 CFR part 247) applies to the termination of tenancy and eviction of a family assisted.... For cases where domestic violence, dating violence, stalking, or criminal activity directly relating to domestic violence, dating violence, or stalking is involved or claimed to be involved,...

  15. Establishing Influential Decision Making Factors for University Library Opening Hours: An Exploratory UK Regional Study

    Science.gov (United States)

    Ravenwood, Clare; Stephens, Derek; Walton, Graham

    2015-01-01

    Many factors and pressures affect decisions made in UK university libraries on opening hours especially 24/7. This article reports on a project to examine the decision-making process, influential factors, and stakeholders. A workshop for senior library managers in the East Midlands was held to gather data and share experiences. From analysis of…

  16. 7 CFR 2902.19 - Composite panels.

    Science.gov (United States)

    2010-01-01

    .... The designation can be found in the Comprehensive Procurement Guideline, 40 CFR 247.12. EPA provides... 7 Agriculture 15 2010-01-01 2010-01-01 false Composite panels. 2902.19 Section 2902.19 Agriculture... Composite panels. (a) Definitions. (1) Plastic lumber composite panels. Engineered products suitable for...

  17. Muscular disease

    Institute of Scientific and Technical Information of China (English)

    2009-01-01

    2009252 Investigation on survival motor neuron gene deletion in Chinese patients with sporadic amyotrophic lateral sclerosis.SU Zongquan(苏宗权),et al.Dept Neurol,1st Affili Hosp,Fujian Med,Fuzhou 350005.Chin J Neurol,2009;42(4):245-247.

  18. IT lessons learnt from real time dike monitoring

    NARCIS (Netherlands)

    Vonder, M.R.; Waaij, B.D. van der

    2013-01-01

    The Dutch lowlands are protected by many kilometres of dikes. Currently these dikes are visually inspected on a regular basis. During heavy weather this frequency is raised, up to 24/7 in very extreme situations. After a dike failure at the Dutch town Wilnis in 2003, the question was raised whether

  19. Kunstiakadeemia uus õppehoone kõrgub õhuliselt vana maja kohale / Ants Juske, Mari Kodres

    Index Scriptorium Estoniae

    Juske, Ants, 1956-

    2008-01-01

    Eesti Kunstiakadeemia uue hoone arhitektuurivõistlusest ja võidutööst "Art Plaza"(Taani arhitektuuribüroo Effekt). Võistlustöödest "TLN247" (II koht), "Arts Factory" (III koht), "Public Section" (ergutuspreemia) ja "Sashimi" (ergutuspreemia)

  20. Download - GETDB | LSDB Archive [Life Science Database Archive metadata

    Lifescience Database Archive (English)

    Full Text Available r List) getdb_cluster.zip (56KB) Simple search and download 5 Expression image data of Drosophila GAL4 enhancer trap lines getdb_imag...es.zip (247MB) - Downlaod via FTP Joomla SEF URLs by Art

  1. Field-theoretic calculation of kinetic helicity flux

    Indian Academy of Sciences (India)

    V Avinash; Mahendra K Verma; Amar K Chandra

    2006-02-01

    In this paper we apply perturbative field-theoretic technique to helical turbulence. In the inertial range the kinetic helicity flux is found to be constant and forward. The universal constant H appearing in the spectrum of kinetic helicity was found to be 2.47.

  2. Euroclay 95. Clays and clay materials sciences. Book of abstracts

    International Nuclear Information System (INIS)

    The document contains the abstracts of the invited lecturers (18) and posters (247) presented at EUROCLAY '95. Clays and clay materials sciences. 13 items (4 from the invited lecturers and 12 from posters) have been considered within the INIS Subject Scope and indexed separately

  3. 75 FR 59329 - Reasonable Charges for Inpatient MS-DRGs and SNF Medical Services; 2011 Fiscal Year Update

    Science.gov (United States)

    2010-09-27

    ... Administration (VHA) Chief Business Office, currently at http://www1.va.gov/CBO/apps/rates/index.asp , under..., 2009 (74 FR 247). Based on the methodologies set forth in 38 CFR 17.101(b), this document provides an... Internet site of the VHA Chief Business Office, currently at...

  4. CLONING AND SEQUENCING OF THE GENE FOR A LACTOCOCCAL ENDOPEPTIDASE, AN ENZYME WITH SEQUENCE SIMILARITY TO MAMMALIAN ENKEPHALINASE

    NARCIS (Netherlands)

    Mierau, Igor; Tan, Paris S.T.; Haandrikman, Alfred J.; Kok, Jan; Leenhouts, Kees J.; Konings, Wil N.; Venema, Gerard

    1993-01-01

    The gene specifying an endopeptidase of Lactococcus lactis, named pepO, was cloned from a genomic library of L. lactis subsp. cremoris P8-247 in lambdaEMBL3 and was subsequently sequenced. pepO is probably the last gene of an operon encoding the binding-protein-dependent oligopeptide transport syste

  5. Identification of TMPRSS2 as a Susceptibility Gene for Severe 2009 Pandemic A(H1N1) Influenza and A(H7N9) Influenza

    NARCIS (Netherlands)

    Cheng, Zhongshan; Zhou, Jie; To, Kelvin Kai-Wang; Chu, Hin; Li, Cun; Wang, Dong; Yang, Dong; Zheng, Shufa; Hao, Ke; Bosse, Yohan; Obeidat, Ma'en; Brandsma, Corry-Anke; Song, You-Qiang; Chen, Yu; Zheng, Bo-Jian; Li, Lanjuan; Yuen, Kwok-Yung

    2015-01-01

    The genetic predisposition to severe A(H1N1) 2009 (A[H1N1]pdm09) influenza was evaluated in 409 patients, including 162 cases with severe infection and 247 controls with mild infection. We prioritized candidate variants based on the result of a pilot genome-wide association study and a lung expressi

  6. Do Antenatal and Postnatal Parental Psychological Distress, and Recognized Need of Help Predict Preadolescent's Psychiatric Symptoms? The Finnish Family Competence Cohort Study

    Science.gov (United States)

    Pihlakoski, Leena; Sourander, Andre; Aromaa, Minna; Ronning, John A.; Rautava, Paivi; Helenius, Hans; Sillanpaa, Matti

    2013-01-01

    In a prospective population-based study, mothers and fathers of 1,247 children reported their physical and mental health during pregnancy, after delivery, within the child's first 18 months of life, and at 12 years. Additionally, maternal health clinic nurses rated parents' well-being and perceived need for support. At age 12, child outcomes were…

  7. Vervangende toestemming tot verhuizing naar Finland

    NARCIS (Netherlands)

    A.J.M. Nuytinck (André)

    2013-01-01

    markdownabstract__Abstract__ In de onderhavige beschikking gaat de Hoge Raad in op de betekenis van het in artikel 1:247 lid 4 BW bedoelde gelijkwaardig ouderschap en op de vraag of op het uitgangspunt hiervan een uitzondering kan worden gemaakt.

  8. Improving Mathematics Learning of Kindergarten Students through Computer-Assisted Instruction

    Science.gov (United States)

    Foster, Matthew E.; Anthony, Jason L.; Clements, Doug H.; Sarama, Julie; Williams, Jeffrey M.

    2016-01-01

    This study evaluated the effects of a mathematics software program, the Building Blocks software suite, on young children's mathematics performance. Participants included 247 Kindergartners from 37 classrooms in 9 schools located in low-income communities. Children within classrooms were randomly assigned to receive 21 weeks of computer-assisted…

  9. Whole-body MRI in neurofibromatosis: incidental findings and prevalence of scoliosis

    Energy Technology Data Exchange (ETDEWEB)

    Jaremko, Jacob L.; MacMahon, Peter J.; Torriani, Martin; Bredella, Miriam A. [Massachusetts General Hospital and Harvard Medical School, Musculoskeletal Imaging and Intervention, Department of Radiology, Boston, MA (United States); Merker, Vanessa L.; Plotkin, Scott R. [Massachusetts General Hospital, Department of Neurology and Cancer Center, Boston, MA (United States); Mautner, Victor F. [University Medical Center Hamburg-Eppendorf, Department of Neurology, Hamburg (Germany)

    2012-08-15

    To demonstrate incidental findings and scoliosis on whole-body MRI (WBMRI) in patients with neurofibromatosis type 1 and 2 (NF1 and NF2, respectively), and schwannomatosis. Institutional review board approval and written informed consent were obtained for this prospective HIPAA-compliant study. A total of 247 subjects (141 with NF1, 55 with NF2, 51 with schwannomatosis; 132 women (53.5%); mean age, 41 years, range, 18-97 years) underwent WBMRI using coronal STIR (TR/TE: 4190/111 ms, TI: 150 ms) and T1-weighted images (TR/TE: 454/10 ms), 10-mm slice thickness, imaging time {proportional_to}40 min. Images were reviewed for the presence of incidental findings, outside of nerve sheath tumors. The presence of scoliosis was recorded and curve morphology was assessed and quantified. Incidental findings other than scoliosis were recorded in 104/247 (42%) patients, most often affecting the musculoskeletal system (65/247 patients, 26%). We found 16/247 (6.5%) significant incidental findings likely to affect clinical management, including avascular necrosis of bone in eight patients (five with NF2), eight insufficiency fractures, and four non-neurogenic neoplasms (Hodgkin's lymphoma, liposarcoma, dermoid cyst, large uterine myoma requiring excision). Scoliosis was seen in 50/247 patients (20%), including 8/55 with NF2 (15%) and 11/51 with schwannomatosis (22%). Incidental findings in the neurofibromatoses frequently involve the skeleton. Given the relatively high incidence of unsuspected osteonecrosis and stress fractures, close attention to the skeleton on WBMRI is advised. In addition, knowledge of common incidental findings can help clinicians prepare patients who undergo WBMRI for potential unexpected findings. (orig.)

  10. Population genetics structure of Plasmodium vivax circumsporozoite protein during the elimination process in low and unstable malaria transmission areas, southeast of Iran.

    Science.gov (United States)

    Shabani, Samaneh Hemati; Zakeri, Sedigheh; Mehrizi, Akram Abouie; Mortazavi, Yousef; Djadid, Navid Dinparast

    2016-08-01

    In Iran, the prevalence of Plasmodium falciparum and Plasmodium vivax has dropped after a national malaria elimination program was launched. To estimate the likelihood of success and to measure the outcome of malaria intervention tools during elimination programs (2008-2012), the population genetic surveys of Iranian P. vivax isolates (n=60) were carried out using the CSP genetic marker. The results were compared with a similar work that was carried out during a control phase (2000-2003) in the same study areas. Based on PCR-RFLP analysis, 49 (81.67%) of 60 studied samples were VK210 and 11 (18.33%) were VK247 with no mixed genotypes. However, 10.97% of P. vivax isolates of control phase harbored the mixed genotypes. Sequencing analysis of 50 pvcsp gene showed 14 distinct haplotypes, of which 11 and 3 were VK210 and VK247 types, respectively. However, during the control phase, 19 distinct subtypes (11 VK210 and 8 VK247) were reported. Also, 7 of 11 VK210 and the VK247F subtypes were new, and 3 out of 7 new VK210 and VK247F were isolated from the patients with Pakistani nationality. The lower nucleotide diversity per site (π=0.02017±0.00436 and π=0.04525±0.00255) and haplotype diversity (Hd=0.513±0.093 and Hd=0.691±0.128) as well as lower In/Del haplotype [Hd(i)=0.243 and 0] and nucleotide diversity [π(i)=0.00078 and 0] were recorded for VK210 and VK247of the elimination samples, respectively. In conclusion, the comparison of PRMs and RATs in CRR along with the polymorphism analysis of the sequence lengths, SNPs, and In/Del polymorphisms in all analyzed samples showed lower genetic diversity for PvCSP in the elimination samples. Also, although there is a turnover of P. vivax parasite genotypes in the study areas, reduction in genetic diversity and transmission was detected due to scaling-up of the intervention tools during an elimination program in Iran. This notable challenge of the elimination program must be taken into account and controlled by active

  11. Current Status of Marine Snakes from Jaffna Peninsula, Sri Lanka with Description of Hitherto Unrecorded Hydrophis fasciatus fasciatus (Schneider, 1799

    Directory of Open Access Journals (Sweden)

    K. Sivashanthini

    2008-01-01

    Full Text Available As only a few study reported on sea snakes of Sri Lanka, a study was undertaken from June 2003 to November 2004 in the coast of Jaffna Peninsula which lies in the Northern part of Sri Lanka. Out of the 121 specimens examined, 9 species under 5 genera in two families were documented in the coastal waters of both Valvettiturai to Point Pedro and the Jaffna lagoon waters. This includes Hydrophis fasciatus fasciatus which is no longer known in Sri Lanka increased the number of Hydrophis species to 8, thus the total number of sea snakes inhabiting the coastal waters of Sri Lanka become 14 in Hydrophiidae. Of the sea snakes collected, Lapemis curtus (33.88% and Praescutata viperina (23.97% were the commonly recorded species. Least recorded species were H. lapemoides, H. fasciatus fasciatus, Kerilia jerdonii jerdonii and Acrochordus granulatus (0.83, 0.83, 2.47 and 2.47%, respectively.

  12. AcEST: BP917728 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000104_F10 247 Adiantum capillus-veneris mRNA. clone: YMU001_000104_F10. BP9177...28 CL1210Contig1 Show BP917728 Clone id YMU001_000104_F10 Library YMU01 Length 247 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000104_F10. Accession BP917728 Tissue type prothallium Developmental stag...rch programs, Nucleic Acids Res. 25:3389-3402. Query= BP917728|Adiantum capillus-veneris mRNA, clone: YMU001...abase search programs, Nucleic Acids Res. 25:3389-3402. Query= BP917728|Adiantum capillus-veneris mRNA, clon

  13. A High-Availability, Distributed Hardware Control System Using Java

    Science.gov (United States)

    Niessner, Albert F.

    2011-01-01

    Two independent coronagraph experiments that require 24/7 availability with different optical layouts and different motion control requirements are commanded and controlled with the same Java software system executing on many geographically scattered computer systems interconnected via TCP/IP. High availability of a distributed system requires that the computers have a robust communication messaging system making the mix of TCP/IP (a robust transport), and XML (a robust message) a natural choice. XML also adds the configuration flexibility. Java then adds object-oriented paradigms, exception handling, heavily tested libraries, and many third party tools for implementation robustness. The result is a software system that provides users 24/7 access to two diverse experiments with XML files defining the differences

  14. AcEST: DK947755 [AcEST

    Lifescience Database Archive (English)

    Full Text Available 9. 5' end sequence. DK947755 CL244Contig1 Show DK947755 Clone id YMU02A01NGRL0016_O09 Library YMU02 Length 2...47 Definition Adiantum capillus-veneris mRNA. clone: YMU02A01NGRL0016_O09. 5' end sequence. Accession DK94775..., Gapped BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= DK94775...new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= DK947755|Adiantu...YMU02A01NGRL0016_O09 247 Adiantum capillus-veneris mRNA. clone: YMU02A01NGRL0016_O0

  15. SYNTHESIS AND STUDY OF COMPLEXES OF COPPER(II, ZINC, COBALT(II AND NICKEL(II WITH NITROFLUORENYLIDENE-9-AMINO(IMINO DERIVATIVES

    Directory of Open Access Journals (Sweden)

    S.B. Strashnova

    2009-12-01

    Full Text Available The complexes of general formula MCl2∙L1-4∙nH2O (where L1 - N-(2,4,7-trinitrofluorenilidene-9-p-dimethyl-aminoanilin, L2 - N-(2,4,5,7-tetranitrofluorenilidene-9-p-dimethylaminoaniline, L3 - N-(2,4,7-trinitrofluorenilidene-N-(p-dimethylaminophenylhydroxylamine, L4 - N-(2,4,5,7-tetranitrofluorenilidene-9-N-(p-dimethylaminophenyl-hydroxylamine; M=Cu, Co, Ni, Zn; n= 1-3 have been synthesized and investigated by different methods. Spectral criteria of co-ordination of the molecules L1 –L4 in electronic adsorption spectra were detected.

  16. Construction of the glucose isomerase deficient strain of Streptomyces M1033 by homologous recombination

    Institute of Scientific and Technical Information of China (English)

    2000-01-01

    After the establishment of the transformation conditions of Streptomyces diastaticus No.7 Strain M1033,the integration plasmid pXW for homologous recombination,which contains a 600 bp fragment of incomplete GI (G138P.G247D) gene,has been constructed in order to realize the stable overexpression of the GI (G138P.G247D) which is valuable for large-scale industrial production.The Gigene's disruption has been realized by pXW's integration into M1033 chromosomes via homologous recombination and GI deficient strain of Streptomyces M1033 has been obtained.The reliability of introduction of mutation has been proved by analysis of recombinant fragment and affirmance of existence of the mutation,as well as detection of the stability of the deficient strain.

  17. The Language Question in Cameroon

    OpenAIRE

    Echu, George

    2004-01-01

    In multilingual Cameroon, 247 indigenous languages live side by side with English and French (the two official languages) and Cameroon Pidgin English (the main lingua franca). While the two official languages of colonial heritage dominate public life in the areas of education, administration, politics, mass media, publicity and literature, both the indigenous languages and Cameroon Pidgin English are relegated to the background. This paper is a critique of language policy in Cameroon reveali...

  18. Urinary estrogens and estrogen metabolites and subsequent risk of breast cancer among premenopausal women

    OpenAIRE

    Eliassen, A. Heather; Spiegelman, Donna; Xu, Xia; Keefer, Larry K; Veenstra, Timothy D.; Barbieri, Robert L.; Willett, Walter C; Hankinson, Susan E.; Ziegler, Regina G.

    2011-01-01

    Endogenous estrogens and estrogen metabolism are hypothesized to be associated with premenopausal breast cancer risk but evidence is limited. We examined 15 urinary estrogens/estrogen metabolites (EM) and breast cancer risk among premenopausal women in a case-control study nested within the Nurses’ Health Study II (NHSII). In 1996–1999, urine was collected from 18,521 women during the mid-luteal menstrual phase. Breast cancer cases (N=247) diagnosed between collection and June 2005 were match...

  19. Guest Editorial: Smart rehabilitation for the 21st century: The Tampa Smart Home for veterans with traumatic brain injury

    OpenAIRE

    Jan Jasiewicz, PhD; William Kearns, PhD; Jeffrey Craighead, PhD; James L. Fozard, PhD; Steven Scott, DO; Jay McCarthy Jr, PT, MS

    2011-01-01

    In this editorial, we report on the development of a smart-home-based cognitive prosthetic that will deliver 24/7 rehabilitation at the James A. Haley Veterans' Hospital Polytrauma Transitional Rehabilitation Program (PTRP) facility in Tampa, Florida. The Tampa Smart Home was designed to address two weaknesses identified by PTRP clinicians in the rehabilitation process for patients with traumatic brain injury (TBI): (1) patient safety and (2) inadequate timing and repetition of prompts used t...

  20. Mobility in Learning: The Feasibility of Encouraging Language Learning on Smartphones

    OpenAIRE

    Keith Barrs

    2011-01-01

    With normalised technology in language learning contexts there is an unprecedented opportunity to re-define the nature of learning. Traditional ideas of classroom-based learning are giving way to modern ideas of ‘24/7 anywhere, anytime’ learning which is accessed and managed in part or in whole by the learners themselves, primarily on mobile devices. This is a "work in progress" article detailing the initial stages of a study investigating normalisation of smart phones in a language classroom...

  1. School Leadership for ICT and Teachers’ Use of Digital Tools

    OpenAIRE

    Geir Ottestad

    2013-01-01

    International literature and Norwegian policy documents both identify school leadership as essential in order to implement ICT (Information and Communication Technologies) in teaching and learning practices in the classrooms. Data from an online survey in 2009 of 247 school leaders and 386 teachers from Norwegian primary and lower secondary schools are used to examine if conditions promoted by school leaders are associated with the use of ICT in classrooms by teachers. The research question p...

  2. Consumption, Health Attitudes and Perception Toward Fast Food Among Arab Consumers in Kuwait: Gender Differences

    OpenAIRE

    Abdulrahman O Musaiger

    2014-01-01

    This study aimed to investigate gender differences in the fast food intake, health attitudes, and perceptions of fast food among adult Arab consumers aged 19 to 65 years in Kuwait. A total of 499 consumers (252 males, 247 females) were selected at convenience from three shopping malls in Kuwait City. The consumers were interviewed using a specially designed questionnaire. The findings revealed that men were more frequently consumed fast food than women (p < 0.001). Men were significantly more...

  3. Pain frequency moderates the relationship between pain catastrophizing and pain

    OpenAIRE

    Heidi eKjøgx; Robert eZachariae; Mogens ePfeiffer-Jensen; Helge eKasch; Peter eSvensson; Troels Staehelin Jensen; Lene eVase

    2014-01-01

    Background Pain frequency has been shown to influence sensitization, psychological distress and pain modulation. The present study examined if pain frequency moderates the relationship between pain catastrophizing and pain. Method A non-clinical (247 students) and a clinical (223 pain patients) sample completed the Danish versions of the Pain Catastrophizing Scale, Beck Depression Inventory and the State Trait Anxiety Inventory and rated pain intensity, unpleasantness and frequency Results In...

  4. Numerical modelling of tidal circulation and studies on salinity distribution in Mandovi and Zuari estuaries

    Digital Repository Service at National Institute of Oceanography (India)

    Manoj, N.T.

    Computation in Civil Engineering, University of Hannover, F.R. Germany (in German)., 1990. X. Chen. An efficient finite difference scheme for simulating hydrodynamics in narrow rivers and estuaries. International Journal for Numerical Methods in Fluids, 42...:233– 247, 2003. X. Chen. Using a piecewise linear bottom to fit the bed variation in a laterally averaged, z-coordinate hydrodynamic model. International Journal for Numerical Methods in Fluids, 44:1185–1205, 2004a. X. Chen. Modelling hydrodynamics and salt...

  5. Surgery for fistula-in-ano in a specialist colorectal unit: a critical appraisal

    OpenAIRE

    Sileri Pierpaolo; Cadeddu Federica; D'Ugo Stefano; Franceschilli Luana; Del Vecchio Blanco Giovanna; De Luca Elisabetta; Calabrese Emma; Capperucci Sara; Fiaschetti Valeria; Milito Giovanni; Gaspari Achille

    2011-01-01

    Abstract Background Several techniques have been described for the management of fistula-in-ano, but all carry their own risks of recurrence and incontinence. We conducted a prospective study to assess type of presentation, treatment strategy and outcome over a 5-year period. Methods Between 1st January 2005 and 31st March 2011 247 patients presenting with anal fistulas were treated at the University Hospital Tor Vergata and were included in the present prospective study. Mean age was 47 year...

  6. Developing m-Services; lesson learned from a developers Perspective

    OpenAIRE

    Andersson, Bo; Hedman, Jonas

    2007-01-01

    In recent years the Swedish Police Force (SPF) have encountered greater demands on availability and 24/7 services when dealing with errands that are regarded as low priority compared to regular police work, e.g. collecting tips from the public. One attempt to meet these increasing demands was the development of a mobile communications platform that allowed the public to communicate easily with the SPF using their own mobile phones by sending SMS and MMS. The focus of this paper...

  7. Demographic, criminal and psychiatric factors related to inmate suicide

    OpenAIRE

    Blaauw, E.; Kerkhof, A.J.F.M.; Hayes, L.M.

    2005-01-01

    A review of 19 studies suggests that it may be feasible to identify prisoners with suicide risk on the basis of demographic, psychiatric, and criminal characteristics. The present study aimed to identify combinations of characteristics that are capable of identifying potential suicide victims. Characteristics of 95 suicide victims in the Dutch prison system were compared with those of a random sample of 247 inmates in ten jails. Combinations of indicators for suicide risk were also tested for...

  8. A Longitudinal Study of Urinary Phthalate Excretion in 58 Full-Term and 67 Preterm Infants from Birth through 14 Months

    OpenAIRE

    Frederiksen, Hanne; Kuiri-Hänninen, Tanja; Main, Katharina M.; Dunkel, Leo; Sankilampi, Ulla

    2014-01-01

    Background: Some phthalates have shown antiandrogenic effects in rat offspring. Premature infants may be exposed to high amounts of specific phthalates during hospitalization, and thus are potentially at risk. Objective: We evaluated longitudinal phthalate exposure and metabolism in full-term (FT) and preterm (PT) infants. Methods: Fifty-eight FT and 67 PT (gestational age, 24.7–36.6 weeks) infants were recruited at birth and followed until 14 months (nine times). Urinary concentrations of me...

  9. Cumulative Alendronate Dose and the Long-Term Absolute Risk of Subtrochanteric and Diaphyseal Femur Fractures: A Register-Based National Cohort Analysis

    DEFF Research Database (Denmark)

    Abrahamsen, Bo; Eiken, Pia Agnete; Eastell, Richard

    2010-01-01

    = 2.62-6.05). The HR for hip fracture was 1.37 (95% CI = 1.30-1.46)) in women and 2.47 (95% CI = 2.07-2.95) in men. Risks of subtrochanteric/diaphyseal fracture were similar in patients who had received 9 yr of treatment (highest quartile) and patients who had stopped therapy after the equivalent of 3...

  10. Underrecognition of Dengue during 2013 Epidemic in Luanda, Angola

    OpenAIRE

    Sharp, Tyler M.; Moreira, Rosa; Soares, Maria José; Miguel da Costa, Lúis; Mann, Jennifer; Delorey, Mark; Hunsperger, Elizabeth; Muñoz-Jordán, Jorge L.; Colón, Candimar; Margolis, Harold S; de Caravalho, Adelaide; Tomashek, Kay M.

    2015-01-01

    During the 2013 dengue epidemic in Luanda, Angola, 811 dengue rapid diagnostic test–positive cases were reported to the Ministry of Health. To better understand the magnitude of the epidemic and identify risk factors for dengue virus (DENV) infection, we conducted cluster surveys around households of case-patients and randomly selected households 6 weeks after the peak of the epidemic. Of 173 case cluster participants, 16 (9%) exhibited evidence of recent DENV infection. Of 247 random cluster...

  11. Victims' use of professional services in a Dutch sexual assault centre

    OpenAIRE

    Bicanic, Iva; Snetselaar, Hanneke; de Jongh, Ad; van de Putte, Elise

    2014-01-01

    Background: Prior research endorsed the establishment of sexual assault centres in the Netherlands because of the potential benefit for victims’ mental recovery. In 2012, the first Dutch sexual assault centre was founded at the University Medical Center Utrecht. The aim of the centre is to provide 24/7 coordinated and integrated services (i.e., medical, forensic, and psychological) in one location.Objective: The purpose of the present study was to describe demographic, background, and assault...

  12. In vivo imaging of cellular proliferation in renal cell carcinoma using 18F-fluorothymidine PET

    Directory of Open Access Journals (Sweden)

    Peter K. Wong

    2014-05-01

    Results: The SUVmax (maximum standardized uptake value mean±SD for FLT in tumour was 2.59±1.27, compared to normal kidney (2.47±0.34. The mean SUVmax for FDG in tumour was similar to FLT (2.60±1.08. There was a significant correlation between FLT uptake and the immunohistochemical marker Ki-67 (r=0.72, P

  13. English as a Lingua Franca in Portugal: What students want, what teachers teach

    OpenAIRE

    Guerra, Luís

    2012-01-01

    This study seeks to show how Portuguese students and teachers view learning and using English today and how their attitudes can influence or be influenced by ELT policies and practices. It made use of two semi-structured questionnaires, one for students (N=247) and another for teachers (N=26). The subjects were part of four educational institutions – two universities and two polytechnic institutes. The methodology used in the analysis of attitudes toward the English language should be diversi...

  14. Novel information on the epitope of an inverse agonist monoclonal antibody provides insight into the structure of the TSH receptor.

    Directory of Open Access Journals (Sweden)

    Chun-Rong Chen

    Full Text Available The TSH receptor (TSHR comprises an extracellular leucine-rich domain (LRD linked by a hinge region to the transmembrane domain (TMD. Insight into the orientation of these components to each other is required for understanding how ligands activate the receptor. We previously identified residue E251 at the LRD-hinge junction as contributing to coupling TSH binding with receptor activation. However, a single residue cannot stabilize the LRD-hinge unit. Therefore, based on the LRD crystal structure we selected for study four other potential LRD-hinge interface charged residues. Alanine substitutions of individual residues K244, E247, K250 and R255 (as well as previously known E251A did not affect TSH binding or function. However, the cumulative mutation of these residues in varying permutations, primarily K250A and R255A when associated with E251A, partially uncoupled TSH binding and function. These data suggest that these three residues, spatially very close to each other at the LRD base, interact with the hinge region. Unexpectedly and most important, monoclonal antibody CS-17, a TSHR inverse agonist whose epitope straddles the LRD-hinge, was found to interact with residues K244 and E247 at the base of the convex LRD surface. These observations, together with the functional data, exclude residues K244 and E247 from the TSHR LRD-hinge interface. Further, for CS-17 accessibility to K244 and E247, the concave surface of the TSHR LRD must be tilted forwards towards the hinge region and plasma membrane. Overall, these data provide insight into the mechanism by which ligands either activate the TSHR or suppress its constitutive activity.

  15. 新闻(英文)

    Institute of Scientific and Technical Information of China (English)

    2009-01-01

    Garment&Accessories Export in May Increased0.52%from Previous Month According to Customs Bureau,theireport and export of China were 164.127billion USD in May,down 25.9%from sameperiod last year.The accumulated importand export from Jan.to May reached763.491 billion USD.down 24.7%.The accumulated export of textiles(excluded those in Chaper 94)in first five

  16. Sexuality and Autistic-Like Symptoms in Juvenile Sex Offenders: A Follow-Up after 8 Years

    Science.gov (United States)

    Baarsma, M. Ewoud; Boonmann, Cyril; 't Hart-Kerkhoffs, Lisette A.; de Graaf, Hanneke; Doreleijers, Theo A. H.; Vermeiren, Robert R. J. M.; Jansen, Lucres M. C.

    2016-01-01

    Juveniles who have committed a sexual offense (JSOs) are thought to have abnormal sexual development, as well as increased ASD symptoms. In the current study, sexual development and behavior, as well as stability of ASD-like symptoms were assessed in a sample of 44 male JSOs (mean age 24.7 ± 1.5 years) 8 years after their sexual offence. JSOs…

  17. Machine Learning at Scale

    OpenAIRE

    Izrailev, Sergei; Stanley, Jeremy M.

    2014-01-01

    It takes skill to build a meaningful predictive model even with the abundance of implementations of modern machine learning algorithms and readily available computing resources. Building a model becomes challenging if hundreds of terabytes of data need to be processed to produce the training data set. In a digital advertising technology setting, we are faced with the need to build thousands of such models that predict user behavior and power advertising campaigns in a 24/7 chaotic real-time p...

  18. Rethinking the crime reducing effect of education : the role of social capital and organized crime

    OpenAIRE

    Brilli, Ylenia; TONELLO, Marco

    2014-01-01

    This paper estimates the causal effect of education on adolescent crime by exploiting a compulsory education reform implemented in 1999 in Italy. To identify the causal relation we use the reform as an instrument for adolescent high school enrollment, and compare the offending rates of the cohorts affected by the reform with the ones not affected. We find that one percentage point increase in the enrollment ratio reduces adolescent crime by 2.47 percent, and that the effect is highly heteroge...

  19. ISOTHERMAL AND THERMOMECHANICAL FATIGUE OF A NICKEL-BASE SUPERALLOY

    OpenAIRE

    Carlos Carvalho Engler-Pinto Júnior; Dirceu Spinelli

    2014-01-01

    Thermal gradients arising during transient regimes of start-up and shutdown operations produce a complex thermal and mechanical fatigue loading which limits the life of turbine blades and other engine components operating at high temperatures. More accurate and reliable assessment under non-isothermal fatigue becomes therefore mandatory. This paper investigates the nickel base superalloy CM 247LC-DS under isothermal low cycle fatigue (LCF) and thermomechanical fatigue (TMF). Test ...

  20. High-Performance Work Systems and Proactive Behavior: The Mediating Role of Psychological Empowerment

    OpenAIRE

    Md. Shamsul Arefin; Ishtiaque Arif; Muhammad Raquib

    2015-01-01

    Drawing on social exchange theory, this study explores the relationship between high-performance work systems (HPWS) and proactive work behavior. We also examined whether psychological empowerment mediated the effects of HPWS on employees’ proactive behavior. Using a sample of 247 employees employed by three large manufacturing firms in Bangladesh, results from structural equation modeling and hierarchical regression analyses showed that HPWS was positively related to proactive behavior. The ...

  1. Synthesis and Fermentation Properties of Novel Galacto-Oligosaccharides by β-Galactosidases from Bifidobacterium Species

    OpenAIRE

    Rabiu, Bodun A.; Jay, Andrew J.; Glenn R Gibson; Rastall, Robert A.

    2001-01-01

    β-Galactosidase enzymes were extracted from pure cultures of Bifidobacterium angulatum, B. bifidum BB-12, B. adolescentis ANB-7, B. infantis DSM-20088, and B. pseudolongum DSM-20099 and used in glycosyl transfer reactions to synthesize oligosaccharides from lactose. At a lactose concentration of 30% (wt/wt) oligosaccharide yields of 24.7 to 47.6% occurred within 7 h. Examination of the products by thin-layer chromatography and methylation analysis revealed distinct product derived spectra fro...

  2. A controlled study of Tourette syndrome. VI. Early development, sleep problems, allergies, and handedness.

    OpenAIRE

    Comings, D E; Comings, B G

    1987-01-01

    Developmental milestones, problems with bladder and bowel control, sleep disturbances, allergies, and handedness were compared in 247 consecutive Tourette syndrome (TS) patients, 17 patients with attention-deficit disorder (ADD), 15 patients with ADD secondary to TS (ADD 2(0) TS), and 47 random controls. There were no significant differences in age of first talking or walking. By contrast, there were significant differences in problems with bladder and bowel control between TS patients and co...

  3. Im/Ex Difficulty Lasts in the First 5 Months

    Institute of Scientific and Technical Information of China (English)

    2009-01-01

    @@ On June 11,General Administration of Customs of the People's Republic of China announced the profile of China foreign trade import and export in the first 5months of this year.According to the customs' statistics,the total import and export value for the first five months amounted to US$763.49 billion,24.7% decreasing compared with the same period last year.

  4. Online Marketing & Travel Agencies. Development stages of websites and the use of webmetrics.

    OpenAIRE

    Droplaug Guttormsdóttir 1986

    2013-01-01

    The way that tourism businesses communicate with their customers has changed in recent years with the development of information technologies and the Internet. The Internet has formed new practices in marketing and changed the buying behaviour of tourists. Websites act as extended company offices, open 24/7, and represent the quality of services and products offered by the company. The extended model of Internet commerce adoption (eMICA) is used to evaluate the level of website development in...

  5. Facial traumas among females through violent and non-violent mechanisms

    OpenAIRE

    Mário César Furtado Costa; Gigliana Maria Sobral Cavalcante; Lorena Marques da Nóbrega; Pierre Andrade Pereira de Oliveira; Josuel Raimundo Cavalcante; Sergio d'Avila

    2014-01-01

    INTRODUCTION: Injuries stemming from facial trauma have both physical and emotional consequences among affected individuals as well as an economic impact on the healthcare system. OBJECTIVE: The aim of this retrospective study was to determine the occurrence of facial trauma among females of different age groups treated at an urgent care ward in the northeast of Brazil in a two-year period. MATERIALS AND METHODS: A cross-sectional study was carried out involving 247 charts. Data on p...

  6. Influence of different etchants on the representation of microstructures in nickel alloys; Einfluss verschiedener Aetzmittel auf die Gefuegedarstellung in Nickellegierungen

    Energy Technology Data Exchange (ETDEWEB)

    Speicher, Magdalena; Scheck, Rudi; Maile, Karl [Stuttgart Univ. (Germany). Materialpruefungsanstalt

    2016-04-15

    This work presents a comparison of selected nickel alloys of the same condition which were treated by means of specifically chosen etching techniques. Microstructures on microscope images of wrought Alloy 617, a casting variant of Alloy 625, a polycrystalline casting alloy IN-738 LC, as well as of a monocrystalline superalloy CM 247 LC SX, respectively, are juxtaposed and evaluated. This approach allows for a comprehensive optical microscopy characterization of the characteristic microstructural features.

  7. Considering an Affect Regulation Framework for Examining the Association Between Body Dissatisfaction and Positive Body Image in Black Older Adolescent Females: Does Body Mass Index Matter?

    OpenAIRE

    Webb, Jennifer B.; Butler-Ajibade, Phoebe; Robinson, Seronda A.

    2014-01-01

    The present study provided an initial evaluation of an affect regulation model describing the association between body dissatisfaction and two contemporary measures of positive body image among 247 Black college-bound older adolescent females. We further tested whether possessing a higher body mass index (BMI) would strengthen these associations. Self-reported height and weight were used to calculate BMI. Respondents also completed a culturally-sensitive figure rating scale along with assessm...

  8. A field study of proteinuria in individuals infected with Schistosoma mansoni

    Directory of Open Access Journals (Sweden)

    José Carlos Bina

    1985-03-01

    Full Text Available Proteinuria was detected in 24.7% of 89 individuals with hepatosplenic schistosomiasis and in only 4.6% of 86 subjects with mild hepato-intestinal schistosomiasis, all of them living in comparable conditions in two endemic areas in Bahia, Brazil. From nine individuals who hadproteinuria over30 mg/100ml, eight had hepatosplenic schistosomiasis. These findings maybe related to the presence of schistosomal nephropathy and reveal the significance of this condition in thefield in endemic areas of schistosomiasis.

  9. Rumen Microbiome Composition in Cattle during Grain-Induced Subacute Ruminal Acidosis (SARA)

    DEFF Research Database (Denmark)

    Danscher, Anne Mette; Derakshani, Hooman; Li, Shucong;

    2014-01-01

    at the genus level. The rumen bacterial communities were altered in response to SARA (P=0.01). The proportion of several taxa was significantly higher in SARA samples, including S24-7, Erysipelotrichales. Lactobacillus, C lostridia, Moryella, Butyrivibrio, Olsenella, and C oprococcus. Microbiome profiling...... of rumen during SARA could provide new knowledge of the pathogenesis and might be used as a biological marker of the disease....

  10. Pulmonary function in healthy young adult Indians in Madras.

    OpenAIRE

    Vijayan, V. K.; Kuppurao, K V; Venkatesan, P; Sankaran, K; Prabhakar, R

    1990-01-01

    Forced vital capacity, forced expiratory volume in one second, functional residual capacity, residual volume, total lung capacity, and single breath diffusing capacity measurements (effective alveolar volume, carbon monoxide transfer factor, and transfer coefficient) were measured in 247 young healthy adults (130 male, 117 female) aged 15-40 years living in Madras. Subjects were of Dravidian stock, living at sea level with rice as their staple diet. Regression equations were derived for men a...

  11. Sedimentological processes and environmental variability at Lake Ohrid (Macedonia, Albania) between 637 ka and the present

    OpenAIRE

    Francke, Alexander; Wagner, Bernd; Just, Janna; Leicher, Niklas; Gromig, Raphael; Baumgarten, Henrike; Vogel, Hendrik; Lacey, Jack H.; Sadori, Laura; Wonik, Thomas; Leng, Melanie J.; Zanchetta, Giovanni; Sulpizio, Roberto; Giaccio, Biagio

    2016-01-01

    Lake Ohrid (Macedonia, Albania) is thought to be more than 1.2 million years old and host more than 300 endemic species. As a target of the International Continental scientific Drilling Program (ICDP), a successful deep drilling campaign was carried out within the scope of the Scientific Collaboration on Past Speciation Conditions in Lake Ohrid (SCOPSCO) project in 2013. Here, we present lithological, sedimentological, and (bio-)geochemical data from the upper 247.8 m compos...

  12. Sedimentological processes and environmental variability at Lake Ohrid (Macedonia, Albania) between 637 ka and the present

    OpenAIRE

    A. Francke; Wagner, B.; Just, J.; N. Leicher; Gromig, R.; H. Baumgarten; Vogel, Hendrik; J. H. Lacey; Sadori, L.; T. Wonik; Leng, M. J.; G. Zanchetta; Sulpizio, R.; Giaccio, B.

    2016-01-01

    Lake Ohrid (Macedonia, Albania) is thought to be more than 1.2 million years old and host more than 300 endemic species. As a target of the International Continental scientific Drilling Program (ICDP), a successful deep drilling campaign was carried out within the scope of the Scientific Collaboration on Past Speciation Conditions in Lake Ohrid (SCOPSCO) project in 2013. Here, we present lithological, sedimentological, and (bio-)geochemical data from the upper 247.8 m composite depth of the o...

  13. Systemic inflammation associated with mechanical ventilation among extremely preterm infants

    OpenAIRE

    Bose, Carl L.; Laughon, Matthew M; Allred, Elizabeth N.; O’Shea, T. Michael; Van Marter, Linda J; Ehrenkranz, Richard A.; Raina N Fichorova; Leviton, Alan

    2012-01-01

    Little evidence is available to document that mechanical ventilation is an antecedent of systemic inflammation in preterm humans. We obtained blood on postnatal day 14 from 726 infants born before the 28th week of gestation and measured the concentrations of 25 inflammation-related proteins. We created multivariable models to assess the relationship between duration of ventilation and protein concentrations in the top quartile. Compared to newborns ventilated for fewer than 7 days (N=247), th...

  14. CLINICAL EFFECT OF TESTOSTERONE IN MEN WITH STABLE ANGINA

    OpenAIRE

    A. Ya. Kravchenko; V. M. Provotorov

    2016-01-01

    Aim. To study efficacy of testosterone undecanoate (TU) therapy in men with stable angina and androgen deficiency.Material and methods. The serum testosterone level was detected in 247 men (aged 51,6±1,8 y.o.) with stable effort angina. 60 patients with androgen deficiency additionally to basic angina therapy received TU (120-160 mg daily). 54 patients with androgen deficiency (control group) received only basic angina therapy. Dynamics of clinical and ECG manifestations of myocardial ischemi...

  15. Serving Culturally Diverse E-Learners in Business Schools

    Science.gov (United States)

    van de Bunt-Kokhuis, Sylvia; Weir, David

    2013-01-01

    Purpose: The purpose of this paper is to highlight how future teaching in business schools will probably take place in an online (here called 24/7) classroom, where culturally diverse e-learners around the globe meet. Technologies such as iPhone, iPad and a variety of social media, to mention but a few, give management learners of any age easy…

  16. Storage and Non-Payment: Persistent Informalities within the Formal Water Supply of Hubli-Dharwad, India

    OpenAIRE

    Zachary Burt; Isha Ray

    2014-01-01

    Urban water systems in Asia and Africa mostly provide intermittent rather than continuous water supplies; such systems compromise water quality and inconvenience the user. Starting in 2008, an upgrade to continuous (24/7) water services was provided for 10% of the twin cities of Hubli-Dharwad, India, through a process of privatisation and formalisation. The goals were to improve water quality, free consumers from collecting and storing water, and reduce non-revenue (i.e. unpaid for) water. Dr...

  17. AcEST: DK948844 [AcEST

    Lifescience Database Archive (English)

    Full Text Available A5BXK1|A5BXK1_VITVI Putative uncharacterized protein OS=Vitis... 72 3e-11 tr|Q2I6N7|Q2I6N7_SOLTU Rhamnose:beta-solanine...KDVLD 245 Query: 673 AL 678 AL Sbjct: 246 AL 247 >tr|Q2I6N7|Q2I6N7_SOLTU Rhamnose:beta-solanine

  18. Nuestra culpa: Collective guilt and shame as predictors of reparation for historical wrongdoing

    OpenAIRE

    Brown, Rupert; Gonzalez, Roberto; Zagefka, Hanna; Manzi, Jorge; Cehajic, Sabina

    2008-01-01

    Three studies examined the hypothesis that collective guilt and shame have different consequences for reparation. In 2 longitudinal studies, the ingroup was nonindigenous Chileans (Study 1: N = 124/120, lag = 8 weeks; Study 2: N = 247/137, lag = 6 months), and the outgroup was Chile's largest indigenous group, the Mapuche. In both studies, it was found that collective guilt predicted reparation attitudes longitudinally. Collective shame had only cross-sectional associations with reparation an...

  19. The value of preoperative lung spirometry test for predicting the operative risk in patients undergoing gastric cancer surgery

    OpenAIRE

    Jeong, Oh; Ryu, Seong Yeop; Park, Young Kyu

    2012-01-01

    Purpose We evaluated the predictive value of preoperative lung spirometry test for postoperative morbidity and the nature of complications related to an abnormal pulmonary function after gastric cancer surgery. Methods Between February 2009 and March 2010, 538 gastric cancer patients who underwent laparoscopic (n = 247) and open gastrectomy (n = 291) were divided into the normal (forced expiratory volume in 1 second [FEV1]/forced vital capacity [FVC] ≥ 0.7, n = 441) and abnormal pulmonary fun...

  20. Communication of risk in oil and gas megaprojects: A case study of the Ivar Aasen development project

    OpenAIRE

    Lefdal, Stine Martine; Eide, Ida

    2014-01-01

    Risk management practices in the oil and gas industry has gained increased attention in the recent years. Achieving efficient and effective project management is essential for the project organization, to increase the level of project success. In this context, management of risk is an important part. The case company for this thesis is Det norske oljeselskap ASA, and its development project Ivar Aasen – a project which is estimated to have a total investment cost of NOK 24.7 billion was ...

  1. AcEST: CL2247Contig1 [AcEST

    Lifescience Database Archive (English)

    Full Text Available CL2247Contig1 1020 2 Adiantum capillus-veneris contig: CL2247contig1 sequence. Link to clone list Show CL2...247Contig1 Contig ID CL2247Contig1 Length 1020 Number of clones 2 Definition Adiantum... capillus-veneris contig: CL2247contig1 sequence. Link to clone list Link to clone list Clone ID DK948571 DK

  2. Factors Associated with Speeding Penalties in Novice Drivers

    OpenAIRE

    Eensoo, Diva; Paaver, Marika; Harro, Jaanus

    2010-01-01

    Novice drivers are an important risk group in traffic and speed limit exceeding is one of the major risk factors for traffic collisions. In this paper we explore how impulsivity measures, driving skills and driving safety are associated with speed limit exceeding in novice drivers if described variables are measured on the same subjects. Participants of the study were 909 novice car-drivers (mean age 24.7(SD=7.5) years). Subjects filled Barratt Impulsivity Scale, Adaptive and Maladaptive Impu...

  3. Small Steps for Workers, a Giant Leap for Productivity

    OpenAIRE

    Hendel, Igal; Spiegel, Yossi

    2014-01-01

    We document the evolution of productivity in a steel mini mill with fixed capital, producing an unchanged product with Leontief technology working 24/7. Despite?almost?unchanged production conditions, output doubled within the sample period (12 years). We decompose the gains into downtime reductions, more rounds of production per time, and more output per run. After attributing productivity gains to investment and an incentive plan, we are left with a large unexplained component. Learning by ...

  4. 适合苹果高密栽培的三种树形%Three apple tree forms suitable for high-density culture

    Institute of Scientific and Technical Information of China (English)

    姚胜蕊; 刘嘉芬; 薛炳烨

    2001-01-01

    介绍了适合苹果高密栽培采用的细长纺锤形,纵轴形和起细纺锤形的树体结构特点,指出三者分别适用于每666.7m2栽115~247株、82~148株、329~824株,并对三种树形进行了比较.

  5. Study on the Development of Yunnan Floral E-commerce

    OpenAIRE

    Kuang, Yulan; Li, Qifang; Ning, Wangyun

    2013-01-01

    Cut flower production in Yunnan accounts for 80% nationwide. In order to expand the Yunnan Flower sales channels, the promotion of the development of e-commerce is necessary. In 2012 China's online shopping users reached 247 million people, but e-commerce of fresh flowers lagged behind due to the constraints of preservation facilities and logistics cost. The analysis of the factors restricting the development of floral e-commerce and the proposition of solutions to this problem can promote fa...

  6. YouTube as a source of useful information on diabetes foot care.

    Science.gov (United States)

    Abedin, Tasnima; Ahmed, Salim; Al Mamun, Mohammad; Ahmed, Syed Walid; Newaz, Sanjida; Rumana, Nahid; Turin, Tanvir C

    2015-10-01

    Diabetes foot care related videos were identified in YouTube to assess their usefulness as a source of information. Two physician reviewers evaluated the videos and categorized those as very-useful (11.2%), moderately-useful (14.6%), somewhat-useful (24.7%) and not-useful (49.4%). YouTube videos on diabetes foot-care contained a variety of content ranging from very useful to not useful.

  7. Global delivery models: The role of talent, speed and time zones in the global outsourcing industry

    OpenAIRE

    Stephan Manning; Marcus M Larsen; Pratyush Bharati

    2015-01-01

    Global delivery models (GDMs) are transforming the global IT and business process outsourcing industry. GDMs are a new form of client-specific investment promoting service integration with clients by combining client proximity with time-zone spread for 24/7 service operations. We investigate antecedents and contingencies of setting up GDM structures. Based on comprehensive data we show that providers are likely to establish GDM location configurations when clients value access to globally dis...

  8. Ja New Yorgis hüppasid ärimehed aknast alla... / Heiki Suurkask

    Index Scriptorium Estoniae

    Suurkask, Heiki, 1972-

    2008-01-01

    Autori hinnangul ähvardab praegune New Yorgis vallandunud börsipaanika sama tõsiste tagajärgedega, kui olid 1929. a. börsikrahhil. USA keskvalitsus päästab raskustesse sattunud suurkontserne, ka Euroopa, Šveitsi, Inglise, Kanada, Jaapani keskpank on paisanud finantsturule 247 mld dollarit. Lehman Brothersi pankroti mõju Euroopas. Lisad: Suur kriis ähvardab korduda; Kõige suuremad raskused ähvardavad Vene majandust

  9. Temporal and geochemical evolution of Miocene volcanism in the Andean back-arc between 36°S and 38°S and U-series analyses of young volcanic centers in the arc and back-arc, Argentina

    DEFF Research Database (Denmark)

    Dyhr, Charlotte Thorup

    New 40Ar/39Ar, major and trace element, and Sr, Nd and Pb isotopic data for the c. 24-7 Ma volcanic rocks from the Andean back-arc (35°S – 38°S) in the Mendoza and Neuquén (Argentina) regions shed light on the Miocene evolution of the back-arc of the Southern Volcanic Zone. Incipient shallowing...

  10. HASTANE İŞLETMELERİNDE SÜRECE DAYALI FAALİYET TABANLI MALİYETLEME MODELLEMESİ

    OpenAIRE

    KIRLIOĞLU, Hilmi; -, Bedia ATALAY

    2015-01-01

    Cost accounting systems, as the source of information is the business of the center pole. Appropriate and achieved successful results of decisions on the basis of the accuracy of the informations provided by these systems is located. Hospital enterprises, man's greatest treasure, which operates in the field of health, different areas of expertise, offering a wide variety and large number of health services, working 24/7 operations. Increased competition and cost pressure that customer awarene...

  11. Tourism Development in Malaysia from the Perspective of Development Plans

    OpenAIRE

    Md. Anowar Hossain Bhuiyan; Chamhuri Siwar; Shaharuddin Mohamad Ismail

    2013-01-01

    Tourism is a potential matter in social, environmental and economic levels of government agendas. Tourism is a mentionable earning industry of Malaysia. About 24.7 million tourist arrivals in Malaysia in 2011 and receipts RM 58.3 billion from this sector. Malaysian government has played a significant role in instituting legal and institutional framework for ensuring sustainable tourism. The present study discusses the tourism enhancement initiatives in development plans of Malaysia. The paper...

  12. Stable Isotope Ratios and Forensic Analysis of Microorganisms▿

    OpenAIRE

    Kreuzer-Martin, Helen W.; Jarman, Kristin H.

    2007-01-01

    In the aftermath of the anthrax letters of 2001, researchers have been exploring various analytical signatures for the purpose of characterizing the production environment of microorganisms. One such signature is stable isotope ratios, which in heterotrophs, are a function of nutrient and water sources. Here we discuss the use of stable isotope ratios in microbial forensics, using as a database the carbon, nitrogen, oxygen, and hydrogen stable isotope ratios of 247 separate cultures of Bacill...

  13. Cognitive Coping Moderates the Association between Violent Victimization by Peers and Substance Use among Adolescents

    OpenAIRE

    Brady, Sonya S; Tschann, Jeanne M.; Pasch, Lauri A.; Flores, Elena; Ozer, Emily J

    2008-01-01

    Objective This study tested whether violent victimization by peers was associated with alcohol and tobacco use among adolescents, and whether adaptive coping styles moderated associations. Methods A total of 247 urban Mexican-American and European-American adolescents aged 16–20 years were interviewed. Results Independent of demographics and violent perpetration, adolescents victimized by violence reported greater alcohol and tobacco use. Adolescents who engaged in higher levels of behavioral...

  14. How participation in the strategy development process impacts managers’ creation of budgetary slack

    OpenAIRE

    DE BAERDEMAEKER, J; W. BRUGGEMAN

    2013-01-01

    This paper explores the impact of participation in the strategy development process on managers’ creation of budgetary slack. It is proposed that a participative strategy development process affects budgetary slack through the mediating effect of the managers’ autonomous motivation to attain the required budget targets and their affective organizational commitment. Data obtained from 247 Belgian managers are used to test the proposed model. Results from a structural equation model suggest tha...

  15. Trafikksikkerhet, holdninger og atferd. En sammenligning av norske og russiske respondenter

    OpenAIRE

    Grønning, Bjørn Erik M.

    2014-01-01

    The main objective of the thesis was to investigate whether there are group differences and whether there exists a relationship between attitudes towards traffic behaviour and actual reported traffic behaviour between Norwegian (n = 247) and Russian (n = 245) respondents. Main concerns are: Does the thesis reveal actual cross-country differences? Does the relationships and possible cross-country differences outrun/go beyond confounding covariates such as: gender, age, and monthly mileage of d...

  16. Diagnosis of cytomegalovirus infections by qualitative and quantitative PCR in HIV infected patients Diagnóstico de infecção por CMV em pacientes infectados pelo HIV utilizando PCR qualitativa e quantitativa

    OpenAIRE

    CUNHA Aldo de Albuquerque; Lauro Juliano MARIN; Aquino, Victor Hugo; Figueiredo, Luiz Tadeu Moraes

    2002-01-01

    A high incidence of cytomegalovirus (CMV) infections is observed in Brazil. These viruses are causatives of significant morbidity and mortality among patients with advanced human immunodeficiency virus (HIV) infection. This work, shows the application of a PCR on determination of CMV load in the buffy coat and plasma. We analyzed the samples of 247 HIV infected patients in order to diagnose CMV infection and disease. We developed a semi-quantitative PCR that amplifies part of the glycoprotein...

  17. WORLD OF TECHNOLOGY AND CHANGING SOCIAL NETWORKING

    OpenAIRE

    Sharmila Sambhaji

    2014-01-01

    In the era of Globalization technology facilitates the psychological, socio-emotional and intellectual needs of adolescents. It provides them more space, opportunities to make new friends and also to create self-identity. It helps them to develop communication skills. Availability of social media 24/7 through modern technological devices like computers and cellphones, fulfills the thirst for social interaction during adolescent years. The excess use of computers has made teena...

  18. Credibility in CSR communication: concepts, methods, analyses

    OpenAIRE

    Lock, Irina; Seele, Peter

    2015-01-01

    In globalized markets, norms for legitimate behavior are scattered and businesses must satisfy often conflicting demands of various stakeholders simultaneously. This is why communicating their Corporate Social Responsibilities (CSR) in a legitimate way is challenging. The present is also a high time for a debate of CSR issues and an era of public scrutiny and mistrust, catalyzed by real-time communication technologies and a 24/7 news cycle. Instances of non-credible communication, the misus...

  19. JOB INFORMATION

    Institute of Scientific and Technical Information of China (English)

    2006-01-01

    Practical Q&A tor Foreign Teachers Reference Sample of the Appendix of the Standard Work Contract for Foreign Cultural and Educational Experts The host institution and the foreign cultural and educational expert shall, when signing the appendix of the contract comply with the provisions of the Administration of Foreign Experts' Affairs and the Ministry of Finance (Wai Zhuan Fa No.247 (1996)) and decide on the salary and living arrangements according to the concrete circumstances of the host institution a...

  20. 48 CFR 52.212-5 - Contract Terms and Conditions Required To Implement Statutes or Executive Orders-Commercial Items.

    Science.gov (United States)

    2010-10-01

    ... Subcontractor Sales to the Government (SEP 2006), with Alternate I (OCT 1995) (41 U.S.C. 253g and 10 U.S.C. 2402... Privately Owned U.S.-Flag Commercial Vessels (FEB 2006) (46 U.S.C. Appx 1241(b) and 10 U.S.C. 2631). ___(ii....247-64, Preference for Privately Owned U.S.-Flag Commercial Vessels (FEB 2006) (46 U.S.C. Appx...

  1. DIFERENCIAS EN ESTRÉS PERCIBIDO, SALUD MENTAL Y FÍSICA DE ACUERDO AL TIPO DE RELACIÓN HUMANO-PERRO / DIFFERENCES IN PERCEIVED STRESS, MENTAL HEALTH, AND PHYSICAL HEALTH ACCORDING TO TYPES OF HUMAN-PET DOG RELATIONSHIPS

    OpenAIRE

    MÓNICA TERESA GONZÁLEZ RAMÍREZ; RENÉ LANDERO HERNÁNDEZ

    2011-01-01

    This study was carried out in order to assess whether the levelsof perceived stress and health differed depending on typesof human-pet dog relationships, and to evaluate the correlationbetween perceived stress and health and the frequencywith which activities are carried out with the dogs. Self-reportquestionnaires were filled out by 247 volunteers owning atleast one dog. The results show lower levels of perceived stressand higher levels of mental health in those individuals whoconsider the d...

  2. Modelling the fathering role: Experience in the family of origin and father involvement

    OpenAIRE

    Mihić Ivana

    2012-01-01

    The study presented in this paper deals with the effects of experiences with father in the family of origin on the fathering role in the family of procreation. The results of the studies so far point to great importance of such experiences in parental role modelling, while recent approaches have suggested the concept of introjected notion or an internal working model of the fathering role as the way to operationalise the transgenerational transfer. The study included 247 two-parent coup...

  3. Regulation of Biosynthesis of Individual Cellulases in Thermomonospora fusca

    OpenAIRE

    Spiridonov, Nikolay A.; Wilson, David B.

    1998-01-01

    Regulation of the biosynthesis of the six cellulases comprising the cellulolytic system of the thermophilic soil bacterium Thermomonospora fusca ER1 was studied. The levels of the individual enzymes produced on different noninducing and inducing carbon sources were determined. The lowest level of cellulase synthesis (3 nM) was observed with xylose as a carbon source, and the highest level (247 to 1,670 nM for different enzymes) was found in cultures grown on microcrystalline cellulose. Endoce...

  4. The Impact of Neighborhood, Family, and Individual Risk Factors on Toddlers’ Disruptive Behavior

    OpenAIRE

    Heberle, Amy E; Thomas, Yolanda M.; Wagmiller, Robert L.; Briggs-Gowan, Margaret J.; Alice S. Carter

    2014-01-01

    Disadvantaged neighborhoods confer risk for behavior problems in school aged children but their impact in toddlerhood is unknown. Relations between toddlers’ disruptive behavior and neighborhood disadvantage, family disadvantage, violence or conflict exposure, parent depressive symptoms, and parenting behavior were examined using multilevel, multi-group (girl/boy) models. Participants were 1204 families (mean child age = 24.7 months). Unique associations between disruptive behavior and all ri...

  5. Surface chemistry of polymers. The adsorption of carbon dioxide and sulfur dioxide on polyvinylidene chloride

    OpenAIRE

    Stoeckli, Fritz

    2007-01-01

    Isotherms for the adsorption of nitrogen (77 K), carbon dioxide (195-247 K) and sulfur dioxide (254-293 K) on polyvinylidene chloride have been measured volumetrically. The B.E.T. cross-sectional areas of 18 Å2 (CO2) and 24 Å2 (SO2) are comparable to liquid density values. The isosteric heat of adsorption of CO2 is constant for 0.2

  6. Modulation of Bacillus thuringiensis Phosphatidylinositol-Specific Phospholipase C Activity by Mutations in the Putative Dimerization Interface

    Energy Technology Data Exchange (ETDEWEB)

    Shi, X.; Shao, C; Zhang, X; Zambonelli, C; Redfield, A; Head, J; Seaton, B; Roberts, M

    2009-01-01

    Cleavage of phosphatidylinositol (PI) to inositol 1,2-(cyclic)-phosphate (cIP) and cIP hydrolysis to inositol 1-phosphate by Bacillus thuringiensis phosphatidylinositol-specific phospholipase C are activated by the enzyme binding to phosphatidylcholine (PC) surfaces. Part of this reflects improved binding of the protein to interfaces. However, crystallographic analysis of an interfacially impaired phosphatidylinositol-specific phospholipase (W47A/W242A) suggested protein dimerization might occur on the membrane. In the W47A/W242A dimer, four tyrosine residues from one monomer interact with the same tyrosine cluster of the other, forming a tight dimer interface close to the membrane binding regions. We have constructed mutant proteins in which two or more of these tyrosine residues have been replaced with serine. Phospholipid binding and enzymatic activity of these mutants have been examined to assess the importance of these residues to enzyme function. Replacing two tyrosines had small effects on enzyme activity. However, removal of three or four tyrosine residues weakened PC binding and reduced PI cleavage by the enzyme as well as PC activation of cIP hydrolysis. Crystal structures of Y247S/Y251S in the absence and presence of myo-inositol as well as Y246S/Y247S/Y248S/Y251S indicate that both mutant proteins crystallized as monomers, were very similar to one another, and had no change in the active site region. Kinetic assays, lipid binding, and structural results indicate that either (i) a specific PC binding site, critical for vesicle activities and cIP activation, has been impaired, or (ii) the reduced dimerization potential for Y246S/Y247S/Y248S and Y246S/Y247S/Y248S/Y251S is responsible for their reduced catalytic activity in all assay systems.

  7. Factors affecting domestic water consumption in rural households upon access to improved water supply: insights from the Wei River Basin, China

    OpenAIRE

    Liangxin Fan; Guobin Liu; Fei Wang; Violette Geissen; Ritsema, Coen J.

    2013-01-01

    Comprehensively understanding water consumption behavior is necessary to design efficient and effective water use strategies. Despite global efforts to identify the factors that affect domestic water consumption, those related to domestic water use in rural regions have not been sufficiently studied, particularly in villages that have gained access to improved water supply. To address this gap, we investigated 247 households in eight villages in the Wei River Basin where three types of improv...

  8. Wearable Electronic Device Design for Preventive Health Care-Related Purposes

    OpenAIRE

    Ginchev, Todor

    2015-01-01

    Medical diagnosis and healthcare recommendations are often challenging and require the correlation between different health-related inputs from the subject. On the one hand, some of the biometric data inputs are only possible to be determined by 24/7 monitoring, such as physical activity tracking, sleep quality or food intake nutritional information and quantity estimation. On the other hand, it is a big data problem as the correlation between all the inputs is rather challenging and time-con...

  9. Analisis Pelaksanaan Program Pos Pembinaan Terpadu Penyakit Tidak Menular di Wilayah Kerja Puskesmas Polonia Kecamatan Medan Polonia Tahun 2016

    OpenAIRE

    Annisa, Nina

    2016-01-01

    Non communicable diseases are usually caused by unhealthy lifestyle factors or also known as degenerative diseases. According to Riskesdas (2013) the prevalence of non communicable diseases keep increasing every year in Indonesia which including hypertension 26,5%, rheumatoid arthritis 24,7%, asthma 4,5%, chronic obstructive pulmonary disease 3,7%, diabetes mellitus 2,1%, coronary hearth disease 1,5%, and stroke 1,2%. Posbindu PTM (Non Communicable Disease Integrated Service...

  10. Evolution of Elliptical Galaxies at z >~ 1 Revealed from a Large, Multicolor Sample of Extremely Red Objects

    CERN Document Server

    Miyazaki, M; Kodama, T; Okamura, S; Furusawa, H; Ouchi, M; Nakata, F; Doi, M; Hamabe, M; Kimura, M; Komiyama, Yu; Miyazaki, S; Nagashima, C; Nagata, T; Nagayama, T; Nakajima, Y; Nakaya, H; Pickles, A J; Sato, S; Sekiguchi, K; Sekiguchi, M; Sugitani, K; Takata, T; Tamura, M; Yagi, M; Yasuda, N

    2002-01-01

    We study the evolution of elliptical galaxies at z >~ 1 on the basis of a sample of 247 Extremely Red Objects (EROs) with R-Ks >= 3.35 (AB) and Ks ~ 1.5 found by several authors, we conclude that the majority of ellipticals seen at present have not established either a red color or a smooth 1/4-law profile before z ~ 1.5$. (abridged)

  11. Self-mutilation and suicidal behaviour in Sami and Norwegian adolescents: prevalence and correlates

    OpenAIRE

    Kvernmo, Siv; Rosenvinge, Jan H

    2009-01-01

    Objectives. To study the prevalence and psychosocial and ethnocultural correlates of selfmutilation and/or suicidal behaviour in Indigenous Sami and majority Norwegian adolescents in north Norway. Study design. A cross-sectional questionnaire study. Methods. A total of 487 students, aged 13–16 years in 21 junior high schools and 247 parents participated in this school based questionnaire study conducted in 1990 in Finnmark, the county in Norway with the highest suicide rates. Sociodemographic...

  12. 《德国大地测量杂志》2002,76(5)要目

    Institute of Scientific and Technical Information of China (English)

    周琪校

    2002-01-01

    H. Schuh, M. Ulrich, D. Egger, J. Mueller, W. Schwegmann: Prediction of Earth orientation parameters by artificial neural networks: 247-258 利用人工神经网络预测地球定向参数 K. -R. Koch, J. Kusche: Regularization of geopotential determination from satellite data by variance components: 259-268 利用方差分量从卫星数据中调整确定地球重力位

  13. Sexual risk behaviors among HIV-infected South Indian couples in the HAART era: implications for reproductive health and HIV care delivery

    OpenAIRE

    Kartik K Venkatesh; Srikrishnan, AK; Safren, Steven A.; Triche, Elizabeth W.; Thamburaj, E.; Prasad, Lakshmi; Lurie, Mark N; Kumar, M. Suresh; N Kumarasamy; Solomon, Suniti; Mayer, Kenneth H.

    2011-01-01

    The current study examines sexual behaviors among HIV-infected Indians in primary care, where access to highly active antiretroviral therapy (HAART) has recently increased. Between January to April 2008, we assessed the sexual behaviors of 247 HIV-infected South Indians in care. Multivariable logistic regression models were used to determine predictors of being in a HIV-seroconcordant primary relationship, being sexually active, and reporting unprotected sex. Over three-fourths (80%) of parti...

  14. Disease: H00265 [KEGG MEDICUS

    Lifescience Database Archive (English)

    Full Text Available 1300 613115 614213 223900 256800 608654 256840 243000 PMID:16775373 (description, gene) Auer-Grumbach M, Mauko B, Auer-Grumba...net J Rare Dis 2:39 (2007) PMID:16969157 Verhoeven K, Timmerman V, Mauko B, Pieber TR, De Jonghe P, Auer-Grumba...tary sensory and autonomic neuropathies. Neurobiol Dis 21:247-55 (2006) PMID:20920666 Rotthier A, Auer-Grumba

  15. Posttraumatic stress due to an acute coronary syndrome increases risk of 42-month major adverse cardiac events and all-cause mortality

    OpenAIRE

    Edmondson, Donald; Rieckmann, Nina; Shaffer, Jonathan A.; Joseph E Schwartz; Burg, Matthew M.; Davidson, Karina W.; Clemow, Lynn; Shimbo, Daichi; Kronish, Ian M.

    2011-01-01

    Approximately 15% of patients with acute coronary syndromes (ACS) develop posttraumatic stress disorder (PTSD) due to their ACS event. We assessed whether ACS-induced PTSD symptoms increase risk for major adverse cardiac events (MACE) and all-cause mortality (ACM) in an observational cohort study of 247 patients (aged 25–93 years; 45% women) hospitalized for an ACS at one of 3 academic medical centers in New York and Connecticut between November 2003 and June 2005. Within 1 week of admission,...

  16. YouTube as a source of useful information on diabetes foot care.

    Science.gov (United States)

    Abedin, Tasnima; Ahmed, Salim; Al Mamun, Mohammad; Ahmed, Syed Walid; Newaz, Sanjida; Rumana, Nahid; Turin, Tanvir C

    2015-10-01

    Diabetes foot care related videos were identified in YouTube to assess their usefulness as a source of information. Two physician reviewers evaluated the videos and categorized those as very-useful (11.2%), moderately-useful (14.6%), somewhat-useful (24.7%) and not-useful (49.4%). YouTube videos on diabetes foot-care contained a variety of content ranging from very useful to not useful. PMID:26303266

  17. [The thermophilic streptomycetes flora in milk powders and condensed milk products (author's transl)].

    Science.gov (United States)

    Falkowski, J

    1978-08-01

    247 specimens of powdered milk and 165 of condensed milk were tested for their contamination with thermophile Streptomycetes. Colonies of these contaminants were isolated from all specimens of powdered milk and from 73 samples of condensed sweeted milk. The isolated strains corresponded with the following species of thermophilic Streptomycetes: Thermoactinomyces vulgaris, Tsiklinsky 1899, Thermoactinomyces vulgaris, Tsiklinsky 1899 "giant colonies", Micromonospora sp. (Agre et al., 1).

  18. Electronic structure of MgB2

    Indian Academy of Sciences (India)

    P Modak; R S Rao; B K Godwal; S K Sikka

    2002-05-01

    Results of ab initio electronic structure calculations on the compound MgB2 using the FPLAPW method employing GGA for the exchange-correlation energy are presented. Total energy minimization enables us to estimate the equilibrium volume, / ratio and the bulk modulus, all of which are in excellent agreement with experiment. We obtain the mass enhancement parameter by using our calculated (F) and the experimental specific heat data. The c is found to be 24.7 K.

  19. Unterdrückung von Bewegungsartefakten beim Langzeitmonitoring zur Anwendung in Personal-Healthcare-Systemen

    OpenAIRE

    Volmer, Achim

    2011-01-01

    Personal-Healthcare integriert die medizinische Vor- und Nachsorge in das häusliche Umfeld, indem ein kontinuierliches 24/7-Monitoring von Biosignalen und Vitalparametern durchgeführt wird. Im Rahmen dieser Arbeit wird ein Personal-Healthcare-System bestehend aus Sensorsystemen für die Messung des Elektrokardiogramms (EKG) sowie des Photoplethysmogramms (PPG) und der Sauerstoffsättigung entwickelt, die in ein Body-Sensor-Network eingebunden sind. Ein auf IEEE 802.15.4 basierendes entwickeltes...

  20. Does entrepreneurial confidence influence the nature of entrepreneurial projects chosen by individuals with high ability?

    OpenAIRE

    Bayon, Manoj; Lafuente González, Esteban Miguel; Vaillant, Yancy

    2015-01-01

    This empirical study of 247 nascent entrepreneurs examines the joint effect of high ability and entrepreneurial confidence is influencing the choice of innovative entrepreneurship. We suggest that in their decision to pursue entrepreneurship aspiring nascent entrepreneurs seek to gain strategic advantages that allow their new ventures to enter and compete in a given marketplace. We argue that aspiring nascent entrepreneurs create such advantages by choosing innovative entrepreneurial projects...