WorldWideScience

Sample records for berkelium 246

  1. New berkelium isotope: 242Bk

    International Nuclear Information System (INIS)

    A new isotope of berkelium, 242Bk, was produced with a cross section of approx. 10 μb in reactions of boron on uranium and nitrogen on thorium. It decays by electron capture with a half-life of 7 +- 1.3 minutes. The branching ratio for this isotope for alpha decay is less than 1% and that for spontaneous fission is less than 0.03%. 2 figures, 2 tables

  2. Characterization of berkelium(III) dipicolinate and borate compounds in solution and the solid state.

    Science.gov (United States)

    Silver, Mark A; Cary, Samantha K; Johnson, Jason A; Baumbach, Ryan E; Arico, Alexandra A; Luckey, Morgan; Urban, Matthew; Wang, Jamie C; Polinski, Matthew J; Chemey, Alexander; Liu, Guokui; Chen, Kuan-Wen; Van Cleve, Shelley M; Marsh, Matthew L; Eaton, Teresa M; van de Burgt, Lambertus J; Gray, Ashley L; Hobart, David E; Hanson, Kenneth; Maron, Laurent; Gendron, Frédéric; Autschbach, Jochen; Speldrich, Manfred; Kögerler, Paul; Yang, Ping; Braley, Jenifer; Albrecht-Schmitt, Thomas E

    2016-08-26

    Berkelium is positioned at a crucial location in the actinide series between the inherently stable half-filled 5f(7) configuration of curium and the abrupt transition in chemical behavior created by the onset of a metastable divalent state that starts at californium. However, the mere 320-day half-life of berkelium's only available isotope, (249)Bk, has hindered in-depth studies of the element's coordination chemistry. Herein, we report the synthesis and detailed solid-state and solution-phase characterization of a berkelium coordination complex, Bk(III)tris(dipicolinate), as well as a chemically distinct Bk(III) borate material for comparison. We demonstrate that berkelium's complexation is analogous to that of californium. However, from a range of spectroscopic techniques and quantum mechanical calculations, it is clear that spin-orbit coupling contributes significantly to berkelium's multiconfigurational ground state. PMID:27563098

  3. Extraction of tetravalent berkelium and cerium by aliquate-336-S-NO3 quaternary ammonium salt

    International Nuclear Information System (INIS)

    Extraction of tetravalent berkelium and cerium by aliquate-336-S-NO3 quaternary ammonium salt from nitric acid solutions is investigated. The effect of concentrations of nitric acid and extracting agent, nature of an oxidant (potassium bromate, potassium bichromate, mixture of AgNO3 and (NH4)2S2O8) and solvent on the distribution coefficient of berkelium(4) and cerium(4) is studied. It is established that solutions of aliquate-336-S-NO3 in carbon tetrachloride and dichloroethane extract quantitatively tetravalent berkelium from 10-12 M nitric acid solutions and cerium - from 1-10 M nitric acid solutions containing potassium bichromate as an oxidant. It is shown that the value of distribution coefficient for berkelium and cerium depends on the nature of an oxidant and extracting agent concentration. It is established that in the case of extraction by quaternary ammonium salt with one berkelium(4) mole four aliquate-336-SNO3 moles are associated and 1.5-1.6 mole of extracting agent are associated with one cerium(4) mole. It permits to make a conclusion that stoichiometry of extraction reactions by quaternary ammonium salt is not the same for tetravalent berkelium and cerium. It is shown that trivalent transplutonium and rare earth elements are not practically extracted by aliquate-336-S-NO3 from nitric acid solutions

  4. 48 CFR 2453.246 - Quality Assurance.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 6 2010-10-01 2010-10-01 true Quality Assurance. 2453.246 Section 2453.246 Federal Acquisition Regulations System DEPARTMENT OF HOUSING AND URBAN DEVELOPMENT CLAUSES AND FORMS FORMS Prescription of Forms 2453.246 Quality Assurance....

  5. 32 CFR 246.5 - Responsibilities.

    Science.gov (United States)

    2010-07-01

    ... 32 National Defense 2 2010-07-01 2010-07-01 false Responsibilities. 246.5 Section 246.5 National... STARS AND STRIPES (S&S) NEWSPAPER AND BUSINESS OPERATIONS § 246.5 Responsibilities. (a) The Assistant to the Secretary of Defense (Public Affairs), under 32 CFR part 375, as the principal staff assistant...

  6. 42 CFR 431.246 - Corrective action.

    Science.gov (United States)

    2010-10-01

    ... 42 Public Health 4 2010-10-01 2010-10-01 false Corrective action. 431.246 Section 431.246 Public... Recipients Procedures § 431.246 Corrective action. The agency must promptly make corrective payments, retroactive to the date an incorrect action was taken, and, if appropriate, provide for admission...

  7. 7 CFR 246.11 - Nutrition education.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 4 2010-01-01 2010-01-01 false Nutrition education. 246.11 Section 246.11 Agriculture... Participant Benefits § 246.11 Nutrition education. (a) General. (1) Nutrition education shall be considered a benefit of the Program, and shall be made available at no cost to the participant. Nutrition...

  8. Dicty_cDB: CHR246 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CH (Link to library) CHR246 (Link to dictyBase) - - - Contig-U16475-1 CHR246P (Link to Original site) CHR...246F 145 CHR246Z 524 CHR246P 649 - - Show CHR246 Library CH (Link to library) Clone ID CHR... URL http://dictycdb.biol.tsukuba.ac.jp/CSM/CH/CHR2-B/CHR246Q.Seq.d/ Representative seq. ID CHR...246P (Link to Original site) Representative DNA sequence >CHR246 (CHR246Q) /CSM/CH/CHR2-B/CHR2...equences producing significant alignments: (bits) Value N AC116957 |AC116957.2 Dictyostelium discoideum chro

  9. 50 CFR 665.246 - Gear identification.

    Science.gov (United States)

    2010-10-01

    ... 50 Wildlife and Fisheries 9 2010-10-01 2010-10-01 false Gear identification. 665.246 Section 665.246 Wildlife and Fisheries FISHERY CONSERVATION AND MANAGEMENT, NATIONAL OCEANIC AND ATMOSPHERIC... Gear identification. In Permit Area 1, the vessel's official number must be marked legibly on all...

  10. 7 CFR 246.21 - Investigations.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 4 2010-01-01 2010-01-01 false Investigations. 246.21 Section 246.21 Agriculture Regulations of the Department of Agriculture (Continued) FOOD AND NUTRITION SERVICE, DEPARTMENT OF AGRICULTURE..., where appropriate, a review of pertinent practices and policies of any State or local agency,...

  11. 7 CFR 246.8 - Nondiscrimination.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 4 2010-01-01 2010-01-01 false Nondiscrimination. 246.8 Section 246.8 Agriculture Regulations of the Department of Agriculture (Continued) FOOD AND NUTRITION SERVICE, DEPARTMENT OF AGRICULTURE CHILD NUTRITION PROGRAMS SPECIAL SUPPLEMENTAL NUTRITION PROGRAM FOR WOMEN, INFANTS AND CHILDREN Participant Eligibility §...

  12. 48 CFR 246.470 - Government contract quality assurance actions.

    Science.gov (United States)

    2010-10-01

    ... quality assurance actions. 246.470 Section 246.470 Federal Acquisition Regulations System DEFENSE ACQUISITION REGULATIONS SYSTEM, DEPARTMENT OF DEFENSE CONTRACT MANAGEMENT QUALITY ASSURANCE Government Contract Quality Assurance 246.470 Government contract quality assurance actions....

  13. Dicty_cDB: AFM246 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available AF (Link to library) AFM246 (Link to dictyBase) - - - - - (Link to Original site) - - AFM...246Z 559 - - - - Show AFM246 Library AF (Link to library) Clone ID AFM246 (Link to dictyBase) Atlas ID... - NBRP ID - dictyBase ID - Link to Contig - Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/AF/AFM2-B/AFM...246Q.Seq.d/ Representative seq. ID - (Link to Original site) Representative DNA sequence >AFM...246 (AFM246Q) /CSM/AF/AFM2-B/AFM246Q.Seq.d/ XXXXXXXXXXAGATTAAACAATTCATTCTTGATGAATGTGATACC

  14. Mechanistic studies of APR-246 in leukemia

    OpenAIRE

    Ali, Dina Mahmoud

    2013-01-01

    PRIMA-1and its analog APR-246 are novel drugs that restore the active conformation of mutated and unfolded p53 protein and induce apoptosis and cell death in various tumors in pre-clinical models. We first aimed to explore the effects of APR-246 alone and in combination with other drugs in acute myeloid leukemia (AML) in vitro. APR-246 induced dose-dependent apoptosis and increased active caspase-3 and p53 protein levels as well as the Bax/Bcl-2 ratio independently of TP53...

  15. 40 CFR 246.202-1 - Requirement.

    Science.gov (United States)

    2010-07-01

    ...-1 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) SOLID WASTES SOURCE SEPARATION FOR MATERIALS RECOVERY GUIDELINES Requirements and Recommended Procedures § 246.202-1 Requirement. Any commercial establishment generating 10 or more tons of waste corrugated containers per month...

  16. 48 CFR 252.246-7002 - Warranty of construction (Germany).

    Science.gov (United States)

    2010-10-01

    ... (Germany). 252.246-7002 Section 252.246-7002 Federal Acquisition Regulations System DEFENSE ACQUISITION... of Provisions And Clauses 252.246-7002 Warranty of construction (Germany). As prescribed in 246.710(4), use the following clause: Warranty of Construction (Germany) (JUN 1997) (a) In addition to any...

  17. 48 CFR 246.408-71 - Aircraft.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Aircraft. 246.408-71... Aircraft. (a) The Federal Aviation Administration (FAA) has certain responsibilities and prerogatives in connection with some commercial aircraft and of aircraft equipment and accessories (Pub. L. 85-726 (72...

  18. Dicty_cDB: AFG246 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available AF (Link to library) AFG246 (Link to dictyBase) - - - Contig-U15510-1 AFG246P (Link to Original ... yhkllnmlkrlfqmd lhmnqmdqfiliq*hfqkhmimvn*--- ---lh*imc *tkdkskikfn*cnrrvyhlhflcfrfnrifnrlfndwfrfrw*r*yrrgd ...

  19. 40 CFR 246.200 - High-grade paper recovery.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 24 2010-07-01 2010-07-01 false High-grade paper recovery. 246.200 Section 246.200 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) SOLID WASTES SOURCE... paper recovery....

  20. 48 CFR 52.246-14 - Inspection of Transportation.

    Science.gov (United States)

    2010-10-01

    ... Transportation. 52.246-14 Section 52.246-14 Federal Acquisition Regulations System FEDERAL ACQUISITION REGULATION....246-14 Inspection of Transportation. As prescribed in 46.314, insert the following clause in solicitations and contracts for freight transportation services (including local drayage) by rail,...

  1. 40 CFR 246.202-5 - Recommended procedures: Transportation.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 24 2010-07-01 2010-07-01 false Recommended procedures: Transportation. 246.202-5 Section 246.202-5 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED... § 246.202-5 Recommended procedures: Transportation. Transportation to market may be supplied by...

  2. 40 CFR 246.200-7 - Recommended procedures: Transportation.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 24 2010-07-01 2010-07-01 false Recommended procedures: Transportation. 246.200-7 Section 246.200-7 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED... § 246.200-7 Recommended procedures: Transportation. Transportation to market may be supplied by...

  3. 40 CFR 246.201-4 - Recommended procedures: Market study.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 24 2010-07-01 2010-07-01 false Recommended procedures: Market study. 246.201-4 Section 246.201-4 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED... § 246.201-4 Recommended procedures: Market study. An investigation of markets should be made for...

  4. 40 CFR 246.202-3 - Recommended procedures: Market study.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 24 2010-07-01 2010-07-01 false Recommended procedures: Market study. 246.202-3 Section 246.202-3 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED... § 246.202-3 Recommended procedures: Market study. An investigation of markets should be made by...

  5. 40 CFR 246.200-3 - Recommended procedures: Market study.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 24 2010-07-01 2010-07-01 false Recommended procedures: Market study. 246.200-3 Section 246.200-3 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED... § 246.200-3 Recommended procedures: Market study. An investigation of markets should be made by...

  6. 48 CFR 552.246-71 - Source Inspection by Government.

    Science.gov (United States)

    2010-10-01

    ... Government. 552.246-71 Section 552.246-71 Federal Acquisition Regulations System GENERAL SERVICES....246-71 Source Inspection by Government. As prescribed in 546.302-71, insert the following clause: Source Inspection by Government (JUNE 1, 2009) (a) Inspection by Government personnel. (1) Supplies to...

  7. Mesityl(2,4,6-trimethoxyphenylborinic acid

    Directory of Open Access Journals (Sweden)

    Sergiusz Luliński

    2010-07-01

    Full Text Available In the title molecule, C18H23BO4, the dihedral angle between the least-squares planes of the aromatic rings is 84.88 (3°. The B atom deviates by 0.202 (1 Å from the least-squares plane of the mesityl ring. All of the methoxy groups are approximately coplanar with the 2,4,6-trimethoxyphenyl ring, whereas the BOH group is twisted with respect to it by 19.5°. The borinic OH group is engaged in an intramolecular O—H...O hydrogen bond with one of ortho-methoxy groups. The molecular structure is stabilized by weak C—H...O contacts. In the crystal, molecules are linked by weak C—H...O and C—H...π interactions, generating a three-dimensional network.

  8. Dicty_cDB: SHA246 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SH (Link to library) SHA246 (Link to dictyBase) - - - Contig-U10899-1 | Contig-U12190-1 SHA246P ... 4-21.b_022.ab1 Whole-genome shotgun library of the elephant ... shark (aka elephant ... fish) Callorhinchus milii geno ...

  9. Dicty_cDB: AFJ246 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available AF (Link to library) AFJ246 (Link to dictyBase) - - - Contig-U16240-1 AFJ246P (Link to Original ... il**mvq***slfklffklsirsrslg*f*ynrwwwtictn*wcwiw *p*sip *vck*siqsvslf*a--- ---TSVCFDGQCSVCXVDSSSVXISXTGIVTT ...

  10. 40 CFR 246.200-6 - Recommended procedures: Storage.

    Science.gov (United States)

    2010-07-01

    ....200-6 Section 246.200-6 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) SOLID WASTES SOURCE SEPARATION FOR MATERIALS RECOVERY GUIDELINES Requirements and Recommended Procedures § 246..., the use of stationary compactors, or storage in corrugated boxes or normal waste containers....

  11. 21 CFR 520.246 - Butorphanol tartrate tablets.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 6 2010-04-01 2010-04-01 false Butorphanol tartrate tablets. 520.246 Section 520.246 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES (CONTINUED... tartrate tablets. (a) Specifications. Each tablet contains 1, 5, or 10 milligrams of butorphanol...

  12. 7 CFR 246.5 - Selection of local agencies.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 4 2010-01-01 2010-01-01 false Selection of local agencies. 246.5 Section 246.5 Agriculture Regulations of the Department of Agriculture (Continued) FOOD AND NUTRITION SERVICE, DEPARTMENT OF... cost efficiency and cost effectiveness of the local agency in terms of both food and nutrition...

  13. 7 CFR 246.13 - Financial management system.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 4 2010-01-01 2010-01-01 false Financial management system. 246.13 Section 246.13 Agriculture Regulations of the Department of Agriculture (Continued) FOOD AND NUTRITION SERVICE, DEPARTMENT OF AGRICULTURE CHILD NUTRITION PROGRAMS SPECIAL SUPPLEMENTAL NUTRITION PROGRAM FOR WOMEN, INFANTS AND CHILDREN State Agency Provisions §...

  14. 7 CFR 246.9 - Fair hearing procedures for participants.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 4 2010-01-01 2010-01-01 false Fair hearing procedures for participants. 246.9 Section 246.9 Agriculture Regulations of the Department of Agriculture (Continued) FOOD AND NUTRITION SERVICE, DEPARTMENT OF AGRICULTURE CHILD NUTRITION PROGRAMS SPECIAL SUPPLEMENTAL NUTRITION PROGRAM FOR WOMEN, INFANTS AND CHILDREN Participant...

  15. 7 CFR 246.15 - Program income other than grants.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 4 2010-01-01 2010-01-01 false Program income other than grants. 246.15 Section 246.15 Agriculture Regulations of the Department of Agriculture (Continued) FOOD AND NUTRITION SERVICE, DEPARTMENT OF AGRICULTURE CHILD NUTRITION PROGRAMS SPECIAL SUPPLEMENTAL NUTRITION PROGRAM FOR WOMEN, INFANTS AND CHILDREN State Agency Provisions §...

  16. 48 CFR 246.704 - Authority for use of warranties.

    Science.gov (United States)

    2010-10-01

    ... acquisitions for— (i) Commercial items (see FAR 46.709); (ii) Technical data, unless the warranty provides for extended liability (see 246.708); (iii) Supplies and services in fixed-price type contracts...

  17. Dicty_cDB: VHP246 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHP246 (Link to dictyBase) - - - Contig-U16439-1 VHP246P (Link to Original ... (bits) Value (Q55C16) RecName: Full=Ubiquitin-like modi fier-activating enzyme... 375 e-102 EF468345_1( EF4 ... BC047256 |pid:none) Xenopus laevis ubiquitin-like modi ... 200 9e-50 AB040073_1( AB040073 |pid:none) Xenop ...

  18. Dicty_cDB: VHD246 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHD246 (Link to dictyBase) - - - Contig-U11170-1 VHD246P (Link to Original ... ce. 38 0.28 5 CX072513 |CX072513.1 UCRCS08_28E10_g Parent ... Washington Navel Orange Callus cDNA Library UCRCS0 ... nce. 46 1.4 1 CX072512 |CX072512.1 UCRCS08_28E10_b Parent ... Washington Navel Orange Callus cDNA Library UCRCS0 ...

  19. 48 CFR 246.470-2 - Quality evaluation data.

    Science.gov (United States)

    2010-10-01

    ... SYSTEM, DEPARTMENT OF DEFENSE CONTRACT MANAGEMENT QUALITY ASSURANCE Government Contract Quality Assurance 246.470-2 Quality evaluation data. The contract administration office shall establish a system for the... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Quality evaluation...

  20. 7 CFR 246.6 - Agreements with local agencies.

    Science.gov (United States)

    2010-01-01

    ... nutrition education services to participants, in compliance with § 246.11 and FNS guidelines and... Agriculture Regulations of the Department of Agriculture (Continued) FOOD AND NUTRITION SERVICE, DEPARTMENT OF AGRICULTURE CHILD NUTRITION PROGRAMS SPECIAL SUPPLEMENTAL NUTRITION PROGRAM FOR WOMEN, INFANTS AND...

  1. 40 CFR Appendix to Part 246 - Recommended Bibliography

    Science.gov (United States)

    2010-07-01

    ... Part 246 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) SOLID WASTES SOURCE... Belknap, M. Paper recycling: a business perspective. Subcommittee on Solid Waste, New York Chamber of... Publication SW-155. Washington, U.S. Government Printing Office, 1975. 26 p. Hansen, P. Solid waste...

  2. 48 CFR 1852.246-73 - Human space flight item.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 6 2010-10-01 2010-10-01 true Human space flight item... 1852.246-73 Human space flight item. As prescribed in 1845.370(b), insert the following clause: Human Space Flight Item (MAR 1997) The Contractor shall include the following statement in all...

  3. 40 CFR 86.246-94 - Intermediate temperature testing.

    Science.gov (United States)

    2010-07-01

    ...) contained in 40 CFR part 86, subpart C. (c) For testing at temperatures of 50 °F (10 °C) or higher, the FTP... 40 Protection of Environment 18 2010-07-01 2010-07-01 false Intermediate temperature testing. 86... New Medium-Duty Passenger Vehicles; Cold Temperature Test Procedures § 86.246-94...

  4. Development of ST-246® for Treatment of Poxvirus Infections

    Directory of Open Access Journals (Sweden)

    Dennis E. Hruby

    2010-11-01

    Full Text Available ST-246 (Tecovirimat is a small synthetic antiviral compound being developed to treat pathogenic orthopoxvirus infections of humans. The compound was discovered as part of a high throughput screen designed to identify inhibitors of vaccinia virus-induced cytopathic effects. The antiviral activity is specific for orthopoxviruses and the compound does not inhibit the replication of other RNA- and DNA-containing viruses or inhibit cell proliferation at concentrations of compound that are antiviral. ST-246 targets vaccinia virus p37, a viral protein required for envelopment and secretion of extracellular forms of virus. The compound is orally bioavailable and protects multiple animal species from lethal orthopoxvirus challenge. Preclinical safety pharmacology studies in mice and non-human primates indicate that ST-246 is readily absorbed by the oral route and well tolerated with the no observable adverse effect level (NOAEL in mice measured at 2000 mg/kg and the no observable effect level (NOEL in non-human primates measured at 300 mg/kg. Drug substance and drug product processes have been developed and commercial scale batches have been produced using Good Manufacturing Processes (GMP. Human phase I clinical trials have shown that ST-246 is safe and well tolerated in healthy human volunteers. Based on the results of the clinical evaluation, once a day dosing should provide plasma drug exposure in the range predicted to be antiviral based on data from efficacy studies in animal models of orthopoxvirus disease. These data support the use of ST-246 as a therapeutic to treat pathogenic orthopoxvirus infections of humans.

  5. 48 CFR 52.246-17 - Warranty of Supplies of a Noncomplex Nature.

    Science.gov (United States)

    2010-10-01

    ... Noncomplex Nature. 52.246-17 Section 52.246-17 Federal Acquisition Regulations System FEDERAL ACQUISITION... Clauses 52.246-17 Warranty of Supplies of a Noncomplex Nature. As prescribed in 46.710(a)(1), insert a clause substantially as follows: Warranty of Supplies of a Noncomplex Nature (JUN 2003) (a)...

  6. 48 CFR 52.246-18 - Warranty of Supplies of a Complex Nature.

    Science.gov (United States)

    2010-10-01

    ... Complex Nature. 52.246-18 Section 52.246-18 Federal Acquisition Regulations System FEDERAL ACQUISITION... Clauses 52.246-18 Warranty of Supplies of a Complex Nature. As prescribed in 46.710(b)(1), insert a clause substantially as follows: Warranty of Supplies of a Complex Nature (MAY 2001) (a) Definitions. As used in...

  7. 48 CFR 552.246-77 - Additional Contract Warranty Provisions for Supplies of a Noncomplex Nature.

    Science.gov (United States)

    2010-10-01

    ... Warranty Provisions for Supplies of a Noncomplex Nature. 552.246-77 Section 552.246-77 Federal Acquisition... a Noncomplex Nature. As prescribed in 546.710(a), insert the following clause in solicitations and contracts that include FAR 52.246-17, Warranty of Supplies of a Noncomplex Nature. Additional...

  8. 10 CFR 431.246 - Energy conservation standards and their effective dates.

    Science.gov (United States)

    2010-01-01

    ... 10 Energy 3 2010-01-01 2010-01-01 false Energy conservation standards and their effective dates. 431.246 Section 431.246 Energy DEPARTMENT OF ENERGY ENERGY CONSERVATION ENERGY EFFICIENCY PROGRAM FOR CERTAIN COMMERCIAL AND INDUSTRIAL EQUIPMENT Unit Heaters Energy Conservation Standards § 431.246...

  9. 48 CFR 246.402 - Government contract quality assurance at source.

    Science.gov (United States)

    2010-10-01

    ... quality assurance at source. 246.402 Section 246.402 Federal Acquisition Regulations System DEFENSE ACQUISITION REGULATIONS SYSTEM, DEPARTMENT OF DEFENSE CONTRACT MANAGEMENT QUALITY ASSURANCE Government Contract Quality Assurance 246.402 Government contract quality assurance at source. Do not...

  10. 40 CFR 246.201-6 - Recommended procedures: Transportation to market.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 24 2010-07-01 2010-07-01 false Recommended procedures: Transportation to market. 246.201-6 Section 246.201-6 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY... Procedures § 246.201-6 Recommended procedures: Transportation to market. Transportation to market may...

  11. Dicty_cDB: SHK246 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CJ486536 |CJ486536.1 Macaca fascicularis mRNA, clone: QtsA-14165, 5' end, expressed in testis. 42 0.012 2 A...frontal lobe. 48 0.54 1 AM076235 |AM076235.1 Staphylococcus aureus partial sdrD gene for Ser-Asp rich fibrinogen-binding, bone si...l*tr*sttfksfh tfkynnlvtr*sngckcntq*scqrsiys*rtk*ryy*sdhlcnwr*gytrf*khni*g* wlrgwccyssiip...00686 |pid:none) Roseiflexus sp. RS-1, complete ... 75 5e-12 (Q7A780) RecName: Full=Serine-aspartate repeat-...SH (Link to library) SHK246 (Link to dictyBase) - - - Contig-U15700-1 SHK246P (Link to Original si

  12. Determination of 2,4,6-trichloroanisole by cyclic voltammetry

    OpenAIRE

    Freitas, Patrícia; Dias, L.G.; Peres, António M.; Luís M. de Castro; Veloso, Ana C. A.

    2012-01-01

    The electrochemical reduction of 2,4,6-trichloroanisole (TCA), which is a chlorinated arene with electron-donating substituents, was evaluated by cyclic voltammetry (CV). TCA is a major concern for the winery industry since it is related with “cork taint”, a wine defect. The results obtained in this work showed that CV could be used to detect and quantify TCA in preparative standard solutions. Linear relationships could be set between the current amplitude and TCA concentration (R...

  13. Solidification Effects in MAR-M246(Hf) Alloy

    Science.gov (United States)

    Johnston, M. H.; Parr, R. A.

    1987-01-01

    Fatigue properties degraded with crystallographic orientations greater than 10 degrees from {001} axis. Influence of solidification and heat-treatment parameters on structure and fatigue properties of nickel-based superalloy MAR-M246(Hf) described in 24-page report. Superalloys have high strength and corrosion resistance at temperatures up to 1,400 degrees C; their uses range from petrochemical equipment to marine, industrial, aircraft, and vehicular gas turbines.

  14. Photocatalytic degradation of 2,4,6-trinitrotoluene

    Institute of Scientific and Technical Information of China (English)

    LIU XiuHua; FU YiBei; WANG HeYi; ZHONG ZhiJing; XU YunShu

    2008-01-01

    A Pt/TiO2 photocatalyst was used in the photocatalytic degradation of 2,4,6-trinitrotoluene (TNT) under the irradiation of the simulated sunlight. The results show that the destruction of TNT is faster and more complete with the photocatalyst. The photocatalytic degradation of TNT follows first order kinetics. The transformation of nitryl groups of TNT molecules into nitrite and nitrate ions may be accelerated in the presence of the Pt/TiO2 photocatalyst. Compared with that without the catalyst, the concentration of nitrate ions was improved 32.3 times within 2.5 h.

  15. Dicty_cDB: SHJ246 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SH (Link to library) SHJ246 (Link to dictyBase) - - - Contig-U16427-1 - (Link to Original site) ... yfg*ytlyiyiiq*nviffrtdfrkdgfhr*ry*ihgns*sck*irkryf*ngs ... nl*k*ncykiisins*fsk*csrkcc*mfrfin*ks*rftsnrny*yiik ... f--- Homology vs CSM-cDNA Score E Sequences producing s ignificant alignments: (bits) Value VHP493 (VHP493 ... 003. 6. 8 Homology vs DNA Score E Sequences producing s ignificant alignments: (bits) Value N AC116956 |AC ... 5.10 Homology vs Protein Score E Sequences producing s ignificant alignments: (bits) Value (Q86KD1) RecNa ...

  16. 25 CFR 1000.246 - Must an AFA that contains a construction project or activity incorporate provisions of Federal...

    Science.gov (United States)

    2010-04-01

    ... 25 Indians 2 2010-04-01 2010-04-01 false Must an AFA that contains a construction project or activity incorporate provisions of Federal construction standards? 1000.246 Section 1000.246 Indians OFFICE... Construction § 1000.246 Must an AFA that contains a construction project or activity incorporate provisions...

  17. 33 CFR 148.246 - When is a document considered filed and where should I file it?

    Science.gov (United States)

    2010-07-01

    ... filed and where should I file it? 148.246 Section 148.246 Navigation and Navigable Waters COAST GUARD... Formal Hearings § 148.246 When is a document considered filed and where should I file it? (a) If a document to be filed is submitted by mail, it is considered filed on the date it is postmarked. If...

  18. Two new polytypes of 2,4,6-tribromobenzonitrile

    Directory of Open Access Journals (Sweden)

    Doyle Britton

    2016-02-01

    Full Text Available Three polymorphs of 2,4,6-tribromobenzonitrile (RCN, C7H2Br3N, two of which are novel and one of which is a redetermination of the original structure first determined by Carter & Britton [(1972. Acta Cryst. B28, 945–950] are found to be polytypic. Each has a layer structure which differs only in the stacking of the layers. Each layer is composed of molecules associated through C[triple-bond]N...Br contacts which form R22(10 rings. Two such rings are associated with each N atom; one with each ortho-Br atom. No new polytypes of 1,3,5-tribromo-2-isocyanobenzene (RNC were found but a re-determination of the original structure by Carter et al. [(1977. Cryst. Struct. Commun. 6, 543–548] is presented. RNC was found to be isostructural with one of the novel polytypes of RCN. Unit cells were determined for 23 RCN samples and 11 RNC samples. Polytypes could not be distinguished based on crystal habits. In all four structures, each molecule of the asymmetric unit lies across a mirror plane.

  19. 10 CFR 72.246 - Issuance of amendment to a certificate of compliance.

    Science.gov (United States)

    2010-01-01

    ... INDEPENDENT STORAGE OF SPENT NUCLEAR FUEL, HIGH-LEVEL RADIOACTIVE WASTE, AND REACTOR-RELATED GREATER THAN CLASS C WASTE Approval of Spent Fuel Storage Casks § 72.246 Issuance of amendment to a certificate...

  20. Bis(2,4,6-triaminopyrimidin-1-ium sulfate pentahydrate

    Directory of Open Access Journals (Sweden)

    Yupa Wattanakanjana

    2013-08-01

    Full Text Available The asymmetric unit of the title salt, 2C4H8N5+·SO42−·5H2O, contains four 2,4,6-triaminopyrimidinium (TAPH+ cations, two sulfate anions and ten lattice water molecules. Each two of the four TAPH+ cations form dimers via N—H...N hydrogen bonds between the amino groups and the unprotonated pyrimidine N atoms [graph-set motif R22(8]. The (TAPH+2 dimers, in turn, form slightly offset infinite π–π stacks parallel to [010], with centroid–centroid distances between pyrimidine rings of 3.5128 (15 and 3.6288 (16 Å. Other amino H atoms, as well as the pyrimidinium N—H groups, are hydrogen-bonded to sulfate and lattice water O atoms. The SO42− anions and water molecules are interconnected with each other via O—H...O hydrogen bonds. The combination of hydrogen-bonding interactions and π–π stacking leads to the formation of a three-dimensional network with alternating columns of TAPH+ cations and channels filled with sulfate anions and water molecules. One of the sulfate anions shows a minor disorder by a ca 37° rotation around one of the S—O bonds [occupancy ratio of the two sets of sites 0.927 (3:0.073 (3]. One water molecule is disordered over two mutually exclusive positions with an occupancy ratio of 0.64 (7:0.36 (7.

  1. Penta- and 2,4,6-tri-chlorophenol biodegradation during municipal solid waste anaerobic digestion.

    Science.gov (United States)

    Limam, Intissar; Limam, Rim Driss; Mezni, Mohamed; Guenne, Angéline; Madigou, Céline; Driss, Mohamed Ridha; Bouchez, Théodore; Mazeas, Laurent

    2016-08-01

    In this study isotopic tracing using (13)C labelled pentachlorophenol (PCP) and 2,4,6-trichlorophenol (2,4,6-TCP) is proposed as a tool to distinguish the loss of PCP and 2,4,6-TCP due to biodegradation from other physical processes. This isotopic approach was applied to accurately assess in situ PCP and 2,4,6-TCP degradation under methanogenic conditions in several microcosms made up of household waste. These microcosms were incubated in anaerobic conditions at 35°C (mesophilic) and 55°C (thermophilic) without agitation. The volume of biogas produced (CH4 and CO2), was followed for a period of 130 days. At this stage of stable methanogenesis, (13)C6-PCP and (13)C6-2,4,6-TCP were introduced anaerobically in microcosms and its monitoring at mesophilic and thermophilic conditions was performed in parallel by gas chromatography mass spectrometry (GC-MS) and gas chromatography isotope-ratio mass spectrometry (GC-IRMS). This study proved the almost total dechlorination of bioavailable PCP and 2,4,6-TCP into 4-CP at 35°C. Nevertheless, high rate adsorption in particular materials of the two compounds was observed. Furthermore, Carbon-13 Nuclear Magnetic Resonance ((13)C-NMR) Spectroscopy analysis of (13)C labelled 2,4,6-TCP mesophilic incubations showed the partial mineralization of 4-CP at 35°C to acetate and then to HCO(3-). Consequently, NMR results confirm the biogas isotopic results indicating the mineralization of (13)C labelled 2,4,6-TCP into (13)C (CH4 and CO2). Concerning (13)C labelled PCP mesophilic incubations, the isotopic composition of the biogas still natural until the day 262. In contrast, no dechlorination was observed at 55°C. Thus PCP and 2,4,6-TCP were persistent in thermophilic conditions. PMID:27151678

  2. Inhibitory activities against rice pathogens of 8-hydroxy-2,4,6-octatriynamide from Agrocybe sp.

    Science.gov (United States)

    Zheng, Yongbiao; Xu, Xiaoping; Wu, Yabin

    2016-03-01

    8-Hydroxy-2,4,6-octatriynamide, a natural polyacetylene with inhibitory activities against rice pathogens, was isolated from the liquid fermentation broth of strain Agrocybe sp. YB2005 during screening for new natural chemical agents to control rice pathogens. 8-hydroxy-2,4,6-octatriynamide was purified by consecutive chromatography over a Cl8 reversed phase silica gel, sephadex LH-20 and silica gel. The chemical structure of 8-hydroxy-2,4,6-octatriynamide was elucidated through spectroscopic analyses, including 1D- and 2D-NMR, ESI mass spectrometry and X-ray single crystal diffraction. Bioassays showed that 8-hydroxy-2,4,6-octatriynamide could significantly inhibit growth of Xanthomonas oryzae with an MIC of 53.1 μM in a 96-well plate and the growth of Rhizoctonia solani at 1.02 mM in a 24-well plate. When rice leaves were inoculated with Magnaporthe grisea and cultured in artificial nutrition liquid containing 0.34 mM 8-hydroxy-2,4,6-octatriynamide, no rice blast was observed. The present study implied that 8-hydroxy-2,4,6-octatriynamide could be a candidate agent against rice pathogens. PMID:26861586

  3. Pathway of the ozonation of 2,4,6-trichlorophenol in aqueous solution

    Institute of Scientific and Technical Information of China (English)

    PI Yunzheng; WANG Jianlong

    2007-01-01

    The reaction mechanism and pathway of the ozonation of 2,4,6-trichlorophenol(2,4,6-TCP)in aqueous solution were investigated.The removal efficiency and the variation of H2O2,Cl-,formic acid,and oxalic acid were studied during the semi-batch ozonation experiments(continuous for ozone gas supply,fixed volume of water sample).The results showed that when there was no scavenger,the removal efficiency of 0.1 mmol/L 2,4,6-TCP could reach 99% within 6 min by adding 24 mg/L ozone.The reaction of molecular ozone with 1 2,4,6-TCP resulted in the formation of H2O2.The maximal concentration of H2O2 detected during the ozonation could reach 22.5% of the original concentration of 2,4,6-TCP.The reaction of ozone with H2O2 resulted in the molecule firstly degraded 2,4,6-TCP to form chlorinated quinone,which was subsequently oxidized to formic acid and oxalic acid.Two reaction pathways of the degradation of 2,4,6-TCP by ozone and O2/OH·were proposed in this study.

  4. Isolation of Pseudomonas pickettii strains that degrade 2,4,6-trichlorophenol and their dechlorination of chlorophenols.

    OpenAIRE

    Kiyohara, H.; Hatta, T; Ogawa, Y.; T Kakuda; H. Yokoyama; Takizawa, N

    1992-01-01

    Three strains of Pseudomonas pickettii that can grow with 2,4,6-trichlorophenol (2,4,6-TCP) as the sole source of carbon and energy were isolated from different mixed cultures of soil bacterial populations that had been acclimatized to 2,4,6-TCP. These strains released 3 mol of chloride ion from 1 mol of 2,4,6-TCP during the complete degradation of the TCP. Of these strains, P. pickettii DTP0602 in high-cell-density suspension cultures dechlorinated various chlorophenols (CPs). Cells that wer...

  5. Functions of Flavin Reductase and Quinone Reductase in 2,4,6-Trichlorophenol Degradation by Cupriavidus necator JMP134▿

    OpenAIRE

    Belchik, Sara Mae; Xun, Luying

    2007-01-01

    The tcpRXABCYD operon of Cupriavidus necator JMP134 is involved in the degradation of 2,4,6-trichlorophenol (2,4,6-TCP), a toxic pollutant. TcpA is a reduced flavin adenine dinucleotide (FADH2)-dependent monooxygenase that converts 2,4,6-TCP to 6-chlorohydroxyquinone. It has been implied via genetic analysis that TcpX acts as an FAD reductase to supply TcpA with FADH2, whereas the function of TcpB in 2,4,6-TCP degradation is still unclear. In order to provide direct biochemical evidence for t...

  6. Condensation monomers and polymers based on 2,4,6-trinitrotoluene

    International Nuclear Information System (INIS)

    The feasibility of conversion of 2,4,6-trinitrotoluene into condensation monomers (nitro compounds, diamines, etc.) and their applications in the synthesis of aromatic polymers has been analysed within the framework of a general problem of 2,4,6-trinitroluene conversion. The use of aromatic dinitro compounds and diamines for the preparation of oligomeric polyethers and polyamides (or polyimides), respectively, is considered. The possibility of the synthesis of polyamides and polyimides containing side aliphatic and aromatic groups and possessing better (in comparison with the corresponding unsubstituted polymers) characteristics is demonstrated.

  7. Coordination chemistry of 2,4,6-tri(pyridyl)-1,3,5-triazine ligands

    OpenAIRE

    Therrien, Bruno

    2012-01-01

    This review covers the rich coordination chemistry of 2,4,6-tri(pyridyl)-1,3,5-triazine ligands. These polypyridyl derivatives have been coupled to transition metals and lanthanides, and the complexes obtained have been used in various fields such as luminescent materials, for the preparation of coordination polymers and networks as well as for the synthesis of discrete metalla-assemblies. The synthetic and structural aspects of the different isomers of 2,4,6-tri(pyridyl)-1,3,5-triazine are p...

  8. A systematic study on the absorption and fluorescence properties of 2,4,6-triaryl and tripyridylpyridines

    OpenAIRE

    FINDIK, Esra; ARIK, Mustafa; Ceylan, Mustafa

    2009-01-01

    Eight different 2,4,6-triaryl, and tripyridylpridines compounds were synthesized and their fluorescent properties were studied by using steady-state and time-resolved fluorescence and UV-Vis absorption spectroscopy techniques in 6 different solvents. Especially, 2,4,6-triarylpyridines showed strong fluorescence properties with high fluorescence quantum yields but small Stokes shifts.

  9. 5 CFR 531.246 - Within-grade increases for GM employees.

    Science.gov (United States)

    2010-01-01

    ... 5 Administrative Personnel 1 2010-01-01 2010-01-01 false Within-grade increases for GM employees... REGULATIONS PAY UNDER THE GENERAL SCHEDULE Determining Rate of Basic Pay Special Rules for Gm Employees § 531.246 Within-grade increases for GM employees. GM employees are entitled to within-grade increases...

  10. SAGE ANALYSIS OF TRANSCRIPTOME RESPONSES IN ARABIDOPSIS ROOTS EXPOSED TO 2,4,6-TRINITROTOLUENE

    Science.gov (United States)

    Serial Analysis of Gene Expression (SAGE) was used to profile transcript levels in Arabidopsis thaliana roots and assess their responses to 2,4,6-trinitrotoluene (TNT) exposure. SAGE libraries representing control and TNT-exposed seedling root transcripts were constructed, and ea...

  11. 8 CFR 246.4 - Immigration judge's authority; withdrawal and substitution.

    Science.gov (United States)

    2010-01-01

    ... 8 Aliens and Nationality 1 2010-01-01 2010-01-01 false Immigration judge's authority; withdrawal... IMMIGRATION REGULATIONS RESCISSION OF ADJUSTMENT OF STATUS § 246.4 Immigration judge's authority; withdrawal and substitution. In any proceeding conducted under this part, the immigration judge shall...

  12. Levan-type fructooligosaccharide production using Bacillus licheniformis RN-01 levansucrase Y246S immobilized on chitosan beads

    Directory of Open Access Journals (Sweden)

    Surawut Sangmanee

    2016-06-01

    Full Text Available Bacillus licheniformis RN-01 levansucrase Y246S (LsRN-Y246S was immobilized by covalently linking onto chitosan, Sepabead EC-EP, and Sepabead EC-HFA, beads. The stability of immobilized LsRN-Y246S was found to be the highest with chitosan beads, retaining more than 70% activity after 13 weeks storage at 4 oC, and 68% activity after 12 hours incubation at 40°C. LsRN-Y246S immobilized on chitosan beads withstands sucrose concentrations up to 70% (w/v, retaining over 85% of its activity, significantly better than LsRN-Y246S immobilized on others supporting matrices. LsRN-Y246S immobilized on chitosan showed a 2.4 fold increase in activity in the presence of Mn2+, and gave slight protection against deactivation by of Cu2+, Zn2+, Fe3+, SDS and EDTA. A maximum of 8.36 g and an average of 7.35 g LFOS yield at least up to DP 11 can be produced from 25 g of sucrose, during five production cycles. We have demonstrated that LFOS can be effectively produced by chitosan immobilized LsRN-Y246S and purified.

  13. White upconversion luminescence nanocrystals for the simultaneous and selective detection of 2,4,6-trinitrotoluene and 2,4,6-trinitrophenol.

    Science.gov (United States)

    Ma, Yingxin; Huang, Sheng; Deng, Mingliang; Wang, Leyu

    2014-05-28

    A highly water stable and strong upconversion (UC) luminescence NaYF4@PSI-NH nanosensor for the simultaneous and selective detection of 2,4,6-trinitrotoluene (TNT) and 2,4,6-trinitrophenol (TNP) was successfully developed. Via the 980 nm near-infrared (NIR) irradiation, these nanosensors emit strong white UC luminescence with five typical emission peaks centered at 363, 455, 475, 546, and 654 nm. The UC emission at both 363 and 546 nm was quenched by the addition of TNT; however, the ratio of luminescence intensity at 363 nm to 546 nm (I363/I546) had no change with the increase of TNT concentration. Meanwhile, only violet UC emission at 363 nm was dramatically quenched via the addition of TNP, and the I363/I546 ratio is negatively proportional to the TNP concentration in the range of 0.01-4.5 μg/mL of TNP. On the other hand, the green UC emission intensity at 546 nm is in negative proportion to the concentration of TNT. Moreover, cyclohexane, toluene, and other nitroaromatics (such as 2,4-dinitrotoluene (DNT) and nitrobenzene (NB)) have no influence on the detection. Therefore, we developed a facile method for the simultaneous and selective detection of TNT and TNP in the mixture solution of nitroaromatics independent of complicated instruments and sample pretreatment. PMID:24734988

  14. Vicarious nucleophilic substitution to prepare 1,3-diamino-2,4,6-trinitrobenzene or 1,3,5-triamino-2,4,6-trinitrobenzene

    Science.gov (United States)

    Mitchell, A.R.; Pagoria, P.F.; Schmidt, R.D.

    1996-10-29

    The present invention relates to a process to produce 1,3-diamino-2,4,6-trinitrobenzene (DATB) or 1,3,5-triamino-2,4,6,trinitrobenzene (TATB) by: (a) reacting at ambient pressure and a temperature of between about 0 and 50 C for between about 0.1 and 24 hr, a trinitroaromatic compound of the structure shown within where X, Y, and Z are each independently selected from --H, or --NH{sub 2}, with the proviso that at least 1 or 2 of X, Y, and Z are hydrogen, with an amount effective to produce DATB or TATB, or 1,1,1-trialkylhydrazinium halide wherein alkyl is selected from methyl, ethyl, propyl or butyl and halide is selected from chloride, bromide or iodide, in the presence of a strong base selected from sodium butoxide, potassium butoxide, potassium propoxide, sodium propoxide, sodium ethoxide, potassium ethoxide, sodium methoxide, potassium methoxide, and combinations thereof; in a solvent selected from the group consisting of methanol, ethanol, propanol, butanol, dimethylsulfoxide, N-methylpyrrolidone, hexamethylphosphoramide, dimethylformide, dimethylacetamide and mixtures thereof, provided that when alcohols are present primarily DATB and picramide is formed; and (b) isolating the DATB or TATB produced. DATB and TATB are useful specialty explosives. TATB is also used for the preparation of benzenehexamine, a starting material for the synthesis of novel materials (optical imaging devices, liquid crystals, ferromagnetic compounds).

  15. Theoretical design of energetic nitrogen-rich derivatives of 1,7-diamino-1,7-dinitrimino-2,4,6-trinitro-2,4,6-triazaheptane.

    Science.gov (United States)

    Wu, Qiong; Zhu, Weihua; Xiao, Heming

    2013-08-01

    The heats of formation (HOFs), energetic properties, and thermal stability of a series of 1,7-diamino-1,7-dinitrimino-2,4,6-trinitro-2,4,6-triazaheptane derivatives with different substituents, different numbers of substituents, and different original chains are found by using the DFT-B3LYP method. The results show that -NO2 or -NH2 is an effective substituent for increasing the gas-phase HOFs of the title compounds, especially -NO2 group. As the numbers of substitutents increase, their HOFs enhance obviously. Increasing the length of original chain is helpful for improving their HOFs. The substitution of -NO2 is useful for enhancing their detonation performances and the effects of the length of original chains on detonation properties are coupled with those of the substituents. An analysis of the BDE of the weakest bonds indicates that the substitution of the -NH2 groups and replacing the -NO2 groups of N-NO2 by the -NH2 groups are favorable for improving their thermal stability, while the substitution of -NO2 and increasing the length of original chain decrease their thermal stability. Considering the detonation performance and thermal stability, seven compounds may be considered as the potential candidates of high energy density compounds. PMID:23559097

  16. Synthesis and structure of diorganotin dibromides, R2SnBr2 (R = 2,4,6-trimethylphenyl or 2,4,6-trimethylbenzyl): Hydrolysis of (2,4,6-Me3C6H2)2SnBr2

    Indian Academy of Sciences (India)

    Vadapalli Chandrasekhar; Ramalingam Thirumoorthi

    2010-09-01

    The reaction of SnBr4 with in situ generated 2,4,6-trimethylphenylmagnesium bromide afforded a mixture of (2,4,6-Me3C6H2)2SnBr2 (1) and (2,4,6-Me3C6H2)3SnBr (2) which could be separated from each other by their solubility differences in diethyl ether. On the other hand, the reaction of tin metal with 2,4,6-Me3C6H2CH2Br afforded (2,4,6-Me3C6H2CH2)2SnBr2 (3). Hydrolysis of the latter using triethylamine as the base afforded [{(2,4,6-Me3C6H2CH2)2Sn}2(-O)(Br)(-OH)]2.2CH2Cl2 (4) while the use of NaOH as the base afforded [{(2,4,6-Me3C6H2CH2)2Sn}2(-O)(OH)(-OH)]2.2CH2Cl2 (5). Compounds 4 and 5 are dimeric tetraorganodistannoxanes consisting of a central distannoxane (Sn2O2) motif.

  17. 1,2-Bis(dimethylamino-1,2-bis(2,4,6-triisopropylphenyldiborane(4

    Directory of Open Access Journals (Sweden)

    Alexander Damme

    2010-12-01

    Full Text Available In the molecular structure of the title compound, C34H58B2N2, each B atom of the diborane(4 is connected to one dimethylamino group and one Tip ligand (Tip = 2,4,6-triisopropylphenyl. These findings indicate that the increased steric demand of the Tip groups exerts influence solely on the B—B separation but not on the overall geometry of the title compound.

  18. Development of the small-molecule antiviral ST-246® as a smallpox therapeutic

    OpenAIRE

    Grosenbach, Douglas W.; Jordan, Robert; Hruby, Dennis E

    2011-01-01

    Naturally occurring smallpox has been eradicated, yet it remains as one of the highest priority pathogens due to its potential as a biological weapon. The majority of the US population would be vulnerable in a smallpox outbreak. SIGA Technologies, Inc. has responded to the call of the US government to develop and supply to the Strategic National Stockpile a smallpox antiviral to be deployed in the event of a smallpox outbreak. ST-246® (tecovirimat) was initially identified via a high-throughp...

  19. 2,4,6-Trichloroanisole is a potent suppressor of olfactory signal transduction

    OpenAIRE

    Takeuchi, Hiroko; Kato, Hiroyuki; Kurahashi, Takashi

    2013-01-01

    Off-flavor substances generated naturally in foods/beverages deteriorate the quality of products considerably. Generally, it has been thought that off-flavor substances induce unpleasant smells exogenously. Here, however, we show that 2,4,6-trichroloanisole (TCA), known as one of the strongest off-flavors, inhibits ciliary transduction channels. Surprisingly, suppression was caused with 1-aM solution. The TCA effect showed slow kinetics, with an integration time of approximately 1 s, and posi...

  20. 2,4,6-Trinitrotoluene Reduction by Carbon Monoxide Dehydrogenase from Clostridium thermoaceticum

    OpenAIRE

    Huang, Shouqin; Lindahl, Paul A.; Wang, Chuanyue; Bennett, George N.; Rudolph, Frederick B.; Hughes, Joseph B.

    2000-01-01

    Purified CO dehydrogenase (CODH) from Clostridium thermoaceticum catalyzed the transformation of 2,4,6-trinitrotoluene (TNT). The intermediates and reduced products of TNT transformation were separated and appear to be identical to the compounds formed by C. acetobutylicum, namely, 2-hydroxylamino-4,6-dinitrotoluene (2HA46DNT), 4-hydroxylamino-2,6-dinitrotoluene (4HA26DNT), 2,4-dihydroxylamino-6-nitrotoluene (24DHANT), and the Bamberger rearrangement product of 2,4-dihydroxylamino-6-nitrotolu...

  1. Structural Studies of N-(2,4,6-trisubstitutedphenyl)-Chloroacetamides, 2,4,6-X3C6 H2 -NHCO-CH3_y Cly, (X = CH3 or Cl and y = 1 -3)

    Science.gov (United States)

    Gowda, B. Thimme; Svoboda, I.; Fuess, Hartmut

    2000-10-01

    The effect of side chain and ring substitutions on the crystal structures of N-(2,4,6-substitutedpheny)- chloroacetamides of the type, 2,4,6-X3C6H2-NHCO-CH3_yCly (X = CH3 or Cl and 1 ⩽ y ⩽ 3), has been studied by determining the crystal structures of N-(2,4,6-trimethylphenyl)- 2-chloroacetamide, 2,4,6-(CH3)3C6H2-NHCO-CH2Cl (TMPMCA); N-(2,4,6-trichlorophenyl)-2- chloroacetamide, 2,4,6-Cl3C6H2-NHCO-CH2Cl (TCPMCA); N-(2,4,6-trichlorophenyl)-2,2-dichloroacetamide, 2,4,6-Cl3C6H2-NHCO-CHCl2 (TCPDCA) and N-(2,4,6-trichlorophenyl)-2,2,2- trichloroacetamide, 2,4,6-Cl3C6H2-NHCO-CCl3 (TCPTCA). The crystal type, space group, formula units and lattice constants in A are: (TMiPMCA); monoclinic, P21,/n, Z = 8, a = 9.029(5), b = 15.688(2), c = 16.150(3), ß = 96.77(2)°; (TCPMCA): orthorhombic, Pna21, Z = 8, a = 30.708(4), b = 4.685(1), c = 14.506(2); (TCPDCA) orthorhombic, P212121 Z = 4, a = 16.459(3), b = 15.240(3), c = 4.640(1) and (TCPTCA): triclinic, P Ī , Z = 4, a = 9.828(2), b = 11.953(2), c = 12.278(2), a = 71,05( 1)°, ß = 75.26(2)°, g = 83.29( 1)°. The results have been analysed along with the structures of the ring unsubstituted N-phenylacetamide (PA), N-phenyl-2,2,2-trichloro-acetamide, side chain unsubstituted N-(2,4,6-trichlorophenyl)-acetamide, 2,4,6-Cl3C6H2-NHCO-CH3 (TCPA) and the corresponding di-substituted phenyl acetamides and chloroacetamides. The compounds TMPMCA, TCPMCA and TCPTCA have 2 molecules each in their asymmetric units. This is in agreement with the multiple lines observed in the 35CI NQR spectra of TCPTCA. Further, this compound shows disorder as indicated by the multiplicity of the C(side chain) - Cl bonds. The compound TCPMCA does not show 35C1 NQR spectra, while the compound TMPMCA shows a single frequency which fades out above 200 K, indicating that it may undergo a phase transition well below room temperature. Conversion of 2,4,6-trichloroaniline into 2,4,6-trichlorophenyl acetamide and gradual replacement of H-atoms in the side chain

  2. Monoklonale Antikörper zum Nachweis von 2,4,6-Trichloranisol in Kork

    OpenAIRE

    Lausterer, Ralph

    2005-01-01

    Die Verbindung 2,4,6-Trichloranisol (TCA) kann in Kork und Wein vorkommen. TCA entsteht durch mikrobielle Umsetzung von Chlorphenolen. In den betroffenen Industrien führt TCA zu jährlichen Verlusten von mehr als einer Milliarde €. Zur Bestimmung von TCA sollten enzymkoppelte Immunabsorptionstest (ELISAs) mit monoklonalen Antikörpern (mAk) entwickelt werden. Es wurden drei TCA-spezifische mAk-produzierende Zelllinien gewonnen. Mit diesen mAk wurden hochsensitive ELISAs hergstellt, die eine Nac...

  3. Synthesis of 2,4,6-triamino-1,3,5- trinitrobenzene

    Directory of Open Access Journals (Sweden)

    Gilson da Silva

    2011-01-01

    Full Text Available The 2,4,6-triamino-1,3,5-trinitrobenzene (TATB is perhaps the most thermostable and insensitive explosive known. Its low sensibility to shock makes it suitable for military and civil applications. TATB application is done either alone or in combination with another high energetic material. This study aimed at reporting the review about many processes to produce TATB and the problems associated with them, as well as suggest techniques like Fourier Transform Infrared Spectroscopy (FT-IR and Differential Scanning Calorimetry (DSC, which can be useful in the characterization of this energetic compound.

  4. Thermal Decomposition Kinetics of Lead 2,4,6-Trinitroresorcinate Monohydrate

    Institute of Scientific and Technical Information of China (English)

    HU Rong-zu; YAO Pu; LI Jing; CHEN San-ping; GAO Sheng-li; ZHAO Feng-qi; SONG Ji-rong; SHI Qi-zhen; CHEN Pei; LUO Yang; ZHAO Hong-an

    2004-01-01

    The non-isothermal decomposition of lead 2,4,6-trinitroresorcinate monohydrate, Pb (TNR) · H2O. was investigated by means of TG-DTA, DSC and IR. The thermal decomposition mechanism and the dissociated kinetics were also investigated. The kinetic parameters were obtained from the analysis of the DSC curves by integral and differential methods. The most probable kinetic model function of the dehydration reaction of Pb(TNR) · H2O was suggested by the comparison of the kinetic parameters.

  5. Synthesis of bis(3-{[2-(allyloxy)ethoxy]methyl}-2,4,6-trimethylbenzoyl)(phenyl)phosphine oxide – a tailor-made photoinitiator for dental adhesives

    OpenAIRE

    Moszner, Norbert; Lamparth, Iris; Angermann, Jörg; Fischer, Urs Karl; Zeuner, Frank; Bock, Thorsten; Liska, Robert; Rheinberger, Volker

    2010-01-01

    Because of the poor solubility of the commercially available bisacylphosphine oxides in dental acidic aqueous primer formulations, bis(3-{[2-(allyloxy)ethoxy]methyl}-2,4,6-trimethylbenzoyl)(phenyl)phosphine oxide (WBAPO) was synthesized starting from 3-(chloromethyl)-2,4,6-trimethylbenzoic acid by the dichlorophosphine route. The substituent was introduced by etherification with 2-(allyloxy)ethanol. In the second step, 3-{[2-(allyloxy)ethoxy]methyl}-2,4,6-trimethylbenzoic acid was chlorinated...

  6. WE-A-18A-01: TG246 On Patient Dose From Diagnostic Radiation

    Energy Technology Data Exchange (ETDEWEB)

    Supanich, M [Rush University Medical Center, Chicago, IL (United States); Dong, F [The Cleveland Clinic, Solon, OH (United States); Andersson, J [Umea University, Umea (Sweden); Pavlicek, W [Mayo Clinic Arizona, Scottsdale, AZ (United States); Bolch, W [University Florida, Gainesville, FL (United States); Fetterly, K [Mayo Clinic, Rochester, MN (United States)

    2014-06-15

    Radiation dose from diagnostic and interventional radiations continues to be a focus of the regulatory, accreditation and standards organizations in the US and Europe. A Joint AAPM/EFOMP effort has been underway in the past year — having the goal to assist the clinical medical physicist with communicating optional and varied approaches in estimating (and validating) patient dose. In particular, the tools provided by DICOM Radiation Dose Structured Reports, either by themselves or as part of a networked data repository of dose related information are a rich source of actionable information. The tools of the medical physicist have evolved to include using DICOM data in meaningful ways to look at patient dose with respect to imaging practices. In addition to how accurate or reproducible a dose value is (totally necessary and our traditional workspace) it is now being asked how reproducible (patient to patient, device to device) are the delivered doses (new tasking)? Clinical medical physicists are best equipped to assist our radiology and technologist colleagues with this effort. The purpose of this session is to review the efforts of TG246 - bringing forward a summary content of the TG246 Report including specific dose descriptors for CT and Fluoroscopy — particularly in a focus of leveraging the RDSR as a means for monitoring good practices ALARA. Additionally, rapidly evolving technologies for more refined dose estimates are now in use. These will be presented as they look to having highly patient specific dose estimates in automated use.

  7. Identification and responsibility of 2,4,6-tribromoanisole in musty, corked odors in wine.

    Science.gov (United States)

    Chatonnet, Pascal; Bonnet, Sandra; Boutou, Stéphane; Labadie, Marie-Dominique

    2004-03-10

    In this work, gas phase chromatography analysis coupled with selective selected ion monitoring (SIM) identified 2,4,6-tribromoanisole (TBA) in wines found on tasting to have significant "musty or corked" character, although they did not contain noteworthy quantities of chloroanisoles or chlorophenols, the contaminants generally reported to cause this type of defect. The perception thresholds were studied, together with contamination conditions during winemaking, storage, and bottle-aging. A "musty" off-odor was perceptible on smelling wine containing as little as 4 ng L(-)(1) TBA, and spoilage may be detected by retro-olfaction at even lower concentrations. TBA, produced by O-methylation of its direct precursor, 2,4,6-tribromophenol, generally comes from sources in the winery environment. This paper is the first to identify the sources of a large number of cases of wines polluted during storage in premises where the atmosphere was contaminated with TBA used recently to treat wood, or originating from much older structural elements of the winery, or from used wooden containers. In certain cases, although the initial source had been eliminated, residual pollution adsorbed on walls could be sufficient to make a building unsuitable for storing wooden barrels and plastics, as well as corks, which have been found to be particularly susceptible to contamination by the TBA in the winery atmosphere. PMID:14995130

  8. Ecotoxicological evaluation of wastewater from 2.4.6-TNT production.

    Science.gov (United States)

    Ribeiro, Elaine N; Da Silva, Flávio Teixeira; De Paiva, Teresa Cristina Brazil

    2012-01-01

    During the manufacture of explosives, large amounts of water are used to remove unwanted by-products generated. This water in turn, ends up in wastewater treatment plants or water bodies. The aim of this study was to evaluate the toxic potential of effluent generated by 2.4.6-Trinitrotoluene (TNT) production, yellow water, red water and mixture of yellow and red water, produced from a plant located in the Paraíba Valley, São Paolo state, Brazil. Daphnia similis, Danio rerio, Escherichia coli, Pseudomonas putida and Pseudokircheneriella subcaptata were used as test organisms. Physicochemical parameters such as color, pH, conductivity, total dissolved solids, dissolved oxygen, chemical oxygen demand (COD) and biochemical oxygen demand (BOD) were evaluated. Effluent from 2.4.6-TNT production was extremely toxic to all test organisms. The physicochemical parameters evaluated showed high levels of conductivity (from 41.533 to 42.344 μS /cm) and chemical oxygen demand (COD of 8471 to 27.364 mg/L) for the effluents analyzed. PMID:22242870

  9. WE-A-18A-01: TG246 On Patient Dose From Diagnostic Radiation

    International Nuclear Information System (INIS)

    Radiation dose from diagnostic and interventional radiations continues to be a focus of the regulatory, accreditation and standards organizations in the US and Europe. A Joint AAPM/EFOMP effort has been underway in the past year — having the goal to assist the clinical medical physicist with communicating optional and varied approaches in estimating (and validating) patient dose. In particular, the tools provided by DICOM Radiation Dose Structured Reports, either by themselves or as part of a networked data repository of dose related information are a rich source of actionable information. The tools of the medical physicist have evolved to include using DICOM data in meaningful ways to look at patient dose with respect to imaging practices. In addition to how accurate or reproducible a dose value is (totally necessary and our traditional workspace) it is now being asked how reproducible (patient to patient, device to device) are the delivered doses (new tasking)? Clinical medical physicists are best equipped to assist our radiology and technologist colleagues with this effort. The purpose of this session is to review the efforts of TG246 - bringing forward a summary content of the TG246 Report including specific dose descriptors for CT and Fluoroscopy — particularly in a focus of leveraging the RDSR as a means for monitoring good practices ALARA. Additionally, rapidly evolving technologies for more refined dose estimates are now in use. These will be presented as they look to having highly patient specific dose estimates in automated use

  10. Visual detection of 2,4,6-trinitrotolune by molecularly imprinted colloidal array photonic crystal.

    Science.gov (United States)

    Lu, Wei; Asher, Sanford A; Meng, Zihui; Yan, Zequn; Xue, Min; Qiu, Lili; Yi, Da

    2016-10-01

    We developed a photonic crystal (PhC) sensor for the quantification of 2,4,6-trinitrotoluene (TNT) in solution. Monodisperse (210nm in diameter) molecularly imprinted colloidal particles (MICs) for TNT were prepared by the emulsion polymerization of methyl methacrylate and acrylamide in the presence of TNT as a template. The MICs were then self-assembled into close-packed opal PhC films. The adsorption capacity of the MICs for TNT was 64mg TNT/g. The diffraction from the PhC depended on the TNT concentration in a methanol/water (3/2, v/v) potassium dihydrogen phosphate buffer solution (pH=7.0, 30mM). The limit of detection (LOD) of the sensor was 1.03μg. The color of the molecularly imprinted colloidal array (MICA) changed from green to red with an 84nm diffraction red shift when the TNT concentration increased to 20mM. The sensor response time was 3min. The PhC sensor was selective for TNT compared to similar compounds such as 2,4,6-trinitrophenol, 2,4-dinitrotoluene, 2,6-dinitrotoluene, 2-nitromesitylene, 4-nitrotoluene, 2-nitrotoluene, 1,3-dinitrobenzene, methylbenzene, 4-nitrophenol, 2-nitroaniline, 3-aminophenol and 3-nitroaniline. The sensor showed high stability with little response change after three years storage. This sensor technology might be useful for the visual determination of TNT. PMID:27214001

  11. 儿童支气管异物246例临床分析%Clinical analysis of bronchial foreign bodies in 246 children

    Institute of Scientific and Technical Information of China (English)

    马渝燕; 焦安夏; 江沁波; 饶小春; 潘跃娜; 刘玺诚

    2010-01-01

    目的 回顾性研究儿童支气管异物的临床特点以及电子支气管镜在诊断治疗儿童支气管异物中的作用.方法 2000年1月至2009年8月北京儿童医院经支气管镜诊断治疗的支气管异物患儿246例,应用Olympus电子支气管镜,在局部黏膜麻醉下经鼻插入支气管镜逐级观察支气管结构,使用篮状异物钳或齿状异物钳钳取异物.结果 246例患儿中,支气管异物以果仁或果壳类(230例,占93.5%)最为常见,异物嵌顿位置以右下叶支气管开口(98例,占39.8%)为最多.钳取异物手术次数平均为(1.9±1.3)次,一次取出率为58.5%(144例).阻塞于左右主支气管、右中叶和右下叶支气管的异物一次取出率较高,分别为91.1%、60.0%和55.1%.篮状异物钳钳取所需次数(1.4±0.9)明显低于齿状异物钳所需次数(2.1±1.4),差异有统计学意义(P=0.000).结论 儿童支气管异物种类以果仁或果壳类植物性异物为主,阻塞部位以右下支气管为多见.位于左右主支气管异物一次取出率明显高于其他部位.用篮状异物钳钳取异物所需手术次数明显少于使用齿状异物钳.%Objective To analyze the characters of bronchial foreign bodies in children and the utilization of bronchoscope in the treatment of bronchial foreign bodies. Methods A total of 246 children were diagnosed with bronchial foreign bodies at our hospital during January 2000 until August 2009. Under local mucosal anesthesia, a bronchoscope was inserted through nasal cavity into bronchi. After identifying the site of foreign body, grasping forceps was guided through bronchoscope to remove the foreign body from airway. Results Among 246 cases, hard nut and skin of melon seed were found ( n = 230, 93.5% ). The most common site of foreign body was in right lower lobe bronchi ( n =98, 38.9% ). The average operative frequency was 1.9 ± 1.3 and one-time extraction ratio 58.5% ( n = 144). The one-time extraction ratio of patients with foreign

  12. Timing analysis of the X-ray transient source XTE J1806--246 (2S1803--245)

    OpenAIRE

    Revnivtsev, M.; Borozdin, K.; A. Emelyanov

    1999-01-01

    An outburst of the X-ray transient source XTE J1806--246 (2S1803--245) has been observed by Rossi X-ray Timing Explorer in April-July 1998. Strong quasi-periodical oscillations (QPO) with a central peak frequency around 9 Hz was detected in one observation of the series performed by PCA/RXTE experiment. X-ray flux from the source during the observation with QPO was maximal. The energy spectrum of XTE J1806--246 at this time was softer than for other observations. A sufficient variability of t...

  13. Chemically catalyzed uptake of 2,4,6-trinitrotoluene by Vetiveria zizanioides.

    Science.gov (United States)

    Makris, Konstantinos C; Shakya, Kabindra M; Datta, Rupali; Sarkar, Dibyendu; Pachanoor, Devanand

    2007-07-01

    The efficiency of vetiver grass (Vetiveria zizanioides) in removing 2,4,6-trinitrotoluene (TNT) from aqueous media was explored in the presence of a common agrochemical, urea, used as a chaotropic agent. Chaotropic agents disrupt water structure, increasing solubilization of hydrophobic compounds (TNT), thus, enhancing plant TNT uptake. The primary objectives of this study were to: (i) characterize TNT absorption by vetiver in hydroponic media, and (ii) determine the effect of urea on chemically catalyzing TNT uptake by vetiver grass in hydroponic media. Results showed that vetiver exhibited a high TNT uptake capacity (1.026 mgg(-1)), but kinetics were slow. Uptake was considerably enhanced in the presence of urea, which significantly (pvetiver grass. PMID:17240499

  14. The high-pressure phase behavior and compressibility of 2,4,6-trinitrotoluene

    Energy Technology Data Exchange (ETDEWEB)

    Stevens, Lewis L.; Velisavljevic, Nenad; Hooks, Daniel E.; Dattelbaum, Dana M. (LANL)

    2008-10-24

    The phase stability and isothermal compression behavior of 2,4,6-trinitrotoluene (TNT) have been established to 26.5 GPa using angle-dispersive x-ray diffraction. P-V isotherms derived from the high-pressure x-ray spectra displayed a slight density hysteresis around 4.0 GPa and a sharp discontinuity at - 20.0 GPa. The latter transition is ascribed to a monoclinic-to-orthorhombic first-order phase transition in TNT. The conversion of the isothermal P-V data to the shock velocity-particle velocity plane revealed a deviation from linearity at low u{sub p}, a cusp associated with the phase transition at high u{sub p}, and general agreement with the wealth of unreacted Hugoniot data on TNT.

  15. Crystal structure of [2-(triethylammonioethyl][(2,4,6-triisopropylphenylsulfonyl]amide tetrahydrate

    Directory of Open Access Journals (Sweden)

    C. Golz

    2015-05-01

    Full Text Available The zwitterionic title compound, C23H42N2O2S·4H2O, crystallized as a tetrahydrate from a solution of N-[(2,4,6-triisopropylphenylsulfonyl]aziridine in triethylamine, diethyl ether and pentane in the presence of moist air. It is formed by a nucleophillic ring-opening that is assumed to be reversible. The molecular structure shows a major disorder of the triisopropylphenyl group over two equally occupied locations. An interesting feature is the uncommon hydrate structure, exhibiting a tape-like motif which can be classified as a transition of the one-dimensional T4(26(2 motif into the two-dimensional L4(65(76(8 motif.

  16. The high-pressure phase stability of 2,4,6-trinitrotoluene (TNT)

    Science.gov (United States)

    Bowden, P. R.; Chellappa, R. S.; Dattelbaum, D. M.; Manner, V. W.; Mack, N. H.; Liu, Z.

    2014-05-01

    2,4,6-trinitrotoluene (TNT) is a widely used explosive that is relatively insensitive to initiation by shock loading. While the detonation properties of TNT have been extensively reported, the high pressure-temperature (P-T) stability of TNT has not been investigated in detail. At ambient conditions, TNT crystallizes in a monoclinic lattice (space group P21/a), and our previous X-ray diffraction (XRD) measurements at room temperature suggested a phase transition to orthorhombic (space group Pca21) at ~20 GPa. In this work, we have performed in-situ synchrotron XRD and vibrational spectroscopy measurements along the room temperature isotherm to investigate phase stabilities up to 18 GPa. While our Raman spectroscopy measurements indicate spectral changes at ~2 GPa, careful XRD measurements reveal that the monoclinic phase persists up to 10 GPa.

  17. The high-pressure phase stability of 2,4,6-trinitrotoluene (TNT)

    International Nuclear Information System (INIS)

    2,4,6-trinitrotoluene (TNT) is a widely used explosive that is relatively insensitive to initiation by shock loading. While the detonation properties of TNT have been extensively reported, the high pressure-temperature (P-T) stability of TNT has not been investigated in detail. At ambient conditions, TNT crystallizes in a monoclinic lattice (space group P21/a), and our previous X-ray diffraction (XRD) measurements at room temperature suggested a phase transition to orthorhombic (space group Pca21) at ∼20 GPa. In this work, we have performed in-situ synchrotron XRD and vibrational spectroscopy measurements along the room temperature isotherm to investigate phase stabilities up to 18 GPa. While our Raman spectroscopy measurements indicate spectral changes at ∼2 GPa, careful XRD measurements reveal that the monoclinic phase persists up to 10 GPa.

  18. Poly[[triaqua(μ3-pyridine-2,4,6-tricarboxylatoterbium(III] monohydrate

    Directory of Open Access Journals (Sweden)

    Hong-lin Zhu

    2012-07-01

    Full Text Available The asymmetric unit of the title compound, {[Tb(C8H2NO6(H2O3]·H2O}n, contains one TbIII ion, one pyridine-2,4,6-tricarboxylate (ptc anion, three aqua ligands and one lattice water molecule. The TbIII ion is nine coordinated by one N and five O atoms from three ptc ligands and by three O atoms from the three aqua ligands in a distorted bicapped trigonal–prismatic geometry. The ptc ligands bridge the TbIII ions into a two-dimensional polymeric framework parallel to (100. An extensive O—H...O hydrogen-bonding network consolidates the crystal packing.

  19. High uptake of 2,4,6-trinitrotoluene by vetiver grass--potential for phytoremediation?

    Science.gov (United States)

    Makris, Konstantinos C; Shakya, Kabindra M; Datta, Rupali; Sarkar, Dibyendu; Pachanoor, Devanand

    2007-03-01

    2,4,6-Trinitrotoluene (TNT) is a potent mutagen, and a Group C human carcinogen that has been widely used to produce munitions and explosives. Vast areas that have been previously used as ranges, munition burning, and open detonation sites are heavily contaminated with TNT. Conventional remediation activities in such sites are expensive and damaging to the ecosystem. Phytoremediation offers a cost-effective, environment-friendly solution, utilizing plants to extract TNT from contaminated soil. We investigated the potential use of vetiver grass (Vetiveria zizanioides) to effectively remove TNT from contaminated solutions. Vetiver grass plants were grown in hydroponic systems containing 40 mg TNTL(-1) for 8d. Aqueous concentrations of TNT reached the method detection limit ( approximately 1 microg L(-1)) within the 8-d period, demonstrating high affinity of vetiver for TNT, without any visible toxic effects. Results from this preliminary hydroponic study are encouraging, but in need of verification using TNT-contaminated soils. PMID:16899329

  20. Reliability of optical fibres and components final report of COST 246

    CERN Document Server

    Griffioen, Willem; Gadonna, Michel; Limberger, Hans; Heens, Bernard; Knuuttila, Hanna; Kurkjian, Charles; Mirza, Shehzad; Opacic, Aleksandar; Regio, Paola; Semjonov, Sergei

    1999-01-01

    Reliability of Optical Fibres and Components reports the findings of COST 246 (1993-1998) - European research initiative in the field of optical telecommunications. Experts in the materials and reliability field of optical fibres and components have contributed to this unique study programme. The results, conclusions and achievements of their work have been obtained through joint experimentation and discussion with representatives from manufacturing and research groups. Topics covered include: Lifetime estimation; Failure mechanisms; Ageing test methods; Field data and service environments for components. For the first time the reader can explore the reliability of products and examine the results and conclusions in published form. This comprehensive volume is intended to provide a deeper understanding of the reliability of optical fibres and components. The book will be extremely useful to all scientists and practitioners involved in the industry.

  1. Oral exposure of adult zebrafish (Danio rerio) to 2,4,6-tribromophenol affects reproduction

    DEFF Research Database (Denmark)

    Halden, Anna Norman; Nyholm, Jenny Rattfelt; Andersson, Patrik L;

    2010-01-01

    not significantly affected, but yolk-sac oedema tended to increase in frequency in exposed groups with time. Our results show that dietary exposure to TBP, at concentrations found in marine organisms that are part of the natural diet of wild fish, can interfere with reproduction in zebrafish. We also......The bromophenol 2,4,6-tribromophenol (TBP) is widely used as an industrial chemical, formed by degradation of tetrabromobisphenol-A, and it occurs naturally in marine organisms. Concentrations of TBP in fish have been related to intake via feed, but little is known about effects on fish health...... after oral exposure. In this study, we exposed adult male and female zebrafish (Danio rerio) to TBP via feed in nominal concentrations of 33, 330, and 3300 mu g/g feed (or control feed) for 6 weeks to assess the effects of TBP on reproductive output, gonad morphology, circulatory vitellogenin levels...

  2. Towards the island of superheavy stability - Prompt spectroscopy of 246Fm and 256Rf nuclei

    International Nuclear Information System (INIS)

    The region of trans-fermium nuclei (Z = 100 to 104) is the last region of the nuclides chart to be accessible to spectroscopic measurements. It therefore provides the ultimate anchor points for nuclear models. This region also lies on the path of the alpha-decay chains of the super-heavy elements. This region represents the limit of today's spectroscopic capabilities. It therefore requires technological developments in order to overcome these limits. My thesis focuses on various aspects of the spectroscopy of trans-fermium nuclei. I took part in the development of the TNT2D digital acquisition cards for germanium detectors. I validated their use on the gamma-ray spectrometer JUROGAM during an in-beam experiment and demonstrated the gain compared to an analogue acquisition system. These tests were part of the developments needed to secure a study of the prompt spectroscopy of 256Rf. The preparation of this experiment also lead me to work on the development of a 50Ti beam. For that purpose, I studied and tested the use of titanium organo-metallic compounds compatible with the MIVOC technique. In parallel, I studied the use of metallic and oxide titanium pellets with an inductive oven newly developed at the University of Jyvaeskylae. In addition to these developments, I had the opportunity to study the in-beam prompt spectroscopy of 246Fm at the University of Jyvaeskylae. The measurements yielded a rotational band built on the ground state of 246Fm. This band has been observed up to the level 16+ and shows a behaviour quite similar to the neighbouring even-even isotopes, except for the top of the band for which a wider statistics is necessary in order to conclude. (author)

  3. Susceptibility of male and female Japanese medaka (Oryzias latipes) to 2,4,6-trichlorophenol-induced micronuclei in peripheral erythrocytes

    Institute of Scientific and Technical Information of China (English)

    Nannan LIU; Mei MA; Yiping XU; Jinmiao ZHA; Kaifeng RAO; Zijian WANG

    2013-01-01

    2,4,6-trichlorophenol (2,4,6-TCP) is a wide- spread probable human carcinogen and has been proven to have genotoxicity in in vitro assays. However, little genotoxicity information and no micronuclei induction data for 2,4,6-TCP is available from in vivo tests, especially for sex-specific differences. Following a preliminary test, a piscine peripheral erythrocyte micro- nucleus assay was conducted on medaka (Oryzias latipes) after a 28-day exposure to 2,4,6-TCE In the present study, the mean micronuclei (MNC) frequencies of all of the groups increased in a dose-dependent manner, which indicated the potential genotoxicity of 2,4,6-TCE More- over, males were found to be more susceptible compared with females after a 28-day exposure to 2,4,6-TCP in all of the dosed groups above 10 ~tg-L-1. This is the first report on the potential of micronuclei induction and a sex-susceptible effect in the peripheral erythrocytes of mature fish after 2,4,6-TCP in vivo exposure.

  4. Highly sensitive detection of 2,4,6-trichlorophenol based on HS-β-cyclodextrin/gold nanoparticles composites modified indium tin oxide electrode

    International Nuclear Information System (INIS)

    Graphical abstract: Display Omitted -- Highlights: •A novel electrochemical sensing platform by self-assembling of HS-β-cyclodextrin/gold nanoparticles onto indium tin oxide electrode (HS-β-CD/AuNPs/SAM/ITO electrode) surface was constructed. •The proposed electrochemical sensor exhibited high sensitivity for the determination 2,4,6-trichlorophenol which electrochemical activity is very weak. •The newly developed method was successfully applied to quantitatively determine 2,4,6-trichlorophenol in tap water samples. -- ABSTRACT: A new electrochemical sensor for determination of 2,4,6-trichlorophenol (2,4,6-TCP) was fabricated. The characterization of the sensor was studied by scanning electron microscopy, electrochemical impedance spectroscopy and cyclic voltammetry techniques. The electrochemical behavior of 2,4,6-TCP was investigated using cyclic voltammetry and differential pulse voltammetry at the HS-β-cyclodextrin (HS-β-CD)/gold nanoparticles (AuNPs) composite modified indium tin oxide (ITO) electrode. The results showed that the current responses of 2,4,6-TCP greatly enhanced due to the high catalytic activity and enrichment capability of composites. The peak current of 2,4,6-TCP increases linearly with the increase of the 2,4,6-TCP concentration from 3.0 × 10−9 to 2.8 × 10−8 M, with the limit of detection of 1.0 × 10−9. Further more, the modified electrode was successfully applied to detect the level of 2,4,6-TCP in tap water samples with excellent sensitivity

  5. PBCDD/F formation from radical/radical cross-condensation of 2-Chlorophenoxy with 2-Bromophenoxy, 2,4-Dichlorophenoxy with 2,4-Dibromophenoxy, and 2,4,6-Trichlorophenoxy with 2,4,6-Tribromophenoxy

    Energy Technology Data Exchange (ETDEWEB)

    Shi, Xiangli [Environment Research Institute, Shandong University, Jinan 250100 (China); Yu, Wanni [Environment Research Institute, Shandong University, Jinan 250100 (China); College of Resources and Environment, Linyi University, Linyi 276000 (China); Xu, Fei [Environment Research Institute, Shandong University, Jinan 250100 (China); Zhang, Qingzhu, E-mail: zqz@sdu.edu.cn [Environment Research Institute, Shandong University, Jinan 250100 (China); Hu, Jingtian; Wang, Wenxing [Environment Research Institute, Shandong University, Jinan 250100 (China)

    2015-09-15

    Highlights: • We studied the formation of PBCDD/Fs from the reaction of three CPRs with BPRs. • The substitution pattern of halogenated phenols determines those of PBCDD/Fs. • The substitution of halogenated phenols influence the coupling of phenoxy radicals. • The rate constants of the crucial elementary steps were evaluated. - Abstract: Quantum chemical calculations were carried out to investigate the homogeneous gas-phase formation of mixed polybrominated/chlorinated dibenzo-p-dioxins/benzofurans (PBCDD/Fs) from the cross-condensation of 2-chlorophenoxy radical (2-CPR) with 2-bromophenoxy radical (2-BPR), 2,4-dichlorophenoxy radical (2,4-DCPR) with 2,4-dibromophenoxy radical (2,4-DBPR), and 2,4,6-trichlorophenoxy radical (2,4,6-TCPR) with 2,4,6-tribromophenoxy radical (2,4,6-TBPR). The geometrical parameters and vibrational frequencies were calculated at the MPWB1K/6-31+G(d,p) level, and single-point energy calculations were performed at the MPWB1K/6-311+G(3df,2p) level of theory. The rate constants of the crucial elementary reactions were evaluated by the canonical variational transition-state (CVT) theory with the small curvature tunneling (SCT) correction over a wide temperature range of 600–1200 K. Studies show that the substitution pattern of halogenated phenols not only determines the substitution pattern of the resulting PBCDD/Fs, but also has a significant influence on the formation mechanism of PBCDD/Fs, especially on the coupling of the halogenated phenoxy radicals.

  6. HIP 3678: a hierarchical triple stellar system in the centre of the planetary nebula NGC 246

    CERN Document Server

    Adam, C

    2014-01-01

    We report the detection of a new low-mass stellar companion to the white dwarf HIP 3678 A, the central star of the planetary nebula NGC 246. The newly found companion is located about 1 arcsec (at projected separation of about 500 au) north-east of HIP 3678 A, and shares a common proper motion with the white dwarf and its known comoving companion HIP 3678 B. The hypothesis that the newly detected companion is a non-moving background object can be rejected on a significance level of more than 8 $\\sigma$, by combining astrometric measurements from the literature with follow-up astrometry, obtained with Wild Field Planetary Camera 2/\\textit{Hubble Space Telescope} and NACO/Very Large Telescope. From our deep NACO imaging data, we can rule out additional stellar companions of the white dwarf with projected separations between 130 up to 5500 au. In the deepest high-contrast NACO observation, we achieve a detection limit in the \\textit{Ks} band of about 20 mag, which allows the detection of brown dwarf companions w...

  7. Degradation mechanism of 2,4,6-trinitrotoluene in supercritical water oxidation

    Institute of Scientific and Technical Information of China (English)

    2007-01-01

    The 2,4,6-trinitrotoluene (TNT) is a potential carcinogens and TNT contaminated wastewater, which could not be effectively disposed with conventional treatments. The supercritical water oxidation (SCWO) to treat TNT contaminated wastewater was studied in this article. The TNT concentration in wastewater was measured by high-performance liquid chromatograph (HPLC) and the degraded intermediates were analyzed using GC-MS. The results showed that SCWO could degrade TNT efficiently with O2. The reaction temperature, pressure, residence time and oxygen excess were the main contributing factors in the process. The decomposition of TNT was accelerated as the temperature or residence time increases. At 550℃, 24 MPa, 120 s and oxygen excess 300%, TNT removal rate could exceed 99.9%. Partial oxidation occurs in SCWO without oxygen. It was concluded that supercritical water was a good solvent and had excellent oxidation capability in the existence of oxygen. The main intermediates of TNT during SCWO include toluene, 1,3,5-trinitrobenzene, nitrophenol, naphthalene, fluorenone, dibutyl phthalate, alkanes and several dimers based on the intermediate analysis. Some side reactions, such as coupled reaction, hydrolysis reaction and isomerization reaction may take place simultaneously as TNT is oxidized by SCWO.

  8. Molecularly Imprinted Nanofiber Film for Sensitive Sensing 2,4,6-Tribromophenol

    Directory of Open Access Journals (Sweden)

    Limei Huang

    2016-06-01

    Full Text Available The determination of brominated flame retardants is of great importance, but remains a challenge. Particularly, universal and facile approaches are limited. Here we report a new general approach, combining molecular imprinting and electrospinning, for the efficient and facile imprinting sensor of 2,4,6-tribromophenol (TBP, which was used as a “novel” brominated flame retardant. With TBP as the template molecular, β-cyclodextrin (β-CD as the functional monomer, and poly-vinylbutyral (PVB as the electro-spinning matrix, the nanofiber film was deposited on the glassy carbon electrode (GCE via electrospinning technique directly. The β-CD-PVB/GCE sensor system exhibited excellent TBP sensing performances, such as a low detection limit (6.29 × 10−10 mol·L−1 at room temperature, selective recognition to TBP/phenol/4-methyl-phenol, and good regeneration performance. The approach of fabricating a molecular imprinting nanofiber sensor may shed new light in the detection of other phenolic pollutants.

  9. Phototransformation of 2,4,6-trinitrotoluene: Sensitized by riboflavin under different irradiation spectral range

    Energy Technology Data Exchange (ETDEWEB)

    Yang Xin [Department of Biology, Jackson State University, Jackson, MS 39217 (United States); Beijing Institute of Pharmacology and Toxicology, Beijing 100850 (China); Zhao Xueheng [Department of Biology, Jackson State University, Jackson, MS 39217 (United States); Hwang, H.-M. [Department of Biology, Jackson State University, Jackson, MS 39217 (United States)]. E-mail: hwang@jsums.edu

    2007-05-08

    Riboflavin-sensitized phototransformation of 2,4,6-trinitrotoluene (TNT) under natural sunlight was investigated with reverse-phase high performance liquid chromatography/mass spectrometry (HPLC/MS) and gas chromatography/mass spectrometry (GC/MS). The effect of different spectral region of sunlight on TNT phototransformation in the absence or presence of riboflavin was also investigated by using optical filters with cut-off at 400 or 455 nm. The concentration of riboflavin in the phototransformation of TNT was optimized. Concentration of riboflavin and TNT was 1.0 and 50 {mu}M, respectively. The rates of phototransformation of TNT under natural sunlight in the presence or absence of riboflavin were conformed to initial pseudo-first-order rate equation. The photolysis half life of TNT in the presence of riboflavin was 21.87 min, compared to 39 min in the absence of riboflavin under natural sunlight. Two major phototransformation products of TNT, 3,5-dinitroaniline (3,5-DNA) and 1,3,5-trinitrobenzene (1,3,5-TNB), were detected in the samples in the presence of riboflavin receiving irradiation at full wavelength or wavelength >400 nm. The results indicate that riboflavin mediates TNT sensitized-phototransfomation under natural sunlight or near-UV-vis light.

  10. Chemically catalyzed uptake of 2,4,6-trinitrotoluene by Vetiveria zizanioides

    International Nuclear Information System (INIS)

    The efficiency of vetiver grass (Vetiveria zizanioides) in removing 2,4,6-trinitrotoluene (TNT) from aqueous media was explored in the presence of a common agrochemical, urea, used as a chaotropic agent. Chaotropic agents disrupt water structure, increasing solubilization of hydrophobic compounds (TNT), thus, enhancing plant TNT uptake. The primary objectives of this study were to: (i) characterize TNT absorption by vetiver in hydroponic media, and (ii) determine the effect of urea on chemically catalyzing TNT uptake by vetiver grass in hydroponic media. Results showed that vetiver exhibited a high TNT uptake capacity (1.026 mg g-1), but kinetics were slow. Uptake was considerably enhanced in the presence of urea, which significantly (p<0.001) increased the 2nd-order reaction rate constant over that of the untreated (no urea) control. Three major TNT metabolites were detected in the roots, but not in the shoot, namely 1,3,5-trinitrobenzene, 4-amino 2,6-dinitrotoluene, and 2-amino 4,6-dinitrotoluene, indicating TNT degradation by vetiver grass. - A common agrochemical, urea catalyzes TNT removal by vetiver grass in aqueous media

  11. Degradation of 2,4,6-trinitrotoluene by P. aeruginosa and characterization of some metabolites

    Directory of Open Access Journals (Sweden)

    Hatice Aysun Mercimek

    2015-03-01

    Full Text Available Degradation of 2,4,6-trinitrotoluene (TNT, a nitroaromatic explosive found in the soil and ground water, was investigated using Pseudomonas aeruginosa in in vitroexperiments. Biodegradable abilitiy of this bacteria was performed with 50 and 75 mg L−1 TNT concentrations in a defined liquid medium for 96 h time period. Treatment of TNT in supernatant samples taken at 0, 6, 12, 24, 48, 72 and 96 h from agitated vessels was followed by reverse-phase high-performance liquid chromatography (HPLC. In cultures supplemented with 50 and 75 mgL−1 TNT, after 96 h of incubation 46% and 59% reduction were detected respectively. Two metabolites as degradation intermediates with nitrite release into the medium, 2,4-dinitrotoluene (2,4-DNT and 4-aminodinitrotoluene (4-ADNT, were elucidated by thin layer chromatography (TLC and gas chromatography-mass spectrometry (GC-MS. These findings clearly indicate that Pseudomonas aeruginosa can be used in bioremediation of TNT contaminated sites.

  12. The high pressure-temperature phase behavior of 2,4,6-trinitrotoluene (TNT)

    Science.gov (United States)

    Bowden, Patrick; Chellappa, Raja; Dattelbaum, Dana; Manner, Virginia; Mack, Nathan; Liu, Zhenxian

    2013-06-01

    2,4,6-trinitrotoluene (TNT) is a widely used explosive that is relatively insensitive to initiation by shock loading. While the detonation properties of TNT have been extensively reported, the high pressure-temperature (P - T) stability of TNT has not been investigated in detail. In addition, there are no studies that have determined the effects of pressure on the stability of the liquid phase. At ambient conditions, TNT crystallizes in a monoclinic lattice (space group P21 / a) , and our previous x-ray diffraction (XRD) measurements at room temperature suggested a phase transition to orthorhombic (space group Pca21) at ~20 GPa. In this work, we have performed in situ synchrotron XRD and vibrational spectroscopy measurements at various P - T conditions along isothermal and isobaric pathways to confirm previously reported phase transitions, and investigate phase stabilities up to 30 GPa and 500°C. Using all the available data, we have established the first comprehensive high P - T phase diagram of TNT, including the melting line as a function of pressure. While our synchrotron IR and Raman spectroscopy measurements indicate spectral changes at ~2 GPa, careful XRD measurements (hydrostatic, He medium and non-hydrostatic) reveal that the monoclinic phase is likely stable up to 20 GPa. We will present a self-consistent P - V - T equation of state derived from the reported structural and vibrational data.

  13. High uptake of 2,4,6-trinitrotoluene by vetiver grass - Potential for phytoremediation?

    International Nuclear Information System (INIS)

    2,4,6-Trinitrotoluene (TNT) is a potent mutagen, and a Group C human carcinogen that has been widely used to produce munitions and explosives. Vast areas that have been previously used as ranges, munition burning, and open detonation sites are heavily contaminated with TNT. Conventional remediation activities in such sites are expensive and damaging to the ecosystem. Phytoremediation offers a cost-effective, environment-friendly solution, utilizing plants to extract TNT from contaminated soil. We investigated the potential use of vetiver grass (Vetiveria zizanioides) to effectively remove TNT from contaminated solutions. Vetiver grass plants were grown in hydroponic systems containing 40 mg TNT L-1 for 8 d. Aqueous concentrations of TNT reached the method detection limit (∼1 μg L-1) within the 8-d period, demonstrating high affinity of vetiver for TNT, without any visible toxic effects. Results from this preliminary hydroponic study are encouraging, but in need of verification using TNT-contaminated soils. - Vetiver grass demonstrates ability to absorb TNT in aqueous media

  14. The Value Of The Nonprofit Hospital Tax Exemption Was $24.6 Billion In 2011.

    Science.gov (United States)

    Rosenbaum, Sara; Kindig, David A; Bao, Jie; Byrnes, Maureen K; O'Laughlin, Colin

    2015-07-01

    The federal government encourages public support for charitable activities by allowing people to deduct donations to tax-exempt organizations on their income tax returns. Tax-exempt hospitals are major beneficiaries of this policy because it encourages donations to the hospitals while shielding them from federal and state tax liability. In exchange, these hospitals must engage in community benefit activities, such as providing care to indigent patients and participating in Medicaid. The congressional Joint Committee on Taxation estimated the value of the nonprofit hospital tax exemption at $12.6 billion in 2002--a number that included forgone taxes, public contributions, and the value of tax-exempt bond financing. In this article we estimate that the size of the exemption reached $24.6 billion in 2011. The Affordable Care Act (ACA) brings a new focus on community benefit activities by requiring tax-exempt hospitals to engage in communitywide planning efforts to improve community health. The magnitude of the tax exemption, coupled with ACA reforms, underscores the public's interest not only in community benefit spending generally but also in the extent to which nonprofit hospitals allocate funds for community benefit expenditures that improve the overall health of their communities. PMID:26085486

  15. High uptake of 2,4,6-trinitrotoluene by vetiver grass - Potential for phytoremediation?

    Energy Technology Data Exchange (ETDEWEB)

    Makris, Konstantinos C. [Department of Earth and Environmental Science, College of Sciences, University of Texas at San Antonio, 6900 North Loop 1604 West, One UTSA Circle, San Antonio, TX 78249-0663 (United States); Shakya, Kabindra M. [Department of Earth and Environmental Science, College of Sciences, University of Texas at San Antonio, 6900 North Loop 1604 West, One UTSA Circle, San Antonio, TX 78249-0663 (United States); Datta, Rupali [Department of Earth and Environmental Science, College of Sciences, University of Texas at San Antonio, 6900 North Loop 1604 West, One UTSA Circle, San Antonio, TX 78249-0663 (United States); Sarkar, Dibyendu [Department of Earth and Environmental Science, College of Sciences, University of Texas at San Antonio, 6900 North Loop 1604 West, One UTSA Circle, San Antonio, TX 78249-0663 (United States)]. E-mail: dibyendu.sarkar@utsa.edu; Pachanoor, Devanand [Department of Earth and Environmental Science, College of Sciences, University of Texas at San Antonio, 6900 North Loop 1604 West, One UTSA Circle, San Antonio, TX 78249-0663 (United States)

    2007-03-15

    2,4,6-Trinitrotoluene (TNT) is a potent mutagen, and a Group C human carcinogen that has been widely used to produce munitions and explosives. Vast areas that have been previously used as ranges, munition burning, and open detonation sites are heavily contaminated with TNT. Conventional remediation activities in such sites are expensive and damaging to the ecosystem. Phytoremediation offers a cost-effective, environment-friendly solution, utilizing plants to extract TNT from contaminated soil. We investigated the potential use of vetiver grass (Vetiveria zizanioides) to effectively remove TNT from contaminated solutions. Vetiver grass plants were grown in hydroponic systems containing 40 mg TNT L{sup -1} for 8 d. Aqueous concentrations of TNT reached the method detection limit ({approx}1 {mu}g L{sup -1}) within the 8-d period, demonstrating high affinity of vetiver for TNT, without any visible toxic effects. Results from this preliminary hydroponic study are encouraging, but in need of verification using TNT-contaminated soils. - Vetiver grass demonstrates ability to absorb TNT in aqueous media.

  16. Chemically catalyzed uptake of 2,4,6-trinitrotoluene by Vetiveria zizanioides

    Energy Technology Data Exchange (ETDEWEB)

    Makris, Konstantinos C. [Environmental Geochemistry Laboratory, Department of Earth and Environmental Science, College of Sciences, University of Texas at San Antonio, One UTSA Circle, San Antonio, TX 78249 (United States); Shakya, Kabindra M. [Environmental Geochemistry Laboratory, Department of Earth and Environmental Science, College of Sciences, University of Texas at San Antonio, One UTSA Circle, San Antonio, TX 78249 (United States); Datta, Rupali [Environmental Geochemistry Laboratory, Department of Earth and Environmental Science, College of Sciences, University of Texas at San Antonio, One UTSA Circle, San Antonio, TX 78249 (United States); Sarkar, Dibyendu [Environmental Geochemistry Laboratory, Department of Earth and Environmental Science, College of Sciences, University of Texas at San Antonio, One UTSA Circle, San Antonio, TX 78249 (United States)]. E-mail: dibyendu.sarkar@utsa.edu; Pachanoor, Devanand [Environmental Geochemistry Laboratory, Department of Earth and Environmental Science, College of Sciences, University of Texas at San Antonio, One UTSA Circle, San Antonio, TX 78249 (United States)

    2007-07-15

    The efficiency of vetiver grass (Vetiveria zizanioides) in removing 2,4,6-trinitrotoluene (TNT) from aqueous media was explored in the presence of a common agrochemical, urea, used as a chaotropic agent. Chaotropic agents disrupt water structure, increasing solubilization of hydrophobic compounds (TNT), thus, enhancing plant TNT uptake. The primary objectives of this study were to: (i) characterize TNT absorption by vetiver in hydroponic media, and (ii) determine the effect of urea on chemically catalyzing TNT uptake by vetiver grass in hydroponic media. Results showed that vetiver exhibited a high TNT uptake capacity (1.026 mg g{sup -1}), but kinetics were slow. Uptake was considerably enhanced in the presence of urea, which significantly (p<0.001) increased the 2nd-order reaction rate constant over that of the untreated (no urea) control. Three major TNT metabolites were detected in the roots, but not in the shoot, namely 1,3,5-trinitrobenzene, 4-amino 2,6-dinitrotoluene, and 2-amino 4,6-dinitrotoluene, indicating TNT degradation by vetiver grass. - A common agrochemical, urea catalyzes TNT removal by vetiver grass in aqueous media.

  17. Using corona discharge-ion mobility spectrometry for detection of 2,4,6-Trichloroanisole.

    Science.gov (United States)

    Lichvanová, Zuzana; Ilbeigi, Vahideh; Sabo, Martin; Tabrizchi, Mahmoud; Matejčík, Stefan

    2014-09-01

    In this work possible application of the corona discharge-ion mobility spectrometer (CD-IMS) for detection of 2,4,6-Trichloroanisole (TCA) has been investigated. We applied CD-IMS interfaced with orthogonal acceleration time of flight mass spectrometer (CD-IMS-oaTOF) to study the ion processes within the CD-IMS technique. The CD-IMS instrument was operated in two modes, (i) standard and (ii) reverse flow modes resulting in different chemical ionisation schemes by NO3(-)(HNO3)n (n=0,1,2) and O2(-)(H2O)n (n=0,1,2), respectively. The O2(-)(H2O)n ionisation was associated with formation of Cl(-) and (TCA-CH3)(-) ions from TCA. The NO3(-)(HNO3)n ionisation, resulted in formation of NO3(-)(HNO3)(TCA-Cl) adduct ions. Limit of detection (LOD) for TCA was determined in gas (100 ppb) and solid phases (150 ng). PMID:24913882

  18. Study on the Synthesis of Phenyl- thio- phosphine Acyl bis ( 2,4,6 - tribromophenyl) amine%苯基硫代膦酰二(2,4,6-三溴苯基)胺的合成研究

    Institute of Scientific and Technical Information of China (English)

    王彦林; 张艳丽; 陈小慧; 季勇

    2011-01-01

    文章以苯胺,溴素,苯基硫代膦酰二氯等为原料,合成了P,N,S,Br四元素协同阻燃的新型高效阻燃剂苯基硫代膦酰二(2,4,6-三溴苯基)胺,最佳工艺条件为以二甲苯做溶剂,吡啶做缚酸剂,低水合硼酸锌作催化剂,苯基硫代膦酰二氯与2,4,6-三溴苯胺的摩尔比为1:2.1,回流反应12 h,产率可达81.21%.并通过IR和NMR对产品的结构进行了表征.%In this paper, a novel high effective flame retardant which collaborated by P, N,S, Br was prepared via the reaction of aniline, bromide and phenylthiophosphonic dichloride. The optimum reaction conditions were: Xylene as the solvent , pyridine as aci - binding agent, low hydrated zinc borate as catalyst, while the molar ratio for the phenylthiophosphonic dichloride and 2,4,6 - tribromoaniline wasl: 2. 1, and the reaction time is 12 h, the yield was 81.21%. The structure of product were characterized by 1R and NMR.

  19. Selective detection of 2,4,6-trinitrophenol based on a fluorescent nanoscale bis(8-hydroxyquinoline) metal complex.

    Science.gov (United States)

    Lv, Xiao-Jun; Qi, Liang; Gao, Xiang-Yu; Wang, Huan; Huo, Yuan; Zhang, Zhi-Qi

    2016-04-01

    The reliable and accurate detection of explosives such as 2,4,6-trinitrophenol (TNP) and 2,4,6-trinitrotoluene (TNT) is in high demand for homeland security and public safety. Although extremely high sensitivity towards TNT has been demonstrated, detection of TNP remains a challenge. In this work, a fluorescent nanoscale complex composed of bis(8-hydroxyquinoline) and Al(3+) ions has been prepared, characterized and applied in detection of TNP. This complex exhibits the ability to sense the nitro explosive TNP via a fluorescence quenching mechanism with high selectivity. A simple paper test system for the rapid monitoring of TNP was also investigated. The results show that Bhq-Al is a quite ideal sensing material for trace-level detection of TNP. PMID:26838414

  20. The statistical model calculation of prompt neutron spectra from spontaneous fission of {sup 244}Cm and {sup 246}Cm

    Energy Technology Data Exchange (ETDEWEB)

    Gerasimenko, B.F. [V.G. Khlopin Radium Inst., Saint Peterburg (Russian Federation)

    1997-03-01

    The calculations of integral spectra of prompt neutrons of spontaneous fission of {sup 244}Cm and {sup 246}Cm were carried out. The calculations were done by the Statistical Computer Code Complex SCOFIN applying the Hauser-Feschbach method as applied to the description of the de-excitation of excited fission fragments by means of neutron emission. The emission of dipole gamma-quanta from these fragments was considered as a competing process. The average excitation energy of a fragment was calculated by two-spheroidal model of tangent fragments. The density of levels in an excited fragment was calculated by the Fermi-gas model. The quite satisfactory agreement was reached between theoretical and experimental results obtained in frames of Project measurements. The calculated values of average multiplicities of neutron number were 2,746 for {sup 244}Cm and 2,927 for {sup 246}Cm that was in a good accordance with published experimental figures. (author)

  1. (N,N,N′,N′-Tetramethylethylenediamine-κNbis(2,4,6-trimethylphenolato-κOgermanium(II

    Directory of Open Access Journals (Sweden)

    Eduard Rusanov

    2012-03-01

    Full Text Available In the title compound, [Ge(C9H11O2(C6H16N2], the GeII atom is coordinated in a distorted trigonal–pyramidal geometry by two O atoms belonging to two 2,4,6-trimethylphenolate ligands and one N atom of a tetramethylethylenediamine ligand. Comparing the structure with published data of similar compounds shows that the Ge—O bonds are covalent and the Ge—N bond is coordinated.

  2. Removal of 2,4,6-trichlorophenol from a solution by humic acids repeatedly extracted from a peat soil

    International Nuclear Information System (INIS)

    Humic acid (HA) is one of the major components of soil organic matter. It strongly affects the sorption behavior of organic and inorganic contaminants in soils. To obtain a better understanding of the interactions of contaminants with HA, a repeated extraction technique has been applied to a peat soil to obtain HA fractions with varying aliphaticity and aromaticity, which were subsequently correlated to the sorption properties of 2,4,6-trichlorophenol (TCP). HA fractions were extracted repeatedly using an alkaline solution and each HA fraction was separated into two portions with an air-drying or re-suspending (denoted as RSHAs) process. Solid-state 13C NMR and elemental analysis demonstrated that the aromaticity and polarity of HAs decreased with extractions. Kinetic results indicated that air-dried HAs exhibited two-step first order sorption behavior with a rapid stage followed by a slower stage. The slower sorption is attributed to the diffusion of 2,4,6-TCP in the condensed aromatic domains of HAs. Conversely, sorption of 2,4,6-TCP on RSHAs was extremely rapid and could not be fitted with any kinetic model. For air-dried HAs the sorption capacity (Koc) was weakly correlated with the chemical compositions of HAs. However, a positive trend between Koc and aromaticity was observed for RSHAs. Compared with the results of air-dried HAs with their counterparts of RSHAs, it is therefore concluded that air-drying may alter the structure of HAs through artificially creating a more condensed domain in HAs. The structural alternation may result in an incorrect interpretation of the relationship between sorption capacity and chemical composition of HAs and a misjudgment of the transport behavior of 2,4,6-TCP in soils and sediments

  3. Transformation of 2,4,6-trinitrotoluene (TNT) by actinomycetes isolated from TNT-contaminated and uncontaminated environments.

    OpenAIRE

    Pasti-Grigsby, M B; Lewis, T A; Crawford, D. L.; Crawford, R L

    1996-01-01

    Actinomycete strains isolated from 2,4,6-trinitrotoluene (TNT)-contaminated and uncontaminated environments were compared for TNT tolerance and abilities to transform TNT. Regardless of previous TNT exposure history, no significant differences in TNT tolerance were seen among strains. Selected strains did not significantly mineralize [14C]TNT. The actinomycetes did, however, transform TNT into reduced intermediates. The data indicate that, in actinomycete-rich aerobic environments like compos...

  4. Dual role of endogenous serotonin in 2,4,6-trinitrobenzene sulfonic acid-induced colitis

    Directory of Open Access Journals (Sweden)

    Alberto eRapalli

    2016-03-01

    Full Text Available Background and Aims: Changes in gut serotonin content have been described in Inflammatory Bowel Disease and in different experimental models of colitis: the critical role of this monoamine in the pathogenesis of chronic gastrointestinal inflammation is gradually emerging. Aim of the present study was to evaluate the contribution of endogenous serotonin through the activation of its specific receptor subtypes to the local and systemic inflammatory responses in an experimental model of Inflammatory Bowel Disease. Methods: Colitis was induced by intrarectal 2,4,6-TriNitroBenzene Sulfonic acid in mice subacutely treated with selective antagonists of 5-HT1A (WAY100135, 5-HT2A (Ketanserin, 5-HT3 (Ondansetron, 5-HT4 (GR125487, 5-HT7 (SB269970 receptors and with 5-HT1A agonist 8-Hydroxy-2-(di-n-propylaminotetralin. Results: Blockade of 5-HT1A receptors worsened TNBS-induced local and systemic neutrophil recruitment while 5-HT1A agonist delayed and mitigated the severity of colitis, counteracting the increase in colonic 5-HT content. On the contrary, blockade of 5-HT2A receptors improved global health conditions, reduced colonic morphological alterations, down-regulated neutrophil recruitment, inflammatory cytokines levels and colonic apoptosis. Antagonism of 5-HT3, 5-HT4 and 5-HT7 receptor sites did not remarkably affect the progression and outcome of the pathology or only slightly improved it.Conclusions: The prevailing deleterious contribution given by endogenous serotonin to inflammation in TNBS-induced colitis is seemingly mediated by 5-HT2A and, to a lesser extent, by 5-HT4 receptors and coexists with the weak beneficial effect elicited by 5-HT1A stimulation. These findings suggest how only a selective interference with 5-HT pro-inflammatory actions may represent an additional potential therapeutic option for intestinal inflammatory disorders.

  5. Development of a cellular biosensor for the detection of 2,4,6-trichloroanisole (TCA).

    Science.gov (United States)

    Varelas, Vassileios; Sanvicens, Nuria; M-Pilar-Marco; Kintzios, Spiridon

    2011-05-15

    2,4,6-trichloroanisole (TCA) is a microbial metabolite formed from chlorophenols through the activity of several natural fungal strains present on the cork oak bark. TCA is the primary compound responsible for the mousty/mould off-odour known as "cork taint" present in cork stoppers, wine, water and alcoholic beverages. Chromatographic and electrochemical methods are currently used for the determination of TCA, however its detection at low concentrations remains a technical challenge. The aim of this study was the development of a rapid novel biosensor system based on the Bioelectric Recognition Assay (BERA). The sensor measured the electric response of cultured membrane-engineered fibroblast cells suspended in an alginate gel matrix due to the change of their membrane potential in the presence of the analyte. Membrane-engineered cells were prepared by osmotic insertion of 0.5 μg/l of specific TCA antibodies into the membrane of the cells. The BERA-based sensor was able to detect TCA in a few minutes (3-5 min) at extremely low concentrations (10(-1)ppt), thus demonstrating higher sensitivity than the human sensory threshold. In addition, the assay was quite selective against other haloanisoles and halophenols structurally related to or co-occurring with TCA. Finally the sensor was tested against real white wine samples from cork soaks. At this real test, the BERA sensor was able to detect TCA from cork soaks rapidly (3-5 min) at very low concentrations (1.02-12 ng/l), covering the whole range for the detection threshold for wines (1.4-10 ng/l). Therefore, this novel biosensor offers new perspectives for ultra-rapid, ultra-sensitive and low-cost monitoring of TCA presence in cork and wine and possibly also other food commodities. PMID:21482306

  6. Dual Role of Endogenous Serotonin in 2,4,6-Trinitrobenzene Sulfonic Acid-Induced Colitis

    Science.gov (United States)

    Rapalli, Alberto; Bertoni, Simona; Arcaro, Valentina; Saccani, Francesca; Grandi, Andrea; Vivo, Valentina; Cantoni, Anna M.; Barocelli, Elisabetta

    2016-01-01

    Background and Aims: Changes in gut serotonin (5-HT) content have been described in Inflammatory Bowel Disease (IBD) and in different experimental models of colitis: the critical role of this monoamine in the pathogenesis of chronic gastrointestinal inflammation is gradually emerging. Aim of the present study was to evaluate the contribution of endogenous 5-HT through the activation of its specific receptor subtypes to the local and systemic inflammatory responses in an experimental model of IBD. Materials and Methods: Colitis was induced by intrarectal 2,4,6-TriNitroBenzene Sulfonic acid in mice subacutely treated with selective antagonists of 5-HT1A (WAY100135), 5-HT2A (Ketanserin), 5-HT3 (Ondansetron), 5-HT4 (GR125487), 5-HT7 (SB269970) receptors and with 5-HT1A agonist 8-Hydroxy-2-(di-n-propylamino)tetralin. Results: Blockade of 5-HT1A receptors worsened TNBS-induced local and systemic neutrophil recruitment while 5-HT1A agonist delayed and mitigated the severity of colitis, counteracting the increase in colonic 5-HT content. On the contrary, blockade of 5-HT2A receptors improved global health conditions, reduced colonic morphological alterations, down-regulated neutrophil recruitment, inflammatory cytokines levels and colonic apoptosis. Antagonism of 5-HT3, 5-HT4, and 5-HT7 receptor sites did not remarkably affect the progression and outcome of the pathology or only slightly improved it. Conclusion: The prevailing deleterious contribution given by endogenous 5-HT to inflammation in TNBS-induced colitis is seemingly mediated by 5-HT2A and, to a lesser extent, by 5-HT4 receptors and coexists with the weak beneficial effect elicited by 5-HT1A stimulation. These findings suggest how only a selective interference with 5-HT pro-inflammatory actions may represent an additional potential therapeutic option for intestinal inflammatory disorders. PMID:27047383

  7. Bis(2,4,6-tri-amino-pyrimidin-1-ium) sulfate penta-hydrate.

    Science.gov (United States)

    Nimthong, Ruthairat; Chamchong, Siva; Pakawatchai, Chaveng; Mokhagul, Jedsada; Wattanakanjana, Yupa

    2013-01-01

    The asymmetric unit of the title salt, 2C4H8N5 (+)·SO4 (2-)·5H2O, contains four 2,4,6-tri-amino-pyrimidinium (TAPH(+)) cations, two sulfate anions and ten lattice water mol-ecules. Each two of the four TAPH(+) cations form dimers via N-H⋯N hydrogen bonds between the amino groups and the unprotonated pyrimidine N atoms [graph-set motif R 2 (2)(8)]. The (TAPH(+))2 dimers, in turn, form slightly offset infinite π-π stacks parallel to [010], with centroid-centroid distances between pyrimidine rings of 3.5128 (15) and 3.6288 (16) Å. Other amino H atoms, as well as the pyrimidinium N-H groups, are hydrogen-bonded to sulfate and lattice water O atoms. The SO4 (2-) anions and water mol-ecules are inter-connected with each other via O-H⋯O hydrogen bonds. The combination of hydrogen-bonding inter-actions and π-π stacking leads to the formation of a three-dimensional network with alternating columns of TAPH(+) cations and channels filled with sulfate anions and water mol-ecules. One of the sulfate anions shows a minor disorder by a ca 37° rotation around one of the S-O bonds [occupancy ratio of the two sets of sites 0.927 (3):0.073 (3)]. One water mol-ecule is disordered over two mutually exclusive positions with an occupancy ratio of 0.64 (7):0.36 (7). PMID:24109349

  8. Biodegradation of TNT (2,4,6-Trinitrotoluene) by Phanerochaete chrysosporium

    International Nuclear Information System (INIS)

    Extensive biodegradation of TNT (2,4,6-trinitrotoluene) by the white rot fungus Phanerochaete chrysosporium was observed. At an initial concentration of 1.3 mg/liter, 35.4 ± 3.6% of the [14C]TNT was degraded to 14CO2 in 18 days. The addition of glucose 12 days after the addition of TNT did not stimulate mineralization, and, after 18 days of incubation with TNT only, about 3.3% of the initial TNT could be recovered. Mineralization of [14C]TNT absorbed on soil was also examined. Ground corncobs served as the nutrient for slow but sustained degradation of [14C]TNT to 14CO2 such that 6.3 ± 0.6% of the [14C]TNT initially present was converted to 14CO2 during the 30-day incubation period. Mass balance analysis of liquid cultures and of soil-corncob cultures revealed that polar [14C]TNT metabolites are formed in both systems, and high-performance liquid chromatography analyses revealed that less then 5% of the radioactivity remained as undegraded [14C]TNT following incubation with the fungus in soil and liquid cultures. When the concentration of TNT in cultures (both liquid and soil) was adjusted to contamination levels that might be found in the environment, i.e., 10,000 mg/kg in soil and 100 mg/liter in water, mineralization studies showed that 18.4 ± 2.9% and 19.6 ± 3.5% of the initial TNT was converted to 14CO2 in 90 days in soil and liquid cultures, respectively. In both cases (90 days in water at 100 mg/liter and in soil at 10,000 mg/kg) approximately 85% of the TNT was degraded. These results suggest that this fungus may be useful for the decontamination of sites in the environment contaminated with TNT

  9. Biodegradation of 2,4,6-trichlorophenol in a packed-bed biofilm reactor equipped with an internal net draft tube riser for aeration and liquid circulation

    International Nuclear Information System (INIS)

    For the aerobic biodegradation of the fungicide and defoliant 2,4,6-trichlorophenol (2,4,6-TCP), a bench-scale packed-bed bioreactor equipped with a net draft tube riser for liquid circulation and oxygenation (PB-ALR) was constructed. To obtain a high packed-bed volume relative to the whole bioreactor volume, a high AD/AR ratio was used. Reactor's downcomer was packed with a porous support of volcanic stone fragments. PB-ALR hydrodynamics and oxygen mass transfer behavior was evaluated and compared to the observed behavior of the unpacked reactor operating as an internal airlift reactor (ALR). Overall gas holdup values εG, and zonal oxygen mass transfer coefficients determined at various airflow rates in the PB-ALR, were higher than those obtained with the ALR. When comparing mixing time values obtained in both cases, a slight increment in mixing time was observed when reactor was operated as a PB-ALR. By using a mixed microbial community, the biofilm reactor was used to evaluate the aerobic biodegradation of 2,4,6-TCP. Three bacterial strains identified as Burkholderia sp., Burkholderia kururiensis and Stenotrophomonas sp. constituted the microbial consortium able to cometabolically degrade the 2,4,6-TCP, using phenol as primary substrate. This consortium removed 100% of phenol and near 99% of 2,4,6-TCP. Mineralization and dehalogenation of 2,4,6-TCP was evidenced by high COD removal efficiencies (∼95%), and by the stoichiometric release of chloride ions from the halogenated compound (∼80%). Finally, it was observed that the microbial consortium was also capable to metabolize 2,4,6-TCP without phenol as primary substrate, with high removal efficiencies (near 100% for 2,4,6-TCP, 92% for COD and 88% for chloride ions)

  10. 40 CFR 721.7280 - 1,3-Propanediamine, N,N′-1,2-ethanediylbis-, polymer with 2,4,6-trichloro-1,3,5-triazine...

    Science.gov (United States)

    2010-07-01

    ...-ethanediylbis-, polymer with 2,4,6-trichloro-1,3,5-triazine, reaction products with N-butyl-2,2,6,6-tetramethyl...-, polymer with 2,4,6-trichloro-1,3,5-triazine, reaction products with N-butyl-2,2,6,6-tetramethyl-4... identified as 1,3-propanediamine, N,N′-1,2-ethanediylbis-, polymer with...

  11. Biodegradation of 2,4,6-trichlorophenol in a packed-bed biofilm reactor equipped with an internal net draft tube riser for aeration and liquid circulation

    Energy Technology Data Exchange (ETDEWEB)

    Gomez-De Jesus, A.; Romano-Baez, F.J.; Leyva-Amezcua, L.; Juarez-Ramirez, C.; Ruiz-Ordaz, N. [Departamento de Ingenieria Bioquimica, Escuela Nacional de Ciencias Biologicas, IPN. Prol. Carpio y Plan de Ayala, Colonia Santo Tomas, s/n. CP 11340, Mexico, D.F. (Mexico); Galindez-Mayer, J. [Departamento de Ingenieria Bioquimica, Escuela Nacional de Ciencias Biologicas, IPN. Prol. Carpio y Plan de Ayala, Colonia Santo Tomas, s/n. CP 11340, Mexico, D.F. (Mexico)], E-mail: cmayer@encb.ipn.mx

    2009-01-30

    For the aerobic biodegradation of the fungicide and defoliant 2,4,6-trichlorophenol (2,4,6-TCP), a bench-scale packed-bed bioreactor equipped with a net draft tube riser for liquid circulation and oxygenation (PB-ALR) was constructed. To obtain a high packed-bed volume relative to the whole bioreactor volume, a high A{sub D}/A{sub R} ratio was used. Reactor's downcomer was packed with a porous support of volcanic stone fragments. PB-ALR hydrodynamics and oxygen mass transfer behavior was evaluated and compared to the observed behavior of the unpacked reactor operating as an internal airlift reactor (ALR). Overall gas holdup values {epsilon}{sub G}, and zonal oxygen mass transfer coefficients determined at various airflow rates in the PB-ALR, were higher than those obtained with the ALR. When comparing mixing time values obtained in both cases, a slight increment in mixing time was observed when reactor was operated as a PB-ALR. By using a mixed microbial community, the biofilm reactor was used to evaluate the aerobic biodegradation of 2,4,6-TCP. Three bacterial strains identified as Burkholderia sp., Burkholderia kururiensis and Stenotrophomonas sp. constituted the microbial consortium able to cometabolically degrade the 2,4,6-TCP, using phenol as primary substrate. This consortium removed 100% of phenol and near 99% of 2,4,6-TCP. Mineralization and dehalogenation of 2,4,6-TCP was evidenced by high COD removal efficiencies ({approx}95%), and by the stoichiometric release of chloride ions from the halogenated compound ({approx}80%). Finally, it was observed that the microbial consortium was also capable to metabolize 2,4,6-TCP without phenol as primary substrate, with high removal efficiencies (near 100% for 2,4,6-TCP, 92% for COD and 88% for chloride ions)

  12. Suppression of PCDD/Fs formation because of the presence of DEHP during the model slow combustion of 2,4,6-trichlorophenol.

    Science.gov (United States)

    Kishi, Tomohiro; Shinkura, Toshinori; Suzuki, Shota; Kawakami, Tsuyoshi; Takeda, Ken; Onodera, Sukeo

    2010-03-01

    The thermal reactions of 2,4,6-T(3)CP in the presence and absence of DEHP in a dry air stream was investigated using a silica flow reactor at a residence time of 10s and a temperature range from 450 degrees C to 850 degrees C. Two isomers of T(4)CDDs (1,3,6,8- and 1,3,7,9-T(4)CDDs) were the most abundant products during the combustion of 2,4,6-T(3)CP alone and were observed at temperatures ranging from 550 degrees C to 800 degrees C. In the presence of DEHP, we observed a remarkable decrease in the yields of T(4)CDDs during the combustion of 2,4,6-T(3)CP. The suppression ratio of the T(4)CDDs formation was more than 90% in the case of the co-combustion with 10% DEHP in molar ratio. Other PCDD/Fs except for 2,7-/2,8-DCDD and 2,8-DCDF also decreased upon the combustion of 2,4,6-T(3)CP in the presence of DEHP. During the co-combustion of 2,4,6-T(3)CP and DEHP, the residual ratio of 2,4,6-T(3)CP increased slightly and formations of lower chlorinated phenols were observed. The suppression of the T(4)CDDs was strongly dependent on the DEHP ratio in the starting material. The prospective pathways of the suppressions of the T(4)CDDs formations during the combustion of 2,4,6-T(3)CP in the presence of DEHP were proposed. PMID:20080281

  13. Anomalous temperature effect on the hydrogen bond strength and phase transition in 2,4,6-trimethylpyridinium pentachlorophenolate.

    Science.gov (United States)

    Majerz, Irena; Jakubas, Ryszard

    2004-06-01

    The phase transition in 2,4,6-trimethylpyridinium pentachlorophenolate has been studied by differential scanning calorimetry (DSC), thermogravimetric analysis (TGA) and dielectric method as well as theoretical calculations. The crystal undergoes a first order phase transition of order-disorder type at 376 K. The transition to the high temperature phase causes anomalous hydrogen-bond shortening. Experimental and theoretical results show that the change in the mutual orientation of the phenol and pyridine rings is connected with the change of the hydrogen bond. Such an effect, which appears in the present simple hydrogen-bond complex, may be common also for the other hydrogen-bond complexes.

  14. The effects of temperature gradient and growth rate on the morphology and fatigue properties of MAR-M246(Hf)

    Energy Technology Data Exchange (ETDEWEB)

    Schmidt, D.D.; Alter, W.S.; Hamilton, W.D.; Parr, R.A.

    1989-08-01

    MAR-M246(Hf) is a nickel based superalloy used in the turbopump blades of the Space Shuttle main engines. The effects are considered of temperature gradient (G) and growth rate (R) on the microstructure and fatigue properties of this superalloy. The primary dendrite arm spacings were found to be inversely proportional to both temperature gradient and growth rate. Carbide and gamma - gamma prime morphology trends were related to G/R ratios. Weibull analysis of fatigue results shows the characteristic life to be larger by a factor of 10 for the low gradient/fast rate pairing of G and R, while the reliability (beta) was lower.

  15. Poly[[triaqua­(μ3-pyridine-2,4,6-tricarboxyl­ato)terbium(III)] monohydrate

    OpenAIRE

    Hong-lin Zhu

    2012-01-01

    The asymmetric unit of the title compound, {[Tb(C8H2NO6)(H2O)3]·H2O}n, contains one TbIII ion, one pyridine-2,4,6-tricarboxylate (ptc) anion, three aqua ligands and one lattice water molecule. The TbIII ion is nine coordinated by one N and five O atoms from three ptc ligands and by three O atoms from the three aqua ligands in a distorted bicapped trigonal–prismatic geometry. The ptc ligands bridge the TbIII ions into a two-dimensional polymeric framework parallel to (100). ...

  16. Structural studies of the polysaccharides from the lipopolysaccharides of Azospirillum brasilense Sp246 and SpBr14.

    Science.gov (United States)

    Sigida, Elena N; Fedonenko, Yuliya P; Shashkov, Alexander S; Grinev, Vyacheslav S; Zdorovenko, Evelina L; Konnova, Svetlana A; Ignatov, Vladimir V; Knirel, Yuriy A

    2014-10-29

    Lipopolysaccharides from closely related Azospirillum brasilense strains, Sp246 and SpBr14, were obtained by phenol-water extraction. Mild acid hydrolysis of the lipopolysaccharides followed by GPC on Sephadex G-50 resulted in polysaccharide mixtures. On the basis of sugar and methylation analyses, Smith degradation and (1)H and (13)C NMR spectroscopy data, it was concluded that both bacteria possess the same two distinct polysaccharides having structures 1 and 2: [structure: see text]. Structure 1 has been reported earlier for a polysaccharide of A. brasilense 54 [Fedonenko et al., 2011] whereas to our knowledge structure 2 has not been hitherto found in bacterial polysaccharides. PMID:25240180

  17. Vicarious nucleophilic substitution using 4-amino-1,2,4-triazole, hydroxylamine or O-alkylhydroxylamine to prepare 1,3-diamino-2,4,6-trinitrobenzene or 1,3,5-triamino-2,4,6-trinitrobenzene

    Science.gov (United States)

    Mitchell, Alexander R.; Pagoria, Philip F.; Schmidt, Robert D.

    1997-01-01

    The present invention relates to a process to produce 1,3-diamino-2,4,6-trinitrobenzene (DATB) or 1,3,5-triamino-2,4,6,-trinitrobenzene (TATB) by: (a) reacting at ambient pressure and a temperature of between about 0.degree. and 50.degree. C. for between about 0.1 and 24 hr, a trinitroaromatic compound of structure V: ##STR1## wherein X, Y, and Z are each independently selected from the group consisting of --H and --NH.sub.2, with the proviso that at least 1 or 2 of X, Y, and Z are hydrogen; with an effective amount of 1-amino-1,2,4-triazole, hydroxylamine or O-alkylhydroxamine to produce DATB or TATB; in the presence of a strong base selected from sodium butoxide, potassium butoxide, potassium propoxide, sodium propoxide, sodium ethoxide, potassium ethoxide, sodium methoxide, potassium methoxide, and combinations thereof; in a solvent selected from the group consisting of methanol, ethanol, propanol, butanol, dimethylsulphoxide, N-methylpyrrolidone, hexamethylphosphoramide, dimethylformide, dimethylacetamide and mixtures thereof, provided that when alcohols are present or when hydroxylamine or its O-alkyl derivatives replace ATA primarily DATB is formed; and (b) isolating the DATB or TATB produced. DATB and TATB are important and useful specialty explosives and intermediates for other materials.

  18. Synthesis of bis(3-{[2-(allyloxyethoxy]methyl}-2,4,6-trimethylbenzoyl(phenylphosphine oxide – a tailor-made photoinitiator for dental adhesives

    Directory of Open Access Journals (Sweden)

    Norbert Moszner

    2010-03-01

    Full Text Available Because of the poor solubility of the commercially available bisacylphosphine oxides in dental acidic aqueous primer formulations, bis(3-{[2-(allyloxyethoxy]methyl}-2,4,6-trimethylbenzoyl(phenylphosphine oxide (WBAPO was synthesized starting from 3-(chloromethyl-2,4,6-trimethylbenzoic acid by the dichlorophosphine route. The substituent was introduced by etherification with 2-(allyloxyethanol. In the second step, 3-{[2-(allyloxyethoxy]methyl}-2,4,6-trimethylbenzoic acid was chlorinated. The formed acid chloride showed an unexpected low thermal stability. Its thermal rearrangement at 180 °C resulted in a fast formation of 3-(chloromethyl-2,4,6-trimethylbenzoic acid 2-(allyloxyethyl ester. In the third step, the acid chloride was reacted with phenylphosphine dilithium with the formation of bis(3-{[2-(allyloxyethoxy]methyl}-2,4,6-trimethylbenzoyl(phenylphosphine, which was oxidized to WBAPO. The structure of WBAPO was confirmed by 1H NMR, 13C NMR, 31P NMR, and IR spectroscopy, as well as elemental analysis. WBAPO, a yellow liquid, possesses improved solubility in polar solvents and shows UV–vis absorption, and a high photoreactivity comparable with the commercially available bisacylphosphine oxides. A sufficient storage stability was found in dental acidic aqueous primer formulations.

  19. Synthesis of bis(3-{[2-(allyloxy)ethoxy]methyl}-2,4,6-trimethylbenzoyl)(phenyl)phosphine oxide - a tailor-made photoinitiator for dental adhesives.

    Science.gov (United States)

    Moszner, Norbert; Lamparth, Iris; Angermann, Jörg; Fischer, Urs Karl; Zeuner, Frank; Bock, Thorsten; Liska, Robert; Rheinberger, Volker

    2010-01-01

    Because of the poor solubility of the commercially available bisacylphosphine oxides in dental acidic aqueous primer formulations, bis(3-{[2-(allyloxy)ethoxy]methyl}-2,4,6-trimethylbenzoyl)(phenyl)phosphine oxide (WBAPO) was synthesized starting from 3-(chloromethyl)-2,4,6-trimethylbenzoic acid by the dichlorophosphine route. The substituent was introduced by etherification with 2-(allyloxy)ethanol. In the second step, 3-{[2-(allyloxy)ethoxy]methyl}-2,4,6-trimethylbenzoic acid was chlorinated. The formed acid chloride showed an unexpected low thermal stability. Its thermal rearrangement at 180 ° C resulted in a fast formation of 3-(chloromethyl)-2,4,6-trimethylbenzoic acid 2-(allyloxy)ethyl ester. In the third step, the acid chloride was reacted with phenylphosphine dilithium with the formation of bis(3-{[2-(allyloxy)ethoxy]methyl}-2,4,6-trimethylbenzoyl)(phenyl)phosphine, which was oxidized to WBAPO. The structure of WBAPO was confirmed by ¹H NMR, ¹³C NMR, ³¹P NMR, and IR spectroscopy, as well as elemental analysis. WBAPO, a yellow liquid, possesses improved solubility in polar solvents and shows UV-vis absorption, and a high photoreactivity comparable with the commercially available bisacylphosphine oxides. A sufficient storage stability was found in dental acidic aqueous primer formulations. PMID:20502649

  20. Preparation of oil palm empty fruit bunch-based activated carbon for removal of 2,4,6-trichlorophenol: Optimization using response surface methodology

    International Nuclear Information System (INIS)

    The effects of three preparation variables: CO2 activation temperature, CO2 activation time and KOH:char impregnation ratio (IR) on the 2,4,6-trichlorophenol (2,4,6-TCP) uptake and carbon yield of the activated carbon prepared from oil palm empty fruit bunch (EFB) were investigated. Based on the central composite design, two quadratic models were developed to correlate the three preparation variables to the two responses. The activated carbon preparation conditions were optimized using response surface methodology by maximizing both the 2,4,6-TCP uptake and activated carbon yield within the ranges studied. The optimum conditions for preparing activated carbon from EFB for adsorption of 2,4,6-TCP were found as follows: CO2 activation temperature of 814 deg. C, CO2 activation time of 1.9 h and IR of 2.8, which resulted in 168.89 mg/g of 2,4,6-TCP uptake and 17.96% of activated carbon yield. The experimental results obtained agreed satisfactorily with the model predictions. The activated carbon prepared under optimum conditions was mesoporous with BET surface area of 1141 m2/g, total pore volume of 0.6 cm3/g and average pore diameter of 2.5 nm. The surface morphology and functional groups of the activated carbon were respectively determined from the scanning electron microscopy and Fourier transform infrared analysis.

  1. Influence of a magnetic field during directional solidification of MAR-M 246 + Hf superalloy. Final Technical Report

    Energy Technology Data Exchange (ETDEWEB)

    Andrews, J.B.; Alter, W.; Schmidt, D.

    1991-01-01

    An area that has been almost totally overlooked in the optimization of properties in directionally solidified superalloys is the control of microstructural features through the application of a magnetic field during solidification. The influence of a magnetic field on the microstructural features of a nickel-base superalloys is investigated. Studies were performed on the dendritic MAR-M 246+Hf alloy, which was solidified under both a 5 K gauss magnetic field and under no-applied-field conditions. The possible influences of the magnetic field on the solidification process were observed by studying variations in microstructural features including volume fraction, surface area, number, and shape of the carbide particles. Stereological factors analyzed also included primary and secondary dendrite arm spacing and the volume fraction of the interdendritic eutectic constituent. Microprobe analysis was performed to determine the chemistry of the carbides, dendrites, and interdendritic constituents, and how it varied between field and no-field solidification samples. Experiments involving periodic application and removal of the magnetic field were also performed in order to permit a comparison with structural variations observed in a MAR-M 246+Hf alloy solidified during KC{sup {minus}135} high-g, low-g maneuvers.

  2. Sensitive determination of 2,4,6-trichloroanisole in water samples by ultrasound assisted emulsification microextraction prior to gas chromatography-tandem mass spectrometry analysis.

    Science.gov (United States)

    Fontana, Ariel R; Altamirano, Jorgelina C

    2010-06-15

    A novel application of an ultrasound assisted emulsification microextraction (USAEME) technique is proposed for the extraction and preconcentration of 2,4,6-trichloroanisole (2,4,6-TCA) from water samples prior to its determination by gas chromatography-tandem mass spectrometry (GC-MS/MS). USAEME employs a non-polar high-density solvent (extractant solvent), which forms an oil-in-water emulsion (O/W) in the aqueous sample bulk assisted by ultrasonic radiation. Several factors including, solvent type and volume, extraction time, extraction temperature, shaking mode and matrix modifiers were studied and optimized over the relative recovery of the target analyte. An aliquot of 5mL water sample was conditioned by adding 150microL 6.15molL(-1) sodium chloride and 300microL 0.05molL(-1) phosphate buffer (pH 6), and finally extracted with 40microL chloroform by using USAEME technique. Under the optimal experimental conditions 2,4,6-TCA was quantitatively extracted achieving an enrichment factor (EF) of 555. The detection limit (LOD), calculated as three times the signal-to-noise ratio (S/N), was 0.2ngL(-1) and the RSD was 6.3% (n=5) when 1ngL(-1) 2,4,6-TCA standard mixture was analyzed. The coefficients of estimation of the calibration curves obtained following the proposed methodology was >or=0.997 and the linear working range was 1-5000ngL(-1). Finally, the proposed technique was successfully applied for extraction and determination of the 2,4,6-TCA in water samples. Recovery studies lead values >or=94%, which showed a successfully robustness of the analytical methodology for determination of nanogram per liter of 2,4,6-TCA in water samples. PMID:20441935

  3. Simultaneous determination of 2,4,6-trichlorophenol and pentachlorophenol based on poly(Rhodamine B)/graphene oxide/multiwalled carbon nanotubes composite film modified electrode

    Science.gov (United States)

    Zhu, Xiaolin; Zhang, Kexin; Lu, Nan; Yuan, Xing

    2016-01-01

    In the present study, a poly(Rhodamine B)/graphene oxide/multiwalled carbon nanotubes nanocomposite modified glass carbon electrode (PRhB/GO/MWCNTs/GCE) was developed for the simultaneous determination of 2,4,6-trichlorophenol (2,4,6-TCP) and pentachlorophenol (PCP). The PRhB/GO/MWCNTs film was extensively characterized by emission scanning electron microscopy (SEM), X-ray diffraction (XRD), Raman spectroscopy and electrochemical impedance spectroscopy (EIS). The electrochemical behaviors of 2,4,6-TCP and PCP were investigated by cyclic voltammetry, linear sweep voltammetry and differential pulse voltammetry. Due to the synergistic effect, the PRhB/GO/MWCNTs/GCE significantly facilitated the simultaneous electro-oxidation of 2,4,6-TCP and PCP with peak potential difference of 160 mV and enhanced oxidation currents. Under optimum conditions, the oxidation current of 2,4,6-TCP was linear to its concentration in the ranges of 4.0 × 10-9 to 1.0 × 10-7 M and 1.0 × 10-7 to 1.0 × 10-4 M with the detection limit (S/N = 3) of 8.0 × 10-10 M. And the linear concentration ranges for PCP were 2.0 × 10-9 to 1.0 × 10-7 M and 1.0 × 10-7 to 9.0 × 10-5 M with the detection limit of 5.0 × 10-10 M. Moreover, the proposed PRhB/GO/MWCNTs/GCE was successfully applied to the simultaneous determination of 2,4,6-TCP and PCP in practical water samples.

  4. Strong synergy with APR-246 and DNA-damaging drugs in primary cancer cells from patients with TP53 mutant High-Grade Serous ovarian cancer

    OpenAIRE

    Fransson, Åsa; Glaessgen, Daria; Alfredsson, Jessica; Wiman, Klas G.; Bajalica-Lagercrantz, Svetlana; Mohell, Nina

    2016-01-01

    Background Mutation in the tumor suppressor gene TP53 is an early event in the development of high-grade serous (HGS) ovarian cancer and is identified in more than 96 % of HGS cancer patients. APR-246 (PRIMA-1MET) is the first clinical-stage compound that reactivates mutant p53 protein by refolding it to wild type conformation, thus inducing apoptosis. APR-246 has been tested as monotherapy in a Phase I/IIa clinical study in hematological malignancies and prostate cancer with promising result...

  5. N-(2-{[5-Bromo-2-(piperidin-1-ylpyrimidin-4-yl]sulfanyl}-4-methoxyphenyl-2,4,6-trimethylbenzenesulfonamide

    Directory of Open Access Journals (Sweden)

    Mohan Kumar

    2012-09-01

    Full Text Available In the title compound, C25H29BrN4O3S2, the benzene rings bridged by the sulfonamide group are tilted relative to each other by 63.9 (1° and the dihedral angle between the sulfur-bridged pyrimidine and benzene rings is 64.9 (1°. The molecular conformation is stabilized by a weak intramolecular π–π stacking interaction between the pyrimidine and the 2,4,6-trimethylbenzene rings [centroid–centroid distance = 3.766 (2 Å]. The piperidine ring adopts a chair conformation. In the crystal, molecules are linked into inversion dimers by pairs of N—H...O hydrogen bonds and these dimers are further linked by C—H...O hydrogen bonds into chains propagating along [010].

  6. Aquatrinitrato[2,4,6-tris(pyridin-2-yl-1,3,5-triazine]neodymium(III dihydrate

    Directory of Open Access Journals (Sweden)

    Jin Zhou

    2011-06-01

    Full Text Available In the title compound, [Nd(NO33(C18H12N6(H2O]·2H2O, the Nd3+ ion is in a distorted bicapped square-antiprismatic geometry formed by three N atoms from the 2,4,6-tris(pyridin-2-yl-1,3,5-triazine (TPTZ ligand, six O atoms from the three nitrate anions and one O atom from the aqua ligand. The molecules are linked by O—H...O and O—H...N hydrogen bonds. Two types of π–π stacking interactions occur between the TPTZ ligands of adjacent complexes [centroid-to-centroid distances = 3.760 (4 and 3.870 (3 Å].

  7. Grignard Reaktiflerinin Aseton O-(2,4,6-trimetilfenilsülfoniloksim ile Elektrofilik Aminasyonuyla Arilaminlerin Sentezi

    Directory of Open Access Journals (Sweden)

    Tahir DAŞKAPAN

    2009-04-01

    Full Text Available Arilaminler, birçok pratik ve yararlı uygulamalara imkan veren önemli bir organik bilesik sınıfıdır. Arilamino grubu dogada temel bir yapısal motiftir. Amin sentezi için gelistirilen modern yöntemler arasında kolay bulunabilen bir organometalik reaktifin elektrofilik aminasyonu yöntemi, organik sentezde önemli bir yöntem olarak ortaya çıkmıstır.Bu çalısmada, sentetik organik, ilaç ve tarım kimyasında kullanılan arilaminlerin, organomagnezyum reaktiflerinin aseton O-(2,4,6-trimetilfenilsülfoniloksim ile elektrofilik aminasyonuyla ılımlı reaksiyon sartları altında ve iyi verimle hazırlanması için kolay uygulanabilir bir yöntem gelistirilmistir.

  8. Ecotoxicological evaluation of in situ bioremediation of soils contaminated by the explosive 2,4,6-trinitrotoluene (TNT)

    International Nuclear Information System (INIS)

    The luminescent bacteria assay, using soil leachates, was the most sensitive toxicity indicator. - To evaluate the environmental relevance of in situ bioremediation of contaminated soils, effective and reliable monitoring approaches are of special importance. The presented study was conducted as part of a research project investigating in situ bioremediation of topsoils contaminated by the explosive 2,4,6-trinitrotoluene (TNT). Changes in soil toxicity within different experimental fields at a former ordnance factory were evaluated using a battery of five bioassays (plant growth, Collembola reproduction, soil respiration, luminescent bacteria acute toxicity and mutagenicity test) in combination to chemical contaminant analysis. Resulting data reveal clear differences in sensitivities between methods with the luminescent bacteria assay performed with soil leachates as most sensitive toxicity indicator. Complete test battery results are presented in so-called soil toxicity profiles to visualise and facilitate the interpretation of data. Both biological and chemical monitoring results indicate a reduction of soil toxicity within 17 months of remediation

  9. Green and solvent-free procedure for microwave-assisted synthesis of 2,4,6-triarylpyridines catalysed using MgAl2O4 nanocrystals

    Indian Academy of Sciences (India)

    Javad Safari; Soheila Gandomi-Ravandi; Mahmoud Borjian Borujeni

    2013-09-01

    Design and development of a heterogeneous nanocatalyst for condensation reaction of acetophenone derivatives, aromatic aldehydes, and ammonium acetate to yield 2,4,6-triarylpyridines followed by microwave irradiation is described. Nanocrystalline MgAl2O4 as a novel heterogeneous recyclable catalyst shows high activity for the above reaction. In addition, the easily recoverable nanosized catalysts showed good reusability.

  10. Critical and subcritical masses of curium-245, -246 and -247 calculated with a combination of MCNP4A code and JENDL-3.2 library

    International Nuclear Information System (INIS)

    Critical masses of three curium isotopes, 245Cm, 246Cm and 247Cm, were calculated with a combination of the current version of the Japanese Evaluated Nuclear Data Library, JENDL-3.2, and a continuous energy Monte Carlo neutron transport code, MCNP4A. The subcritical masses corresponding to the neutron multiplication factor keff=0.9 and 0.8 were also computed in the same way. The subcritical masses that correspond to keff=0.9 for 246Cm metal and 246CmO2 with a 30-cm-thick stainless steel reflector were computed as 25.2 kg and 41.8 kg, respectively. The minimum critical mass for 245Cm was obtained as 65.6 g in a sphere of a homogeneous mixture of granulated 245Cm metal and water surrounded by a fully thick water reflector. The corresponding quantity for 247Cm was found to be 2.19 kg. The critical masses of 245Cm, 246Cm and 247Cm metals were computed also for reference by replacing the JENDL-3.2 with the ENDF/B-VI; they were reduced by 23%, 45% and 2%, respectively, from each corresponding value, which revealed a large dependence of the results on the evaluated nuclear data libraries. The present report was prepared for revision of the ANSI/ANS-8.15, the American National Standard for Nuclear Criticality Control of Special Actinide Elements. (author)

  11. APR-246 (PRIMA-1(MET)) strongly synergizes with AZD2281 (olaparib) induced PARP inhibition to induce apoptosis in non-small cell lung cancer cell lines.

    Science.gov (United States)

    Deben, Christophe; Lardon, Filip; Wouters, An; Op de Beeck, Ken; Van den Bossche, Jolien; Jacobs, Julie; Van Der Steen, Nele; Peeters, Marc; Rolfo, Christian; Deschoolmeester, Vanessa; Pauwels, Patrick

    2016-06-01

    APR-246 (PRIMA-1(Met)) is able to bind mutant p53 and restore its normal conformation and function. The compound has also been shown to increase intracellular ROS levels. Importantly, the poly-[ADP-ribose] polymerase-1 (PARP-1) enzyme plays an important role in the repair of ROS-induced DNA damage. We hypothesize that by blocking this repair with the PARP-inhibitor AZD2281 (olaparib), DNA damage would accumulate in the cell leading to massive apoptosis. We observed that APR-246 synergistically enhanced the cytotoxic response of olaparib in TP53 mutant non-small cell lung cancer cell lines, resulting in a strong apoptotic response. In the presence of wild type p53 a G2/M cell cycle block was predominantly observed. NOXA expression levels were significantly increased in a TP53 mutant background, and remained unchanged in the wild type cell line. The combined treatment of APR-246 and olaparib induced cell death that was associated with increased ROS production, accumulation of DNA damage and translocation of p53 to the mitochondria. Out data suggest a promising targeted combination strategy in which the response to olaparib is synergistically enhanced by the addition of APR-246, especially in a TP53 mutant background. PMID:26975633

  12. Degradation of 2,4,6-Trichlorophenol Using Hydrogen Peroxide Catalyzed by Nanoscale Zero-Valent Iron Supported on Ion Exchange Resin.

    Science.gov (United States)

    Tai, Chao; She, Jiaping; Yin, Yongguang; Zhao, Tongqian; Wu, Li

    2016-06-01

    Nanoscale zero-valent iron (NZVI) supported on ion exchange resin was prepared and characterized by scanning electron microscope and energy dispersive spectroscopy, with a simple model developed for describing the catalyst. The degradation of 2,4,6-trichlorophenol (2,4,6-TCP) by hydrogen peroxide using NZVI supported on ion exchange resin as the catalyst, was studied. The results showed that 2,4,6-TCP with a concentration of 1 mmol L(-1) could be well degraded into low molecule weight organic acids in two hours. The optimized condition was as follows: pH, 3.0; temperature, 35 degrees C; catalyst dosage, 1.5 g; and hydrogen peroxide, 0.16 mmol L(-1). The catalyst has good reusability, with no catalytic efficiency decreasing even after ten times recycles. A possible mechanism of 2,4,6-TCP degradation was proposed, based on the products indentified by GC-MS after derived using trimethylsulfonium hydroxide. PMID:27427643

  13. 2,4,6-Trichloro-1,3,5-triazine/dimethylformamide as an efficient reagent for one-pot conversion of alcohols into N-alkylphthalimides

    Institute of Scientific and Technical Information of China (English)

    Babak; Mokhtari; Roya; Azadi; Aseieh; Azhdari

    2010-01-01

    An efficient and mild method for the direct conversion of alcohols into N-alkylphthalimides using 2,4,6-trichloro-1,3,5-triazine and dimethylformamide was described.The reaction was preceded via(alcoxymethylene) dimethylammonium chloride intermediate and produced corresponding N-alkylphthalimides in good-to-excellent yields.

  14. 1,1´,1´´-(2,4,6-Trihydroxybenzene-1,3,5-triyl)triethanone tautomerism revisited

    DEFF Research Database (Denmark)

    Hansen, Poul Erik; Kamounah, Fadhil S.; Zhiryakova, Diana;

    2014-01-01

    It has recently been suggested that 1,1′,1′′-(2,4,6-trihydroxybenzene-1,3,5-triyl)triethanone may be tautomeric. Using 13C NMR chemical shifts and deuterium isotope effects on 13C chemical shifts, it is demonstrated that this is not the case. This compound occurs as a strongly hydrogen bonded ben...

  15. Microwave assisted facile synthesis of {1/1,3-bis/1,3,5-tris-[(2-nitroxyethylnitramino)-2,4,6-trinitrobenzene]} using bismuth nitrate pentahydrate as an eco-friendly nitrating agent

    International Nuclear Information System (INIS)

    1-(2-Nitroxyethylnitramino)-2,4,6-trinitrobenzene (3a), 1,3-bis(2-nitroxyethyl nitramino)-2,4,6-trinitrobenzene (3b) and 1,3,5-tris(2-nitroxyethylnitramino)-2,4,6-trinitrobenzene (3c) were prepared by the nitration of 1-(2-hydroxyethylamino)-2,4,6-trinitrobenzene (2a) 1,3-bis(2-hydroxyethylamino)-2,4,6-trinitrobenzene (2b) and 1,3,5-tris(2-hydroxyethylamino)-2,4,6-trinitrobenzene (2c) using bismuth nitrate pentahydrate (eco-friendly nitrating agent) in tetrahydrofuran adsorbed on silica gel under microwave irradiation, respectively. Key intermediate compounds viz., 2a, 2b and 2c were synthesized by condensing picryl chloride, styphnyl chloride and 1,3,5-trichloro-2,4,6-trinitrobenzene with ethanol amine, respectively, based on the lines of the reported method. The synthesized compounds were characterized based on their physical constant, infrared (IR) spectroscopy and 1H nuclear magnetic resonance (NMR) spectroscopy. The spectroscopic data obtained indicated the formation of nitrate esters (3a-3c). The nitration methodology adopted in the present study is of relevance in the context of green chemistry. The target compounds (3a-3c) synthesized using eco-friendly approach are of interest from the point of high energy materials (HEMs)

  16. Microwave assisted facile synthesis of {1/1,3-bis/1,3,5-tris-[(2-nitroxyethylnitramino)-2,4,6-trinitrobenzene]} using bismuth nitrate pentahydrate as an eco-friendly nitrating agent.

    Science.gov (United States)

    Badgujar, D M; Talawar, M B; Asthana, S N; Venugopalan, S; Rao, A Subhananda; Mahulikar, P P

    2008-04-01

    1-(2-Nitroxyethylnitramino)-2,4,6-trinitrobenzene (3a), 1,3-bis(2-nitroxyethyl nitramino)-2,4,6-trinitrobenzene (3b) and 1,3,5-tris(2-nitroxyethylnitramino)-2,4,6-trinitrobenzene (3c) were prepared by the nitration of 1-(2-hydroxyethylamino)-2,4,6-trinitrobenzene (2a) 1,3-bis(2-hydroxyethylamino)-2,4,6-trinitrobenzene (2b) and 1,3,5-tris(2-hydroxyethylamino)-2,4,6-trinitrobenzene (2c) using bismuth nitrate pentahydrate (eco-friendly nitrating agent) in tetrahydrofuran adsorbed on silica gel under microwave irradiation, respectively. Key intermediate compounds viz., 2a, 2b and 2c were synthesized by condensing picryl chloride, styphnyl chloride and 1,3,5-trichloro-2,4,6-trinitrobenzene with ethanol amine, respectively, based on the lines of the reported method. The synthesized compounds were characterized based on their physical constant, infrared (IR) spectroscopy and (1)H nuclear magnetic resonance (NMR) spectroscopy. The spectroscopic data obtained indicated the formation of nitrate esters (3a-3c). The nitration methodology adopted in the present study is of relevance in the context of green chemistry. The target compounds (3a-3c) synthesized using eco-friendly approach are of interest from the point of high energy materials (HEMs). PMID:17723262

  17. Microwave assisted facile synthesis of {l_brace}1/1,3-bis/1,3,5-tris-[(2-nitroxyethylnitramino)-2,4,6-trinitrobenzene]{r_brace} using bismuth nitrate pentahydrate as an eco-friendly nitrating agent

    Energy Technology Data Exchange (ETDEWEB)

    Badgujar, D.M. [School of Chemical Sciences, North Maharashtra University, Jalgaon, 425001 Maharashtra (India)], E-mail: dmbadgujar@rediffmail.com; Talawar, M.B. [High Energy Material Research Laboratory (HEMRL), Ministry of Defense (MOD), Defense Research and Development Organization - DRDO, Pune, 411021 Maharastra (India)], E-mail: mbtalawar@yahoo.com; Asthana, S.N.; Venugopalan, S.; Rao, A. Subhananda [High Energy Material Research Laboratory (HEMRL), Ministry of Defense (MOD), Defense Research and Development Organization - DRDO, Pune, 411021 Maharastra (India); Mahulikar, P.P. [School of Chemical Sciences, North Maharashtra University, Jalgaon, 425001 Maharashtra (India)], E-mail: mahulikarpp@rediffmail.com

    2008-04-01

    1-(2-Nitroxyethylnitramino)-2,4,6-trinitrobenzene (3a), 1,3-bis(2-nitroxyethyl nitramino)-2,4,6-trinitrobenzene (3b) and 1,3,5-tris(2-nitroxyethylnitramino)-2,4,6-trinitrobenzene (3c) were prepared by the nitration of 1-(2-hydroxyethylamino)-2,4,6-trinitrobenzene (2a) 1,3-bis(2-hydroxyethylamino)-2,4,6-trinitrobenzene (2b) and 1,3,5-tris(2-hydroxyethylamino)-2,4,6-trinitrobenzene (2c) using bismuth nitrate pentahydrate (eco-friendly nitrating agent) in tetrahydrofuran adsorbed on silica gel under microwave irradiation, respectively. Key intermediate compounds viz., 2a, 2b and 2c were synthesized by condensing picryl chloride, styphnyl chloride and 1,3,5-trichloro-2,4,6-trinitrobenzene with ethanol amine, respectively, based on the lines of the reported method. The synthesized compounds were characterized based on their physical constant, infrared (IR) spectroscopy and {sup 1}H nuclear magnetic resonance (NMR) spectroscopy. The spectroscopic data obtained indicated the formation of nitrate esters (3a-3c). The nitration methodology adopted in the present study is of relevance in the context of green chemistry. The target compounds (3a-3c) synthesized using eco-friendly approach are of interest from the point of high energy materials (HEMs)

  18. APR-246/PRIMA-1(MET) rescues epidermal differentiation in skin keratinocytes derived from EEC syndrome patients with p63 mutations.

    Science.gov (United States)

    Shen, Jinfeng; van den Bogaard, Ellen H; Kouwenhoven, Evelyn N; Bykov, Vladimir J N; Rinne, Tuula; Zhang, Qiang; Tjabringa, Geuranne S; Gilissen, Christian; van Heeringen, Simon J; Schalkwijk, Joost; van Bokhoven, Hans; Wiman, Klas G; Zhou, Huiqing

    2013-02-01

    p53 and p63 share extensive sequence and structure homology. p53 is frequently mutated in cancer, whereas mutations in p63 cause developmental disorders manifested in ectodermal dysplasia, limb defects, and orofacial clefting. We have established primary adult skin keratinocytes from ectrodactyly, ectodermal dysplasia, and cleft lip/palate (EEC) syndrome patients with p63 mutations as an in vitro human model to study the disease mechanism in the skin of EEC patients. We show that these patient keratinocytes cultured either in submerged 2D cultures or in 3D skin equivalents have impaired epidermal differentiation and stratification. Treatment of these patient keratinocytes with the mutant p53-targeting compound APR-246/PRIMA-1(MET) (p53 reactivation and induction of massive apoptosis) that has been successfully tested in a phase I/II clinical trial in cancer patients partially but consistently rescued morphological features and gene expression during epidermal stratification in both 2D and 3D models. This rescue coincides with restoration of p63 target-gene expression. Our data show that EEC patient keratinocytes with p63 mutations can be used for characterization of the abnormal molecular circuitry in patient skin and may open possibilities for the design of novel pharmacological treatment strategies for patients with mutant p63-associated developmental abnormalities. PMID:23355676

  19. Aniline and 2,4,6-trinitrotoluene associate preferentially to low molecular weight fractions of dissolved soil organic matter

    International Nuclear Information System (INIS)

    Aniline and 2,4,6-trinitrotoluene (TNT) were equilibrated with particulate (POM) and dissolved organic matter (DOM) from an organic soil at different compositions of adsorbed major cations (Na, Al) and pH (aniline: 3.7-5.1, TNT: 4.8-5.0). After separation of POM, concentrations of 14C-labelled aniline and TNT* (including TNT degradation products) were determined in DOM size fractions using size-exclusion chromatography (SEC) and UV-detection. Concentrations in the 40 kDa fraction. Thus, both aniline and TNT* were preferentially associated to the smallest DOM size fraction. The significant binding to DOM (similar extent as to POM) and the fact that the <3.5 kDa DOM fraction was less susceptible to flocculation by major metals suggests that the mobility of aniline and TNT is highly affected by the solubility of soil organic matter. - Concentrations of aniline and TNT associated with dissolved organic matter (DOM) was shown to increase with decreasing apparent molecular mass of DOM.

  20. In vitro study to determine decontamination of 3,5-dichloro-2,4,6-trifluoropyridine (DCTFP) from human skin.

    Science.gov (United States)

    Hui, Xiaoying; Domoradzki, Jeanne Y; Maibach, Howard C

    2012-07-01

    This in vitro study determined the decontamination potential of soap and water, D-TAM skin cleanser, corn oil and the O'Dell reactive skin decontamination system to remove 3,5-dichloro-2,4,6-trifluoropyridine (DCTFP) from human skin after short exposure periods (10 and 30 min). The main result turned out to be the rapid volatility of DCTFP where half of the dose evaporated within 10 min and most of the dose was evaporated after 30 min. This rapid volatility was confirmed in an additional study where DCTFP rapidly evaporated from inert plastic disks (70% loss in 10 min). Despite rapid evaporation and short exposure periods, some DCTFP entered into the human skin epidermis, dermis and receptor fluid. Less DCTFP reached the receptor fluid with the 10 min decontamination (0.13%) than the 30 min decontamination (0.27%). Statistically, all tested decontamination systems performed the same (P>0.05). For human risk the volatility of DCTFP seems paramount. For skin decontamination any of the tested systems will work. An important point is that they should be used within minutes of skin exposure. This study exhibits the dynamics of evaporation, substantivity (skin binding), percutaneous absorption and decontamination of a volatile chemical. PMID:22504088

  1. Molecular and Crystal Structure of 1,3,5 Tris(benzimidazol-1-ylmethyl)-2,4,6-Trimethylbenzene

    Institute of Scientific and Technical Information of China (English)

    2001-01-01

    The compound 1,3,5-tris(benzimidazol-l-ylmethyl)-2,4,6-trimethylbenzene, crystallizes in the monoclinic system, space group P2rC, with a = 17.571(4), b = 10.860(2), c = 14.126(3) A; β = 92.89(3)°, V= 2692(1)A3, De = 1.260 g/cm3, Z = 4, C33H30N6, Mr. = 510.63, μ(MoKα) = 0.077mm-1, F(000) = 1080. The structure was refined to R = 0.0592, wR = 0.1379 for 1492 (I>2σ(I)) reflections. The title molecule has cis, trans, trans-conformation about the central phenyl ring. The screw-related molecules are connected by hydrogen bonds C-H...N (x,-0.5-y, 0.5+z) and form the infinite helical chains. The polar molecular chains are antiparallelly stacked through edge-to-face C-H… π interactions.

  2. Highly selective detection of 2,4,6-trinitrophenol by using newly developed terbium-doped blue carbon dots.

    Science.gov (United States)

    Chen, Bin Bin; Liu, Ze Xi; Zou, Hong Yan; Huang, Cheng Zhi

    2016-04-25

    The detection of nitroaromatic explosives is of great importance owing to their strong explosive power and harmfulness in terms of the environment, homeland security and public safety. Herein, rare earth-doped carbon dots with multifunctional features were firstly prepared by simply keeping the mixture of terbium(iii) nitrate pentahydrate and citric acid at 190 °C for 30 min. The as-prepared terbium doped carbon dots (Tb-CDs), through a rapid and simple direct carbonization route, have a size of about 3 nm, and exhibit excitation wavelength dependent emission of blue fluorescence, are stable, and can be applied for the selective and colorimetric detection of 2,4,6-trinitrophenol (TNP) in the range of 500 nM-100 μM with a limit of detection of 200 nM based on the inner filtering effect (IFE) of the excitation and emission bands of Tb-CDs by TNP and the electron transfer (ET) from Tb-CDs to TNP, giving a precise and highly reproducible result for detecting complex water samples. PMID:27109163

  3. 2,4,6-Trinitrotoluene mineralization and bacterial production rates of natural microbial assemblages from coastal sediments

    International Nuclear Information System (INIS)

    The nitrogenous energetic constituent, 2,4,6-Trinitrotoluene (TNT), is widely reported to be resistant to bacterial mineralization (conversion to CO2); however, these studies primarily involve bacterial isolates from freshwater where bacterial production is typically limited by phosphorus. This study involved six surveys of coastal waters adjacent to three biome types: temperate broadleaf, northern coniferous, and tropical. Capacity to catabolize and mineralize TNT ring carbon to CO2 was a common feature of natural sediment assemblages from these coastal environments (ranging to 270+/-38 μg C kg-1 d-1). More importantly, these mineralization rates comprised a significant proportion of total heterotrophic production. The finding that most natural assemblages surveyed from these ecosystems can mineralize TNT ring carbon to CO2 is consistent with recent reports that assemblage components can incorporate TNT ring carbon into bacterial biomass. These data counter the widely held contention that TNT is recalcitrant to bacterial catabolism of the ring carbon in natural environments. - Highlights: → TNT mineralization is a common feature of natural bacterial assemblages in coastal sediments. → TNT mineralization rates comprised a significant proportion of total heterotrophic production. → These data counter the widely held contention that TNT is recalcitrant to bacterial catabolism of the ring carbon in natural environments. - The capacity to mineralize TNT ring carbon to CO2 is a common feature of natural bacterial assemblages in coastal sediment.

  4. Highly Photoluminescent Molybdenum Oxide Quantum Dots: One-Pot Synthesis and Application in 2,4,6-Trinitrotoluene Determination.

    Science.gov (United States)

    Xiao, Sai Jin; Zhao, Xiao Jing; Hu, Ping Ping; Chu, Zhao Jun; Huang, Cheng Zhi; Zhang, Li

    2016-03-30

    As a well-studied transition-metal semiconductor material, MoOx has a wider band gap than molybdenum disulfide (MoS2), and its property varies dramatically for the existence of several different allotropes and suboxide phases of molybdenum oxides (MoOx, x synthesis of highly photoluminescent MoOx quantum dots (MoOx QDs), in which commercial molybdenum disulfide (MoS2) powder and hydrogen peroxide (H2O2) are employed as the precursor and oxidant, respectively. The obtained MoOx QDs can be further utilized as an efficient photoluminescent probe, and a new turn-off sensor is developed for 2,4,6-trinitrotoluene (TNT) determination based on the fact that the photoluminescence of MoOx QDs can be quenched by the Meisenheimer complexes formed in the strong alkali solution through the inner filter effect (IFE). Under the optimal conditions, the decreased photoluminescence of MoOx QDs shows a good linear relationship to the concentration of TNT ranging from 0.5 to 240.0 μM, and the limit of detection was 0.12 μM (3σ/k). With the present turn-off sensor, TNT in river water samples can be rapidly and selectively detected without tedious sample pretreatment processes. PMID:26954663

  5. Effectiveness of urea in enhancing the extractability of 2,4,6-trinitrotoluene from chemically variant soils.

    Science.gov (United States)

    Das, Padmini; Sarkar, Dibyendu; Makris, Konstantinos C; Punamiya, Pravin; Datta, Rupali

    2013-11-01

    One of the major challenges in developing an effective phytoremediation technology for 2,4,6-trinitrotoluene (TNT) contaminated soils is limited plant uptake resulting from low solubility of TNT. The effectiveness of urea as a solubilizing agent in increasing plant uptake of TNT in hydroponic systems has been documented. Our preliminary greenhouse experiments using urea were also very promising, but further characterization of the performance of urea in highly-complex soil-solution was necessary. The present study investigated the natural retention capacity of four chemically variant soils and optimized the factors influencing the effectiveness of urea in enhancing TNT solubility in the soil solutions. Results show that the extent of TNT sorption and desorption varies with the soil properties, and is mainly dependent on soil organic matter (SOM) content. Hysteretic desorption of TNT in all tested soils suggests irreversible sorption of TNT and indicates the need of using an extractant to increase the release of TNT in soil solutions. Urea significantly (porganic matter content and urea application rates showed significant effects, whereas pH did not exert any significant effect on urea catalysis of TNT extraction from soil. The optimum urea application rates (125 or 350 mg kg(-1)) for maximizing TNT extraction were within the limits set by the agronomic fertilizer-N rates used for major agricultural crops. The data obtained from this batch study will facilitate the optimization of a chemically-catalyzed phytoremediation model for cleaning up TNT-contaminated soils. PMID:23835412

  6. Ozonation catalyzed by the raw bauxite for the degradation of 2,4,6-trichloroanisole in drinking water

    International Nuclear Information System (INIS)

    A kind of inexpensive and environmental friendly mineral, the raw bauxite has been used successfully as a catalyst combined with ozonation in the degradation of 2,4,6-trichloroanisole (TCA). The catalyst was characterized by using various analytical techniques. X-ray powder diffraction (XRD) characterization showed that the raw bauxite containing boehmite (γ-AlOOH), kaolinite (Al2Si2O5(OH)4) and quartz (SiO2), and γ-AlOOH was the major composition. The catalytic ozonation removal effectiveness of TCA was investigated under various physicochemical conditions. Both the adsorption and the single ozonation were not effective for the degradation of TCA, and the presence of the raw bauxite in ozonation enhanced the TCA removal effectiveness. Both the hydroxyl radicals (·OH) scavenging experiment and Rct characterization confirmed that the generation of ·OH was accounted for the enhancement of the degradation of TCA. The generation of ·OH was inhibited faintly by the presence of both natural organic matters (NOMs) and alkalinity in the natural water during catalyzed ozonation with the raw bauxite. The increasing of both the bauxite dosage and the ozone dosage enhanced the removal effectiveness of TCA. The raw bauxite was an efficient green catalyst for TCA degradation in drinking water.

  7. Biotransformation of 2,4,6-trinitrotoluene (TNT) by enchytraeids (Enchytraeus albidus) in vivo and in vitro

    International Nuclear Information System (INIS)

    2,4,6-Trinitrotoluene (TNT) is toxic to soil invertebrates, but little is known about its toxicokinetic behavior in soil. Tissue residue analysis was used to evaluate whether the presence of TNT and its reduced metabolites in soil invertebrates was due to uptake of these compounds from the soil into the organism, or due to microbial transformation of TNT associated with the organism followed by uptake. Adult white potworms (Enchytraeus albidus) were exposed to non-lethal concentrations of TNT in amended artificial soil for 21 d, or to TNT in solution for 20 h. Soil exposure studies confirmed earlier reports that TNT was transformed in enchytraeids in vivo to 2- and 4-aminodinitrotoluenes. However, enchytraeid exposure to TNT in solution led to the additional presence of 2,4-diaminonitrotoluene as well as 2- and 4- hydroxyamino-dinitrotoluenes and azoxy-compounds, suggesting that TNT can be metabolized in vivo in the absence of soil. Incubation of unexposed enchytraeid homogenates with TNT led to a protein-dependent appearance of these metabolites in vitro after ≥16 h incubation. Cellular fractionation studies indicated that most of this activity resided in the 8000xg pellet, and was completely inhibited by broad-spectrum antibiotics. These studies demonstrate that enchytraeids can transform TNT in vivo and in vitro, at least in part, by bacteria associated with the host organism

  8. Effects of additives on 2,4,6-trinitrotoluene (TNT) removal and its mineralization in aqueous solution by gamma irradiation

    International Nuclear Information System (INIS)

    The effects of additives (i.e., methanol, EDTA, mannitol, thiourea, nitrous oxide, oxygen and ozone) on gamma irradiation of 2,4,6-trinitrotoluene (TNT) were investigated to elucidate the initial reaction mechanism of TNT degradation and suggest an practical method for complete by-product removal. All additives, except thiourea, significantly increased the TNT removal efficiency by gamma irradiation. The overall results of the additive experiments implied that the TNT decomposition would be initiated by ·OH, eaq-, and HO2·/O2·-, and also implied that ·H did not have any direct effect on the TNT decomposition. Additions of methanol and nitrous oxide were more effective in TNT removal than the other additives, achieving complete removal of TNT at doses below 20 kGy. Total organic carbon (TOC) of the irradiated solution was analyzed to evaluate the degree of TNT mineralization under the additive conditions. TOC under the nitrous oxide addition was removed rapidly, and complete TNT mineralization was thus achieved at 50 kGy. Methanol addition was very effective in the TNT removal, but it was not effective in reduction in TOC. Trinitrobenzene (TNB), oxalic acid and glyoxalic acid were detected as radiolytic organic by-products, while ammonia and nitrate were detected as radiolytic inorganic by-products. The most efficient TNT removal and its mineralization by gamma irradiation would be achieved by supersaturating the solution with nitrous oxide before irradiation.

  9. Synthesis and Docking Studies of 2,4,6-Trihydroxy-3-Geranylacetophenone Analogs as Potential Lipoxygenase Inhibitor

    Directory of Open Access Journals (Sweden)

    Chean Hui Ng

    2014-08-01

    Full Text Available The natural product molecule 2,4,6-trihydroxy-3-geranyl-acetophenone (tHGA isolated from the medicinal plant Melicope ptelefolia was shown to exhibit potent lipoxygenase (LOX inhibitory activity. It is known that LOX plays an important role in inflammatory response as it catalyzes the oxidation of unsaturated fatty acids, such as linoleic acid to form hydroperoxides. The search for selective LOX inhibitors may provide new therapeutic approach for inflammatory diseases. Herein, we report the synthesis of tHGA analogs using simple Friedel-Craft acylation and alkylation reactions with the aim of obtaining a better insight into the structure-activity relationships of the compounds. All the synthesized analogs showed potent soybean 15-LOX inhibitory activity in a dose-dependent manner (IC50 = 10.31–27.61 μM where compound 3e was two-fold more active than tHGA. Molecular docking was then applied to reveal the important binding interactions of compound 3e in soybean 15-LOX binding site. The findings suggest that the presence of longer acyl bearing aliphatic chain (5Cs and aromatic groups could significantly affect the enzymatic activity.

  10. Application of Novel Amino-Functionalized NZVI@SiO2 Nanoparticles to Enhance Anaerobic Granular Sludge Removal of 2,4,6-Trichlorophenol

    Directory of Open Access Journals (Sweden)

    Zeyu Guan

    2015-01-01

    Full Text Available A novel amino-functionalized silica-coated nanoscale zerovalent iron (NZVI@SiO2-NH2 was successfully synthesized by using one-step liquid-phase method with the surface functionalization of nanoscale zerovalent iron (NZVI to enhance degradation of chlorinated organic contaminants from anaerobic microbial system. NZVI@SiO2-NH2 nanoparticles were synthesized under optimal conditions with the uniform core-shell structure (80–100 nm, high loading of amino functionality (~0.9 wt%, and relatively large specific surface area (126.3 m2/g. The result demonstrated that well-dispersed NZVI@SiO2-NH2 nanoparticle with nFe0-core and amino-functional silicon shell can effectively remove 2,4,6-trichlorophenol (2,4,6-TCP in the neutral condition, much higher than that of NZVI. Besides, the surface-modified nanoparticles (NZVI@SiO2-NH2 in anaerobic granule sludge system also showed a positive effect to promote anaerobic biodechlorination system. More than 94.6% of 2,4,6-TCP was removed from the combined NZVI@SiO2-NH2-anaerobic granular sludge system during the anaerobic dechlorination processes. Moreover, adding the appropriate concentration of NZVI@SiO2-NH2 in anaerobic granular sludge treatment system can decrease the toxicity of 2,4,6-TCP to anaerobic microorganisms and improved the cumulative amount of methane production and electron transport system activity. The results from this study clearly demonstrated that the NZVI@SiO2-NH2/anaerobic granular sludge system could become an effective and promising technology for the removal of chlorophenols in industrial wastewater.

  11. Development of an analytical method to quantify PBDEs, OH-BDEs, HBCDs, 2,4,6-TBP, EH-TBB, and BEH-TEBP in human serum.

    Science.gov (United States)

    Butt, Craig M; Miranda, Marie Lynn; Stapleton, Heather M

    2016-04-01

    Polybrominated diphenyl ethers (PBDEs) flame retardants (FRs) were phased-out in the mid-2000s (penta- and octaBDE) and 2013 (decaBDE); however, their hydroxylated metabolites (OH-BDEs) are still commonly detected in human serum. Today, novel FRs such as Firemaster® 550, a mixture that contains two brominated compounds, EH-TBB and BEH-TEBP are used as replacements for PBDEs in some applications, and there is a need to develop a comprehensive analytical method to assess exposure to both legacy PBDEs and novel FRs. This study developed a solid-phase extraction (SPE)-based method to analyze PBDEs, OH-BDEs, 2,4,6-tribromophenol (TBP), hexabromocylcododecane isomers (HBCDs), EH-TBB, and BEH-TEBP in human serum. Briefly, serum proteins were first denatured with formic acid, and then the target analytes were isolated using a SPE column. Finally, the extract was cleaned and fractioned using a silica SPE column. Method performance was assessed by spiking fetal bovine serum with 1-2 ng of the target analytes, and method accuracy was quantified by comparison to a serum Standard Reference Material (SRM). The developed method showed good recovery and accuracy for all target analytes with the exception of the very low and very high molecular weight PBDE congeners. Using this method, 43 serum samples collected from the Healthy Pregnancy, Healthy Baby Study (HPHB) cohort in Durham, NC, USA were analyzed for FRs. A novel finding was the ubiquitous detection of 2,4,6-TBP, at levels greater than the individual PBDE congeners. Furthermore, 2,4,6-TBP was positively correlated with PBDEs, suggesting that they may have a similar source of exposure, or that 2,4,6-TBP may result from metabolism of PBDEs in vivo. PMID:26864867

  12. 40 CFR 721.5356 - Ethanol, 2,2′2″-nitrilotris-, compound with alpha-2,4,6-tris (1-phenylethyl)phenyl]-omega...

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 30 2010-07-01 2010-07-01 false Ethanol, 2,2â²2â³-nitrilotris... Substances § 721.5356 Ethanol, 2,2′2″-nitrilotris-, compound with alpha-2,4,6-tris (1-phenylethyl)phenyl... subject to reporting. (1) The chemical substance identified as ethanol, 2,2′2″-nitrilotris-, compound...

  13. Dichlorido{(E-2,4,6-trimethyl-N-[phenyl(2-pyridylmethylidene]aniline-κ2N,N′}palladium(II

    Directory of Open Access Journals (Sweden)

    Cheng-Hsien Yang

    2010-06-01

    Full Text Available The title complex, [PdCl2(C21H20N2], contains a PdII atom in a slightly distorted square-planar coordination environment defined by two N atoms from one 2,4,6-trimethyl-N-[phenyl(2-pyridylmethylidene]aniline ligand and two Cl atoms, forming a five-membered ring (N—Pd—N—C—C.

  14. Draft Genome Sequence of Bacillus sp. GZT, a 2,4,6-Tribromophenol-Degrading Strain Isolated from the River Sludge of an Electronic Waste-Dismantling Region

    Science.gov (United States)

    Liang, Zhishu; Li, Guiying; Das, Ranjit

    2016-01-01

    Here, we report the draft genome sequence of Bacillus sp. strain GZT, a 2,4,6-tribromophenol (TBP)-degrading bacterium previously isolated from an electronic waste-dismantling region. The draft genome sequence is 5.18 Mb and has a G+C content of 35.1%. This is the first genome report of a brominated flame retardant-degrading strain. PMID:27257197

  15. Characterization of bacterial populations of 2,4,6-trinitrotoluene (TNT) contaminated soils and isolation of a Pseudomonas aeruginosa strain with TNT denitration activities

    OpenAIRE

    Eyers, Laurent

    2007-01-01

    2,4,6-trinitrotoluene (TNT) is a toxic and recalcitrant pollutant contaminating soils and groundwater. Therefore, characterization of microbial populations of TNT-contaminated soils and isolation of bacteria degrading this pollutant are of primordial importance. Comparison of hybridizations of 16S rRNA derived from uncontaminated and TNT-contaminated soil samples required the development of a functional ANOVA model. Specifically, a statistical tool was necessary to compare dissociation curves...

  16. Organic-inorganic compounds with strong nonlinear optical properties based on 2,4,6-trimethylpyridinium and tetrahedral BF4- networks

    Science.gov (United States)

    Wojtaś, Maciej; Bil, Andrzej; Jakubas, Ryszard; Gągor, Anna; Pietraszko, Adam; Czupiński, Olaf; Tylczyński, Zbigniew; Isakov, Dmitry

    2011-04-01

    A different organic-inorganic crystal—[2,4,6-trimethylpyridinium][BF4]—of nonlinear optical properties at room temperature was synthesized and characterized. The compound is built up of the organic [2,4,6-trimethylpyridinium] cations incorporated into inorganic, tetrahedral BF4 anions. It crystallizes at room temperature in the polar space group Pmn21, and undergoes three first-order phase transitions at [cooling (heating)] 241 (245) K, 297 (328) K, and 389 (406) K. The lowest temperature ferroic phase transition (ferroelastic; mm2→m type) is related to the significant pyroelectric effect. The compound was studied by single-crystal x-ray diffraction at several temperatures, using thermal (differential scanning calorimetry and thermogravimetric analysis) methods and dielectric spectroscopy. The piezoelectric, pyroelectric, and second-harmonic generation (SHG) properties were determined. Density-functional theory calculations in two stable phases are given. The [2,4,6-trimethylpyridinium][BF4] crystal exhibits a SHG efficiency of 1.7 times that of KDP. The mechanism of structural phase transitions in the title compound is discussed.

  17. Chemical and physical data collected aboard the THOMAS G. THOMPSON during cruise TN246 in the South Atlantic Ocean and South Pacific Ocean from 2010-01-15 to 2010-03-05 (NODC Accession 0117396)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — NODC accession 0117396 includes chemical and physical data collected aboard the THOMAS G. THOMPSON during cruise TN246 in the South Atlantic Ocean and South Pacific...

  18. 2,4,6-Trimethylpyridinium perchlorate: Polar properties and correlations with molecular structure of organic-inorganic hybrid crystal

    International Nuclear Information System (INIS)

    [(CH3)3C5H2NH][ClO4] has been synthesized and characterized by X-ray (at 344, 245, 180 and 115 K), calorimetric, dilatometric, dielectric and pyroelectric measurements. At room temperature the crystal structure is polar, space group Pmn21. It consists of discrete disordered [ClO4]- anions and ordered trimethylpyridinium cations giving the 3D network of hydrogen bonds. The compound reveals a rich polymorphism in the solid state. It undergoes four solid-solid phase transitions: from phases I to II at 356/327 K (heating/cooling), II→III at 346/326, III→IV at 226 K and IV→V at 182/170 K. [(CH3)3C5H2NH][ClO4] reveals a strong pyroelectric response over a wide temperature region (phases III, IV and V) with the spontaneous polarization changes (ΔPs) of the order of 1.5-8x10-3C/m2. The spontaneous polarization is irreversible over all the polar phases, however, the magnitude of the ΔPs in the vicinity of the phase transitions is characteristic of compounds with the ferroelectric order. The molecular mechanism of the successive phases transitions in the studied crystal is proposed. - A novel organic-inorganic hybrid material, simple ionic salt: 2,4,6-trimethylpyridinium perchlorate, [(CH3)3C5H2NH][ClO4] has been synthesized. In this paper we report singlecrystal X-ray, powder X-ray, calorimetric, dilatometric, dielectric and pyroelectric studies of this compound over a wide temperature range. A possible mechanism of the structural phase transitions in [(CH3)3C5H2NH][ClO4] is discussed with particular attention focused on unusually strong pyroelectric properties.

  19. Degradation of 2,4,6-trinitrotoluene in water and soil slurry utilizing a calcium peroxide compound.

    Science.gov (United States)

    Arienzo, M

    2000-02-01

    The degradation of 2,4,6-trinitrotoluene was examined in pure water and contaminated soil slurry using calcium peroxide as a source of solid hydrogen peroxide and oxygen. The extent of TNT oxidation was compared with that obtained by using hydrated lime, which is normally generated by slurrying CaO2 in water and contained in CaO2 technical formulation (approximately 50%, w/w). Complete TNT degradation occurred between 280 min, 0.1% CaO2/Ca(OH)2 and 20 min, 1% CaO2/Ca(OH)2. A large part of the generated oxidation products, 80-90%, were absorbed on the solid calcium hydroxide, whereas the remaining 10-20% was detected in solution until 48 h. Removal of nitro groups was extremely effective in CaO2 slurry, where all the nitrogen (3 mol per mol of TNT) was removed from TNT within 240 min. Respect to calcium hydroxide, the peroxy compound liberated H2O2 in solution, 370 mg l-1 at 0.2% CaO2, w/v, which then decomposed within 480 min. Most of the 14C-TNT was retained more strongly on the calcium hydroxide generated by slurrying CaO2. This pool remained adsorbed on the solid until pH dropped below 5.8. The treatment of a contaminated soil slurry, 700 mg TNT kg-1, reduced CH3CN extractable TNT below 20 mg kg-1 at very low concentration of CaO2/Ca(OH)2, approximately 0.2%, w/w. Both oxidants do not lead to soil sterilization as the phosphorus added to neutralize the pH serves as a source of nutrient for the soil biomass. PMID:10665396

  20. Alkaline Hydrolysis/Polymerization of 2,4,6-Trinitrotoluene: Characterization of Products by 13C and 15N NMR

    Science.gov (United States)

    Thorn, K.A.; Thorne, P.G.; Cox, L.G.

    2004-01-01

    Alkaline hydrolysis has been investigated as a nonbiological procedure for the destruction of 2,4,6-trinitrotoluene (TNT) in explosives contaminated soils and munitions scrap. Nucleophilic substitutions of the nitro and methyl groups of TNT by hydroxide ion are the initial steps in the alkaline degradation of TNT. Potential applications of the technique include both in situ surface liming and ex situ alkaline treatment of contaminated soils. A number of laboratory studies have reported the formation of an uncharacterized polymeric material upon prolonged treatment of TNT in base. As part of an overall assessment of alkaline hydrolysis as a remediation technique, and to gain a better understanding of the chemical reactions underlying the hydrolysis/polymerization process, the soluble and precipitate fractions of polymeric material produced from the calcium hydroxide hydrolysis of unlabeled and 15N-labeled TNT were analyzed by elemental analysis and 13C and 15N nuclear magnetic resonance spectroscopy. Spectra indicated that reactions leading to polymerization included nucleophilic displacement of nitro groups by hydroxide ion, formation of ketone, carboxyl, alcohol, ether, and other aliphatic carbons, conversion of methyl groups to diphenyl methylene carbons, and recondensation of aromatic amines and reduced forms of nitrite, including ammonia and possibly hydroxylamine, into the polymer. Compared to the distribution of carbons in TNT as 14% sp 3- and 86% sp2-hybridized, the precipitate fraction from hydrolysis of unlabeled TNT contained 33% sp3- and 67% sp 2-hybridized carbons. The concentration of nitrogen in the precipitate was 64% of that in TNT. The 15N NMR spectra showed that, in addition to residual nitro groups, forms of nitrogen present in the filtrate and precipitate fractions include aminohydroquinone, primary amide, indole, imine, and azoxy, among others. Unreacted nitrite was recovered in the filtrate fraction. The toxicities and susceptibilities to

  1. Vibrational spectroscopic study of new promising materials for non-linear optics. Phosphates of 2,4,6-triaminopyrimidine

    International Nuclear Information System (INIS)

    Complete text of publication follows. The searching for new materials exhibiting nonlinear optical properties (e.g. second harmonic generation - SHG) in combination with other desirable properties (optical transparency, thermal, optical and mechanical stability) continues to be an important research goal in nonlinear optics (NLO). Essential applications of these materials lie in the areas of optical communications and optical signal processing, as well as storage and other information processing tasks. Interesting class of NLO compounds is based on salts combining a cation derived from a polarizable organic molecule with an inorganic anion capable of forming hydrogen-bonded crystal structures. The bonding energy present in the hydrogen bonds can counteract the tendencies of the organic dipoles to form centrosymmetric pairs. It is assumed that the acid part of such molecular complex is responsible for favourable chemical, mechanical and thermal properties, due to strong hydrogen bond interactions which stabilize the crystal lattice and also contributes to the second-order NLO coefficient of the crystal. The organic part is mainly responsible for the nonlinear optical properties of the crystal. Full assignment of vibrational spectra (employing quantum-chemical computational methods) of crystalline materials with promising SHG activity is very useful not only for their identification but also with respect to their nonlinear optical properties. In this contribution we are presenting results concerning three novel phosphates of 2,4,6-triaminopyrimidine. Assignment of vibrational spectra is based on results of X-ray structural analysis and quantum-chemical computations. Efficiency of SHG for polycrystalline samples is also presented and discussed. This work was supported by the Grant Agency of Czech Republic (grant No. 203/09/0878 and is part of the long term Research Plan of the Ministry of Education of the Czech Republic No. MSM0021620857.

  2. Spartathlon, a 246 kilometer foot race: effects of acute inflammation induced by prolonged exercise on circulating progenitor reparative cells.

    Science.gov (United States)

    Goussetis, Evgenios; Spiropoulos, Antonia; Tsironi, Maria; Skenderi, Katerina; Margeli, Alexandra; Graphakos, Stelios; Baltopoulos, Panayiotis; Papassotiriou, Ioannis

    2009-01-01

    Endothelial progenitor cells (EPCs) and the recently described circulating fibrocytes (CFs) are strongly associated with tissue repair. We investigated the kinetics of both "repair" progenitor cells in healthy athletes who participated in the "Spartahlon" ultradistance foot race (246 km continuous running exercise), which provides a unique model of inducing dramatic systemic inflammatory changes. Peripheral blood mononuclear cells (PBMCs) were isolated from 10 volunteer athletes, who completed successfully the race, before, at the end, and at 48 h post-race. EPCs and CFs were detected as endothelial colony-forming units (CFU-ECs) and as the number of adherent with a spindle-shaped morphology Collagen I(+) cells detected after 6-day culture of PBMCs, respectively. The marked increase of plasma levels of CRP, IL-6, SAA, MCP-1, IL-8, sVCAM-1, sICAM-1, thrombomodulin (sTM) and NT-pro-BNP at the end of race established acute inflammation and tissue injury. EPCs increased by nearly eleven-fold in peripheral blood at the end of the race from 44.5+/-2.5/ml to 494.6+/-27.9/ml and remained increased 428.5+/-31.5/ml at 48 h post-race (p<0.0001). The number of the fibrocytes cultured from PBMCs obtained before, at the end, and 48 h post-race did not reveal any significant difference. These findings indicate that bone marrow responses to acute inflammatory damage, induced by exhausting exercise, with a rapid release of EPCs but not CFs into circulation. Given the ability of EPCs to promote angiogenesis and vascular regeneration, we may suggest that this kind of cell mobilization may serve as a physiologic repair mechanism in acute inflammatory tissue injury. PMID:19233694

  3. Transformation of 2,4,6-trinitrotoluene in soil in the presence of the earthworm Eisenia andrei

    Energy Technology Data Exchange (ETDEWEB)

    Renoux, A.Y.; Sarrazin, M.; Hawari, J.; Sunahara, G.I.

    2000-06-01

    The ability of the earthworm Eisenia andrei to metabolize 2,4,6-trinitrotoluene (TNT) was studied in experiments with TNT-spiked soils, dermal contact tests, and with an in vitro assay. Lethality of TNT in a forest sandy soil was first determined. Then TNT at lethal and sublethal concentrations was applied to the same soil and was monitored along with its metabolites in extracts of soil and earthworm tissue for up to 14 d post application. High performance liquid chromatography-ultra violet analyses indicated that TNT was transformed in the presence of E. andrei by a reductive pathway to 2-amino-3,6-dinitrotoluene (2-ADNT), 4-amino-2,6-dinitrotoluene (4-ADNT), 2,4-diamino-6-nitrotoluene (2.4-DANT), and traces of 2,6-diamino-4-nitrotoluene (2,6-DANT) in earthworm tissues. This transformation could be explained by either a metabolic mechanism within the earthworm or by the enhancement of an earthworm-associated microbial activity or both. The TNT concentrations decreased from the spiked soils. However, the monoamino-dinitrotoluene (2-ADNT and 4-ADNT) concentrations increased with exposure duration and were dependent on the initial TNT soil concentrations. This was also observed to a lesser extent in the TNT-spiked soils with no earthworms present. The biotransformation of TNT into 2-ADNT, 4-ADNT, and 2,4-DANT and the presence of these metabolites in E. andrei after dermal contact on TNT-spiked filter paper showed that dermal uptake can be a significant exposure route for TNT. In vitro experiments showed that earthworm homogenate could metabolize TNT and form 2-ADNT and 4-ADNT at room temperature and at 37 C. This effect was inhibited by heat inactivation prior to incubation or by incubation at 4 C, suggesting that the biotransformation of TNT in the presence of E. andrei may be enzymatic in nature.

  4. Transplacental transport and fetal localization of bispehnol A, tetrabromobisphenol A and 2,4,6-tribromophenol in mice

    Energy Technology Data Exchange (ETDEWEB)

    Sundberg, A.; Brunstroem, B.; Brandt, I. [Uppsala Univ. (Sweden). Dept. of Environmental Toxicology; Cantillana, T.; Bergman, Aa. [Stockholm Univ. (Sweden). Dept. of Environmental Chemistry

    2004-09-15

    Bisphenol A (BPA) is an intermediate in the production of epoxy resins, while its brominated derivative tetrabromobishenol A (TBBPA) and its photolysis degradation product 2,4,6-tribromophenol (TBP) are widely used flame retardants. These brominated compounds have been identified in human blood. TBBPA, TBP and a number of 4-hydroxy-PCBs (e.g. 4-OH-CB107) are high affinity ligands for the thyroxin (T4) transporter transthyretin (TTR) in rodents and other species. Displacement of T4 from the TTR binding site has been proposed as an important mechanism of endocrine disruption by certain halogenated phenolic environmental pollutants. BPA is a fairly potent environmental estrogen receptor agonist that can induce an array of estrogenic effects in several species including mammals, birds and fish. Although the estrogenic activity of TBBPA is less obvious, this brominated BPA analog has been reported to interact with the estrogen receptor and induce estrogenic effects in some in vitro test systems. While the reproductive and developmental toxicity of BPA is well documented, there is evidence that also halogenated phenolic compounds can pass the placental barrier and induce such toxicity. Within the objectives of the COMPARE EU project we study the fetal and maternal kinetics and transplacental transport of phenolic environmental pollutants in pregnant mice. To explore the role of TTR in the placental and blood-brain barrier transport, we employ TTR-deficient mice. For comparative reasons, we also explore the transfer to bird embryos following injection into the yolk or administration to the egg-laying bird. In the present communication, we report on the disposition of BPA, TBBPA and TBP in the fetoplacental unit in pregnant wild-type mice.

  5. SEMI SINTESIS SENYAWA 2,4,6-TRINITROFENILHIDRAZON KALANON DAN UJI AKTIVITAS TERHADAP SEL LEUKIMIA L1210

    Directory of Open Access Journals (Sweden)

    Mochammad Chasani

    2011-11-01

    Full Text Available Kalanon adalah senyawa antikanker yang diisolasi dari Calophyllum biflorum Hends dan Ws. Aktivitas kalanon terhadap sel leukemia L1210 masih rendah yakni dengan niali IC50 = 59,4 ug/mL. Suatu senyawa dikatakan aktif sebagai antikanker jjika memiliki nilai IC50 di bawah 10 ug/mL. Penelitian ini ditujukan untuk mensintesis senyawa turunan kalanon dan diharapkan diperoleh senyawa baru yang mempunyai aktivitas lebih tinggi dibandingkan senyawa asal kalanon. Senyawa turunan kalanon diperoleh melalui reaksi antara kalanon dengan 2,4,6-trinitrofenilhidrazin. Reaksi dilakukan pada suhu 78 oC selama delapan jam. Analisis pendahuluan senyawa hasil sintesis dilakukan dengan metode kromatografi lapis tipis (KLT menggunakan eluen n-heksana dan etil asetat (2:1, v/v. Pemurnian senyawa hasil sintesis menggunakan teknik rekristalisasi dengan pelarut n-heksana dan diklorometan (3:1, v/v. Senyawa hasil sintesis diperoleh dengan Rf = 0,6609 dan rendemen 5,125 % ( b/b serta berupa kristal berwarna coklat. Identifikasi senyawa hasil sintesis dilakukan dengan spektrometer massa dan spektrofotometer IR. Hasil identifikasi menunjukkan bahwa senyawa hasil sintesis yang diharapkan telah terbentuk. Data spektrometer massa diperoleh ion molekul M+ = 647 dengan lepasnya molekul H2. Fragmen-fragmen yang terbentuk adalah pada m/e = 504, m/e = 479, m/e = 451, m/e = 429, m/e = 405, m/e = 377, m/e = 341, m/e = 316, m/e = 281, m/e = 253, m/e = 233, m/e = 207, m/e = 177, m/e = 156, m/e = 135, m/e = 96, m/e = 73, dan m/e = 41. Hasil spektrofotometer IR menunjukkan pita serapan pada 1654.8 cm-1 yang merupakan daerah regang ikatan rangkap C=N, pita serapan pada 3000 cm-1 – 3400 cm-1 adalah pita getaran OH fenol dan pita pada 1380 cm-1 menunjukkan rentangan simetri gugus nitro (NO2. Hasil uji sitotoksik terhadap sel leukemia L1210 menghasilkan nilai IC50 sebesr 47.69 μg/ml.

  6. Uptake of 2,4,6-Trinitrotoluene (TNT) by Vetiver grass (Vetiviera ziznoides L.) -- Preliminary results from a hydroponic study

    Science.gov (United States)

    Shakya, K. M.; Sarkar, D.; Datta, R.; Makris, K.; Pachanoor, D.

    2006-05-01

    2,4,6-Trinitrotoluene(TNT) is a potent mutagen and a Group C human carcinogen that has been widely used to produce munitions and explosives. As a result, vast areas that have been previously used as military ranges, munition burning and open detonation sites have been heavily contaminated with TNT. Conventional remedial activities in such contaminated sites commonly rely on methods such as incineration, land filling and soil composting. Phytoremediation offers a cost-effective solution, utilizing plants to phytoextract TNT from the contaminated soil. We propose the use of vetiver grass (Vetiveria zizanoides) to remove TNT from such contaminated soils. Vetiver is a fast-growing and adaptive grass, enabling its use in TNT-contaminated sites in a wide variety of soil types and climate. We also hypothesized that TNT removal by vetiver grass will be enhanced by utilizing a chaotropic agent (urea) to alter rhizosphere/root hair chemical environment. The objectives of this preliminary hydroponic study were: i) to investigate the effectiveness of vetiver grass in removing TNT from solution, and ii) to evaluate the use of a common agrochemical (urea) in enhancing TNT removal by vetiver grass. Vetiver plants were grown in a hydroponic system with five different TNT concentrations (0, 5, 10, 25, and 50 mg TNT L-1) and three urea concentrations (0, 0.01 and 0.1%). A plant density of 10 g L-1 and three replicate vessels per treatment were used. Aliquots were collected at several time intervals up to 192 hour, and were analyzed for TNT with HPLC. Results showed that vetiver was able to remove TNT from hydroponic solutions. The overall magnitude and kinetics of TNT removal by vetiver grass was enhanced in the presence of urea. TNT removal kinetics depended on TNT and urea initial concentrations, suggestive of second-order kinetic reactions. Preliminary results are encouraging, but in need for verification using more detailed studies involving TNT-contaminated soils. Ongoing

  7. Preliminary kinetics and metabolism of 2,4,6-trinitrotoluene and its reduced metabolites in an aquatic oligochaete

    Energy Technology Data Exchange (ETDEWEB)

    Conder, Jason M.; Point, Thomas W. La; Bowen, Alethea T

    2004-08-25

    We examined the toxicokinetics and metabolism of 2,4,6-trinitirotoluene (TNT) and four of its major reduced metabolites (2-amino-4,6-dinitrotoluene (2ADNT), 4-amino-2,6-dinitrotoluene (4ADNT), and 2,4-diamino-6-nitrotoluene (2,4DANT)) in the freshwater, aquatic oligochaete Tubifex tubifex exposed to spiked, reconstituted water. In uptake experiments with each compound, steady state concentrations were reached within 1 h, and all absorbed compounds were completely eliminated in 0-3 h. The appearance of 2ADNT and 4ADNT (from metabolism of absorbed TNT) was five times slower, reaching 95% of steady state in 14.2-16.1 h. Approximately, 82% of absorbed TNT was metabolized to ADNTs; metabolism to 4ADNT was favored over 2ADNT by a factor of 3. No further metabolism of ADNTs to DANTs was detected. After a loss of 29-50% of metabolically-generated ADNTs during the first hour of the TNT depuration experiment, Tubifex ADNT concentrations remained constant throughout the 53 h depuration period. This suggests differences between the toxicokinetics of absorbed ADNTs and the toxicokinetics of metabolically-generated ADNTs. Experiments using radiolabeled ({sup 14}C) TNT revealed that only 15-47% of {sup 14}C-TNT equivalents were identified as TNT, 2ADNT, or 4ADNT, indicating significant metabolism and/or binding to biomolecules. Of unidentified {sup 14}C-TNT equivalents, 28-38% remained unextractable. Both unextractable and extractable unidentified substances increased throughout the 54 h {sup 14}C-TNT uptake experiment. The unidentified portions of the radiolabel were not eliminated during a 53-h depuration experiment. Bioconcentration factors (BCFs) for HPLC-detectable compounds were found to be linearly related to log K{sub OW} (r{sup 2} = 0.9963). BCFs for 2ADNT, 4ADNT, and 2,4DANT were 10.22, 12.41, and 2.75, respectively. The BCF for TNT was 12.25, based on a molar sum of total TNT and its metabolites ({sigma}TNT + 2ADNT + 4ADNT), and 2.53 based on TNT only. Compound

  8. Preliminary kinetics and metabolism of 2,4,6-trinitrotoluene and its reduced metabolites in an aquatic oligochaete

    International Nuclear Information System (INIS)

    We examined the toxicokinetics and metabolism of 2,4,6-trinitirotoluene (TNT) and four of its major reduced metabolites (2-amino-4,6-dinitrotoluene (2ADNT), 4-amino-2,6-dinitrotoluene (4ADNT), and 2,4-diamino-6-nitrotoluene (2,4DANT)) in the freshwater, aquatic oligochaete Tubifex tubifex exposed to spiked, reconstituted water. In uptake experiments with each compound, steady state concentrations were reached within 1 h, and all absorbed compounds were completely eliminated in 0-3 h. The appearance of 2ADNT and 4ADNT (from metabolism of absorbed TNT) was five times slower, reaching 95% of steady state in 14.2-16.1 h. Approximately, 82% of absorbed TNT was metabolized to ADNTs; metabolism to 4ADNT was favored over 2ADNT by a factor of 3. No further metabolism of ADNTs to DANTs was detected. After a loss of 29-50% of metabolically-generated ADNTs during the first hour of the TNT depuration experiment, Tubifex ADNT concentrations remained constant throughout the 53 h depuration period. This suggests differences between the toxicokinetics of absorbed ADNTs and the toxicokinetics of metabolically-generated ADNTs. Experiments using radiolabeled (14C) TNT revealed that only 15-47% of 14C-TNT equivalents were identified as TNT, 2ADNT, or 4ADNT, indicating significant metabolism and/or binding to biomolecules. Of unidentified 14C-TNT equivalents, 28-38% remained unextractable. Both unextractable and extractable unidentified substances increased throughout the 54 h 14C-TNT uptake experiment. The unidentified portions of the radiolabel were not eliminated during a 53-h depuration experiment. Bioconcentration factors (BCFs) for HPLC-detectable compounds were found to be linearly related to log KOW (r2 = 0.9963). BCFs for 2ADNT, 4ADNT, and 2,4DANT were 10.22, 12.41, and 2.75, respectively. The BCF for TNT was 12.25, based on a molar sum of total TNT and its metabolites (ΣTNT + 2ADNT + 4ADNT), and 2.53 based on TNT only. Compound hydrophobicity predicted the toxicokinetics and

  9. Wet oxidative method for removal of 2,4,6-trichlorophenol in water using Fe(III), Co(II), Ni(II) supported MCM41 catalysts

    Energy Technology Data Exchange (ETDEWEB)

    Chaliha, Suranjana [Department of Chemistry, Gauhati University, Guwahati 781014, Assam (India); Bhattacharyya, Krishna Gopal [Department of Chemistry, Gauhati University, Guwahati 781014, Assam (India)], E-mail: krishna2604@sify.com

    2008-02-11

    Chlorophenols in water are resistant to biological oxidation and they have to be destroyed by chemical oxidation. In the present work, Fe(III), Co(II) and Ni(II) incorporated MCM41 mesoporous solids were used as catalysts for oxidation of 2,4,6-trichlorophenol in water with or without the oxidant, H{sub 2}O{sub 2}. The catalysts were prepared by impregnation and were characterized by XRD and FTIR measurements. The parent MCM41, Fe(III), Co(II) and Ni(II) impregnated MCM41 had cation exchange capacity of 20.5, 25.5, 24.2, 26.0 mequiv./100 g, respectively. The catalysts were used after calcination at 773-873 K for 5 h. The reactions were carried out in a high pressure stirred reactor at 0.2 MPa (autogenous) and 353 K under various reaction conditions. The conversion achieved with Fe(III), Co(II) and Ni(II) incorporated MCM41 in 5 h is respectively 59.4, 50.0 and 65.6% with 2,4,6-TCP:H{sub 2}O{sub 2} molar ratio of 1:1, and 60.2, 60.9 and 68.8% in absence of H{sub 2}O{sub 2}. The oxidation has a first order rate coefficient of (1.2-4.8) x 10{sup -3} min{sup -1}. The results show that introduction of Fe(III), Co(II) and Ni(II) into MCM-41 through impregnation produces very effective catalysts for wet oxidation of 2,4,6-trichlorophenol.

  10. Detecció de compostos volàtils, clorofenols, cloroanisoles i 2,4,6-tribromoanisole, relacionats amb el "gust del suro"

    OpenAIRE

    Insa Aguilar, Sara

    2006-01-01

    D'entre els defectes organolèptics associats al vi, en destaca l'anomenat "gust de suro" habitualment vinculat a la presència de cloroanisoles, els quals són productes de l'activitat microbiana formats a partir dels corresponents clorofenols. La present tesi doctoral recull, en primer lloc, metodologies analítiques adreçades principalment a la determinació dels compostos clorofenòlics (2,4,6-triclorofenol, 2,3,4,6-tetraclorofenol i pentaclorofenol) en el control de qualitat dels taps suro, em...

  11. PRIMA-1Met/APR-246 induces apoptosis and tumor growth delay in small cell lung cancer expressing mutant p53

    DEFF Research Database (Denmark)

    Zandi, Roza; Selivanova, Galina; Christensen, Camilla Laulund;

    2011-01-01

    Small cell lung cancer (SCLC) is a highly malignant disease with poor prognosis, necessitating the need to develop new and efficient treatment modalities. PRIMA-1(Met) (p53-dependent reactivation of massive apoptosis), also known as APR-246, is a small molecule, which restores tumor suppressor...... function to mutant p53 and induces cancer cell death in various cancer types. Since p53 is mutated in more than 90% of SCLC, we investigated the ability of PRIMA-1(Met) to induce apoptosis and inhibit tumor growth in SCLC with different p53 mutations....

  12. Synthesis and characterization of 2,3-dibromopropyl-2,4,6-tribromophenyl ether (DPTE) and structurally related compounds evidenced in seal blubber and brain.

    Science.gov (United States)

    von der Recke, Roland; Vetter, Walter

    2007-03-01

    The unknown compound UBC-1 previously described as the major organobromine contamination in the blubber extract of a hooded seal (Cystophora cristata) from the Barents Sea was identified as 2,3-dibromopropyl-2,4,6-tribromophenyl ether (DPTE). DPTE, which is the main component of the brominated flame retardant (BFR) Bromkal 73-5 PE, was synthesized by electrophilic addition of bromine to allyl-2,4,6-tribromophenyl ether (ATE). The chirality of DPTE was proven by gas chromatographic enantioseparation of the synthesized racemate. On the basis of GC/ECNI-MS ion chromatograms (m/z79 and 81), DPTE was the dominating organobromine compound in blubber and brain samples of hooded seals and harp seals (Phoca groenlandica) from the Barents and Greenland Seas. The concentrations of DPTE in blubber and brain were up to 470 and 340 microg/kg wet weight. Next to DPTE, the natural dibromo-trichloromonoterpene (MHC-1), the anthropogenic BDE 47 and BDE 99, as well as ATE, 3,5-dibromo-2-(2',4'-dibromo)-phenoxyanisole (6-MeO-BDE 47), 2-bromoallyl-2,4,6-tribromophenyl ether (BATE), and 4,6-dibromo-2-(2',4'-dibromo)-phenoxyanisole (2'-MeO-BDE 68) were present with decreasing relevance. BATE, which was detected for the first time in environmental samples, was synthesized from DPTE by E2 elimination. In brain samples of the harp seals, DPTE, ATE, and BATE were the most abundant organobromine compounds, whereas polybrominated diphenyl ethers (PBDEs) and MHC-1 were virtually absent. This indicated that DPTE, ATE, and BATE were able to penetrate the blood-brain barrier. The general co-occurrence of ATE and BATE in samples contaminated with DPTE support the hypothesis that these compounds are biotransformation products of DPTE. Anaerobic transformation studies of DPTE with super-reduced corrinoids resulted in the formation of ATE. Furthermore, 2,4,6-tribromophenol (TBP) and two other unknown minor transformation products were detected. PMID:17396646

  13. catena-Poly[[diaquabis(formato-κOnickel(II]-μ-2,4,6-tris(4-pyridyl-1,3,5-triazine-κ2N2:N4

    Directory of Open Access Journals (Sweden)

    Miao Feng

    2011-05-01

    Full Text Available In the title compound, [Ni(CHO22(C18H12N6(H2O2]n, the NiII ion, lying on a crystallographic inversion center, has a distorted octahedral coordination comprising two water ligands, two O-atom donors from formate ligands and two N-atom donors from the 2,4,6-tris(4-pyridyl-1,3,5-triazine ligands. These ligands bridge the NiII complex units, forming zigzag chains along the c axis. Adjacent chains are linked by O—H...O hydrogen bonds, forming a three-dimensional supramolecular network.

  14. Fe(III) mineral reduction followed by partial dissolution and reactive oxygen species generation during 2,4,6-trinitrotoluene transformation by the aerobic yeast Yarrowia lipolytica

    OpenAIRE

    Ziganshin, Ayrat M; Ziganshina, Elvira E; Byrne, James; Gerlach, Robin; Struve, Ellen; Biktagirov, Timur; Rodionov, Alexander; Kappler, Andreas

    2015-01-01

    Understanding the factors that influence pollutant transformation in the presence of ferric (oxyhydr)oxides is crucial to the efficient application of different remediation strategies. In this study we determined the effect of goethite, hematite, magnetite and ferrihydrite on the transformation of 2,4,6-trinitrotoluene (TNT) by Yarrowia lipolytica AN-L15. The presence of ferric (oxyhydr)oxides led to a small decrease in the rate of TNT removal. In all cases, a significant release of NO2 − fro...

  15. Theoretical Study on the Structures and Electronic Spectra of the Derivatives of C60-P-2,4,6-Triphenyl Borazinc

    Institute of Scientific and Technical Information of China (English)

    2005-01-01

    The structures and electronic spectra of the derivatives of C6o-P-2,4,6-triphenyl borazinc have been studied by using AM1 method. The calculated results indicate that this kind of compounds has a lower energy difference between HOMO and LUMO. It is found that the electron cloud on unoccupied frontier orbital mainly comes from the contribution of C6o, while that on occupied frontier orbital mainly concentrates on the side chain. A long-lived charge-separated state may occur in the objective compounds.

  16. Template synthesis, characterization and antimicrobial activity of the complex combinations of some transitional metals with isonicotinoylhydrazone -2,4,6- trimethylbenzaldehyde

    International Nuclear Information System (INIS)

    The complexes of Cu(II), Ni(II), Co(II), Mn(II), and Zn(II) with isonicotinoyl-hydrazone -2,4,6-trimethylbenzaldehyde (INHTB) are reported. The complexes have been characterized by analytical data, IR, UV-Vis, NMR spectra, magnetic susceptibility, thermal analysis and for the Cu(II) complex the ESR spectrum has been recorded. The anti-bacterial activity of these complexes were investigated against Staphylococcus aureus, Escherichia coli, Pseudomonas aeruginosa, Salmonella enteritidis, Shigella flexneri bacteria. The INHTB ligand is coordinated at the metallic ions by oxygen amide (O=C) and the azomethine nitrogen. (author)

  17. Highly efficient and easy synthesis of 2,4,6-triarylpyridines catalyzed by pentafluorophenylammonium triflate (PFPAT) as a new recyclable solid acid catalyst in solvent-free conditions

    Institute of Scientific and Technical Information of China (English)

    Naser Montazeri; Saber Mahjoob

    2012-01-01

    Pentafluorophenylammonium triflate (PFPAT) was found to be a highly efficient catalyst for the preparation of 2,4,6-triarylpyridines from the reaction of acetophenone derivatives,aromatic aldehydes and ammonium acetate.Present methodology offers several advantages,such as short reaction time,high yields,simple procedure with an easy work-up and the absence of any volatile and hazardous organic solvent.In addition,this catalytic system can act as an active,inexpensive,metal-free,recoverable and recyclable catalyst.

  18. Hexaaquabis[3,5-bis(hydroxyimino-1-methyl-2,4,6-trioxocyclohexanido-κ2N3,O4]barium tetrahydrate

    Directory of Open Access Journals (Sweden)

    Nguyen Dinh Do

    2013-11-01

    Full Text Available In the title compound, [Ba(C7H5N2O52(H2O6]·4H2O, the Ba2+ cation lies on a twofold rotation axis and is ten-coordinated by two 3,5-bis(hydroxyimino-1-methyl-2,4,6-trioxocyclohexanide oxo O atoms [Ba—O = 2.8715 (17 Å], two hydroxyimino N atoms [Ba—N = 3.036 (2 Å], and six water molecules [Ba—O = 2.847 (2, 2.848 (2, and 2.880 (2 Å]. The 3,5-bis(hydroxyimino-1-methyl-2,4,6-trioxocyclohexanide monoanions act in a bidentate chelating manner, coordinating through an N atom of the non-deprotonated hydroxyimino group and an O atom of the neighboring oxo group. Two lattice water molecules are located in the cavities of the framework and are involved in hydrogen bonding to O atoms of one of the coordinating water molecules and the O atom of a keto group of the ligand. As a result, a three-dimensional network is formed.

  19. Thiocyanate cadmium(II) complexes of 2,4,6-tri(2-pyridyl)-1,3,5-triazine – Synthesis, structure and luminescence properties

    International Nuclear Information System (INIS)

    Two new thiocyanate cadmium(II) complexes of 2,4,6-tri(2-pyridyl)-1,3,5-triazine were synthesized and characterized. The resulted complexes [Cd(SCN)(NO3)(tptz)(H2O)] (1) and [Cd(SCN)2(tptz)(MeOH)] (2) were studied by IR, UV–vis spectroscopy and single crystal X-ray analysis. The luminescent properties of 1 and 2 were studied in solution and solid state and compared with the free ligand. To get detailed insight into the electronic structure and spectroscopic properties of [Cd(SCN)(NO3)(tptz)(H2O)] and [Cd(SCN)2(tptz)(MeOH)], the density functional theory (DFT) and time-dependent DFT (TD-DFT) calculations were performed. - Highlights: • Two novel thiocyanate cadmium(II) compounds of 2,4,6-tri(2-pyridyl)-1,3,5-triazine were synthesized. • The compounds were identified by IR, UV–vis spectroscopy and X-ray analysis. • The fluorescence properties of the complexes were examined and compared with the free ligand. • The electronic spectra were investigated at the TD-DFT level employing B3LYP/LANL2DZ

  20. Thiocyanate cadmium(II) complexes of 2,4,6-tri(2-pyridyl)-1,3,5-triazine – Synthesis, structure and luminescence properties

    Energy Technology Data Exchange (ETDEWEB)

    Nawrot, I. [Department of Crystallography, Institute of Chemistry, University of Silesia, ul. Szkolna 9, 40-006 Katowice (Poland); Machura, B., E-mail: basia@ich.us.edu.pl [Department of Crystallography, Institute of Chemistry, University of Silesia, ul. Szkolna 9, 40-006 Katowice (Poland); Kruszynski, R., E-mail: rafal.kruszynski@p.lodz.pl [Department of X-ray Crystallography and Crystal Chemistry, Institute of General and Ecological Chemistry, Lodz University of Technology, ul. Żeromskiego 116, 90-924 Łódź (Poland)

    2014-12-15

    Two new thiocyanate cadmium(II) complexes of 2,4,6-tri(2-pyridyl)-1,3,5-triazine were synthesized and characterized. The resulted complexes [Cd(SCN)(NO{sub 3})(tptz)(H{sub 2}O)] (1) and [Cd(SCN){sub 2}(tptz)(MeOH)] (2) were studied by IR, UV–vis spectroscopy and single crystal X-ray analysis. The luminescent properties of 1 and 2 were studied in solution and solid state and compared with the free ligand. To get detailed insight into the electronic structure and spectroscopic properties of [Cd(SCN)(NO{sub 3})(tptz)(H{sub 2}O)] and [Cd(SCN){sub 2}(tptz)(MeOH)], the density functional theory (DFT) and time-dependent DFT (TD-DFT) calculations were performed. - Highlights: • Two novel thiocyanate cadmium(II) compounds of 2,4,6-tri(2-pyridyl)-1,3,5-triazine were synthesized. • The compounds were identified by IR, UV–vis spectroscopy and X-ray analysis. • The fluorescence properties of the complexes were examined and compared with the free ligand. • The electronic spectra were investigated at the TD-DFT level employing B3LYP/LANL2DZ.

  1. Structural and Catalytic Differences between Two FADH2-Dependent Monooxygenases: 2,4,5-TCP 4-Monooxygenase (TftD) from Burkholderia cepacia AC1100 and 2,4,6-TCP 4-Monooxygenase (TcpA) from Cupriavidus necator JMP134

    OpenAIRE

    ChulHee Kang; Luying Xun; Andrew Popchock; Arun Kumar Subramanian; Webb, Brian N.; Robert P. Hayes; Mark Nissen

    2012-01-01

    2,4,5-TCP 4-monooxygenase (TftD) and 2,4,6-TCP 4-monooxygenase (TcpA) have been discovered in the biodegradation of 2,4,5-trichlorophenol (2,4,5-TCP) and 2,4,6-trichlorophenol (2,4,6-TCP). TcpA and TftD belong to the reduced flavin adenine dinucleotide (FADH2)-dependent monooxygenases and both use 2,4,6-TCP as a substrate; however, the two enzymes produce different end products. TftD catalyzes a typical monooxygenase reaction, while TcpA catalyzes a typical monooxygenas...

  2. Bis(2,4,6-triamino-1,3,5-triazin-1-ium) tris(pyridine-2,6-dicarboxylato)zirconate(IV) tetrahydrate

    OpenAIRE

    Faranak Manteghi; Hossein Aghabozorg; Shirin Daneshvar

    2008-01-01

    The title compound, (C3H7N6)2[Zr(C7H3NO4)3]·4H2O or (tataH)2[Zr(pydc)3]·4H2O (tata is 2,4,6-triamino-1,3,5-triazine and pydcH2 is pyridine-2,6-dicarboxylic acid), was obtained by reaction between pydcH2, tata and zirconyl chloride octahydrate in aqueous solution. In the structure, the ZrIV atom is nine-coordinated by three (pydc)2− groups, resulting in an anionic complex which is balanced by two (tataH)+ cations. One of the NH2 groups shows positional disorder, with site occup...

  3. Adhesive properties of some fluoropolymer binders with the insensitive explosive 1,3,5-triamino-2,4,6-trinitrobenzene (TATB).

    Science.gov (United States)

    Yeager, J D; Dattelbaum, A M; Orler, E B; Bahr, D F; Dattelbaum, D M

    2010-12-15

    Adhesion between binders and explosive crystals is of critical importance for the mechanical performance of plastic-bonded explosives (PBXs). The surface properties of several prospective binders have been determined from static advancing contact angle measurements. The surface energies have been used to calculate theoretical work of adhesion to 1,3,5-triamino-2,4,6-trinitrobenzene (TATB), a common insensitive high explosive. The fluorinated terpolymer Oxy-461™, and Kel-F™ chlorotrifluoroethylene-vinylidene fluoride copolymers show the greatest potential for wetting TATB surfaces, and should promote the best adhesion to TATB in PBX formulations. In general, none of the fluoropolymer binders investigated here exhibit markedly superior adhesion to TATB. Thus, bulk physical properties are likely to be more important when choosing a binder. PMID:20875644

  4. Synthesis of novel tripodal-benzimidazole from 2,4,6-tris(p-formylphenoxy)-1,3,5-triazine: Structural, electrochemical and antimicrobial studies

    Energy Technology Data Exchange (ETDEWEB)

    Koc, Ziya Erdem, E-mail: zerdemkoc@gmail.com [Department of Chemistry, Faculty of Science, Selcuk University, 42031 Konya (Turkey); Bingol, Haluk; Saf, Ahmet O. [Department of Chemistry, Faculty of Science, Selcuk University, 42031 Konya (Turkey); Torlak, Emrah [Provincial Control Laboratory, Konya (Turkey); Coskun, Ahmet [Department of Chemistry, Faculty of Science, Selcuk University, 42031 Konya (Turkey)

    2010-11-15

    Four new tripodal-benzimidazole derivatives were synthesized by Schiff base reaction between 2,4,6-tris(p-formylphenoxy)-1,3,5-triazine (TRIPOD) and different diamine derivatives. The structures of the obtained compounds were identified by FT-IR, {sup 1}H NMR, {sup 13}C NMR and UV-vis spectral data, thermal analysis and elemental analysis. Electrochemical behaviors of the compounds were studied by cyclic voltammetry in DMF including 0.1 M [NBu{sub 4}] [PF{sub 6}]. The voltammograms showed peaks having similar characteristics except tripodal-benzimidazole including -NO{sub 2} derivative. In addition, their antimicrobial activities were evaluated by using the standard disk diffusion method in dimethylformamide media. The activities were determined against 4 bacteria cultures by comparing to those of gentamycin.

  5. Fluorescence-based Sensing of 2,4,6-Trinitrotoluene (TNT Using a Multi-channeled Poly(methyl methacrylate (PMMA Microimmunosensor

    Directory of Open Access Journals (Sweden)

    Anne W. Kusterbeck

    2010-01-01

    Full Text Available Fluorescence immunoassays employing monoclonal antibodies directed against the explosive 2,4,6-trinitrotoluene (TNT were conducted in a multi-channel microimmunosensor. The multi-channel microimmunosensor was prepared in poly (methyl methacrylate (PMMA via hot embossing from a brass molding tool. The multi-channeled microfluidic device was sol-gel coated to generate a siloxane surface that provided a scaffold for antibody immobilization. AlexaFluor-cadaverine-trinitrobenzene (AlexaFluor-Cad-TNB was used as the reporter molecule in a displacement immunoassay. The limit of detection was 1-10 ng/mL (ppb with a linear dynamic range that covered three orders of magnitude. In addition, antibody crossreactivity was investigated using hexahydro-1,3,5-triazine (RDX, HMX, 2,4-dinitrotoluene (DNT, 4-nitrotoluene (4-NT and 2-amino-4,6-DNT.

  6. Synthesis, characterization and evaluation of 1,2-bis(2,4,6-trinitrophenyl) hydrazine: a key precursor for the synthesis of high performance energetic materials.

    Science.gov (United States)

    Badgujar, D M; Talawar, M B; Harlapur, Sujata F; Asthana, S N; Mahulikar, P P

    2009-12-15

    1,2-Bis(2,4,6-trinitrophenyl) hydrazine (3) is one of the precursors in the synthesis of an important energetic material viz., hexanitrazobenzene. The simple and convenient lab scale synthesis of title compound (3) was carried out by the condensation of picryl chloride (2) with hydrazine hydrate at 30-50 degrees C in methanol based on the lines of scanty literature reports. Picryl chloride was synthesized by the reaction of picric acid (1) with phosphorous oxychloride based on the lines of reported method. The synthesized compound (3) was characterized by IR and 1H NMR spectral data. Some of the energetic properties of the synthesized compound have also been studied. The theoretically computed energetic properties of the title compound (3) indicated the superior performance in comparison to tetranitrodibenzo tetraazapentalene (TACOT) and hexanitrostilbene (HNS) in terms of velocity of detonation. PMID:19665292

  7. Fabrication of surface plasmon resonance sensor surface with control of the nonspecific adsorption and affinity for the detection of 2,4,6-trinitrotoluene using an antifouling copolymer

    Directory of Open Access Journals (Sweden)

    RuiYatabe

    2014-04-01

    Full Text Available We fabricated a surface plasmon resonance (SPR sensor using a hydrophilic polymer for the highly sensitive detection of 2,4,6-trinitrotoluene (TNT. The hydrophilic polymer was made from mono-2-(methacryloyloxyethylsuccinate (MES and 2-hydroxyethylmethacrylate (HEMA by surface-initiated atom transfer radical polymerization (SI-ATRP. The detection of TNT was carried out by displacement assay with the SPR measurement. In displacement assay, the affinity between anti-TNT antibody and the sensor surface, affects to the sensitivity. In the SPR measurement, nonspecific adsorption should be controlled because SPR sensor cannot discriminate between specific and nonspecific adsorption. Therefore, the affinity and nonspecific adsorption were controlled by changing the ratio of HEMA to MES. A detection limit of 0.4 ng/ml (ppb for TNT was achieved using a sensor surface with the lowest affinity without nonspecific adsorption.

  8. Magnetism of 1,3,5-trithia-2,4,6-triazapentalenyl (TTTA) and bis(hexafluoroacetylacetonato)copper(II) (Cu(hfac)2)

    International Nuclear Information System (INIS)

    An accurate full-potential density-functional method is used to study the mechanism of the origin of magnetism and the magnetic interactions in 1,3,5-Trithia-2,4,6-triazapentalenyl (TTTA) and Bis(hexafluoroacetylacetonato)copper(II) (Cu(hfac)2). The results revealed that the spontaneous magnetic moments for the TTTA.Cu(hfac)2 mainly come from Cu and N1 atoms, and the O1, O2, O3, O4 and N2, N3, S1, S2 atoms also contribute to the magnetism. In TTTA.Cu(hfac)2, there would be ferromagnetic interaction between the Cu(II) ion and the N1atom of TTTAA, and there exists antiferromagnetic interaction between the intramolecular organic ligands

  9. Synthesis of novel tripodal-benzimidazole from 2,4,6-tris(p-formylphenoxy)-1,3,5-triazine: Structural, electrochemical and antimicrobial studies

    International Nuclear Information System (INIS)

    Four new tripodal-benzimidazole derivatives were synthesized by Schiff base reaction between 2,4,6-tris(p-formylphenoxy)-1,3,5-triazine (TRIPOD) and different diamine derivatives. The structures of the obtained compounds were identified by FT-IR, 1H NMR, 13C NMR and UV-vis spectral data, thermal analysis and elemental analysis. Electrochemical behaviors of the compounds were studied by cyclic voltammetry in DMF including 0.1 M [NBu4] [PF6]. The voltammograms showed peaks having similar characteristics except tripodal-benzimidazole including -NO2 derivative. In addition, their antimicrobial activities were evaluated by using the standard disk diffusion method in dimethylformamide media. The activities were determined against 4 bacteria cultures by comparing to those of gentamycin.

  10. Crystal structure of 4,4′,4′′-(1,3,5-triazine-2,4,6-triyltripyridinium trichloride 2.5-hydrate

    Directory of Open Access Journals (Sweden)

    Bo-Kai Ling

    2015-11-01

    Full Text Available The asymmetric unit of the title compound, C18H15N63+·3Cl−·2.5H2O, contains two independent (1,3,5-triazine-2,4,6-triyltripyridinium cations. Both cations are approximately planar, the r.m.s. deviations of fitted non-H atoms being 0.045 and 0.051 Å. In the crystal, extensive O—H...Cl, O—H...O, N—H...Cl and N—H...O hydrogen bonds and weak C—H...Cl and C—H...O interactions link the organic cations, Cl− anions and water molecules into a three-dimensional supramolecular architecture. π–π stacking between the pyridine rings of adjacent cations is also observed, the centroid-to-centroid distance being 3.7578 (8 Å.

  11. Elimination Reactions of (E)-2,4,6-Trinitrobenzaldehyde O-benzoyloximes Promoted by R2NH in MeCN. Change of Reaction Mechanism

    International Nuclear Information System (INIS)

    We have studied the nitrile-forming elimination reactions from 1 promoted by R2NH in MeCN. The reaction proceeded by (E1cb)irr mechanism. Change of the β-aryl group from 2,4-dinitrophenyl to a more strongly electron-withdrawing 2,4,6-trinitrophenyl increased the reaction rate by 470-fold, shifted the transition state toward more reactant-like, and changed the reaction mechanism from E2 to (E1cb)irr. To the best of our knowledge, this is the first example of nitrile-forming elimination reaction that proceeds by the (E1cb)irr mechanism in MeCN. Noteworthy is the carbanion stabilizing ability of the 2,4,6-trinitrophenyl group in aprotic solvent. Nitrile-forming elimination reactions of (E)-benzaldoxime derivatives have been extensively investigated under various conditions. The reactions proceeded by the E2 mechanism in MeCN despite the fact that the reactants have syn stereochemistry, poor leaving, and sp2 hybridized β-carbon atom, all of which favor E1cb- or E1cb-like transition state. Moreover, the transition state structures were relatively insensitive to the variation of the reactant structures. The results have been attributed to the poor anion solvating ability of MeCN, which favors E2 transition state with maximum charge dispersal. For eliminations from strongly activated (E)-2,4-(NO2)2C6H3CH=NOC(O)C6H4X, a change in the reaction mechanism from E2 to (E1cb)irr was observed as the base-solvent was changed from R2NH in MeCN to R2NH/R2NH2+ in 70 mol % MeCN(aq). A combination of a strong electron-withdrawing β-aryl group and anion-solvating protic solvent was required for the mechanistic change

  12. Preparation, Crystal Structure and Thermal Analyses of 1,5-Diamino-4-hydro-1,2,3,4-tetrazolium 3,5-Dihydroxy-2,4,6-trinitrophenolate

    Institute of Scientific and Technical Information of China (English)

    CUI Yan; ZHANG Tong-Lai; ZHANG Jian-Guo; HU Xiao-Chun; ZHANG Jin; HUANG Hui-Sheng

    2008-01-01

    A novel energetic salt 1,5-diamino-4-hydro-1,2,3,4-tetrazolium 3,5-dihydroxy-2,4,6-trinitrophenolate was synthesized by the reaction of 1,5-diamino-1,2,3,4-tetrazole (DAT) with 2,4,6-trinitro-1,3,5-trihydroxybenzene (trinitrophloroglucinol, TNPG). It was characterized by X-ray single crystal diffraction, elemental analysis, FT-IR spectroscopy and 1H NMR. The title compound crystallizes in monoclinic system, P2(1)/c space group with crystal parameters of a=1.3399(3) nm, b=0.47088(9) nm, c=2.0127(4) nm, β=92.83(3)°, V= 1.2684(4) nm3, Z=4. Hydrogen bonds, electrostatic interactions, and weak van der Waals' forces make the molecules form a stable threedimensional net structure. Mulliken charge distribution and overlap population of DAT and DATH+TNPG- in bulk state have been obtained from the density functional theory (DFT) with the B3LYP method employing the 6-31G**basis sets to interpret the reason why the protonation site of DAT is N(4) atom of the tetrazole ring. Thermal decomposition of the title compound was studied by using differential scanning calorimetry (DSC) and thermogravimetric analysis (TG) techniques. The high enthalpy change and leaving no solid residue after thermal decomposition indicate that the title compound can be used as a promising energetic material or gas-generating composition.The kinetic parameters of the exothermic process of DATH+TNPG- were studied by using Kissinger's and Ozawa-Doyle's methods and the Arrhenius equation of this process was obtained.

  13. Synthesis, structure and luminescence properties of cadmium(II) complexes with 2,4,6-tri(2-pyridyl)-1,3,5-triazine

    International Nuclear Information System (INIS)

    The paper presents a combined experimental and computational study for two cadmium(II) complexes [Cd(dca)(NO3)(tptz)(H2O)]·2H2O (1) and [Cd(dca)(OAc) (tptz)(H2O)]·2H2O (2) (tptz=2,4,6-tri(2-pyridyl)-1,3,5-triazine and dca=dicyanamide anion). The compounds have been studied by IR, UV–vis spectroscopy and single crystal X-ray analysis. Due to the presence of multidentate N-donor ligand, coordinated water molecule and nitrate or acetate groups together with the lattice water molecules their crystal structures are dominated by the hydrogen-bonding interactions that give rise to the supramolecular architectures. The luminescent properties of compounds 1 and 2 have been studied in solution and solid state and compared with the free ligand. The studies revealed that the fluorescence of tptz ligand and complexes 1 and 2 was concentration and solvent dependent. To get detailed insight into the electronic structure and spectroscopic properties of [Cd(dca)(NO3)(tptz)(H2O)] and [Cd(dca)(OAc) (tptz)(H2O)], the density functional theory (DFT) and time-dependent DFT (TD-DFT) calculations were performed. -- Highlights: • Two novel dicyanamide cadmium(II) compounds of 2,4,6-tri(2-pyridyl)-1,3,5-triazine were synthesized. • The compounds were identified by IR, UV–vis spectroscopy and X-ray analysis. • The fluorescence properties of the complexes were examined and compared with the free ligand. • The electronic spectra were investigated at the TDDFT level employing B3LYP/LANL2DZ

  14. 1,3,5-Triazine-2,4,6-triyltrisulfamic acid (TTSA): A new organic solid acid for the nitrosation of secondary amines and oxidation of urazoles in the presence of NaNO2 under mild and heterogeneous conditions

    Indian Academy of Sciences (India)

    Gholamabbas Chehardoli; Mohammad Ali Zolfigol; Toktam Faal-Rastegar; Shadpour Mallakpour; Arash Ghorbani-Choghamarani

    2009-07-01

    Melamine reacted with chlorosufonic acid (ClSO3H) to form a new sulfamic-type acid, 1,3,5-triazine-2,4,6-triyltrisulfamic acid (TTSA). Both nitrosation of secondary amines and oxidation of urazoles were accomplished by using TTSA/NaNO2 system under mild and heterogeneous conditions with good to excellent yields.

  15. Oxidation-reduction properties of americium, curium, berkelium, californium, einsteinium and fermium, and thermodynamic consequences for the 5f series

    International Nuclear Information System (INIS)

    The amalgamation of 5f elements from Am to Fm has been studied by using 241Am, 244Cm, 249Bk, 249Cf, 252Cf, 253Es, 254Es, 252Fm and 255Fm with two electrochemical methods, radiocoulometry and radiopolarography, perfectly adapted to investigate extremely diluted solutions when the concentration of electroactive species is as low as 10-16M. The theory of radiocoulometry has been developed in the general cases of reversible and irreversible electrode process. It has been used to interpret the experimental data on the kinetic curves of amalgamation, and to estimate the standard rate constant of the electrode process in complexing medium (citric). On the other hand the radiopolarographic method has been applied to study the mechanism of reduction at the dropping mercury electrode of cations M3+ in aqueous medium to the metal M with formation of amalgam. The results are exploited into two directions: 1- Acquisition of some data concerning the oxidation-reduction properties of elements from Am to Fm. Therefore the standard electrode E0 [M(III-0)] potentials for Bk, Cf and Es, and the standard electrode E0 [M(II-0)] potential for Fm are estimated and the relative stability of each oxidation state (from II to VII) of 5f elements is discussed; 2- Acquisition of unknown thermodynamic data on transcalifornium elements. Correlations between 4f and 5f elements are precised and some divergences appear for the second half of 4f and 5f series (i.e. for 65<=Z<=71 and 97<=Z<=103)

  16. Evaluation of thermal neutron cross-sections and resonance integrals of protactinium, americium, curium, and berkelium isotopes

    International Nuclear Information System (INIS)

    Data on the thermal neutron fission and capture cross-sections as well as their corresponding resonance integrals are reviewed and analysed. The data are classified according to the form of neutron spectra under investigation. The weighted mean values of the cross-sections and resonance integrals for every type of neutron spectra were adopted as evaluated data. (author). 87 refs, 2 tabs

  17. Molecular dynamics and first-principles studies of structural change in 1,3,5-triamino-2,4,6-trinitrobenzene (TATB) in crystalline state under high pressure: Comparison of hydrogen bond systems of TATB versus 1,3-diamino-2,4,6-trinitrobenzene (DATB)

    Science.gov (United States)

    Kohno, Yuji; Mori, Kazuki; Hiyoshi, Reiko I.; Takahashi, Osamu; Ueda, Kazuyoshi

    2016-06-01

    Classical molecular dynamics (MD) calculations were performed to reveal the effect of high pressure on the crystal structure of 1,3,5-triamino-2,4,6-trinitrobenzene (TATB), an insensitive energetic material. The primary simulation cell consisted of 54 molecules in a triclinic cell, corresponding to 27 unit cells obtained by replicating the experimentally determined unit cell. Inter- and intra-molecular hydrogen bonds were maintained in the range of 1.0 atm to 20.0 GPa as pressure was incremented by 0.5 GPa. The pressure dependence of the interlayer distances (h1) and farthest intermolecular distance (d1) between nitro groups in the TATB crystal's unit cell was investigated in the same range. h1 decreased monotonously from 3.50 to 2.90 Å as pressure increased to 20.0 GPa. However, d1 increased considerably with pressure up to 4.0 GPa, most remarkably between 2.0 and 4.0 GPa. Thus, a unique structural change occurred in TATB crystal in this range. On the other hand, 1,3-diamino-2,4,6-trinitrobenzene (DATB) crystal showed a unique structural change between 7.0 and 8.0 GPa. These discrepancies are attributed to the different network systems of hydrogen bonding of these two molecules. To validate the MD calculation results, we conducted first-principles calculations. MD and first-principles calculations showed good agreement with previous experimental results.

  18. A facile synthesis of highly luminescent nitrogen-doped graphene quantum dots for the detection of 2,4,6-trinitrophenol in aqueous solution

    Science.gov (United States)

    Lin, Liping; Rong, Mingcong; Lu, Sisi; Song, Xinhong; Zhong, Yunxin; Yan, Jiawei; Wang, Yiru; Chen, Xi

    2015-01-01

    A facile bottom-up method for the synthesis of highly fluorescent nitrogen-doped graphene quantum dots (N-GQDs) has been developed via a one-step pyrolysis of citric acid and tris(hydroxymethyl)aminomethane. The obtained N-GQDs emitted strong blue fluorescence under 365 nm UV light excitation with a high quantum yield of 59.2%. They displayed excitation-independent behavior, high resistance to photobleaching and high ionic strength. In addition to the good linear relationship between the fluorescence intensity of the N-GQDs and pH in the range 2-7, the fluorescence intensity of the N-GQDs could be greatly quenched by the addition of a small amount of 2,4,6-trinitrophenol (TNP). A sensitive approach has been developed for the detection of TNP with a detection limit of 0.30 μM, and a linearity ranging from 1 to 60 μM TNP could be obtained. The approach was highly selective and suitable for TNP analysis in natural water samples.A facile bottom-up method for the synthesis of highly fluorescent nitrogen-doped graphene quantum dots (N-GQDs) has been developed via a one-step pyrolysis of citric acid and tris(hydroxymethyl)aminomethane. The obtained N-GQDs emitted strong blue fluorescence under 365 nm UV light excitation with a high quantum yield of 59.2%. They displayed excitation-independent behavior, high resistance to photobleaching and high ionic strength. In addition to the good linear relationship between the fluorescence intensity of the N-GQDs and pH in the range 2-7, the fluorescence intensity of the N-GQDs could be greatly quenched by the addition of a small amount of 2,4,6-trinitrophenol (TNP). A sensitive approach has been developed for the detection of TNP with a detection limit of 0.30 μM, and a linearity ranging from 1 to 60 μM TNP could be obtained. The approach was highly selective and suitable for TNP analysis in natural water samples. Electronic supplementary information (ESI) available. See DOI: 10.1039/c4nr06365a

  19. Anti-leukaemic effects induced by APR-246 are dependent on induction of oxidative stress and the NFE2L2/HMOX1 axis that can be targeted by PI3K and mTOR inhibitors in acute myeloid leukaemia cells.

    Science.gov (United States)

    Ali, Dina; Mohammad, Dara K; Mujahed, Huthayfa; Jonson-Videsäter, Kerstin; Nore, Beston; Paul, Christer; Lehmann, Sören

    2016-07-01

    The small molecule APR-246 (PRIMA-1(MET) ) is a novel drug that restores the activity of mutated and unfolded TP53 protein. However, the mechanisms of action and potential off-target effects are not fully understood. Gene expression profiling in TP53 mutant KMB3 acute myeloid leukaemia (AML) cells showed that genes which protected cells from oxidative stress to be the most up-regulated. APR-246 exposure also induced reactive oxygen species (ROS) formation and depleted glutathione in AML cells. The genes most up-regulated by APR-246, confirmed by quantitative real time polymerase chain reaction, were heme oxygenase-1 (HMOX1, also termed HO-1), SLC7A11 and RIT1. Up-regulation of HMOX1, a key regulator of cellular response to ROS, was independent of TP53 mutational status. NFE2L2 (also termed Nrf2), a master regulator of HMOX1 expression, showed transcriptional up-regulation and nuclear translocation by APR-246. Down-regulation of NFE2L2 by siRNA in AML cells significantly increased the antitumoural effects of APR-246. The PI3K inhibitor wortmannin and the mTOR inhibitor rapamycin inhibited APR-246-induced nuclear translocation of NFE2L2 and counteracted the protective cellular responses to APR-246, resulting in synergistic cell killing together with APR-246. In conclusion, ROS induction is important for antileukaemic activities of APR-246 and inhibiting the protective response of the Nrf-2/HMOX1 axis using PI3K inhibitors, enhances the antileukaemic effects. PMID:26991755

  20. Stand-off imaging Raman spectroscopy for forensic analysis of post-blast scenes: trace detection of ammonium nitrate and 2,4,6-trinitrotoluene

    Science.gov (United States)

    Ceco, Ema; Önnerud, Hans; Menning, Dennis; Gilljam, John L.; Bââth, Petra; Östmark, Henric

    2014-05-01

    The following paper presents a realistic forensic capability test of an imaging Raman spectroscopy based demonstrator system, developed at FOI, the Swedish Defence Research Agency. The system uses a 532 nm laser to irradiate a surface of 25×25mm. The backscattered radiation from the surface is collected by an 8" telescope with subsequent optical system, and is finally imaged onto an ICCD camera. We present here an explosives trace analysis study of samples collected from a realistic scenario after a detonation. A left-behind 5 kg IED, based on ammonium nitrate with a TNT (2,4,6-trinitrotoluene) booster, was detonated in a plastic garbage bin. Aluminum sample plates were mounted vertically on a holder approximately 6 m from the point of detonation. Minutes after the detonation, the samples were analyzed with stand-off imaging Raman spectroscopy from a distance of 10 m. Trace amounts could be detected from the secondary explosive (ammonium nitrate with an analysis time of 1 min. Measurement results also indicated detection of residues from the booster (TNT). The sample plates were subsequently swabbed and analyzed with HPLC and GC-MS analyses to confirm the results from the stand-off imaging Raman system. The presented findings indicate that it is possible to determine the type of explosive used in an IED from a distance, within minutes after the attack, and without tampering with physical evidence at the crime scene.

  1. Impaired epithelial differentiation of induced pluripotent stem cells from ectodermal dysplasia-related patients is rescued by the small compound APR-246/PRIMA-1MET.

    Science.gov (United States)

    Shalom-Feuerstein, Ruby; Serror, Laura; Aberdam, Edith; Müller, Franz-Josef; van Bokhoven, Hans; Wiman, Klas G; Zhou, Huiqing; Aberdam, Daniel; Petit, Isabelle

    2013-02-01

    Ectodermal dysplasia is a group of congenital syndromes affecting a variety of ectodermal derivatives. Among them, ectrodactyly, ectodermal dysplasia, and cleft lip/palate (EEC) syndrome is caused by single point mutations in the p63 gene, which controls epidermal development and homeostasis. Phenotypic defects of the EEC syndrome include skin defects and limbal stem-cell deficiency. In this study, we designed a unique cellular model that recapitulated major embryonic defects related to EEC. Fibroblasts from healthy donors and EEC patients carrying two different point mutations in the DNA binding domain of p63 were reprogrammed into induced pluripotent stem cell (iPSC) lines. EEC-iPSC from both patients showed early ectodermal commitment into K18(+) cells but failed to further differentiate into K14(+) cells (epidermis/limbus) or K3/K12(+) cells (corneal epithelium). APR-246 (PRIMA-1(MET)), a small compound that restores functionality of mutant p53 in human tumor cells, could revert corneal epithelial lineage commitment and reinstate a normal p63-related signaling pathway. This study illustrates the relevance of iPSC for p63 related disorders and paves the way for future therapy of EEC. PMID:23355677

  2. Fluorescent Detection of 2,4-DNT and 2,4,6-TNT in Aqueous Media by Using Simple Water-Soluble Pyrene Derivatives.

    Science.gov (United States)

    Kovalev, Igor S; Taniya, Olga S; Slovesnova, Nataliya V; Kim, Grigory A; Santra, Sougata; Zyryanov, Grigory V; Kopchuk, Dmitry S; Majee, Adinath; Charushin, Valery N; Chupakhin, Oleg N

    2016-03-01

    Pyrene-containing water-soluble probes for the fluorescent detection of nitroaromatic compounds (NACs), such as explosive components (2,4-DNT and 2,4,6-TNT) and herbicides (2,4-dinitrocresol, 2,4-DNOC), in aqueous media are reported. In the probes, the introduction of surface-active hydrophilic "heads" at the periphery of lipophilic (i.e., hydrophobic) pyrene "tails" resulted in the formation of highly fluorescent micelle-like aggregates/pre-associates in aqueous solutions at concentrations of ≤10(-5)  m. The enhanced fluorescence quenching of the herein reported architectures is achieved in the presence of ultra-trace amounts of TNT or 2,4-DNT with values of Stern-Volmer quenching constant close to 1×10(5)  m(-1) and a detection limit as low as 182 ppb. The most hydrophilic probes demonstrated higher response to 2,4-DNT over TNT. Filter paper test strips impregnated with 1×10(-5)  m solutions of the probes were able to detect TNT, 2,4-DNT, and other NACs at levels as low as 50 ppb in water. PMID:26757403

  3. Bis[1,3-bis(2,4,6-trimethylphenyl-2,3-dihydro-1H-imidazol-2-ylidene]dichloridodinitrosyltungsten(II tetrahydrofuran-d8 monosolvate

    Directory of Open Access Journals (Sweden)

    Heinz Berke

    2011-01-01

    Full Text Available The molecular structure of the title compound, [WCl2(NO2(C21H24N22]·C4D8O, displays a distorted octahedral arrangement around the W atom with two trans 1,3-bis(2,4,6-trimethylphenylimidazol-2-ylidene (IMes carbene ligands in axial positions. The four equatorial positions are occupied by nitrosyl and chloride ligands, which are trans to each other. The Ccarbene—W—Ccarbene bond angle of 173.44 (18° and the Cl—W—Nnitrosyl bond angles of 171.34 (11 and 171.32 (13° deviate only slightly from linearity. The distortion comes from the nitrosyl and chloride ligands which are not fully coplanar since the two N atoms deviate from the WCl2 plane by −0.279 (4 and 0.272 (4 Å, respectively. An intermolecular C—H...O interaction connects the organometallic molecule and the tetrahydrofuran-d8 solvent molecule.

  4. Tracing the Cycling and Fate of the Explosive 2,4,6-Trinitrotoluene in Coastal Marine Systems with a Stable Isotopic Tracer, (15)N-[TNT].

    Science.gov (United States)

    Smith, Richard W; Vlahos, Penny; Böhlke, J K; Ariyarathna, Thivanka; Ballentine, Mark; Cooper, Christopher; Fallis, Stephen; Groshens, Thomas J; Tobias, Craig

    2015-10-20

    2,4,6-Trinitrotoluene (TNT) has been used as a military explosive for over a hundred years. Contamination concerns have arisen as a result of manufacturing and use on a large scale; however, despite decades of work addressing TNT contamination in the environment, its fate in marine ecosystems is not fully resolved. Here we examine the cycling and fate of TNT in the coastal marine systems by spiking a marine mesocosm containing seawater, sediments, and macrobiota with isotopically labeled TNT ((15)N-[TNT]), simultaneously monitoring removal, transformation, mineralization, sorption, and biological uptake over a period of 16 days. TNT degradation was rapid, and we observed accumulation of reduced transformation products dissolved in the water column and in pore waters, sorbed to sediments and suspended particulate matter (SPM), and in the tissues of macrobiota. Bulk δ(15)N analysis of sediments, SPM, and tissues revealed large quantities of (15)N beyond that accounted for in identifiable derivatives. TNT-derived N was also found in the dissolved inorganic N (DIN) pool. Using multivariate statistical analysis and a (15)N mass balance approach, we identify the major transformation pathways of TNT, including the deamination of reduced TNT derivatives, potentially promoted by sorption to SPM and oxic surface sediments. PMID:26375037

  5. Quasi-monoenergetic neutron energy spectra for 246 and 389 MeV (7)Li(p,n) reactions at angles from 0 degrees to 300 degrees

    CERN Document Server

    Iwamoto, Y; Nakamura, T; Nakashima, H; Mares, V; Itoga, T; Matsumoto, T; Nakane, Y; Feldbaumer, E; Jaegerhofer, L; Pioch, C; Tamii, A; Satoh, D; Masuda, A; Sato, T; Iwase, H; Yashima, H; Nishiyama, J; Hagiwara, M; Hatanaka, K; Sakamoto, Y

    2011-01-01

    The authors measured the neutron energy spectra of a quasi-monoenergetic (7)Li(p,n) neutron source with 246 and 389 MeV protons set at seven angles (0 degrees, 2.5 degrees, 5 degrees, 10 degrees, 15 degrees, 20 degrees and 30 degrees), using a time-of-flight (TOF) method employing organic scintillators NE213 at the Research Center for Nuclear Physics (RCNP) of Osaka University. The energy spectra of the source neutrons were precisely deduced down to 2 MeV at 0 degrees and 10 MeV at other angles. The cross-sections of the peak neutron production reaction at 0 degrees were on the 35-40 mb line of other experimental data, and the peak neutron angular distribution agreed well with the Taddeucci formula. Neutron energy spectra below 100 MeV at all angles were comparable, but the shapes of the continuum above 150 MeV changed considerably with the angle. In order to consider the correction required to derive the response in the peak region from the measured total response for high-energy neutron monitors such as DAR...

  6. Degradation pathway, toxicity and kinetics of 2,4,6-trichlorophenol with different co-substrate by aerobic granules in SBR.

    Science.gov (United States)

    Khan, Mohammad Zain; Mondal, Pijush Kanti; Sabir, Suhail; Tare, Vinod

    2011-07-01

    The present study deals with cultivation of 2,4,6-trichlorophenol (TCP) degrading aerobic granules in two SBR systems based on glucose and acetate as co-substrate. Biodegradation of TCP containing wastewater starting from 10 to 360 mg L(-1) with more than 90% efficiency was achieved. Sludge volume index decreases as the operation proceeds to stabilize at 35 and 30 mL g(-1) while MLVSS increases from 4 to 6.5 and 6.2 g L(-1) for R1 (with glucose as co-substrate) and R2 (with sodium acetate as co-substrate), respectively. FTIR, GC and GC/MS spectral studies shows that the biodegradation occurred via chlorocatechol pathway and the cleavage may be at ortho-position. Haldane model for inhibitory substrate was applied to the system and it was observed that glucose fed granules have a high specific degradation rate and efficiency than acetate fed granules. Genotoxicity studies shows that effluent coming from SBRs was non-toxic. PMID:21565491

  7. Utility of four strains of white-rot fungi for the detoxification of 2,4,6-trinitrotoluene in liquid culture

    Energy Technology Data Exchange (ETDEWEB)

    Donnelly, K.C.; Chen, J.C.; Huebner, H.J.; Brown, K.W.; Autenrieth, R.L.; Bonner, J.S. [Texas A and M Univ., College Station, TX (United States)

    1997-06-01

    The purpose of this study was to investigate the potential of four different strains of white-rot fungi (Phanerochaete chrysosporium, Phanerochaete sordida, Phlebia brevispora, and Cyathus stercoreus) to degrade 2,4,6-trinitrotoluene (TNT) in liquid medium. Loss of TNT from the culture medium was determined using high-performance liquid chromatography (HPLC), while the mutagenicity of the medium residues were evaluated using the Salmonella/microsome bioassay. The data indicate that within 21 d of incubation, all fungi were able to reduce the TNT concentration in the liquid medium to below detection limits. In this study, P. sordida showed a relatively high growth rate and the fastest rate of TNT degradation. The fungal treatment also produced a significant reduction of TNT mutagenicity. Treatment with C. stercoreus, P. brevispora, P. sordida, and P. chrysosporium resulted in the elimination of 94%, 90%, 87%, and 67% of the initial TNT-amended medium mutagenicity, respectively. The data also demonstrate that during incubation, TNT was eliminated from the culture medium two to eight times faster than the reduction in mutagenic potential. These results suggest that TNT disappearance alone cannot be used as the sole criterion in TNT remediation. Chemical analysis revealed that the major metabolites in the initial transformation of TNT were the monoamino-dinitrotoluenes, which were also degraded by the selected white-rot fungi. The study demonstrated that the white-rot fungi are capable of metabolizing and detoxifying TNT under aerobic conditions in nonligninolytic liquid medium.

  8. Fabrication of an SPR Sensor Surface with Antifouling Properties for Highly Sensitive Detection of 2,4,6-Trinitrotoluene Using Surface-Initiated Atom Transfer Polymerization

    Directory of Open Access Journals (Sweden)

    Kiyoshi Toko

    2013-07-01

    Full Text Available In this study, we modified a surface plasmon resonance immunosensor chip with a polymer using surface-initiated atom transfer polymerization (SI-ATRP for the highly sensitive detection of 2,4,6-trinitrotoluene (TNT. To immobilize a TNT analogue on the polymer, mono-2-(methacryloyloxyethylsuccinate (MES, which has a carboxyl group, was used in this study. However, the anti-TNT antibody may adsorb non-specifically on the polymer surface by an electrostatic interaction because MES is negatively charged. Therefore, a mixed monomer with MES and diethylaminoethylmethacrylate (DEAEM, which has a tertiary amino group and is positively charged, was prepared to obtain electroneutrality for suppressing the nonspecific adsorption. The detection of TNT was performed by inhibition assay using the polymer surface. To ensure high sensitivity to TNT, the affinity between the surface and the antibody was optimized by controlling the density of the initiator for ATRP by mixing two types of self-assembled monolayer reagents. As a result, a limit of detection of 5.7 pg/mL (ppt for TNT was achieved using the optimized surface.

  9. Chandra Observation of 3C288 - Reheating the Cool Core of a 3 keV Cluster from a Nuclear Outburst at z = 0.246

    CERN Document Server

    Lal, D V; Forman, W R; Hardcastle, M J; Jones, C; Nulsen, P E J; Evans, D A; Croston, J H; Lee, J C

    2010-01-01

    We present results from a 42 ks Chandra/ACIS-S observation of the transitional FRI/FRII radio galaxy 3C288 at z = 0.246. We detect $\\sim$3 keV gas extending to a radius of $\\sim$0.5 Mpc with a 0.5-2.0 keV luminosity of 6.6 $\\times$ 10$^{43}$ ergs s$^{-1}$, implying that 3C288 lies at the center of a poor cluster. We find multiple surface brightness discontinuities in the gas indicative of either a shock driven by the inflation of the radio lobes or a recent merger event. The temperature across the discontinuities is roughly constant with no signature of a cool core, thus disfavoring either the merger cold-front or sloshing scenarios. We argue therefore that the discontinuities are shocks due to the supersonic inflation of the radio lobes. If they are shocks, the energy of the outburst is $\\sim$10^{60} ergs, or roughly 30% of the thermal energy of the gas within the radius of the shock, assuming that the shocks are part of a front produced by a single outburst. The cooling time of the gas is $\\sim$10^8 yrs, so...

  10. Liquid chromatographic enantioseparation of the brominated flame retardant 2,3-dibromopropyl-2,4,6-tribromophenyl ether (DPTE) and enantiomer fractions in seal blubber.

    Science.gov (United States)

    Vetter, Walter; Recke, Roland von der; Ostrowicz, Patrizia; Rosenfelder, Natalie

    2010-01-01

    Enantioselective analyses of the chiral brominated flame retardant 2,3-dibromopropyl-2,4,6-tribromophenyl ether (DPTE) are the focus of this work. High performance liquid chromatography (HPLC) equipped with a column that had a chiral stationary phase consisting of a modified cellulose derivative allowed for the fractionation of the enantiomers of DPTE. The enantiomeric excess was 98.2% for enantiomer 1 and 99% for enantiomer 2. Polarimetric measurements verified that the first eluting enantiomer originated from (-)-DPTE and the second peak originated from (+)-DPTE. Two gas chromatographic columns allowed for the direct enantioresolution of DPTE. The elution order of DPTE enantiomers was the same as observed in the chiral HPLC system ((-)-DPTE before (+)-DPTE). The best enantioseparation was achieved on a Chirasil-DEX CB column, which was used to analyze the enantiomer fractions of DPTE in blubber and brain samples of hooded seals (Cystophora cristata) and harp seals (Phoca groenlandica) from the Barents and Greenland Seas. Analyses were carried out by means of gas chromatography/electron capture negative ion mass spectrometry operated in the selected ion monitoring (GC/ECNI-MS-SIM) mode. In both matrices, only minute deviations from the racemate were observed (maximum +/-3% excess of (-)-DPTE). However, the samples from the Barents Sea were either racemic or showed a slight excess of (+)-DPTE (up to 2.5%), whereas all samples from the Greenland Sea contained a slight excess (up to 4%) of (-)-DPTE. PMID:19863996

  11. Evaluation of tissue and cellular biomarkers to assess 2,4,6-trinitrotoluene (TNT) exposure in earthworms: effects-based assessment in laboratory studies using Eisenia andrei.

    Science.gov (United States)

    Robidoux, Pierre Yves; Svendsen, Claus; Sarrazin, Manon; Hawari, Jalal; Thiboutot, Sonia; Ampleman, Guy; Weeks, Jason M; Sunahara, Geoffrey I

    2002-01-01

    The lysosomal neutral red retention time (NRRT) assay, a biomarker for lysosomal membrane stability, and the total immune activity (TIA) assay, a measure of non-specific immune system activity, were used in laboratory studies to assess the toxic effects of 2,4,6-trinitrotoluene (TNT) on earthworms (Eisenia andrei) in vivo. The results were compared with the concentration of TNT and its metabolites in earthworm tissue, as well as standard sublethal toxicity endpoints including growth (i.e. weight change) and reproduction effects from previously published studies. Filter paper experiments indicated a significant decrease in NRRT at >or=1.8 micro g TNT cm(-2), whereas sublethal (weight loss) and lethal effects to earthworms were detected at >or=3.5 and 7.1 micro g TNT cm(-2), respectively. Experiments in artificial soil showed that NRRT effects could be detected at lower TNT concentrations (>or=55 mg TNT kg(-1) soil dry weight) compared with other sublethal endpoints (effects on growth and reproduction). The TIA biomarker did not significantly respond to TNT. Copper (as CuSO4, filter paper contact tests) and 2-chloroacetamide (soil tests), which were used as reference toxicants, also decreased the NRRT. The use of the NRRT assay linked with tissue concentrations of TNT metabolites in earthworms was identified as a potentially appropriate biomarker approach for TNT exposure assessment under laboratory conditions and a novel tool for effects-based risk assessment. PMID:12171758

  12. Tetrakis(2,4,6-triamino-1,3,5-triazin-1-ium tris(pyridine-2,6-dicarboxylatocalcate(II hexahydrate

    Directory of Open Access Journals (Sweden)

    Hossein Aghabozorg

    2008-08-01

    Full Text Available The title compound, (C3H7N64[Ca(C7H3NO43]·6H2O or (tataH4[Ca(pydc3]·6H2O (where tata is 2,4,6-triamino-1,3,5-triazine and pydcH2 is pyridine-2,6-dicarboxylic acid, was obtained by reaction of Ca(NO32·4H2O with the proton-transfer compound (tataH2(pydc in aqueous solution. The [Ca(pydc3]4− anion has twofold crystallographic symmetry. It is a nine-coordinate CaII complex with a distorted tricapped trigonal-prismatic coordination geometry. The structure also contains four tataH+ cations and six uncoordinated water molecules. There are extensive O—H...O, O—H...N, N—H...O, N—H...N and C—H...O hydrogen bonds in the crystal structure.

  13. Dibromido(2,4,6-tri-2-pyridyl-1,3,5-triazine-κ3N2,N1,N6manganese(II

    Directory of Open Access Journals (Sweden)

    Kwang Ha

    2011-12-01

    Full Text Available The MnII ion in the title complex, [MnBr2(C18H12N6], is five-coordinated in a distorted square-pyramidal geometry by three N atoms of the tridentate 2,4,6-tri-2-pyridyl-1,3,5-triazine (tptz ligand and two bromide anions. In the crystal, the pyridyl rings coordinated to the Mn atom are inclined slightly to their carrier triazine ring [dihedral angles = 8.0 (3 and 7.5 (3°], whereas the uncoordinated pyridyl ring is located approximately parallel to the triazine ring [dihedral angle = 3.7 (3°]. The complexes are stacked in columns along the a axis and linked by intermolecular C—H...Br hydrogen bonds, forming chains. In the column, intermolecular π–π interactions between the six-membered rings are present, the shortest centroid–centroid distance being 3.750 (4 Å.

  14. Facile Synthesis, Characterization, and In Vitro Antimicrobial Screening of a New Series of 2,4,6-Trisubstituted-s-triazine Based Compounds

    Directory of Open Access Journals (Sweden)

    Ravi Bhushan Singh

    2015-01-01

    Full Text Available A series of new 2,4,6-trisubstituted-s-triazine was synthesized, assessed for antimicrobial activity, and characterized by FTIR, 1HNMR, 13CNMR, and elemental analysis. The tested compounds, 4d, 4g, 4h, 4k, and 4n, have shown considerable in vitro antibacterial efficacy with reference to the standard drug ciprofloxacin (MIC 3.125 μgmL−1 against B. subtilis, E. coli, and K. pneumoniae. It was observed that compounds 4d and 4h displayed equipotent antibacterial efficacy against B. subtilis (MIC 3.125 μgmL−1 and S. aureus (MIC 6.25 μgmL−1. The studies demonstrated that the para-fluorophenylpiperazine substituted s-triazine (4n was potent and exhibited broad spectrum antibacterial activity against S. epidermidis, K. pneumoniae, and P. aeruginosa with MIC of 6.25 μgmL−1 and for E. coli, it showed an MIC of 3.125 μgmL−1 equipotent with reference to the standard drug. Among all the compounds under investigation, compound 4g also demonstrated significant antifungal activity (3.125 μgmL−1 against C. albicans.

  15. Preconcentration of ruthenium on activated carbon impregnated with 2,4,6-tri-2-pyridyl-1,3,5-triazine/graphite furnace AAS

    International Nuclear Information System (INIS)

    Ruthenium is adsorbed on activated carbon impregnated with 2,4,6-tri-2-pyridyl-1,3,5-triazine (TPTZ-AC). A simple and rapid determination method for trace amounts of Ru by graphite furnace AAS using direct heating of Ru adsorbed TPTZ-AC was investigated. The proposed method is as follows. A sample solution of 100-1000 cm3 containing Ru is mixed with 50 mg of TPTZ-AC. The pH is then adjusted to 7.0 with phosphate buffer solution, and stirred for 10 min. The Ru adsorbed TPTZ-AC was separated from the sample solution by filtration. The TPTZ-AC on membrane filter is dispersed in 5.0 cm3 water. After shaking, 10 μl of the resulting suspension is injected directly into the graphite furnace. The absorbance is measured at 349.9 nm. The pyrocarbon treated graphite tube was most effective for the measurement of Ru. The calibration curve was liner below 2.5 μg/100 cm3 (aqueous phase). The determination limits (3σ) were 0.08 μg/100 cm3 (aqueous phase). The presence of such as Cu, Ni did not interfere. Interference by Fe could be masked by adding thiourea and 1,10-phenanthroline and ammonium fluoride. The proposed method was applied to the determination of Ru in several water samples. (author)

  16. Spectrophotometric analysis of vitamin E using Cu(I)-Bathocuproine or/and Fe(II)-2,4,6-tris-(2'-pyridyl)-s-triazine complexes

    International Nuclear Information System (INIS)

    Vitamin E (tocopherols and tocotrienols) antioxidants are determined by reducing Cu(II) to Cu(I) or Fe(III) to Fe(II) in presence of vitamin E and subsequent complexation of Cu(I) with bathocuproine and/or Fe(II) with 2,4,6-tris-(2'-pyridyl)-s-triazine (TPTZ). Both the reactions are monitored separately, Cu(I)-bathocuproine at 479 nm where as, Fe(II)-(TPTZ) at 595 nm spectrophotometrically. Linear calibration curves are achieved for both complexes between I to 5mu g ml-1 for vitamin E. The methods were applied for the determination of vitamin E in pharmaceutical preparations and edible oils. Vitamin E, from edible oils, was solvent extracted into n-hexane prior to saponification. Furthermore, a single lined flow was also examined. A larger excess of Cu(II) or Fe =(II) with different concentrations of vitamin E in buffer pH 4 was run on the line and constant amounts of reagent bathocuproine or TPTZ in each case was injected through the injector. The peak height shows a linear relationship for vitamin E between 0.5 to 2.5 mu g ml-1 for both complexes. (author)

  17. Photoluminescence detection of 2,4,6-trinitrotoluene (TNT) binding on diatom frustule biosilica functionalized with an anti-TNT monoclonal antibody fragment.

    Science.gov (United States)

    Zhen, Le; Ford, Nicole; Gale, Debra K; Roesijadi, Guritno; Rorrer, Gregory L

    2016-05-15

    A selective and label-free biosensor for detection of the explosive compound 2,4,6-trinitrotoluene (TNT) in aqueous solution was developed based on the principle of photoluminescence quenching of upon immunocomplex formation with antibody-functionalized diatom frustule biosilica. The diatom frustule is an intricately nanostructured, highly porous biogenic silica material derived from the shells of microscopic algae called diatoms. This material emits strong visible blue photoluminescence (PL) upon UV excitation. PL-active frustule biosilica was isolated from cultured cells of the marine diatom Pinnularia sp. and functionalized with a single chain variable fragment (scFv) derived from an anti-TNT monoclonal antibody. When TNT was bound to the anti-TNT scFv-functionalized diatom frustule biosilica, the PL emission from the biosilica was partially quenched due to the electrophilic nature of the nitro (-NO2) groups on the TNT molecule. The dose-response curve for immunocomplex formation of TNT on the scFv-functionalized diatom frustule biosilica had a half-saturation binding constant of 6.4 ± 2.4·10(-8)M and statistically-significant measured detection limit of 3.5·10(-8)M. The binding and detection were selective for TNT and TNB (trinitrobenzene) but not RDX (hexahydro-1,3,5-trinitro-1,3,5-triazine) or 2,6-DNT (2,6-dinitrotoluene). PMID:26774089

  18. COD, 2,4,6-trichlorophenol (TCP) and toxicity removal from synthetic wastewater in a rotating perforated-tubes biofilm reactor

    International Nuclear Information System (INIS)

    Synthetic wastewater containing different concentrations of 2,4,6-trichlorophenol (TCP) was biologically treated using a novel rotating perforated-tubes biofilm reactor (RTBR) for chemical oxygen demand (COD), TCP and toxicity removal. Performance of the reactor was investigated as function of major operating variables such as the feed TCP and COD concentrations and A/Q (biofilm surface area/feed flow rate) ratio. A Box-Behnken statistical experiment design method was used by considering the feed TCP (0-400 mg L-1), COD (1000-4000 mg L-1) and A/Q ratio (23-163 m2 d m-3) as the independent variables while percent TCP, COD, and toxicity removals were the objective functions. The results were correlated with the quadratic model since this was found to be the most suitable one. Response function coefficients were determined by correlating the experimental data with the response function. Percent TCP, COD and toxicity removals estimated from the response functions were in good agreement with the experimental results. TCP, COD and toxicity removals increased with increasing A/Q ratio and decreasing feed TCP concentrations. Percent toxicity removals were always lower than TCP removals indicating presence or formation of some toxic by products from TCP biodegradation. For the feed TCP of 400 mg L-1, the optimum conditions resulting in maximum COD (99%), TCP (100%) and toxicity (93%) removals were A/Q ratio of nearly 165 m2 d m-3 and feed COD of 2985 mg L-1

  19. 2,4,6-Tribromophenol Interferes with the Thyroid Hormone System by Regulating Thyroid Hormones and the Responsible Genes in Mice

    Science.gov (United States)

    Lee, Dongoh; Ahn, Changhwan; Hong, Eui-Ju; An, Beum-Soo; Hyun, Sang-Hwan; Choi, Kyung-Chul; Jeung, Eui-Bae

    2016-01-01

    2,4,6-Tribromophenol (TBP) is a brominated flame retardant (BFR). Based on its affinity for transthyretin, TBP could compete with endogenous thyroid hormone. In this study, the effects of TBP on the thyroid hormone system were assessed in mice. Briefly, animals were exposed to 40 and 250 mg/kg TBP. Thyroid hormones were also administered with or without TBP. When mice were treated with TBP, deiodinase 1 (Dio1) and thyroid hormone receptor β isoform 2 (Thrβ2) decreased in the pituitary gland. The levels of deiodinase 2 (Dio2) and growth hormone (Gh) mRNA increased in response to 250 mg/kg of TBP, and the relative mRNA level of thyroid stimulating hormone β (Tshβ) increased in the pituitary gland. Dio1 and Thrβ1 expression in the liver were not altered, while Dio1 decreased in response to co-treatment with thyroid hormones. The thyroid gland activity decreased in response to TBP, as did the levels of free triiodothyronine and free thyroxine in serum. Taken together, these findings indicate that TBP can disrupt thyroid hormone homeostasis and the presence of TBP influenced thyroid actions as regulators of gene expression. These data suggest that TBP interferes with thyroid hormone systems PMID:27420076

  20. 2,4,6-tris[dialkyl(diaryl)phosphoryl]-1,3,5-triazines as extractants for transplutonium and rare-earth elements

    International Nuclear Information System (INIS)

    The extraction ability and selectivity of 2,4,6-tris[dialkyl(diaryl)phosphoryl]-1,3,5-triazines with various substituents on the P atoms for trivalent transplutonium (TPE) and rare-earth (REE) elements are studied. The most effective reagent is the toluene-substituted one. The TPE and REE are extracted much more effectively from SCN-HCl solution than from HNO3 solutions. IR spectroscopy using Nd as an example demonstrated that two phosphoryl groups and not the nitrogens form a chelate complex with the elements. The basicity of the reagents is determined. IR spectroscopy can detect the hydrolysis products of the reagents, cyanuric acid, after contact with 0.1 M HNO3 but not after contact with 3 M acid. The reagents exhibit selectivity for the TPE during extraction from HNO3 and especially from SCN solutions. The intergroup separation factor, defines as the ratio of the distribution coefficients of Cm and Ce, reaches ∼10 on extraction from SCN solutions

  1. A New Indirect Spectrofluorimetric Method for Determination of Ascorbic Acid with 2,4,6-Tripyridyl-S-Triazine in Pharmaceutical Samples

    Directory of Open Access Journals (Sweden)

    Lejla Klepo

    2016-01-01

    Full Text Available Ascorbic acid (AA is a water-soluble vitamin which shows no fluorescence. However, in reaction with iron(III, AA is oxidised to dehydroascorbic acid and iron(III is reduced to iron(II which forms a complex with 2,4,6-tripyridyl-S-triazine (TPTZ in buffered medium. The relative fluorescence intensity of the resulting Fe(TPTZ22+ complex can be measured at excitation and emission wavelengths of 393 and 790 nm, respectively. Based on this data, a new indirect spectrofluorimetric method for the determination of AA in pharmaceutical samples was proposed. Influence of the reaction conditions, such as acidity of acetic buffer, concentration of TPTZ and iron(III, reaction time and instrumental parameters were investigated in detail. The linear range was from 5.4 × 10−4 to 5.4 × 10−6 mol·L−1 (R = 0.9971. The LOD was 7.7 × 10−7 mol·L−1 and LOQ was 2.3 × 10−4 mol·L−1. Fourteen pharmaceutical samples containing various amounts of AA were analysed. Influences of potential interfering substances were also examined. Analysis of commercial pharmaceutical formulations showed good correlation with the nominal values given by the manufacturers and with the results obtained by a titration method. The proposed method can be applied in routine quality control in the pharmaceutical industry due to its sensitivity, simplicity, selectivity and low cost.

  2. Performance of a hybrid-loop bioreactor system in biological treatment of 2,4,6-tri-chlorophenol containing synthetic wastewater: Effects of hydraulic residence time

    International Nuclear Information System (INIS)

    A hybrid-loop bioreactor system consisting of a packed column biofilm and an aerated tank bioreactor with effluent recycle was used for biological treatment of 2,4,6-tri-chlorophenol (TCP) containing synthetic wastewater. Effects of hydraulic residence time (HRT) on COD, TCP and toxicity removal performance of the reactor were investigated for the HRT values between 5 and 30 h, while the feed COD (2700 ± 100 mg l-1), TCP (300 ± 10 mg l-1) and the solids retention time (sludge age, SRT, 20 d) were constant. Percent TCP, COD and toxicity removals increased with increasing HRT resulting in more than 90% COD, TCP and toxicity removals at HRT values above 25 h. Biomass concentrations in the packed column and in the aeration tank increased with increasing HRT resulting in low reactor TCP concentrations and therefore high TCP, COD and toxicity removals at high HRT values. Volumetric and specific rates of TCP and COD removals decreased with increasing HRT due to increased biomass and decreased flow rates at high HRT levels. Volumetric and specific removal rates of COD and TCP were maximum at an HRT of 5 h

  3. Prednisolone-appended alpha-cyclodextrin: alleviation of systemic adverse effect of prednisolone after intracolonic administration in 2,4,6-trinitrobenzenesulfonic acid-induced colitis rats.

    Science.gov (United States)

    Yano, H; Hirayama, F; Arima, H; Uekama, K

    2001-12-01

    The titled compound is a cyclodextrin derivative in which prednisolone 21-succinate (PDsuc) is covalently bound to one of the secondary hydroxyl groups of alpha-cyclodextrin (alpha-CyD) via an ester linkage. In this study, the PDsuc-appended alpha-CyD ester conjugate (PDsuc/alpha-CyD conjugate) was intracolonically administered to rats with 2,4,6-trinitrobenzensulfonic acid-induced colitis, and its antiinflammatory and systemic adverse effects were compared with those of prednisolone (PD) alone and the PD/2-hydroxypropyl-beta-CyD complex (PD/HP-beta-CyD complex), which is a noncovalent inclusion complex. Colonic damage score, ratio of distal colon wet weight to body weight, and myeloperoxidase activity were evaluated as measures of the therapeutic effect of PD, whereas the ratio of thymus wet weight to body weight was evaluated as a measure of the side effect of PD. The local antiinflammatory activity increased in the order of PD alone approximately PDsuc/alpha-CyD conjugate keeps the local concentration in the colon at a low but constant level. The results suggest that the PDsuc/alpha-CyD conjugate can alleviate the systemic adverse effect of PD while maintaining the therapeutic activity of PD. This kind of knowledge will be useful in the rational design of steroid prodrugs for the colon-specific drug delivery system. PMID:11745769

  4. Absorption spectroscopic and FTIR studies on EDA complexes between TNT (2,4,6-trinitrotoluene) with amines in DMSO and determination of the vertical electron affinity of TNT

    Science.gov (United States)

    Sharma, S. P.; Lahiri, S. C.

    2008-06-01

    TNT (2,4,6-trinitrotoluene) formed deep red 1:1 CT complexes with chromogenic agents like isopropylamine, ethylenediamine, bis(3-aminopropyl)amine and tetraethylenepentamine in DMSO. The complexes were also observed in solvents like methanol, acetone, etc. when the amines were present in large excess. The isopropylamine, complex showed three absorption peaks (at 378, 532 and 629 nm) whereas higher amines showed four peaks (at 370, 463, 532 and 629 nm). The peak at 463 nm vanished rapidly. The peak of the complexes near 530 nm required about 8-10 min to develop and the complexes were stable for about an hour but the peak slowly shifted towards 500 nm and the complexes were found to be stable for more than 24 h. The evidence of complex formation was obtained from distinct spots in HPTLC plates and from the shifts in frequencies and formation of new peaks in FTIR spectra. The peaks near 460 nm (transient) and 530 nm may be due to Janovsky reaction but could not be established. The extinction coefficients of the complexes were determined directly which enabled the accurate determination of the association constants KDA with TNT and amines in stoichiometric ratios. The results were verified using iterative method. The quantfication of TNT was made using ɛ value of the complex with ethylenediamine. The vertical electron affinity ( EA) of TNT was calculated using the method suggested by Mulliken.

  5. Adsorption isotherms, kinetics, thermodynamics and desorption studies of 2,4,6-trichlorophenol on oil palm empty fruit bunch-based activated carbon

    International Nuclear Information System (INIS)

    The adsorption characteristics of 2,4,6-trichlorophenol (TCP) on activated carbon prepared from oil palm empty fruit bunch (EFB) were evaluated. The effects of TCP initial concentration, agitation time, solution pH and temperature on TCP adsorption were investigated. TCP adsorption uptake was found to increase with increase in initial concentration, agitation time and solution temperature whereas adsorption of TCP was more favourable at acidic pH. The adsorption equilibrium data were best represented by the Freundlich and Redlich-Peterson isotherms. The adsorption kinetics was found to follow the pseudo-second-order kinetic model. The mechanism of the adsorption process was determined from the intraparticle diffusion model. Boyd plot revealed that the adsorption of TCP on the activated carbon was mainly governed by particle diffusion. Thermodynamic parameters such as standard enthalpy (ΔHo), standard entropy (ΔSo), standard free energy (ΔGo) and activation energy were determined. The regeneration efficiency of the spent activated carbon was high, with TCP desorption of 99.6%.

  6. DECHLORINATION OF 2,4,6-TRICHLOROPHENOL BY FREE AND IMMOBILIZED LACCASE FROM TRAMETES VERSICOLOR IN A LAB SCALE BIOREACTOR Arzu ÜNAL, Ahmet ÇABUK, Nazif KOLONKAYA

    Directory of Open Access Journals (Sweden)

    Nazif KOLANKAYA

    2011-08-01

    Full Text Available Detoxification of a chlorinated phenolic compound, 2,4,6- trichlorophenol through treatment with laccase enzyme produced by a white rot fungus, Trametes versicolor was investigated. Enzymaticdechlorination experiments by using free and immobilized laccase have been performed in a lab scale bioreactor. Chlorine ion and dissolved oxygen electrodes mounted to the bioreactor were used continuouslyto detect the profiles of chlorine ions and oxygen consumption, respectively, in reaction medium. The maximum dechlorination activity of laccase for free and immobilized form was determined as 160 μM of substrate concentration at pH 5.0, 25 °C, and 30 min of incubation time. Also, GC/MS analyses of enzymatic degradation products indicated that chlorine removal was a result of degradation of 2,4,6- trichlorophenol by the laccase under the determined optimum conditions.

  7. Research Progress in New Detection Technology of2,4,6-Trichloroanisole in Grape Wine%葡萄酒中2,4,6-三氯苯甲醚(TCA)检测新技术的研究进展

    Institute of Scientific and Technical Information of China (English)

    周立华; 牟德华; 李艳

    2016-01-01

    2,4,6-trichloroanisole (TCA) is a substance harmful to wine sensory quality. It usually comes from wine corks, and possibly comes from grape or wine-making process contamination. Its existence results in bad odor and bad taste in wine. In this paper, the new methods and in-struments for the detection of TCA in wine in recent years were introduced including the extraction technology and detection technology of TCA in wine. And the characteristics, principles and application advantages of these new technologies were elaborated for the purpose of pro-viding useful reference for achieving high-precision, low-detection-limit and high-sensitivity qualitative and quantitative determination of TCA in wine, further monitoring TCA in wine, and ultimately improving wine quality.%2,4,6-三氯苯甲醚(TCA)是危害葡萄酒感官品质的一种物质,通常来自于葡萄酒封装所用的软木塞,也可能来自葡萄原料或酿酒过程中的污染,它的存在使葡萄酒产生不良气味和口感.简介了最近十几年来检测葡萄酒中TCA的新方法和新仪器,包括葡萄酒中TCA的萃取技术和检测技术.并对这些新技术的特点、原理及应用优势进行了阐述.目的是为对葡萄酒中的TCA做到精确、低检出限和高灵敏性的定性及定量测定提供参考,从而对葡萄酒中的TCA进行准确的监测,最终提高葡萄酒的品质.

  8. In Vitro Drug Combination Studies of Letermovir (AIC246, MK-8228) with Approved Anti-Human Cytomegalovirus (HCMV) and Anti-HIV Compounds in Inhibition of HCMV and HIV Replication

    OpenAIRE

    Wildum, Steffen; Zimmermann, Holger; Lischka, Peter

    2015-01-01

    Despite modern prevention and treatment strategies, human cytomegalovirus (HCMV) remains a common opportunistic pathogen associated with serious morbidity and mortality in immunocompromised individuals, such as transplant recipients and AIDS patients. All drugs currently licensed for the treatment of HCMV infection target the viral DNA polymerase and are associated with severe toxicity issues and the emergence of drug resistance. Letermovir (AIC246, MK-8228) is a new anti-HCMV agent in clinic...

  9. Induction by phenobarbital of aniline-p-hydroxylase in mouse liver under the influence of X-irradiation and 2,4,6-triethyleneimino-1,3,5-triazine

    International Nuclear Information System (INIS)

    The phenobarbital-induced activity of aniline-p-hydroxylase in livers of mice was enhanced additionally when the animals were X-irradiated 4-16 hours before the administration of the inducer. The same effect could be demonstrated after repeated irradiation with low doses. 2,4,6-triethyleneimino-1,3,5-triazine (tretamine) inhibited the induction of aniline-p-hydroxylase only when administered in extremely high doses. Lower doses resulted in 'superinduciton'. (orig.)

  10. Synthesis, Crystal Structure and Thermal Stability of a One-dimensional Chain Cobalt Coordination Polymer [ Co( 4,4 '-bipy)( 2,4,6- TMBA)2( CH3CH2OH)2]n

    Institute of Scientific and Technical Information of China (English)

    LI Wei; LI Chang-Hong; YANG Ying-Qun; CHEN Zhi-Min; KUANG Dai-Zhi; ZHANG Chun-Hua; KANG Yun-Fei

    2006-01-01

    A one-dimensional chain cobalt(Ⅱ) coordination polymer with 2,4,6-trimethylbenzoic acid, 4,4'-bipyridine and cobalt perchlorate anhydrous has been synthesized and characterized in the mixture solvent of water and alcohol. Crystal data for this complex: monoclinic, space group C2/c, a = 2.3805(8), b = 1.1464(4), c = 1.5807(5) nm, γ = 128.435(4)°, V= 3.3791(18) nm3,Dc = 1.246 g/cm3, Z = 4, F(000) = 1340, final GooF = 1.009, R = 0.0504 and wR = 0.1287.Structural analysis shows that the cobalt ion is coordinated with two nitrogen atoms of one 4,4'-bipyridine molecule and four oxygen atoms from two 2,4,6-trimethylbenzoic acid molecules and two alcohol molecules, giving a distorted octahedral coordination geometry. The result of TG analysis indicates that the title complex is stable till 200 ℃.

  11. Synthesis and characterization of -phosphorylated thioureas RNHC(S)NHP(O)(OPr)2 (R = 2-MeC6H4, 2,6-Me2C6H3, 2,4,6-Me3C6H2)

    Indian Academy of Sciences (India)

    Damir A Safin; Maria G Babashkina; Michael Bolte; Axel Klein

    2010-05-01

    Reaction of O,O'-diisopropylphosphoric acid isothiocyanate (PrO)2P(O)NCS with 2-methylaniline 2-MeC6H4NH2, 2,6-dimethylaniline 2,6-Me2C6H3NH2 or 2,4,6-trimethylaniline 2,4,6-Me3C6H2NH2 leads to the -phosphorylated thioureas RNHC(S)NHP(O)(OPr)2 (R = 2-MeC6H4-, HLI; 2,6-Me2C6H3-, HLII; 2,4,6-Me3C6H2-, HLIII). The new compounds were investigated by 1H and 31P{1H} NMR spectroscopy, and microanalysis. The molecular structure of the thiourea HLIII was elucidated by single crystal X-ray diffraction analysis. Single crystal X-ray diffraction studies showed HLIII forms both intra- and intermolecular hydrogen bonds, which in turn leads to the formation of polymeric chains. One of the intermolecular hydrogen bonds is of the type N-H$\\cdots$S. Moreover, the formation of intermolecular C-H$\\cdots$ 6 -phenyl interactions was established.

  12. Influence of Halogen Substituents on the Catalytic Oxidation of 2,4,6-Halogenated Phenols by Fe(III-Tetrakis(p-hydroxyphenyl porphyrins and Potassium Monopersulfate

    Directory of Open Access Journals (Sweden)

    Seiya Nagao

    2011-12-01

    Full Text Available The influence of halogen substituents on the catalytic oxidation of 2,4,6-trihalogenated phenols (TrXPs by iron(III-porphyrin/KHSO5 catalytic systems was investigated. Iron(III-5,10,15,20-tetrakis(p-hydroxyphenylporphyrin (FeTHP and its supported variants were employed, where the supported catalysts were synthesized by introducing FeTHP into hydroquinone-derived humic acids via formaldehyde poly-condensation. F (TrFP, Cl (TrCP, Br (TrBP and I (TrIP were examined as halogen substituents for TrXPs. Although the supported catalysts significantly enhanced the degradation and dehalogenation of TrFP and TrCP, the oxidation of TrBP and TrIP was not enhanced, compared to the FeTHP catalytic system. These results indicate that the degree of oxidation of TrXPs is strongly dependent on the types of halogen substituent. The order of dehalogenation levels for halogen substituents in TrXPs was F > Cl > Br > I, consistent with their order of electronegativity. The electronegativity of a halogen substituent affects the nucleophilicity of the carbon to which it is attached. The levels of oxidation products in the reaction mixtures were analyzed by GC/MS after extraction with n-hexane. The most abundant dimer product from TrFP via 2,6-difluoroquinone is consistent with a scenario where TrXP, with a more electronegative halogen substituent, is readily oxidized, while less electronegative halogen substituents are oxidized less readily by iron(III-porphyrin/KHSO5 catalytic systems.

  13. Development of a microwave assisted extraction method for the analysis of 2,4,6-trichloroanisole in cork stoppers by SIDA-SBSE-GC-MS

    International Nuclear Information System (INIS)

    The aim of this research work was focused on the replacement of the time-consuming soaking of cork stoppers which is mainly used as screening method for cork lots in connection with sensory analysis and/or analytical methods to detect releasable 2,4,6-trichloroanisole (TCA) of natural cork stoppers. Releasable TCA from whole cork stoppers was analysed with the application of a microwave assisted extraction method (MAE) in combination with stir bar sorptive extraction (SBSE). The soaking of corks (SOAK) was used as a reference method to optimise MAE parameters. Cork lots of different quality and TCA contamination levels were used to adapt MAE. Pre-tests indicated that an MAE at 40 deg. C for 120 min with 90 min of cooling time are suitable conditions to avoid an over-extraction of TCA of low and medium tainted cork stoppers in comparison to SOAK. These MAE parameters allow the measuring of almost the same amounts of releasable TCA as with the application of the soaking procedure in the relevant range (-1 releasable TCA from one cork) to evaluate the TCA level of cork stoppers. Stable isotope dilution assay (SIDA) was applied to optimise quantification of the released TCA with deuterium-labelled TCA (TCA-d5) using a time-saving GC-MS technique in single ion monitoring (SIM) mode. The developed MAE method allows the measuring of releasable TCA from the whole cork stopper under improved conditions and in connection with a low use of solvent and a higher sample throughput.

  14. Luminescence properties and crystal structure of europium complexes with phenoxyacetic acid and 2,4,6-tri(2-pyridyl)-s-triazine

    International Nuclear Information System (INIS)

    Using anion ligand phenoxyacetic acid (HPOA) and neutral ligand 2,4,6-tri(2-pyridyl)-s-triazine (TPTZ), two complexes Eu2(TPTZ)2(POA)6·6H2O and EuY(TPTZ)2(POA)6·6H2O have been synthesized and one crystal EuY(TPTZ)2(POA)6·2CH3OH has been obtained. These complexes are characterized by elemental analysis, ICP-AES, IR and UV absorption spectroscopy. The luminescence spectra, luminescence lifetimes and emission quantum efficiencies of the complexes have been studied. The results show that the complex EuY(TPTZ)2(POA)6·6H2O exhibits stronger luminescence intensity, longer luminescent lifetime and higher emission quantum efficiency than Eu2(TPTZ)2(POA)6·6H2O. The single-crystal X-ray diffraction of EuY(TPTZ)2(POA)6·2CH3OH reveals that the crystal is heteronuclear and crystallizes in the triclinic space group P-1 with following unit cell parameters a=12.2411(10) Å, b=13.2294(11) Å, c=13.5232(11) Å, α=74.8596(13)°, β=82.9593(16)°, γ=87.1641(14)°, and V=2097.7(3) Å3. Each metal ion coordinates with three nitrogen atoms of one TPTZ and seven oxygen atoms of three POA− ions. And there exist two coordination forms between POA− and metal ions in the crystal. One is chelating bidentate, the other is the single-atom bridge. - Highlights: • One Eu/Y heteronuclear crystal and two complexes with HPOA and TPTZ were prepared. • Each metal ion in the crystal coordinates with three nitrogen and seven oxygen atoms. • The two complexes exhibit strong luminescence emissions. • The heteronuclear complex shows better luminescent properties than the homonuclear one. • The structure of the crystal and the sensitization mechanism are deeply discussed

  15. Effects of sinomenine on the expression of microRNA-155 in 2,4,6-trinitrobenzenesulfonic acid-induced colitis in mice.

    Directory of Open Access Journals (Sweden)

    Qiao Yu

    Full Text Available BACKGROUND: Sinomenine, a pure alkaloid isolated in Chinese medicine from the root of Sinomenium acutum, has been demonstrated to have anti-inflammatory and immunosuppressive effects. MicroRNAs (miRNAs are gradually being recognized as critical mediators of disease pathogenesis via coordinated regulation of molecular effector pathways. METHODOLOGY/FINDINGS: After colitis was induced in mice by instillation of 5% (w/v 2,4,6-trinitrobenzenesulfonic acid (TNBS, sinomenine at a dose of 100 or 200 mg/kg was orally administered once daily for 7 days. We evaluated body weight, survival rate, diarrhea score, histological score and myeloperoxidase (MPO activity. The mRNA and protein expression levels of miR-155, c-Maf, TNF-α and IFN-γ were determined by quantitative RT-PCR and immunohistochemistry, respectively. Sinomenine (100 or 200 mg/kg-treated mice with TNBS-induced colitis were significantly improved in terms of body weight, survival rate, diarrhea score, histological score and MPO activity compared with untreated mice. Both dosages of sinomenine significantly decreased the mRNA and protein expression levels of c-Maf, TNF-α and IFN-γ, which elevated in TNBS-induced colitis. Furthermore, sinomenine at a dose of 200 mg/kg significantly decreased the level of miR-155 expression by 71% (p = 0.025 compared with untreated TNBS-induced colitis in mice. CONCLUSIONS/SIGNIFICANCE: Our study evaluated the effects and potential mechanisms of sinomenine in the anti-inflammatory response via miRNA-155 in mice with TNBS-induced colitis. Our findings suggest that sinomenine has anti-inflammatory effects on TNBS-induced colitis by down-regulating the levels of miR-155 and several related inflammatory cytokines.

  16. Association between Exposure to Benzodiazepines and Related Drugs and Survivorship of Total Hip Replacement in Arthritis: A Population-Based Cohort Study of 246,940 Patients.

    Directory of Open Access Journals (Sweden)

    Dan Beziz

    Full Text Available Total hip replacement (THR is successful in treating hip arthritis. Prosthetic survivorship may depend on the medications taken by the patient; particularly, the role of benzodiazepines and related drugs (Z-drugs with THR revision has been poorly investigated. Our objective was to compare THR short-term survivorship according to level of exposure to benzodiazepine and Z-drugs.All French patients aged 40 years or older, having undergone primary THR from January 1, 2009, through December 31, 2012, for arthritis according to French national health insurance databases were included in the cohort. Outcome of interest was THR revision, including any surgical procedure in which the implant or any component was changed or removed. Follow-up started the day the primary THR was performed. Observations were right-censored on December 31, 2014, if neither revision nor death had yet occurred. Exposure of interest was the cumulative defined daily doses per day (cDDD/day of benzodiazepines and Z-drugs dispensed within 6 months before or after inclusion. We defined four exposure groups; cDDD/d = 0: unexposed; 0.38: high exposure. THR survivorship was assessed according to level of exposure to benzodiazepines and Z-drugs in univariate and multivariate Cox models adjusted for patient, THR and implanting center characteristics.The study cohort comprised 246,940 individuals: mean age at baseline, 69.9 years; women, 57.9%; unexposed: 51.7%; low exposure: 16.7%; medium exposure: 15.9%; and high exposure: 15.7%. During the median 45-month follow-up, 9043 individuals underwent prosthetic revision. Adjusted hazard ratios in low, medium and high exposed groups were 1.18 (95%CI, 1.12-1.26; P<0.001, 1.32 (95%CI, 1.24-1.40; P<0.001 and 1.37 (95%CI, 1.29-1.45; P<0.001, respectively, compared to unexposed.Exposure to benzodiazepines and Z-drugs is associated with an increased risk of THR revision, with a dose-response relationship. Cautious prescribing might be needed as well

  17. Association between Exposure to Benzodiazepines and Related Drugs and Survivorship of Total Hip Replacement in Arthritis: A Population-Based Cohort Study of 246,940 Patients

    Science.gov (United States)

    Beziz, Dan; Colas, Sandrine; Collin, Cédric; Dray-Spira, Rosemary; Zureik, Mahmoud

    2016-01-01

    Background Total hip replacement (THR) is successful in treating hip arthritis. Prosthetic survivorship may depend on the medications taken by the patient; particularly, the role of benzodiazepines and related drugs (Z-drugs) with THR revision has been poorly investigated. Our objective was to compare THR short-term survivorship according to level of exposure to benzodiazepine and Z-drugs. Design, Setting and Participants All French patients aged 40 years or older, having undergone primary THR from January 1, 2009, through December 31, 2012, for arthritis according to French national health insurance databases were included in the cohort. Outcome of interest was THR revision, including any surgical procedure in which the implant or any component was changed or removed. Follow-up started the day the primary THR was performed. Observations were right-censored on December 31, 2014, if neither revision nor death had yet occurred. Exposure of interest was the cumulative defined daily doses per day (cDDD/day) of benzodiazepines and Z-drugs dispensed within 6 months before or after inclusion. We defined four exposure groups; cDDD/d = 0: unexposed; 0.38: high exposure. THR survivorship was assessed according to level of exposure to benzodiazepines and Z-drugs in univariate and multivariate Cox models adjusted for patient, THR and implanting center characteristics. Results The study cohort comprised 246,940 individuals: mean age at baseline, 69.9 years; women, 57.9%; unexposed: 51.7%; low exposure: 16.7%; medium exposure: 15.9%; and high exposure: 15.7%. During the median 45-month follow-up, 9043 individuals underwent prosthetic revision. Adjusted hazard ratios in low, medium and high exposed groups were 1.18 (95%CI, 1.12–1.26; P<0.001), 1.32 (95%CI, 1.24–1.40; P<0.001) and 1.37 (95%CI, 1.29–1.45; P<0.001), respectively, compared to unexposed. Conclusion and Relevance Exposure to benzodiazepines and Z-drugs is associated with an increased risk of THR revision, with a

  18. Luminescence properties and crystal structure of europium complexes with phenoxyacetic acid and 2,4,6-tri(2-pyridyl)-s-triazine

    Energy Technology Data Exchange (ETDEWEB)

    Wang, Ai-Ling; Zhou, Dan; Wei, Xiao-Yan; Wang, Zhong-Xia; Qu, Yan-Rong; Zhang, Hai-Xia; Chen, Ying-Nan; Li, Jing-Jing; Chu, Hai-Bin, E-mail: binghai99@gmail.com; Zhao, Yong-Liang, E-mail: hxzhaoyl@163.com

    2015-04-15

    Using anion ligand phenoxyacetic acid (HPOA) and neutral ligand 2,4,6-tri(2-pyridyl)-s-triazine (TPTZ), two complexes Eu{sub 2}(TPTZ){sub 2}(POA){sub 6}·6H{sub 2}O and EuY(TPTZ){sub 2}(POA){sub 6}·6H{sub 2}O have been synthesized and one crystal EuY(TPTZ){sub 2}(POA){sub 6}·2CH{sub 3}OH has been obtained. These complexes are characterized by elemental analysis, ICP-AES, IR and UV absorption spectroscopy. The luminescence spectra, luminescence lifetimes and emission quantum efficiencies of the complexes have been studied. The results show that the complex EuY(TPTZ){sub 2}(POA){sub 6}·6H{sub 2}O exhibits stronger luminescence intensity, longer luminescent lifetime and higher emission quantum efficiency than Eu{sub 2}(TPTZ){sub 2}(POA){sub 6}·6H{sub 2}O. The single-crystal X-ray diffraction of EuY(TPTZ){sub 2}(POA){sub 6}·2CH{sub 3}OH reveals that the crystal is heteronuclear and crystallizes in the triclinic space group P-1 with following unit cell parameters a=12.2411(10) Å, b=13.2294(11) Å, c=13.5232(11) Å, α=74.8596(13)°, β=82.9593(16)°, γ=87.1641(14)°, and V=2097.7(3) Å{sup 3}. Each metal ion coordinates with three nitrogen atoms of one TPTZ and seven oxygen atoms of three POA{sup −} ions. And there exist two coordination forms between POA{sup −} and metal ions in the crystal. One is chelating bidentate, the other is the single-atom bridge. - Highlights: • One Eu/Y heteronuclear crystal and two complexes with HPOA and TPTZ were prepared. • Each metal ion in the crystal coordinates with three nitrogen and seven oxygen atoms. • The two complexes exhibit strong luminescence emissions. • The heteronuclear complex shows better luminescent properties than the homonuclear one. • The structure of the crystal and the sensitization mechanism are deeply discussed.

  19. Dextran sulfate sodium and 2,4,6-trinitrobenzene sulfonic acid induce lipid peroxidation by the proliferation of intestinal gram-negative bacteria in mice

    Directory of Open Access Journals (Sweden)

    Hyun Yang-Jin

    2010-02-01

    Full Text Available Abstrect Background To understand whether TLR-4-linked NF-kB activation negatively correlates with lipid peroxidation in colitic animal models, we caused colitis by the treatment with dextran sulfate sodium (DSS or 2,4,6-trinitrobenzenesulfonic acid (TNBS to C3H/HeJ (TLR-4-defective and C3H/HeN (wild type mice, investigated inflammatory markers, lipid peroxidation, proinflammatory cytokines and TLR-4-linked NF-κB activation, in colon and intestinal bacterial composition in vivo. Methods Orally administered DSS and intrarectally injected TNBS all caused severe inflammation, manifested by shortened colons in both mice. These agents increased intestinal myeloperoxidase activity and the expression of the proinflammatory cytokines, IL-1β, TNF-α and IL-6, in the colon. Results DSS and TNBS induced the protein expression of TLR-4 and activated transcription factor NF-κB. However, these colitic agents did not express TLR-4 in C3H/HeJ mice. Of proinflammatory cytokines, IL-1β was most potently expressed in C3H/HeN mice. IL-1β potently induced NF-κB activation in CaCo-2 cells, but did not induce TLR-4 expression. DSS and TNBS increased lipid peroxide (malondialdehyde and 4-hydroxy-2-nonenal content in the colon, but reduced glutathione content and superoxide dismutase and catalase activities. These colitic inducers increased the number of Enterobacteriaceae grown in DHL agar plates in both mice, although the number of anaerobes and bifidobacteria grown in GAM and BL agar plates was reduced. E. coli, K. pneumoniae and Proteus mirabilis isolated in DHL agar plates increased lipid peroxidation in liposomes prepared by L-α-phosphatidylcholine, but B. animalis and B. cholerium isolated from BL agar plates inhibited it. Discussion These findings suggest that DSS and TNBS may cause colitis by inducing lipid peroxidation and enterobacterial proliferation, which may deteriorate the colitis by regulating proinflammatory cytokines via TLR-4-linked NF

  20. Volumetric Properties of the Mixture Dimethyl carbonate C3H6O3 + C6H12O3 2,4,6-Trimethyl-1,3,5-trioxane (VMSD1511, LB4517_V)

    Science.gov (United States)

    Cibulka, I.; Fontaine, J.-C.; Sosnkowska-Kehiaian, K.; Kehiaian, H. V.

    This document is part of Subvolume C 'Binary Liquid Systems of Nonelectrolytes III' of Volume 26 'Heats of Mixing, Vapor-Liquid Equilibrium, and Volumetric Properties of Mixtures and Solutions' of Landolt-Börnstein Group IV 'Physical Chemistry'. It contains the Chapter 'Volumetric Properties of the Mixture Dimethyl carbonate C3H6O3 + C6H12O3 2,4,6-Trimethyl-1,3,5-trioxane (VMSD1511, LB4517_V)' providing data from direct measurement of low-pressure thermodynamic speed of sound at variable mole fraction and constant temperature, in the single-phase region(s).

  1. Volumetric Properties of the Mixture Dimethyl carbonate C3H6O3 + C6H12O3 2,4,6-Trimethyl-1,3,5-trioxane (VMSD1212, LB4519_V)

    Science.gov (United States)

    Cibulka, I.; Fontaine, J.-C.; Sosnkowska-Kehiaian, K.; Kehiaian, H. V.

    This document is part of Subvolume C 'Binary Liquid Systems of Nonelectrolytes III' of Volume 26 'Heats of Mixing, Vapor-Liquid Equilibrium, and Volumetric Properties of Mixtures and Solutions' of Landolt-Börnstein Group IV 'Physical Chemistry'. It contains the Chapter 'Volumetric Properties of the Mixture Dimethyl carbonate C3H6O3 + C6H12O3 2,4,6-Trimethyl-1,3,5-trioxane (VMSD1212, LB4519_V)' providing data by calculation of molar excess volume from low-pressure density measurements at variable mole fraction and constant temperature.

  2. Volumetric Properties of the Mixture Dimethyl carbonate C3H6O3 + C6H12O3 2,4,6-Trimethyl-1,3,5-trioxane (VMSD1111, LB4518_V)

    Science.gov (United States)

    Cibulka, I.; Fontaine, J.-C.; Sosnkowska-Kehiaian, K.; Kehiaian, H. V.

    This document is part of Subvolume C 'Binary Liquid Systems of Nonelectrolytes III' of Volume 26 'Heats of Mixing, Vapor-Liquid Equilibrium, and Volumetric Properties of Mixtures and Solutions' of Landolt-Börnstein Group IV 'Physical Chemistry'. It contains the Chapter 'Volumetric Properties of the Mixture Dimethyl carbonate C3H6O3 + C6H12O3 2,4,6-Trimethyl-1,3,5-trioxane (VMSD1111, LB4518_V)' providing data from direct low-pressure measurement of mass density at variable mole fraction and constant temperature, in the single-phase region(s).

  3. Molecular interactions in (2,4,6-trimethyl-1,3,5-trioxane + n-alkyl acetates) at T = (298.15, 303.15, and 308.15) K

    Energy Technology Data Exchange (ETDEWEB)

    Wankhede, N.N. [Department of Chemistry, Dr. Babasaheb Ambedkar Marathwada University, Aurangabad 431004 (India); Wankhede, D.S. [Department of Chemistry, Dr. Babasaheb Ambedkar Marathwada University, Aurangabad 431004 (India); Lande, M.K. [Department of Chemistry, Dr. Babasaheb Ambedkar Marathwada University, Aurangabad 431004 (India); Arbad, B.R. [Department of Chemistry, Dr. Babasaheb Ambedkar Marathwada University, Aurangabad 431004 (India)]. E-mail: nil_w@rediffmail.com

    2006-12-15

    Densities and viscosities of the binary mixtures of 2,4,6-trimethyl-1,3,5-trioxane with methyl acetate, ethyl acetate, and 1-butyl acetate were measured over the entire mole fractions at (298.15, 303.15, and 308.15) K. Using the experimental values of densities {rho} and viscosities {eta}, excess molar volumes V {sup E}, viscosity deviations {delta}{eta} were calculated. The values of excess molar volumes V {sup E} and viscosity deviations {delta}{eta} were fitted to the Redlich-Kister polynomial.

  4. (E-N-[2-(9-Fluorenylidene-3a,5,7-trimethyl-3,3a-dihydro-2H-indol-3-ylidene]-2,4,6-trimethylaniline

    Directory of Open Access Journals (Sweden)

    Norihiro Tokitoh

    2008-02-01

    Full Text Available The title compound, C33H30N2, has an E configuration at the imine double bond. The angle between the least-squares planes of the imine C=N—C group and the benzene ring of the 2,4,6-trimethylphenyl substituent is 85.38 (11°. The crystal structure is sustained mainly by intermolecular π–π interactions (3.510 Å between the two fluorene rings and some C—H...π interactions.

  5. Synthesis of 1,3–bis(2,4,6–trimethylphenyl)–imidazolinium salts : SIMes.HCl, SIMes.HBr, SIMes.HBF4 and SIMes.HPF6.

    OpenAIRE

    sprotocols

    2015-01-01

    Authors: Arnaud Gautier, Federico Cisnetti, Silvia Díez-González & Clémentine Gibard ### Abstract N,N’–bis–(2,4,6–trimethylphenylamino)ethane dihydrobromide is obtained in a single step through the dialkylation of dibromoethane. It serves as a versatile starting material for the synthesis of imidazolium salts: SIMes.HBr, SIMes.HCl, SIMes.HPF6 and SIMes.HBF4. ### Introduction Azolium salts have become indispensable starting materials in N–heterocyclic carbene (NHC) chem...

  6. Synthesis of a new tripodal chemosensor based on 2,4,6-triethyl-1,3,5-trimethylbencene scaffolding bearing thiourea and fluorescein for the chromo-fluorogenic detection of anions

    OpenAIRE

    Moragues Pons, María Esperanza; Santos Figueroa, Luis Enrique; Abalos Aguado, Tatiana; Sancenón Galarza, Félix; Martínez Mañez, Ramón

    2012-01-01

    A tripodal receptor containing thiourea as binding site and fluorescein as signalling subunit has been designed, synthesized and used for the colorimetric detection of basic anions in DMSO solutions. (C) 2012 Elsevier Ltd. All rights reserved. Moragues Pons, ME.; Santos Figueroa, LE.; Abalos Aguado, T.; Sancenón Galarza, F.; Martínez Mañez, R. (2012). Synthesis of a new tripodal chemosensor based on 2,4,6-triethyl-1,3,5-trimethylbencene scaffolding bearing thiourea and fluorescein for the ...

  7. Bis[1,3-bis(2,4,6-trimethylphenyl-2,3-dihydro-1H-imidazol-2-ylidene]dinitrosyl(tetrahydroborato-κ2H,H′tungsten(0

    Directory of Open Access Journals (Sweden)

    Heinz Berke

    2011-01-01

    Full Text Available In the title paramagnetic 19-electron neutral complex, [W(BH4(C21H24N22(NO2], the W(0 atom is coordinated by two 1,3-bis(2,4,6-trimethylphenylimidazol-2-ylidene (IMes carbene ligands, two NO groups and two H atoms of an η2-tetrahydroborate ligand. Depending on the number of coordination sites (n assigned to the BH4− ligand, the coordination geometry of the W atom may either be described as approximately trigonal–bipyramidal (n = 1 or as very distorted octahedral with the bridging H atoms filling two coordination positions (n = 2. In the latter case, the coplanar NO groups and bridging H atoms (r.m.s. deviation = 0.032 Å form one octahedral plane, with mutually trans-oriented carbene ligands. In the crystal, molecules are connected via C—H...O interactions.

  8. Binding of 2'(3')-O-(2,4-6-trinitrophenyl) ADP to soluble alpha beta protomers of Na, K-ATPase modified with fluorescein isothiocyanate. Evidence for two distinct nucleotide sites.

    Science.gov (United States)

    Ward, D G; Cavieres, J D

    1996-05-24

    The overall reaction of well-defined solubilized protomers of Na,K-ATPase (one alpha plus one beta subunit) retains the dual ATP dependence observed with the membrane-bound enzyme, with distinctive ATP effects in the submicromolar and submillimolar ranges (Ward, D. G., and Cavieres, J. D. (1993) Proc. Natl. Acad. Sci. U. S. A. 90, 5332-5336). We have now found that the K+/-phosphatase activity of the alpha beta protomers is still inhibited by 2'(3')-O-(2,4,6-trinitrophenyl)adenosine 5'-diphosphate (TNP-ADP). What is most significant is that the TNP-ADP effect can be observed clearly with protomeric enzyme whose high affinity ATP site has been blocked covalently with fluorescein isothiocyanate. We conclude that nucleotides can bind at two discrete sites in each protomeric unit of Na,K-ATPase. PMID:8647832

  9. Localization of hexahydro-1,3,5-trinitro-1,3,5-triazine (RDX) and 2,4,6-trinitrotoluene (TNT) in poplar and switchgrass plants using phosphor imager autoradiography

    International Nuclear Information System (INIS)

    Phosphor imager autoradiography is a technique for rapid, sensitive analysis of the localization of xenobiotics in plant tissues. Use of this technique is relatively new to research in the field of plant science, and the potential for enhancing visualization and understanding of plant uptake and transport of xenobiotics remains largely untapped. Phosphor imager autoradiography is used to investigate the uptake and translocation of the explosives 1,3,5-trinitro-1,3,5-triazine (RDX) and 2,4,6-trinitrotoluene within Populus deltoides x nigra DN34 (poplar) and Panicum vigratum Alamo (switchgrass). In both plant types, TNT and/or TNT-metabolites remain predominantly in root tissues while RDX and/or RDX-metabolites are readily translocated to leaf tissues. Phosphor imager autoradiography is further investigated for use in semi-quantitative analysis of uptake of TNT by switchgrass. - Phosphor imager autoradiography allows for rapid localization and quantification of RDX, TNT, and/or metabolites in plant tissues.

  10. Group separation of transplutonium and rare earth elements by liquid chromatography with free stationary phase using 2,4,6-tris[ditolylphosphoryl] - 1,3,5 - triazine as extractant

    International Nuclear Information System (INIS)

    Methods of group separation of trace amounts of transplutonium elements (TPE) and weight amounts of rare earth elements (REE) in the systems on the basis of bifunctional neutral organophosphoric compounds by the method of liquid chromatography with a free stationary phase have been developed. When solution of 2,4,6 - tris[ditolylphosphoryl] - 1,3,5 - triazine in chloroform was used as stationary phase, REE were the first to be washed out by 0.5 mol/l NH4SCN-1 mol/l HCl solution, then TPE - by 0.025 mol/l of oxyethylidenediphosphonic acid in water. the fractions contained about 100% of one of the groups without impurity of the other. 7 refs.; 6 figs

  11. Quasi-monoenergetic neutron energy spectra for 246 and 389 MeV {sup 7}Li(p,n) reactions at angles from 0{sup o} to 30{sup o}

    Energy Technology Data Exchange (ETDEWEB)

    Iwamoto, Yosuke, E-mail: iwamoto.yosuke@jaea.go.j [Japan Atomic Energy Agency, 2-4 Shirakatashirane, Tokai, Naka, Ibaraki 319-1195 (Japan); Hagiwara, Masayuki [High Energy Accelerator Research Organization (KEK), 1-1 Oho, Tsukuba, Ibaraki 305-0801 (Japan); Satoh, Daiki [Japan Atomic Energy Agency, 2-4 Shirakatashirane, Tokai, Naka, Ibaraki 319-1195 (Japan); Iwase, Hiroshi [High Energy Accelerator Research Organization (KEK), 1-1 Oho, Tsukuba, Ibaraki 305-0801 (Japan); Yashima, Hiroshi [Research Reactor Institute, Kyoto University, 2-1010 Asashiro-nishi, Kumatori-cho, Sennnan-gun, Osaka 590-0494 (Japan); Itoga, Toshiro [RIKEN, 1-1-1 Kouto, Sayo-cho, Sayo-gun, Hyogo 679-5148 (Japan); Sato, Tatsuhiko; Nakane, Yoshihiro; Nakashima, Hiroshi; Sakamoto, Yukio [Japan Atomic Energy Agency, 2-4 Shirakatashirane, Tokai, Naka, Ibaraki 319-1195 (Japan); Matsumoto, Tetsuro; Masuda, Akihiko; Nishiyama, Jun [National Institute of Advanced Industrial Science and Technology, 1-1-1 Higashi, Tsukuba, Ibaraki 305-8561 (Japan); Tamii, Atsushi; Hatanaka, Kichiji [Research Center for Nuclear Physics (RCNP), 10-1 Mihogaoka, Ibaraki, Osaka 567-0047 (Japan); Theis, C.; Feldbaumer, E.; Jaegerhofer, L. [CERN, CH-1211 Geneve 23 (Switzerland); Pioch, C.; Mares, V. [German Research Center for Environmental Health, Institute of Radiation Protection, Ingolstaedter Landstr. 1, 85764 Neuherberg (Germany)

    2011-02-11

    The authors measured the neutron energy spectra of a quasi-monoenergetic {sup 7}Li(p,n) neutron source with 246 and 389 MeV protons set at seven angles (0{sup o}, 2.5{sup o}, 5{sup o}, 10{sup o}, 15{sup o}, 20{sup o} and 30{sup o}), using a time-of-flight (TOF) method employing organic scintillators NE213 at the Research Center for Nuclear Physics (RCNP) of Osaka University. The energy spectra of the source neutrons were precisely deduced down to 2 MeV at 0{sup o} and 10 MeV at other angles. The cross-sections of the peak neutron production reaction at 0{sup o} were on the 35-40 mb line of other experimental data, and the peak neutron angular distribution agreed well with the Taddeucci formula. Neutron energy spectra below 100 MeV at all angles were comparable, but the shapes of the continuum above 150 MeV changed considerably with the angle. In order to consider the correction required to derive the response in the peak region from the measured total response for high-energy neutron monitors such as DARWIN and Wendi-2, the authors showed the subtractions of H*(10) obtained at larger angles (10{sup o}, 15{sup o}, 20{sup o} and 30{sup o}) from the 0{sup o} data in the continuum part for the 246 and 389 MeV {sup 7}Li(p,n) reactions. It was found that subtracting the dose equivalent at about 20{sup o} from the 0{sup o} data almost eliminates the continuum component. This method has potential to eliminate problems associated with continuum correction for high-energy neutron monitors.

  12. Structural and Catalytic Differences between Two FADH2-Dependent Monooxygenases: 2,4,5-TCP 4-Monooxygenase (TftD from Burkholderia cepacia AC1100 and 2,4,6-TCP 4-Monooxygenase (TcpA from Cupriavidus necator JMP134

    Directory of Open Access Journals (Sweden)

    ChulHee Kang

    2012-08-01

    Full Text Available 2,4,5-TCP 4-monooxygenase (TftD and 2,4,6-TCP 4-monooxygenase (TcpA have been discovered in the biodegradation of 2,4,5-trichlorophenol (2,4,5-TCP and 2,4,6-trichlorophenol (2,4,6-TCP. TcpA and TftD belong to the reduced flavin adenine dinucleotide (FADH2-dependent monooxygenases and both use 2,4,6-TCP as a substrate; however, the two enzymes produce different end products. TftD catalyzes a typical monooxygenase reaction, while TcpA catalyzes a typical monooxygenase reaction followed by a hydrolytic dechlorination. We have previously reported the 3D structure of TftD and confirmed the catalytic residue, His289. Here we have determined the crystal structure of TcpA and investigated the apparent differences in specificity and catalysis between these two closely related monooxygenases through structural comparison. Our computational docking results suggest that Ala293 in TcpA (Ile292 in TftD is possibly responsible for the differences in substrate specificity between the two monooxygenases. We have also identified that Arg101 in TcpA could provide inductive effects/charge stabilization during hydrolytic dechlorination. The collective information provides a fundamental understanding of the catalytic reaction mechanism and the parameters for substrate specificity. The information may provide guidance for designing bioremediation strategies for polychlorophenols, a major group of environmental pollutants.

  13. 含不同水溶性基团的三聚氰氯衍生物的合成%Synthesis of 2,4,6-Trichloro-1,3,5-triazine Derivatives with Different Water-Soluble Groups

    Institute of Scientific and Technical Information of China (English)

    刘琳; 田秀枝; 蒋学

    2015-01-01

    The key of producing fuel ethanol with lignocellulose is how to hydrolyze cellulose into fermentable sugars efficiently, but the low yield of fermentable sugar in cellulose hydrolysis is the bottle-neck problem in biomass utilization. A creative idea was proposed that based on the cellulose fabric dyed reactive dyes owns the character of“reactive tendering”, the yield of hydrolysis can be improved by the crystal structural change of cellulose based on chemical modification. 2,4,6-trichloro-1,3,5-triazine derivatives with different water-soluble groups were synthesized successfully through nucleophilic substitution reaction between cyanuric chloride and aminopropionic acid or aminoethanesulfonic acid. These 2,4,6-trichloro-1,3,5-triazine derivatives were used as modifiers and reacted with lignocellulose under chemical modification. The structure of the target products were determined by IR, HPLC/MS and 13C NMR spectrometer.%木质纤维素制备乙醇最关键的步骤是使纤维素水解成可发酵糖,但目前纤维素水解效率很低,是生物质能源化利用的瓶颈。依据活性染料染色纤维素类织物具有“活性脆损”的性质提出一种新思路——以化学改性的方法改变纤维素的结晶结构从而提高其水解效率。采用三聚氰氯与氨基丙酸、氨基乙磺酸中的-NH2发生亲核取代反应,制备含有不同水溶性基团的三聚氰氯衍生物作为木质纤维素化学改性的改性剂。通过红外光谱、高效液相色谱质谱联用、13C NMR谱对其进行结构验证。

  14. Simultaneous determination of three alternative flame retardants (dechlorane plus, 1,2-bis(2,4,6-tribromophenoxy) ethane, and decabromodiphenyl ethane) in soils by gas chromatography-high resolution mass spectrometry.

    Science.gov (United States)

    Xu, Pengjun; Tao, Bu; Ye, Zhiqiang; Qi, Li; Ren, Yue; Zhou, Zhiguang; Li, Nan; Huang, Yeru; Chen, Jiping

    2015-11-01

    A gas chromatography-high resolution mass spectrometry (GC-HRMS) method has been developed for the simultaneous determination of three alternative flame retardants, dechlorane plus (DP), 1,2-bis(2,4,6-tribromophenoxy) ethane (BTBPE), and decabromodiphenyl ethane (DBDPE) in soils. The soil samples were extracted by accelerated solvent extraction, followed by purification with concentrated sulfuric acid partitioning combined with acid-base silica gel column separation. The gas chromatography featured with a thermostable capillary column of short length and a thin stationary phase was operated in pulse injection mode. A double-focusing magnetic sector high resolution mass spectrometer with electron impact ionization was used for quantification of the analytes. The method detection limits were 0.27-0.33 pg for DPs, 0.41 pg for BTBPE, and 36 pg for DBDPE. The mean recoveries for DPs, BTBPE, and DBDPE in spiked soils were 88-107%, 78-97%, and 74-113%, respectively, with relative standard deviations ranging from 5.2% to 18%. The recoveries of (13)C-labeled standards for DPs, BTBPE, and DBDPE in soil samples were 45-110%, 67-118%, and 27-82%, respectively. These results met the acceptable range of labeled standards for analysis of polybrominated diphenyl ethers as specified by the USEPA 1614 method. PMID:26452921

  15. One pot synthesis, molecular structure and spectroscopic studies (X-ray, IR, NMR, UV-Vis) of novel 2-(4,6-dimethoxy-1,3,5-triazin-2-yl) amino acid ester derivatives

    Science.gov (United States)

    El-Faham, Ayman; Soliman, Saied M.; Osman, Sameh M.; Ghabbour, Hazem A.; Siddiqui, Mohammed R. H.; Fun, Hoong-Kun; Albericio, Fernando

    2016-04-01

    Novel series of 2-(4,6-dimethoxy,1,3,5-triazin-2-yl) amino acid ester derivatives were synthesized using simple one pot method in methanol. The products were obtained in high yields and purities as observed from their spectral data, elemental analyses, GC-MS and X-ray crystallographic analysis. The B3LYP/6-311G(d,p) calculated molecular structures are well correlated with the geometrical parameters obtained from the X-ray analyses. The spectroscopic properties such as IR vibrational modes, NMR chemical shifts and UV-Vis electronic transitions were discussed both experimentally and theoretically. The IR vibrational frequencies showed good correlations with the experimental data (R2 = 0.9961-0.9995). The electronic spectra were assigned based on the TD-DFT results. Intense electronic transition band is calculated at 198.1 nm (f = 0.1389), 204.2 nm (f = 0.2053), 205.0 (f = 0.1704) and 205.7 (0.2971) for compounds 6a-i, respectively. The molecular orbital energy levels contributed in the longest wavelength transition band were explained. For all compounds, the experimental wavelengths showed red shifts compared to the calculations due to the solvent effect. The NMR chemical shifts were calculated using GIAO method. The NBO analyses were performed to predict the stabilization energies due to the electron delocalization processes occur in the studied systems.

  16. NCX-1015, a nitric-oxide derivative of prednisolone, enhances regulatory T cells in the lamina propria and protects against 2,4,6-trinitrobenzene sulfonic acid-induced colitis in mice

    Science.gov (United States)

    Fiorucci, Stefano; Antonelli, Elisabetta; Distrutti, Eleonora; Del Soldato, Piero; Flower, Roderick J.; Clark, Mark J. Paul; Morelli, Antonio; Perretti, Mauro; Ignarro, Louis J.

    2002-01-01

    NCX-1015 is a nitric oxide (NO)-releasing derivative of prednisolone. In this study we show NCX-1015 protects mice against the S. A. development and induces healing of T helper cell type 1-mediated experimental colitis induced by intrarectal administration of 2,4,6-trinitrobenzene sulfonic acid (TNBS). The beneficial effect of NCX-1015 was reflected in increased survival rates, improvement of macroscopic and histologic scores, a decrease in the mucosal content of T helper cell type 1 cytokines (protein and mRNA), and diminished myeloperoxidase activity in the colon. In contrast to its NO derivative, only very high doses of prednisolone were effective in reproducing these beneficial effects. NCX-1015 was 10- to 20-fold more potent than the parent compound in inhibiting IFN-γ secretion by lamina propria mononuclear cells. Protection against developing colitis correlated with inhibition of nuclear translocation of p65/Rel A in these cells. In vivo treatment with NCX-1015 potently stimulated IL-10 production, suggesting that the NO steroid induces a regulatory subset of T cells that negatively modulates intestinal inflammation. PMID:12427966

  17. Poly[[(1,10-phenanthroline{μ3-2,2′,2′′-[1,3,5-triazine-2,4,6-triyltris(sulfanediyl]triacetato}cadmium] 0.42-hydrate

    Directory of Open Access Journals (Sweden)

    Chun-Jing Chi

    2011-07-01

    Full Text Available The asymmetric unit of the title complex, {[Cd(C9H7N3O6S3(C12H8N2]·0.42H2O}n, contains a CdII atom, one doubly deprotonated 2,2′,2′′-[1,3,5-triazine-2,4,6-triyltris(sulfanediyl]triacetic acid ligand (HTTTA2−, a 1,10-phenanthroline (phen ligand and a fractionally occupied water molecule [site occupancy = 0.421 (15]. The CdII atom is six-coordinated within a distorted octahedral coordination geometry. Six coordination arises from four O atoms derived from three different HTTTA2− ligands, and two N atoms of the chelating phen molecule. The incompletely deprotonated triazine ligand adopts a μ3-η1:η1:η2 coordination mode, resulting in the formation of chains along the c axis based on Cd2O2 dimeric units. Adjacent chains are stacked through π–π stacking [3.533 (2 Å between phen and triazine rings] and C—H...O interactions, forming supramolecular sheets in the ab plane. Intra-and intermolecular O—H...O hydrogen bonds are also observed.

  18. One pot synthesis, molecular structure and spectroscopic studies (X-ray, IR, NMR, UV-Vis) of novel 2-(4,6-dimethoxy-1,3,5-triazin-2-yl) amino acid ester derivatives.

    Science.gov (United States)

    El-Faham, Ayman; Soliman, Saied M; Osman, Sameh M; Ghabbour, Hazem A; Siddiqui, Mohammed R H; Fun, Hoong-Kun; Albericio, Fernando

    2016-04-15

    Novel series of 2-(4,6-dimethoxy,1,3,5-triazin-2-yl) amino acid ester derivatives were synthesized using simple one pot method in methanol. The products were obtained in high yields and purities as observed from their spectral data, elemental analyses, GC-MS and X-ray crystallographic analysis. The B3LYP/6-311G(d,p) calculated molecular structures are well correlated with the geometrical parameters obtained from the X-ray analyses. The spectroscopic properties such as IR vibrational modes, NMR chemical shifts and UV-Vis electronic transitions were discussed both experimentally and theoretically. The IR vibrational frequencies showed good correlations with the experimental data (R(2)=0.9961-0.9995). The electronic spectra were assigned based on the TD-DFT results. Intense electronic transition band is calculated at 198.1 nm (f=0.1389), 204.2 nm (f=0.2053), 205.0 (f=0.1704) and 205.7 (0.2971) for compounds 6a-i, respectively. The molecular orbital energy levels contributed in the longest wavelength transition band were explained. For all compounds, the experimental wavelengths showed red shifts compared to the calculations due to the solvent effect. The NMR chemical shifts were calculated using GIAO method. The NBO analyses were performed to predict the stabilization energies due to the electron delocalization processes occur in the studied systems. PMID:26845586

  19. The inhibition effect of 2,4,6-tris (2-pyridyl)-1,3,5-triazine on corrosion of tin, indium and tin-indium alloys in hydrochloric acid solution

    International Nuclear Information System (INIS)

    The influence of 2,4,6-tris (2-pyridyl)-1,3,5-triazine (TPTZ) on the corrosion of tin, indium and tin-indium alloys in 0.5 M HCl solution at different temperatures was studied. Potentiodynamic cathodic polarization and extrapolation of cathodic and anodic Tafel lines techniques were used to obtained experimental data. In the case of tin, the percent inhibition efficiency (IE%) increases as both concentration of TPTZ and temperature are increased. The value of activation energy (Ea) is smaller in the presence of TPTZ than that in uninhibited solution, and decreases with increasing the concentration. However, the effect of TPTZ on indium and the investigated alloys exhibited similar behavior; so, the maximum inhibition efficiency is observed at lowest concentration (10-6 M) of TPTZ. Then, the value of inhibition efficiency starts to decrease gradually with increasing TPTZ concentration than that of 10-6 M. But at higher concentration (10-3 M) the corrosion current density (Icorr) is still lower than that in uninhibited solution. SEM photographs support that the higher inhibition efficiency is observed at 10-6 M of TPTZ. The plots of ln K versus 1/T in the presence of the TPTZ in the case of tin, the inhibitor showed linear behavior. The standard enthalpy, ΔHoads., entropy, ΔSoads. and free energy changes of adsorption ΔGoads. were evaluated using Frumkin adsorption isotherm.

  20. Actinide Oxidation State and O/M Ratio in Hypostoichiometric Uranium-Plutonium-Americium U0.750Pu0.246Am0.004O2-x Mixed Oxides.

    Science.gov (United States)

    Vauchy, Romain; Belin, Renaud C; Robisson, Anne-Charlotte; Lebreton, Florent; Aufore, Laurence; Scheinost, Andreas C; Martin, Philippe M

    2016-03-01

    Innovative americium-bearing uranium-plutonium mixed oxides U1-yPuyO2-x are envisioned as nuclear fuel for sodium-cooled fast neutron reactors (SFRs). The oxygen-to-metal (O/M) ratio, directly related to the oxidation state of cations, affects many of the fuel properties. Thus, a thorough knowledge of its variation with the sintering conditions is essential. The aim of this work is to follow the oxidation state of uranium, plutonium, and americium, and so the O/M ratio, in U0.750Pu0.246Am0.004O2-x samples sintered for 4 h at 2023 K in various Ar + 5% H2 + z vpm H2O (z = ∼15, ∼90, and ∼200) gas mixtures. The O/M ratios were determined by gravimetry, XAS, and XRD and evidenced a partial oxidation of the samples at room temperature. Finally, by comparing XANES and EXAFS results to that of a previous study, we demonstrate that the presence of uranium does not influence the interactions between americium and plutonium and that the differences in the O/M ratio between the investigated conditions is controlled by the reduction of plutonium. We also discuss the role of the homogeneity of cation distribution, as determined by EPMA, on the mechanisms involved in the reduction process. PMID:26907589

  1. Ultrafast shock compression and shock-induced decomposition of 1,3,5-triamino-2,4,6-trinitrobenzene subjected to a subnanosecond-duration shock: an analysis of decomposition products.

    Science.gov (United States)

    Carter, Jeffrey A; Zaug, Joseph M; Nelson, A J; Armstrong, Michael R; Manaa, M Riad

    2012-05-24

    Shock compression studies of pressed and confined ultrafine 1,3,5-triamino-2,4,6-trinitrobenzene (TATB) powder were conducted using ultrashort ~300 ps, ~50 GPa shock waves. The recovered decomposition products were characterized using X-ray photoelectron spectroscopy, infrared spectroscopy, and Raman spectroscopy. A substantial amount of shock-related chemistry was observed. Approximately 75% of the nitrogen atoms were liberated as gas-phase species, along with ~33% of the oxygen atoms, as a result of the applied shock. Furthermore, we observe C 1s binding energies suggesting the formation of sp(3) hybridized amorphous carbon. For comparison, a carbon nitride material was also prepared and characterized by thermally pyrolizing TATB. The shock-compressed TATB and the thermally pyrolized TATB are qualitatively different, suggesting that, carbon nitrides, a possible indicator of nitrogen-rich heterocycles precursors, are not a major product class for strongly overdriven shock conditions. These experimental conditions were, however, not detonation conditions, and the possible formation of nitrogen-rich heterocycles in actual detonations still exists. PMID:22554068

  2. One-pot, solvent-free, and efficient synthesis of 2,4,6-triarylpyridines using CoCl2.6H2O as a recyclable catalyst

    Directory of Open Access Journals (Sweden)

    Mahmood Kamali

    2016-12-01

    Full Text Available A one-pot, three components coupling of aryl aldehyde, acetophenone, and ammonium acetate was performed to afford the corresponding 2,4,6-triarylpyridines (TAP1–17. The TAP1–17 were synthesized in the presence of cobalt(II chloride hexahydrate (CoCl2.6H2O via an improved Chichibabin pyridine synthesis protocol. This study has shown that CoCl2.6H2O promotes this reaction in comparison to other transition metal salt such as with FeCl3, NiCl2.6H2O, CuCl2.2H2O, CdCl2.H2O, SbCl3, SnCl2.2H2O, and ZnCl2. This method has several advantages, for example, excellent yields, short reaction times, easy work up, and solvent-free condition. Also, this catalyst was recyclable for four consecutive runs.

  3. Characteristics of energy exchange between inter- and intramolecular degrees of freedom in crystalline 1,3,5-triamino-2,4,6-trinitrobenzene (TATB) with implications for coarse-grained simulations of shock waves in polyatomic molecular crystals

    Science.gov (United States)

    Kroonblawd, Matthew P.; Sewell, Thomas D.; Maillet, Jean-Bernard

    2016-02-01

    In this report, we characterize the kinetics and dynamics of energy exchange between intramolecular and intermolecular degrees of freedom (DoF) in crystalline 1,3,5-triamino-2,4,6-trinitrobenzene (TATB). All-atom molecular dynamics (MD) simulations are used to obtain predictions for relaxation from certain limiting initial distributions of energy between the intra- and intermolecular DoF. The results are used to parameterize a coarse-grained Dissipative Particle Dynamics at constant Energy (DPDE) model for TATB. Each TATB molecule in the DPDE model is represented as an all-atom, rigid-molecule mesoparticle, with explicit external (molecular translational and rotational) DoF and coarse-grained implicit internal (vibrational) DoF. In addition to conserving linear and angular momentum, the DPDE equations of motion conserve the total system energy provided that particles can exchange energy between their external and internal DoF. The internal temperature of a TATB molecule is calculated using an internal equation of state, which we develop here, and the temperatures of the external and internal DoF are coupled using a fluctuation-dissipation relation. The DPDE force expression requires specification of the input parameter σ that determines the rate at which energy is exchanged between external and internal DoF. We adjusted σ based on the predictions for relaxation processes obtained from MD simulations. The parameterized DPDE model was employed in large-scale simulations of shock compression of TATB. We show that the rate of energy exchange governed by σ can significantly influence the transient behavior of the system behind the shock.

  4. Characteristics of energy exchange between inter- and intramolecular degrees of freedom in crystalline 1,3,5-triamino-2,4,6-trinitrobenzene (TATB) with implications for coarse-grained simulations of shock waves in polyatomic molecular crystals

    Energy Technology Data Exchange (ETDEWEB)

    Kroonblawd, Matthew P.; Sewell, Thomas D., E-mail: sewellt@missouri.edu [Department of Chemistry, University of Missouri-Columbia, Columbia, Missouri 65211-7600 (United States); Maillet, Jean-Bernard, E-mail: jean-bernard.maillet@cea.fr [CEA, DAM, DIF, F-91297 Arpajon (France)

    2016-02-14

    In this report, we characterize the kinetics and dynamics of energy exchange between intramolecular and intermolecular degrees of freedom (DoF) in crystalline 1,3,5-triamino-2,4,6-trinitrobenzene (TATB). All-atom molecular dynamics (MD) simulations are used to obtain predictions for relaxation from certain limiting initial distributions of energy between the intra- and intermolecular DoF. The results are used to parameterize a coarse-grained Dissipative Particle Dynamics at constant Energy (DPDE) model for TATB. Each TATB molecule in the DPDE model is represented as an all-atom, rigid-molecule mesoparticle, with explicit external (molecular translational and rotational) DoF and coarse-grained implicit internal (vibrational) DoF. In addition to conserving linear and angular momentum, the DPDE equations of motion conserve the total system energy provided that particles can exchange energy between their external and internal DoF. The internal temperature of a TATB molecule is calculated using an internal equation of state, which we develop here, and the temperatures of the external and internal DoF are coupled using a fluctuation-dissipation relation. The DPDE force expression requires specification of the input parameter σ that determines the rate at which energy is exchanged between external and internal DoF. We adjusted σ based on the predictions for relaxation processes obtained from MD simulations. The parameterized DPDE model was employed in large-scale simulations of shock compression of TATB. We show that the rate of energy exchange governed by σ can significantly influence the transient behavior of the system behind the shock.

  5. Characteristics of energy exchange between inter- and intramolecular degrees of freedom in crystalline 1,3,5-triamino-2,4,6-trinitrobenzene (TATB) with implications for coarse-grained simulations of shock waves in polyatomic molecular crystals.

    Science.gov (United States)

    Kroonblawd, Matthew P; Sewell, Thomas D; Maillet, Jean-Bernard

    2016-02-14

    In this report, we characterize the kinetics and dynamics of energy exchange between intramolecular and intermolecular degrees of freedom (DoF) in crystalline 1,3,5-triamino-2,4,6-trinitrobenzene (TATB). All-atom molecular dynamics (MD) simulations are used to obtain predictions for relaxation from certain limiting initial distributions of energy between the intra- and intermolecular DoF. The results are used to parameterize a coarse-grained Dissipative Particle Dynamics at constant Energy (DPDE) model for TATB. Each TATB molecule in the DPDE model is represented as an all-atom, rigid-molecule mesoparticle, with explicit external (molecular translational and rotational) DoF and coarse-grained implicit internal (vibrational) DoF. In addition to conserving linear and angular momentum, the DPDE equations of motion conserve the total system energy provided that particles can exchange energy between their external and internal DoF. The internal temperature of a TATB molecule is calculated using an internal equation of state, which we develop here, and the temperatures of the external and internal DoF are coupled using a fluctuation-dissipation relation. The DPDE force expression requires specification of the input parameter σ that determines the rate at which energy is exchanged between external and internal DoF. We adjusted σ based on the predictions for relaxation processes obtained from MD simulations. The parameterized DPDE model was employed in large-scale simulations of shock compression of TATB. We show that the rate of energy exchange governed by σ can significantly influence the transient behavior of the system behind the shock. PMID:26874491

  6. Effects of 6-methyl-uracil upon the phagocytic activity in mice following whole-body X-irradiation or 2,4,6,-triethyleneimino-s-triazine treatment

    International Nuclear Information System (INIS)

    1. Phagocytic activity measured by means of the intravasal clearence of a soot dispersion in male NMRI-mice was increased six to ten days after whole-body X-irradiation (640 R) and decreased during the same period after i.v. administration of 2,4,6-triethyleneimino-s-triazine (TEM 2.0 mg/kg). 2. By means of 6-methyl-uracil food admixtures (200 to 400 ppm during 2 or 3 weeks) or by repeated intravenous injections of a N-methyl-D-glucosamine-6-methyluracil complex (62.5 to 250 mg/kg daily during five days), a significant augmentation of the phagocytic index being related to time and dosage was obtained in otherwise untreated mice. Comparable results were seen using cytidine and cytidine-5'-phosphate, whereas guanosine-5'-phosphate remained ineffective. 3. Whilst stimulating effects of 6-methyl-uracil or its N-methyl-D-glucosamine complex on X-irradiated mice were suspended, an increase up to supernormal values of the phagocytic index was produced by the pyrimidine base in animals treated with TEM. In accordance to this the survival rate of lethally X-irradiated mice (960 R) could not be increased; with animals given lethal TEM-doses, however, a significantly increased survival rate was obtained. 4. The present investigations as well as former biochemical analyses confirm the assumption that 6-methyluracil produces its regeneration effects, to some extent at least, by specific pathways influencing the reticuloendothelium. Different results from X-irradiated and TEM-treated mice are referring to the different points of attack of the two noxa. (orig.)

  7. Characteristics of energy exchange between inter- and intramolecular degrees of freedom in crystalline 1,3,5-triamino-2,4,6-trinitrobenzene (TATB) with implications for coarse-grained simulations of shock waves in polyatomic molecular crystals

    International Nuclear Information System (INIS)

    In this report, we characterize the kinetics and dynamics of energy exchange between intramolecular and intermolecular degrees of freedom (DoF) in crystalline 1,3,5-triamino-2,4,6-trinitrobenzene (TATB). All-atom molecular dynamics (MD) simulations are used to obtain predictions for relaxation from certain limiting initial distributions of energy between the intra- and intermolecular DoF. The results are used to parameterize a coarse-grained Dissipative Particle Dynamics at constant Energy (DPDE) model for TATB. Each TATB molecule in the DPDE model is represented as an all-atom, rigid-molecule mesoparticle, with explicit external (molecular translational and rotational) DoF and coarse-grained implicit internal (vibrational) DoF. In addition to conserving linear and angular momentum, the DPDE equations of motion conserve the total system energy provided that particles can exchange energy between their external and internal DoF. The internal temperature of a TATB molecule is calculated using an internal equation of state, which we develop here, and the temperatures of the external and internal DoF are coupled using a fluctuation-dissipation relation. The DPDE force expression requires specification of the input parameter σ that determines the rate at which energy is exchanged between external and internal DoF. We adjusted σ based on the predictions for relaxation processes obtained from MD simulations. The parameterized DPDE model was employed in large-scale simulations of shock compression of TATB. We show that the rate of energy exchange governed by σ can significantly influence the transient behavior of the system behind the shock

  8. 7 CFR 246.3 - Administration.

    Science.gov (United States)

    2010-01-01

    ... part; the Department's regulations governing nondiscrimination (7 CFR parts 15, 15a, and 15b); governing administration of grants (7 CFR part 3016); governing nonprocurement debarment/suspension (7 CFR..., 15a, 15b), the Department's regulations governing the administration of grants (7 CFR part...

  9. 32 CFR 246.4 - Policy.

    Science.gov (United States)

    2010-07-01

    ... with the principles governing the release of information to media in 32 CFR part 375. (b) Editorial.... Government organizations that are required to operate in accordance with the following: (1) 32 CFR part 40... security constraints prescribed by E.O. 12356 (47 FR 14874 and 15557, 3 CFR, 1982 Comp., p. 166)....

  10. 7 CFR 246.26 - Other provisions.

    Science.gov (United States)

    2010-01-01

    ... section. (3) Child abuse and neglect reporting. Staff of the State agency and its local agencies who are required by State law to report known or suspected child abuse or neglect may disclose confidential... abuse or neglect that is not otherwise required by State law; (D) Streamlining administrative...

  11. 7 CFR 246.2 - Definitions.

    Science.gov (United States)

    2010-01-01

    ... Child Nutrition Act of 1966, 42 U.S.C. 1786. WIC-eligible medical foods means certain enteral products... medical foods must serve the purpose of a food, meal or diet (may be nutritionally complete or incomplete... medical foods include many, but not all, products that meet the definition of medical food in Section...

  12. 43 CFR 2.46 - Definitions.

    Science.gov (United States)

    2010-10-01

    ... number, symbol, or other identifying particular assigned to the individual, such as a finger or voice print, or a photograph. (f) System of records. As used in this subpart, “System of records” means...

  13. 32 CFR 246.1 - Purpose.

    Science.gov (United States)

    2010-07-01

    ... Commands consistent with 32 CFR part 372. (b) Supersedes policies and procedures in 32 CFR part 247 about... Forces Information Service (AFIS), designated Unified Commands, and the S&S. (e) Authorizes the...

  14. 32 CFR 246.6 - Procedures.

    Science.gov (United States)

    2010-07-01

    ... Director of the AFIS. The Unified Commands shall forward such requests to the Director of the AFIS, as required. (2) Classified information shall be protected in accordance with 32 CFR parts 159 and 159a. (3... matters. The S&S shall keep the Unified Command and the AFIS informed of all actions. (b)...

  15. 32 CFR 246.3 - Definitions.

    Science.gov (United States)

    2010-07-01

    ... OASD (PA) AFIS member and includes members from the OASD (FM&P) and other DoD offices with the authority and expertise to address various S&S problems. The Director of the AFIS, and the Deputy Assistant.../publisher, the Stars and Stripes editor, the Director of the AFIS, and the Congress on matters of...

  16. 7 CFR 246.14 - Program costs.

    Science.gov (United States)

    2010-01-01

    ... equipment used to determine nutritional risk, including the following: (i) Laboratory fees incurred for up... services and administration costs are: (i) Direct costs. Those direct costs that are allowable under 7 CFR part 3016. (ii) Indirect costs. Those indirect costs that are allowable under 7 CFR part 3016....

  17. 40 CFR 246.100 - Scope.

    Science.gov (United States)

    2010-07-01

    ... Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) SOLID WASTES SOURCE SEPARATION FOR... source separation of residential, commercial, and institutional solid wastes. Explicitly excluded are... separation. Pursuant to section 211 of the Solid Waste Disposal Act, as amended, and Executive Order...

  18. 40 CFR 246.101 - Definitions.

    Science.gov (United States)

    2010-07-01

    ... industrial wastewater effluents, dissolved materials in irrigation return flows or other common water... packing wastes generated at industrial facilities. (h) Construction and demolition waste means the waste... wastepaper industry. (p) Industrial solid waste means the solid waste generated by industrial processes...

  19. 7 CFR 246.4 - State plan.

    Science.gov (United States)

    2010-01-01

    ... Regulations of the Department of Agriculture (Continued) FOOD AND NUTRITION SERVICE, DEPARTMENT OF AGRICULTURE... performed at the local level, including the list of acceptable foods and their maximum monthly quantities as... appeal procedures for local agencies and food vendors. (19) The State agency's plan to reach and...

  20. N-(2,4,6-Trimethylphenylformamide

    Directory of Open Access Journals (Sweden)

    David C. Liles

    2011-01-01

    Full Text Available The title compound, C10H13NO, was obtained as the unexpected, almost exclusive, product in the attempted synthesis of a manganese(I–N-heterocyclic carbene (NHC complex. The dihedral angle between the planes of the formamide moiety and the aryl ring is 68.06 (10°. In the crystal, molecules are linked by N—H...O hydrogen bonds, forming infinite chains along the c axis.

  1. 2,4,6-Trinitrophenyl 3-methylbenzoate

    Directory of Open Access Journals (Sweden)

    Rodolfo Moreno-Fuquen

    2012-07-01

    Full Text Available In the title benzoate derivative, C14H9N3O8, the benzene rings form a dihedral angle of 87.48 (5°. The central ester unit forms an angle of 19.42 (7° with the methylbenzene ring, indicating a significant twist. In the crystal, the molecules are linked by weak C—H...O interactions forming a helical chain along [010].

  2. 7 CFR 246.10 - Supplemental foods.

    Science.gov (United States)

    2010-01-01

    ... WIC food category except for the categories of peanut butter and eggs, and any of the WIC-eligible... vegetables, breakfast cereal, whole wheat bread or other whole grains, juice, legumes and/or peanut butter..., fruits and vegetables, whole wheat bread or other whole grains, eggs, and legumes or peanut butter...

  3. Differential sensitivity of aerobic gram-positive and gram-negative microorganisms to 2,4,6-trinitrotoluene (TNT) leads to dissimilar growth and TNT transformation: Results of soil and pure culture studies

    Energy Technology Data Exchange (ETDEWEB)

    Fuller, M.E.; Manning, J.F. Jr.

    1996-07-30

    The effects of 2,4,6-trinitrotoluene (TNT) on indigenous soil populations and pure bacterial cultures were examined. The number of colony-forming units (CFU) appearing when TNT-contaminated soil was spread on 0.3% molasses plates decreased by 50% when the agar was amended with 67 {mu}g TNT mL{sup -1}, whereas a 99% reduction was observed when uncontaminated soil was plated. Furthermore, TNT-contaminated soil harbored a greater number of organisms able to grow on plates amended with greater than 10 {mu}g TNT mL{sup -1}. The percentage of gram-positive isolates was markedly less in TNT-contaminated soil (7%; 2 of 30) than in uncontaminated soil (61%; 20 of 33). Pseudomonas aeruginosa, Pseudomonas corrugate, Pseudomonasfluorescens and Alcaligenes xylosoxidans made up the majority of the gram-negative isolates from TNT-contaminated soil. Gram-positive isolates from both soils demonstrated marked growth inhibition when greater than 8-16 {mu}g TNT mL{sup -1} was present in the culture media. Most pure cultures of known aerobic gram-negative organisms readily degraded TNT and evidenced net consumption of reduced metabolites. However, pure cultures of aerobic gram-positive bacteria were sensitive to relatively low concentrations of TNT as indicated by the 50% reduction in growth and TNT transformation which was observed at approximately 10 {mu}g TNT mL{sup -1}. Most non-sporeforming gram-positive organisms incubated in molasses media amended with 80 {mu}g TNT mL{sup -1} or greater became unculturable, whereas all strains tested remained culturable when incubated in mineral media amended with 98 {mu}g TNT mL{sup -1}, indicating that TNT sensitivity is likely linked to cell growth. These results indicate that gram-negative organisms are most likely responsible for any TNT transformation in contaminated soil, due to their relative insensitivity to high TNT concentrations and their ability to transform TNT.

  4. Biodegradation of Nitro-Substituted Explosives 2,4,6-Trinitrotoluene, Hexahydro-1,3,5-Trinitro-1,3,5-Triazine, and Octahydro-1,3,5,7-Tetranitro-1,3,5-Tetrazocine by a Phytosymbiotic Methylobacterium sp. Associated with Poplar Tissues (Populus deltoides × nigra DN34)

    OpenAIRE

    Van Aken, Benoit; Yoon, Jong Moon; Schnoor, Jerald L.

    2004-01-01

    A pink-pigmented symbiotic bacterium was isolated from hybrid poplar tissues (Populus deltoides × nigra DN34). The bacterium was identified by 16S and 16S-23S intergenic spacer ribosomal DNA analysis as a Methylobacterium sp. (strain BJ001). The isolated bacterium was able to use methanol as the sole source of carbon and energy, which is a specific attribute of the genus Methylobacterium. The bacterium in pure culture was shown to degrade the toxic explosives 2,4,6-trinitrotoluene (TNT), hexa...

  5. Survival of Escherichia coli O157:H7 in full- and reduced-fat pepperoni after manufacture of sticks, storage of slices at 4 degrees C or 21 degrees C under air and vacuum, and baking of slices on frozen pizza at 135, 191 and 246 degrees C.

    Science.gov (United States)

    Faith, N G; Wierzba, R K; Ihnot, A M; Roering, A M; Lorang, T D; Kaspar, C W; Luchansky, J B

    1998-04-01

    Pepperoni batter was prepared with fat contents of about 15, 20, and 32% (wt/wt) and inoculated with a pediococcal starter culture and > or = 2.0 x 10(7) CFU/g of a five-strain inoculum of Escherichia coli O157:H7. The batter was fermented at 96 degrees F (ca. 36 degrees C and 85% relative humidity (RH) to pH cheese pizzas that were subsequently baked at 275 degrees F (ca. 135 degrees C), 375 degrees F (ca. 191 degrees C), or 475 degrees F (ca. 246 degrees C) for 0 to 20 min. Appreciable differences related to fat levels were observed after drying; pathogen numbers decreased by 1.04, 1.31 and 1.62 log10 units in sticks prepared from batter at initial fat levels of 15, 20, and 32%, respectively. During storage, the temperature rather than the atmosphere had the greater effect on pathogen numbers, with similar viability observed among the three fat levels tested. At 70 degrees F (ca. 21 degrees C), compared to original levels, pathogen numbers decreased by > or = 5.56 and > or = 4.53 log10 units within 14 days in slices stored under air and vacuum, respectively, whereas at 39 degrees F (ca. 4 degrees C) numbers decreased by pizza at 475 degrees F (ca. 246 degrees C) for 10 min or at 375 degrees F (ca. 191 degrees C) for 15 min. The calculated D values for all three temperatures tested increased as the fat content of the batter increased from 15 to 20 to 32%. The present study confirmed that fermentation and drying were sufficient to reduce levels of E. coli O157:H7 in pepperoni sticks by 5.5-log10-unit total reduction of the pathogen. Baking slices on frozen pizza for at least 15 min at 475 degrees F (ca. 246 degrees C) or 20 min at 375 degrees F (ca. 191 degrees C) was necessary to reduce pathogen numbers to below detection by both direct plating and enrichment. PMID:9709198

  6. 1H-MAS-NMR Chemical Shifts in Hydrogen-Bonded Complexes of Chlorophenols (Pentachlorophenol, 2,4,6-Trichlorophenol, 2,6-Dichlorophenol, 3,5-Dichlorophenol, and p-Chlorophenol) and Amine, and H/D Isotope Effects on 1H-MAS-NMR Spectra

    OpenAIRE

    Hisashi Honda

    2013-01-01

    Chemical shifts (CS) of the 1H nucleus in N···H···O type hydrogen bonds (H-bond) were observed in some complexes between chlorophenols [pentachlorophenol (PCP), 2,4,6-tricholorophenol (TCP), 2,6-dichlorophenol (26DCP), 3,5-dichlorophenol (35DCP), and p-chlorophenol (pCP)] and nitrogen-base (N-Base) by solid-state high-resolution 1H-NMR with the magic-angle-spinning (MAS) method. Employing N-Bases with a wide range of pKa values (0.65–10.75), 1H-MAS-NMR CS values of bridging H atoms in H-bonds...

  7. Synthesis and characterization of d2 imido complexes of molybdenum. Crystal structure of [MoCl2{N(mes)}(PhC≡CPh)-(PMe3)2]·0.5PhC≡CPh (mes = 2,4,6-trimethylphenyl)

    OpenAIRE

    Montilla Ramos, Francisco Javier; Galindo del Pozo, Agustín; Carmona Guzmán, Ernesto; Gutiérrez Puebla, Enrique; Monge, Ángeles

    1998-01-01

    The compound [MoCl2{N(mes)}(PMe3)3] 1 (mes = 2,4,6-trimethylphenyl) has been prepared by the reaction of [MoCl3{N(mes)}(dme)] (dme = 1,2-dimethoxyethane) with 2 equivalents of PMe3 and subsequent sodium amalgam reduction, in the presence of 1 additional equivalent of PMe3. Metathesis reactions of 1 with KX gave [MoX2{N(mes)}(PMe3)3] (X = Br 2 or NCS 3), whereas the anionic bidentate PriOCS2– ligand produced the monophosphine compound [Mo{N(mes)}(S2COPri)2(PMe3)] 4. Substitution of two of the ...

  8. Изотермическое сжатие 1,3,5триамино 2,4,6тринитробензола

    OpenAIRE

    БАДРЕТДИНОВА Л.Х.; КОСТИЦЫН О.В.; СМИРНОВ Е.Б.; СТАНКЕВИЧ А.В.; ТЕН К.А.; ТОЛОЧКО Б.П.

    2014-01-01

    В работе предложен метод определения кривой изотермического сжатия на примере энергонасыщенного вещества 1,3,5триамино 2,4,6тринитробензол (ТАТБ).In this work a method for determining the isothermal compression curve on the example of explosives TATB is present.

  9. Photoinactivation of fluorescein isothiocyanate-modified Na,K-ATPase by 2'(3')-O-(2,4,6-trinitrophenyl)8-azidoadenosine 5'-diphosphate. Abolition of E1 and E2 partial reactions by sequential block of high and low affinity nucleotide sites.

    Science.gov (United States)

    Ward, D G; Cavieres, J D

    1998-06-01

    The Na,K-ATPase activity of the sodium pump exhibits apparent multisite kinetics toward ATP, a feature that is inherent to the minimal enzyme unit, the alpha beta protomer. We have argued that this should arise from separate catalytic and noncatalytic sites on the alpha beta protomer as fluorescein isothiocyanate (FITC) blocks a high affinity ATP site on all alpha subunits and yet the modified Na, K-ATPase retains a low affinity response to nucleotides (Ward, D. G., and Cavieres, J. D. (1996) J. Biol. Chem. 271, 12317-12321). We now find that 2'(3')-O-(2,4,6-trinitrophenyl)8-azido-adenosine 5'-diphosphate (TNP-8N3-ADP), a high affinity photoactivatable analogue of ATP, can inhibit the K+-phosphatase activity of the FITC-modified enzyme during assays in dimmed light. The inhibition occurs with a Ki of 140 microM at 20 mM K+; it requires the adenine ring as 2'(3')-O-(2,4 6-trinitrophenyl) (TNP)-UDP or TNP-uridine are less potent and 2,4,6-trinitrobenzene-sulfonate is ineffective. Under irradiation with UV light, TNP-8N3-ADP inactivates the K+-phosphatase activity of the fluorescein-enzyme and also its phosphorylation by [32P]Pi. The photoinactivation process is stimulated by Na+ or Mg2+, and is inhibited by K+ or excess TNP-ADP. In the presence of 50 mM Na+ and 1 mM Mg2+, TNP-8N3-ADP photoinactivates with a K0.5 of 15 microM. Furthermore, TNP-8N3-ADP photoinactivates the FITC-modified, solubilized alpha beta protomers, even more effectively than the membrane-bound fluorescein-enzyme. These results strongly suggest that catalytic and allosteric ATP sites coexist on the alpha beta protomer of Na,K-ATPase. PMID:9603934

  10. Synthesis and Crystal Structure of a Three-dimensional Manganese(Ⅱ)Complex (tataH)2[Mn(pydc)2]·4H2O(tata= 2,4,6-Triamino-1,3,4,-triazine,pydcH2= Pyridine-2,6-dicarboxylic Acid)

    Institute of Scientific and Technical Information of China (English)

    SUN Yi-Feng; LI Ji-Kun; CUI Yi-Ping

    2008-01-01

    A manganese(Ⅱ) complex (tataH)2[Mn(pydc)2]·4H2O (C20H28MnN14O12, Mr = 711.50, tata = 2,4,6-triamino-1,3,5-triazine, pydcH2 = pyridine-2,6-dicarboxylic acid) has been synthesized and its crystal structure was determined by single-crystal X-ray diffraction. The crystal belongs to the triclinic system, space group P1, with a = 9.9847(3), b = 10.9813(3), c = 15.2616(5) (A), α =101.5310(10), β = 90.2610(10), γ = 116.4600(10)°, V = 1459.44(8) A3, Z = 2, Dc = 1.619 g/cm3, μ = 0.539 mm-1, F(000) = 734, the final R = 0.0292 and wR = 0.0745. In the crystal the MnⅡ atom is six-coordinated by four carbonyl oxygen atoms and two pyridine nitrogen atoms from two tridentate H-bonded tetramer. The molecules are packed in a three-dimensional framework structure by the combination of O-H…O,N-H…O and N-H…N hydrogen bonds between (tataH)+,[Mn(pydc)2]2- and crystal water.

  11. 1H-MAS-NMR Chemical Shifts in Hydrogen-Bonded Complexes of Chlorophenols (Pentachlorophenol, 2,4,6-Trichlorophenol, 2,6-Dichlorophenol, 3,5-Dichlorophenol, and p-Chlorophenol and Amine, and H/D Isotope Effects on 1H-MAS-NMR Spectra

    Directory of Open Access Journals (Sweden)

    Hisashi Honda

    2013-04-01

    Full Text Available Chemical shifts (CS of the 1H nucleus in N···H···O type hydrogen bonds (H-bond were observed in some complexes between chlorophenols [pentachlorophenol (PCP, 2,4,6-tricholorophenol (TCP, 2,6-dichlorophenol (26DCP, 3,5-dichlorophenol (35DCP, and p-chlorophenol (pCP] and nitrogen-base (N-Base by solid-state high-resolution 1H-NMR with the magic-angle-spinning (MAS method. Employing N-Bases with a wide range of pKa values (0.65–10.75, 1H-MAS-NMR CS values of bridging H atoms in H-bonds were obtained as a function of the N-Base’s pKa. The result showed that the CS values were increased with increasing pKa values in a range of DpKa 2: The maximum CS values was recorded in the PCP (pKa = 5.26–4-methylpyridine (6.03, TCP (6.59–imidazole (6.99, 26DCP (7.02–2-amino-4-methylpyridine (7.38, 35DCP (8.04–4-dimethylaminopyridine (9.61, and pCP (9.47–4-dimethylaminopyridine (9.61 complexes. The largest CS value of 18.6 ppm was recorded in TCP–imidazole crystals. In addition, H/D isotope effects on 1H-MAS-NMR spectra were observed in PCP–2-amino-3-methylpyridine. Based on the results of CS simulation using a B3LYP/6-311+G** function, it can be explained that a little changes of the N–H length in H-bond contribute to the H/D isotope shift of the 1H-MAS-NMR peaks.

  12. Synthesis, Structure and Magnetic Properties of Two Cobalt(Ⅱ) Dicyanamide (dca) Complexes with Heterocyclic Nitrogen Donors Tetra(2-pyridyl)pyrazine (tppz) and 2,4,6-Tri(2- pyridyl)-1,3,5-triazine (tptz): [Co2(tppz)(dca)4]·CH3CN and [Co(tptz)(dca...

    Institute of Scientific and Technical Information of China (English)

    罗俊; 邱丽娟; 刘宝姝; 张欣荣; 杨峰; 崔黎丽

    2012-01-01

    Two new transition metal dicyanamide complexes [Co2(tppz)(dca)4]·CH3CN (1) [tppz=tetra(2-pyridyl)pyrazine, dca=dicyanamide] and [Co(tptz)(dca)(H20)](dca) (2) [tptz=2,4,6-tri(2-pyridyl)-1,3,5-triazine] were synthesized and characterized by single crystal X-ray diffraction analysis. In 1 each cobalt(Ⅱ) atom is coordinated to three dca anions and one tppz molecule to form a distorted octahedral geometry, the neigbour two cobalt(Ⅱ) atoms are bridged by one tppz ligand to form a dimer, then the cobalt(Ⅱ) atoms in each dimer are joined together to form a ladder chain structure. In 2 the coordination geometry around the central metal is also distorted octahedral, each cobalt(Ⅱ) atom is coordinated by two dca anions, one tptz molecule and one water ligand to form a cationic part, and the cationic part is linked with the free dca anions via the electrostatic attraction to give an infinite chain structure. Magnetic susceptibility measurement in the range of 2-300 K indicates that there are antiferromagnetic couplings between adjacent metal ions in 1 (T〉29 K, θ=-9.78 K, C=4.92 cm^3·K·mo1-1) and ferromagnetic couplings in 2 (T〉 150 K, θ=7.97 K, C=2.59 cm^3·K·mol^-1) respectively.

  13. Enzymic determination of saliva glucose with use of 2,4,6-tribromo-3-hydroxybenzoic acid on biochemical analyzer%以TBHBA为色原的唾液葡萄糖全自动分析法的建立及应用

    Institute of Scientific and Technical Information of China (English)

    刘琳琳; 王华忠; 左世友; 蒲晓允

    2006-01-01

    目的 建立一种灵敏、可靠的唾液葡萄糖全自动分析方法,并评价其在监测血糖浓度中的价值.方法 用2,4,6-三溴-3-羟基苯甲酸(TBHBA)取代葡萄糖氧化酶测定法的苯酚,在HATACHI 7150上测定唾液葡萄糖,并观察糖尿病患者唾液葡萄糖的变化及与血糖浓度之间的相关性.结果 经方法学评价,葡萄糖浓度在60mg/L范围内呈良好的线性关系,精密度检测CV值批内3.3%,批间3.8%,平均回收率100.3%,受干扰物影响较小.糖尿病患者唾液葡萄糖含量高于正常对照组的含量(P<0.05),唾液葡萄糖与血浆葡萄糖相关系数r=0.87(P<0.01).结论 以TBHBA为色原的全自动分析方法可准确地测定唾液葡萄糖,并可对糖尿病患者血糖浓度进行无创性检测.

  14. Molecular formation dynamics of 5-nitro-2,4-dihydro-3H-1,2,4-triazol-3-one, 1,3,5-trinitroperhydro-1,3,5-triazine, and 2,4,6-trinitrotoluene in air, nitrogen, and argon atmospheres studied using femtosecond laser induced breakdown spectroscopy

    International Nuclear Information System (INIS)

    Femtosecond laser induced breakdown spectroscopic (LIBS) studies were performed on three high energy materials namely 5-nitro-2,4-dihydro-3H-1,2,4-triazol-3-one (NTO), 1,3,5-trinitroperhydro-1,3,5-triazine (RDX), and 2,4,6-trinitrotoluene (TNT). LIBS spectral features were obtained for these samples in three different atmospheres i.e. air, nitrogen, and argon. Different molecular to elemental ratios in these three atmospheres were investigated in detail. CN/C and CN/N ratios were observed to be prominent in nitrogen and air atmospheres. We attempt to elucidate the role of several reactions involving CN molecular formation in connection with discrepancies obtained in the measured ratios. The complete temporal dynamics of atomic C (247.82 nm) and CN (388.20 nm) molecular species in three different atmospheres are elaborated. The decay rates of C peak were found to be longest (96 ns–121 ns) in argon atmosphere for all the samples. The decay rates of CN peak (388.2 nm) were longer (161 ns–364 ns) in nitrogen compared to air and argon atmospheres. We also attempt to explicate the decay mechanisms with respect to the molecular species formation dynamics in different atmospheres. - Highlights: • LIBS studies of NTO, RDX, and TNT in nitrogen, air, and argon were performed using fs pulses. • Decay constants of C, CN in three atmospheres were recorded systematically. • Different molecular to elemental ratios were investigated in detail. • CN/C and CN/N ratios were observed to be prominent in nitrogen and air atmospheres

  15. Use of trioctylphosphine oxide for transplutonium element extraction and purification

    International Nuclear Information System (INIS)

    Investigated was extraction of tri-valent curium, berkelium, californium, einsteinium as well as cerium and europium with trioctylphosphin oxide from lactic acid solutions, containing DTPA and aluminium nitrate depending on the aluminium nitrate and TOPO concentrations and nitric acid solutions of variable concentration as well. Under optimum conditions of extraction chromatography of berkelium studied was the distribution of cobalt, nickel, chromium, iron, aluminium, titanium, zirconium and niobium ions, and the coefficients of berkelium purification from cations investigated were determined. The effect of weight quantities of cation impurities on extraction chromatographic yield of berkelium has been investigated. Examples of practice application of the extraction chromatography with the use of TOPO are given

  16. Cycloaddition Reactions of the Diphosphenyl Complex (η5-C5Me5)(CO)2Fe-P=P-Mes* (Mes* = 2,4,6-tBu3C6H2) with Hexafluoroacetone. X-Ray Structure Analyses of (η5-C5Me5)(CO) Fe P(=PMes*)OC(CF3)2CO and (η5-C5Me5)(CO)2FePP(Mes*)OC(CF3)2

    OpenAIRE

    Weber, Lothar; Buchwald, Susanne; Lentz, Dieter; Preugschat, Dagmar; Stammler, Hans-Georg; Neumann, Beate

    1992-01-01

    The diphosphenyl complex (eta-5-C5Me5)-(CO)2Fe-P=P-Mes* (Mes* = 2,4,6-tBu3C6H2) undergoes a [3 + 2] dipolar cycloaddition with hexafluoroacetone to give the metalla heterocycle (eta-5-C5Me5)(CO)-Fe-P(=PMes*)OC(CF3)2C(O) with a remarkably short Fe-P bond (2.084 (4) angstrom) and an exocyclic P=P bond. When stored in solution at -40-degrees-C, this complex partly rearranges to the metalated 1-oxa-2,3-diphosphetane (eta-5-C5Me5)(CO)2Fe-P-P(Mes*)OC(CF3)2. The molecular structures of both isomers ...

  17. The Reactivity of 2,4,6-Tirphenylpyridinium Ylids

    Institute of Scientific and Technical Information of China (English)

    2003-01-01

    Triphenylpyridinium ylid 2, generated by the decarboxylation of betaine 1, were noted to react with acetyl chloride, chloroform or acetone to form addition-elimination product and proton extraction - carbanion addition products, respectively. The reaction with chloroform was determined as pseudo first order from kinetic experiments. The values of kobsd and t1/2 for decarboxylation at 20, 40 and 50°C were calculated to be 4.6 x 10-4, 8.8 x 10-3, 2.8 x 10-2 min-1 and 1.5 x 103, 78, 24 minutes, respectively.

  18. 7 CFR 246.16a - Infant formula cost containment.

    Science.gov (United States)

    2010-01-01

    ... with home delivery or direct distribution food delivery systems; (2) Indian State agencies with 1,000... person, company, corporation, or other legal entity that submits a bid in response to a bid solicitation... advertising to contacting in writing each infant formula manufacturer which has registered with the...

  19. Dicty_cDB: SSJ246 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ifihf*kkkkkkkkkkkkkkkk Translated Amino Acid sequence (All Frames) Frame A: kl*nviqiitinhkc*lnpkesnffnfsrkhtik**cstlrccstccnsrfid...nfsrkhtik**cstlrccstccnsrfidccrccsy lnlqriln*liihilipweifenlivylinn*LYLLIFKKKKKKK...AAAAAAAAAAAAAAAAAAAAAAAA sequence update 1998.12.21 Translated Amino Acid sequence kl*nviqiitinhkc*lnpkesnff

  20. Bis(2,4,6-trimethylanilinium sulfate monohydrate

    Directory of Open Access Journals (Sweden)

    Tao Rong

    2011-10-01

    Full Text Available In the crystal structure of the title compound, 2C9H14N+·SO42−·H2O, the components are linked by intermolecular N—H...O and O—H...O hydrogen bonds. N—H...S and O—H...S interactions also occur.

  1. PHYTOREMEDIATION OF 2,4,6-TRINITROTOLUENE: PROTEOMIC INSIGHT

    Czech Academy of Sciences Publication Activity Database

    Fialová, Zuzana; Vaněk, Tomáš

    University of Verona : Polo Zanotto, 2008. s. 55-56. [Genes and Proteins Involved in Steps of Phytoextraction and Degradation of Pollutants. 05.06.2008-06.06.2008, Verona] Institutional research plan: CEZ:AV0Z50380511 Keywords : trinitrotoluene * Arabidopsis thaliana * two-dimensional difference gel electrophoresis Subject RIV: DJ - Water Pollution ; Quality

  2. Degradation of 2,4,6-trinitrotoluene by selected helophytes

    Czech Academy of Sciences Publication Activity Database

    Nepovím, Aleš; Hebner, A.; Soudek, Petr; Gerth, A.; Thomas, H.; Smrček, S.; Vaněk, Tomáš

    2005-01-01

    Roč. 60, - (2005), s. 1454-1461. ISSN 0045-6535 R&D Projects: GA ČR(CZ) GP206/02/P065; GA MŠk(CZ) 1P05OC042 Institutional research plan: CEZ:AV0Z40550506 Keywords : TNT * biodegradation * emergent plant Subject RIV: EI - Biotechnology ; Bionics Impact factor: 2.297, year: 2005

  3. 7 CFR 246.25 - Records and reports.

    Science.gov (United States)

    2010-01-01

    ..., equipment purchases and inventory, certification, nutrition education, civil rights and fair hearing... Regulations of the Department of Agriculture (Continued) FOOD AND NUTRITION SERVICE, DEPARTMENT OF AGRICULTURE CHILD NUTRITION PROGRAMS SPECIAL SUPPLEMENTAL NUTRITION PROGRAM FOR WOMEN, INFANTS AND...

  4. 7 CFR 246.1 - General purpose and scope.

    Science.gov (United States)

    2010-01-01

    ... provide supplemental foods and nutrition education through payment of cash grants to State agencies which... AGRICULTURE CHILD NUTRITION PROGRAMS SPECIAL SUPPLEMENTAL NUTRITION PROGRAM FOR WOMEN, INFANTS AND CHILDREN... Agriculture shall carry out the Special Supplemental Nutrition Program for Women, Infants and Children...

  5. 7 CFR 246.12 - Food delivery systems.

    Science.gov (United States)

    2010-01-01

    ..., parents or caretakers of child participants to pay the difference when the purchase of authorized fruits... agency or its local agencies. (xx) Criminal penalties. A vendor who commits fraud or abuse in the...

  6. 40 CFR 246.201-7 - Recommended procedures: Cost analysis.

    Science.gov (United States)

    2010-07-01

    ...) SOLID WASTES SOURCE SEPARATION FOR MATERIALS RECOVERY GUIDELINES Requirements and Recommended Procedures... Residential, Commercial and Institutional Solid Wastes (40 CFR part 243) and Thermal Processing and Land... residual solid waste have been established, an analysis should be conducted which compares the costs of...

  7. 40 CFR 246.202-6 - Recommended procedures: Cost analysis.

    Science.gov (United States)

    2010-07-01

    ...) SOLID WASTES SOURCE SEPARATION FOR MATERIALS RECOVERY GUIDELINES Requirements and Recommended Procedures... Residential, Commercial and Institutional Solid Wastes (40 CFR part 243) and Thermal Processing and Land... residual solid waste have been established, an analysis should be conducted which compares the costs of...

  8. 40 CFR 246.200-8 - Recommended procedures: Cost analysis.

    Science.gov (United States)

    2010-07-01

    ...) SOLID WASTES SOURCE SEPARATION FOR MATERIALS RECOVERY GUIDELINES Requirements and Recommended Procedures... Collection of Residential, Commercial and Institutional Solid Wastes (40 CFR part 243) and Thermal Processing... paper and residual solid waste have been established, an analysis should be conducted which compares...

  9. 7 CFR 246.7 - Certification of participants.

    Science.gov (United States)

    2010-01-01

    .... 2466d); (15) Payments pursuant to the Agent Orange Compensation Exclusion Act (Pub. L. 101-201, sec. 1..., history of high risk pregnancies or factors associated with high risk pregnancies (such as smoking; conception before 16 months postpartum; history of low birth weight, premature births, or neonatal...

  10. 29 CFR 1952.246 - Changes to approved plans.

    Science.gov (United States)

    2010-07-01

    ... (29 CFR 1928.110) and temporary labor camps (29 CFR 1910.142) in agriculture (except for agricultural... personal sampling, ex parte warrants, petition to modify abatement dates, withdrawal of contest...) Temporary labor camps/field sanitation. Effective February 3, 1997, the Assistant Secretary approved...

  11. 1935 15' Quad #246 Aerial Photo Mosaic Index

    Data.gov (United States)

    Earth Data Analysis Center, University of New Mexico — Aerial Photo Reference Mosaics contain aerial photographs that are retrievable on a frame by frame basis. The inventory contains imagery from various sources that...

  12. (E-4-Chloro-N-(2,4,6-trimethylbenzylideneaniline

    Directory of Open Access Journals (Sweden)

    Ying Guo

    2011-08-01

    Full Text Available In the title compound, C16H16ClN, the dihedral angle between the benzene rings is 24.61 (13°. In the crystal, only van der Waals interactions occur between neighbouring molecules.

  13. Dicty_cDB: SHI246 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 111 length of database: 80,480,566 effective HSP length: 17 effective length of query: 94 effective length o...f database: 78,821,179 effective search space: 7409190826 effective search space used: 7409190826 T: 0 A: 0 ...han 10.0: 0 length of query: 111 length of database: 61,358,773,460 effective HSP length: 22 effective length of query: 89 effective... length of database: 60,109,362,660 effective search space: 5349733276740 effective

  14. 40 CFR 98.246 - Data reporting requirements.

    Science.gov (United States)

    2010-07-01

    ... process unit. (1) The petrochemical process unit ID number or other appropriate descriptor. (2) The type... product was produced, the volume or mass of off-specification product produced, and if applicable, the... process unit ID or other appropriate descriptor, and the type of petrochemical produced. (4) The...

  15. Eyjafjallaj&#246;kull Volcanic Eruption: Ice Nuclei and Particle Characterization

    OpenAIRE

    Gianni Santachiara; Franco Belosi; Franco Prodi

    2011-01-01

    The Eyjafjallajökull 2010 eruption was an extraordinary event in that it led to widespread and unprecedented disruption to air travel over Europe – a region generally considered to be free from the hazards associated with volcanic eruptions, excluding the extreme south influenced by Mt. Etna. In situ measurements were performed at the research centre of the National Research Council (CNR) area of Bologna (44?31′ N; 11?20′ E), an urban background site, in order to contribute to knowledge conce...

  16. Decree number 1.246 of September 16, 1994; Decreto no. 1.246 de 16 de setembro de 1994

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1994-09-16

    Promulgates the Treaty for Proscription of Nuclear Weapon in Latin America and Caribbean - Tlatelolco Treaty, held in Mexico City in February 14, 1967 an the Resolutions numbers 267(E-V), of July 3, 1990, 268 (XII), of May 10, 1991 and 290 (VII), of August 26, 1992, all of them adopted by the General Conference of the Organism for the Proscription of Nuclear Weapon in Latin America and Caribbean (OPANAL) in Mexico City.

  17. Hypericin from St. John’s Wort (hypericum perforatum) as a novel natural fluorophore for chemiluminescence reaction of bis (2,4,6-trichlorophenyl) oxalate–H2O2–imidazole and quenching effect of some natural lipophilic hydrogen peroxide scavengers

    International Nuclear Information System (INIS)

    Hypericin (HYP) molecule is a natural photoactive pigment, which plays a role as an effective photoreceptor in some plants of the Hypericum species (the most common of which is Saint John’s Wort) and some insect species. The present work deals with the first attempt to the study of peroxyoxalate chemiluminescence (POCL) system in the presense of HYP as a natural fluorophore. Reaction of bis (2,4,6-trichlorophenyl) oxalate(TCPO)–H2O2–imidazole can transfer energy to a HYP via formation of dioxetane through the chemically initiated electron exchange luminescence (CIEEL) mechanism and can emits a very intense red light. The effects of HYP, hydrogen peroxide, TCPO and imidazole concentrations on kinetic chemiluminescence parameters were also studied. These parameters including rise and fall rate constant for the chemiluminescence burst, theoretical and experimental maximum intensity, theoretical and experimental time to reach maximum intensity and total light yield emission were evaluated by using a pooled intermediate model for a non-linear least-squares curve fitting program, KINFIT. Moreover, quenching effect of two lipophilic natural antioxidant, Quercetin and β-carotene on it system was also investigated. The measurable concentration range of 7×10−6 M to 7.5×10−5 M of antioxidants were evaluated from the proper Stern–Volmer plots with satisfactory RSD% and corresponding detection limits of 2.2×10−6 and 3.7×10−6 for β-carotene and quercetin respectively. - Highlights: ► Red fluorophores may therefore chemiluminescence more intensely than other commonly chemiluminophores and emits light in longer wavelengths. ► Hypericin from St. John’s wort (hypericum perforatum) as natural red fluorophore for peroxyoxalate chemiluminescence was introduced. ► Quenching effect of two antioxidant, quercetin and β-carotene on it system was also investigated. ► The non linear least-squares curve fitting program KINFIT was applied to study of CL kinetic

  18. 阻燃剂三嗪三苯基次膦酸叔丁酯的合成及应用%Synthesis and Application of Flame Retardant 2-4-6-three(O-tertiary butyl-phenyl phosphinic acyl)-1,3,5-triazine

    Institute of Scientific and Technical Information of China (English)

    李果; 胡新利; 王彦林

    2015-01-01

    A novel flame retardant,2,4,6-three(O-tertiary butyl-phenyl phosphinic acyl)-1,3,5-triazine was synthesized from cyanuric chloride and phenyl phosphonic acid two tert-butyl ester. Effects of reaction time,reaction temperature,phenyl phosphonic acid two tert-butyl ester dropping speed and material proportion on yield of product were investigated. The product reached 90.6%under the optimal conditions of r(phenyl phosphonic acid two tert-butyl ester)∶r(cyanuric chloride)=3.4,dropping phenyl phosphonic acid two tert-butyl ester at twice,then keeping the reaction going at 100℃for 5 h. The target compound was characterized by means of FTIR,1H NMR,TG–DTA analysis and limiting oxygen index technique. The results show that the product have the high flame retardance,good compatibility with PE and have high fire retardance when mix with MCA and MPP.%以三聚氯氰和苯基次膦酸二叔丁酯为原料,合成新型阻燃剂三嗪三苯基次膦酸叔丁酯2,4,6-三(O-叔丁基–苯基次膦酰基)-1,3,5-三嗪化合物。讨论了反应时间、反应温度、原料配比等对合成反应的影响。其最佳反应条件为:三聚氯氰与苯基次膦酸二叔丁酯的物质的量之比为1∶3.4,分两次滴加苯基次膦酸二叔丁酯,在100℃反应5 h,收率为90.6%。采用傅里叶变换红外光谱、核磁共振、差热分析及极限氧指数等表征了产品的结构及阻燃应用性能。研究表明,该化合物对PE阻燃效能高,相容性好,且与MCA,MPP复配有很好的协同阻燃效果。

  19. Hypericin from St. John's Wort (hypericum perforatum) as a novel natural fluorophore for chemiluminescence reaction of bis (2,4,6-trichlorophenyl) oxalate-H{sub 2}O{sub 2}-imidazole and quenching effect of some natural lipophilic hydrogen peroxide scavengers

    Energy Technology Data Exchange (ETDEWEB)

    Kazemi, Sayed Yahya [Department of Basic Sciences, Sari Agricultural Sciences and Natural Resources University, P.O. Box 578, Sari (Iran, Islamic Republic of); Abedirad, Seyed Mohammad, E-mail: mabedirad@yahoo.com [Department of Basic Sciences, Sari Agricultural Sciences and Natural Resources University, P.O. Box 578, Sari (Iran, Islamic Republic of); Zali, Seyed Hassan; Amiri, Mohadeseh [Department of Range and Watershed Management, Sari Agricultural Sciences and Natural Resources University, P.O. Box 578, Sari (Iran, Islamic Republic of)

    2012-05-15

    Hypericin (HYP) molecule is a natural photoactive pigment, which plays a role as an effective photoreceptor in some plants of the Hypericum species (the most common of which is Saint John's Wort) and some insect species. The present work deals with the first attempt to the study of peroxyoxalate chemiluminescence (POCL) system in the presense of HYP as a natural fluorophore. Reaction of bis (2,4,6-trichlorophenyl) oxalate(TCPO)-H{sub 2}O{sub 2}-imidazole can transfer energy to a HYP via formation of dioxetane through the chemically initiated electron exchange luminescence (CIEEL) mechanism and can emits a very intense red light. The effects of HYP, hydrogen peroxide, TCPO and imidazole concentrations on kinetic chemiluminescence parameters were also studied. These parameters including rise and fall rate constant for the chemiluminescence burst, theoretical and experimental maximum intensity, theoretical and experimental time to reach maximum intensity and total light yield emission were evaluated by using a pooled intermediate model for a non-linear least-squares curve fitting program, KINFIT. Moreover, quenching effect of two lipophilic natural antioxidant, Quercetin and {beta}-carotene on it system was also investigated. The measurable concentration range of 7 Multiplication-Sign 10{sup -6} M to 7.5 Multiplication-Sign 10{sup -5} M of antioxidants were evaluated from the proper Stern-Volmer plots with satisfactory RSD% and corresponding detection limits of 2.2 Multiplication-Sign 10{sup -6} and 3.7 Multiplication-Sign 10{sup -6} for {beta}-carotene and quercetin respectively. - Highlights: Black-Right-Pointing-Pointer Red fluorophores may therefore chemiluminescence more intensely than other commonly chemiluminophores and emits light in longer wavelengths. Black-Right-Pointing-Pointer Hypericin from St. John's wort (hypericum perforatum) as natural red fluorophore for peroxyoxalate chemiluminescence was introduced. Black-Right-Pointing-Pointer Quenching

  20. Rubidium 2,4,6-trioxo-1,3-diazinan-5-ide–1,3-diazinane-2,4,6-trione–water (1/1/1

    Directory of Open Access Journals (Sweden)

    Marlena Gryl

    2011-05-01

    Full Text Available The asymmetric unit of the title compound, Rb+·C4H3N2O3−·C4H4N2O3·H2O, consists of one rubidium cation, a barbituric acid molecule, a barbiturate anion and one water molecule. The rubidium ion has seven close-contact interactions with O atoms, with Rb...O distances ranging from 2.8594 (16 to 3.2641 (14 Å. These seven O atoms together with an eighth O atom at 3.492 (2 Å away from Rb form a distorted polyhedron with shape intermediate between an antiprism and a dodecahedron. The Rb+ ions connect layers built of organic components and water molecules linked via N—H...O and O—H...O hydrogen bonds.

  1. 12 CFR 24.6 - Examples of qualifying public welfare investments.

    Science.gov (United States)

    2010-01-01

    ... approved by the Federal Reserve Board under 12 CFR 208.22 for state member banks that are consistent with... 12 Banks and Banking 1 2010-01-01 2010-01-01 false Examples of qualifying public welfare... COMMUNITY AND ECONOMIC DEVELOPMENT ENTITIES, COMMUNITY DEVELOPMENT PROJECTS, AND OTHER PUBLIC...

  2. 2,4,6-trikloorifenolilla kontaminoitujen maiden mikrobiston analysointi PCR-DGGE-menetelmällä

    OpenAIRE

    Selin, Maiju

    2010-01-01

    Suomessa vanhojen sahojen maaperät ovat pääsääntöisesti kloorifenoleiden ja niiden epäpuhtauksien saastuttamia. Kloorifenolit päätyivät maaperään 1930–1980-luvuilla käytetyn KY-5-nimisen sahatavarassa home- ja sinistäjäsienten aiheuttamia värivikoja estävän puunsuoja-aineen käytön seurauksena. Pilaantuneen maaperän kunnostuksessa on tavallisesti käytetty massanvaihtoa, mutta kloorifenolit hajoavat myös biologisesti useiden eri mekanismien kautta. Opinnäytetyön tarkoituksena oli vertailla ...

  3. Influence of cosubstrates in the anaerobic biodegradation of 2,4,6-thricholorophenol and methanogenesis

    Energy Technology Data Exchange (ETDEWEB)

    Puyol, D.; Mohedano, A. F.; Rodriguez, J. J.; Sanz, J. L.

    2009-07-01

    Chlorophenols, very toxic organic compounds, are widely distributed in soils and water. These substances are related to cellular damage as they have mutagenic and carcinogenic characteristics. Aromatic compounds have been eliminated from wastewater under methanogenic conditions; however, in most of the cases the elimination rates are low and some toxic intermediated might be accumulated. (Author)

  4. 32 CFR Appendix B to Part 246 - Business and Financial Operations

    Science.gov (United States)

    2010-07-01

    ...'s Risk Management Insurance Program in accordance with DoD instruction 7000.12 and the implementing... management purposes, the Unified Commands shall administer the Stars and Stripes (S&S), with policy oversight..., and similar products; job printing; authorized advertising revenues; and other authorized sources...

  5. 48 CFR 552.246-70 - Source Inspection by Quality Approved Manufacturer.

    Science.gov (United States)

    2010-10-01

    ... Federal Standard 368 or the International Organization for Standardization (ISO) Standard 9001:2000... required inspections and tests. (2) In addition to the requirements in Federal Standard 368, ISO 9001:2000... may authorize in writing exceptions to the quality assurance standards identified above....

  6. A meta-analysis of 120 246 individuals identifies 18 new loci for fibrinogen concentration.

    Science.gov (United States)

    de Vries, Paul S; Chasman, Daniel I; Sabater-Lleal, Maria; Chen, Ming-Huei; Huffman, Jennifer E; Steri, Maristella; Tang, Weihong; Teumer, Alexander; Marioni, Riccardo E; Grossmann, Vera; Hottenga, Jouke J; Trompet, Stella; Müller-Nurasyid, Martina; Zhao, Jing Hua; Brody, Jennifer A; Kleber, Marcus E; Guo, Xiuqing; Wang, Jie Jin; Auer, Paul L; Attia, John R; Yanek, Lisa R; Ahluwalia, Tarunveer S; Lahti, Jari; Venturini, Cristina; Tanaka, Toshiko; Bielak, Lawrence F; Joshi, Peter K; Rocanin-Arjo, Ares; Kolcic, Ivana; Navarro, Pau; Rose, Lynda M; Oldmeadow, Christopher; Riess, Helene; Mazur, Johanna; Basu, Saonli; Goel, Anuj; Yang, Qiong; Ghanbari, Mohsen; Willemsen, Gonneke; Rumley, Ann; Fiorillo, Edoardo; de Craen, Anton J M; Grotevendt, Anne; Scott, Robert; Taylor, Kent D; Delgado, Graciela E; Yao, Jie; Kifley, Annette; Kooperberg, Charles; Qayyum, Rehan; Lopez, Lorna M; Berentzen, Tina L; Räikkönen, Katri; Mangino, Massimo; Bandinelli, Stefania; Peyser, Patricia A; Wild, Sarah; Trégouët, David-Alexandre; Wright, Alan F; Marten, Jonathan; Zemunik, Tatijana; Morrison, Alanna C; Sennblad, Bengt; Tofler, Geoffrey; de Maat, Moniek P M; de Geus, Eco J C; Lowe, Gordon D; Zoledziewska, Magdalena; Sattar, Naveed; Binder, Harald; Völker, Uwe; Waldenberger, Melanie; Khaw, Kay-Tee; Mcknight, Barbara; Huang, Jie; Jenny, Nancy S; Holliday, Elizabeth G; Qi, Lihong; Mcevoy, Mark G; Becker, Diane M; Starr, John M; Sarin, Antti-Pekka; Hysi, Pirro G; Hernandez, Dena G; Jhun, Min A; Campbell, Harry; Hamsten, Anders; Rivadeneira, Fernando; Mcardle, Wendy L; Slagboom, P Eline; Zeller, Tanja; Koenig, Wolfgang; Psaty, Bruce M; Haritunians, Talin; Liu, Jingmin; Palotie, Aarno; Uitterlinden, André G; Stott, David J; Hofman, Albert; Franco, Oscar H; Polasek, Ozren; Rudan, Igor; Morange, Pierre-Emmanuel; Wilson, James F; Kardia, Sharon L R; Ferrucci, Luigi; Spector, Tim D; Eriksson, Johan G; Hansen, Torben; Deary, Ian J; Becker, Lewis C; Scott, Rodney J; Mitchell, Paul; März, Winfried; Wareham, Nick J; Peters, Annette; Greinacher, Andreas; Wild, Philipp S; Jukema, J Wouter; Boomsma, Dorret I; Hayward, Caroline; Cucca, Francesco; Tracy, Russell; Watkins, Hugh; Reiner, Alex P; Folsom, Aaron R; Ridker, Paul M; O'Donnell, Christopher J; Smith, Nicholas L; Strachan, David P; Dehghan, Abbas

    2016-01-15

    Genome-wide association studies have previously identified 23 genetic loci associated with circulating fibrinogen concentration. These studies used HapMap imputation and did not examine the X-chromosome. 1000 Genomes imputation provides better coverage of uncommon variants, and includes indels. We conducted a genome-wide association analysis of 34 studies imputed to the 1000 Genomes Project reference panel and including ∼120 000 participants of European ancestry (95 806 participants with data on the X-chromosome). Approximately 10.7 million single-nucleotide polymorphisms and 1.2 million indels were examined. We identified 41 genome-wide significant fibrinogen loci; of which, 18 were newly identified. There were no genome-wide significant signals on the X-chromosome. The lead variants of five significant loci were indels. We further identified six additional independent signals, including three rare variants, at two previously characterized loci: FGB and IRF1. Together the 41 loci explain 3% of the variance in plasma fibrinogen concentration. PMID:26561523

  7. Influence of spatial differential reflection parameters on 2,4,6- trinitrotoluene (TNT) absorption spectra

    Science.gov (United States)

    Dubroca, Thierry; Guetard, Ga"l.; Hummel, Rolf E.

    2012-06-01

    Differential reflectometry has been shown to be a sensitive and fast tool to detect explosive substances on surfaces such as luggage and parcel. This paper elucidates the influence of several parameters on the sensitivity of the technique. An expression for the reflected intensity that contains the influence of angle of incidence, wavelength of the incident light, and surface roughness has been established. The feature used to identify and detect TNT stems mainly from the diffuse component of the reflected light. This spectral "finger-print" shape does not change by varying these parameters. The maximum sensitivity is obtained for samples which are strongly diffusive and weakly specular.

  8. A meta-analysis of 120 246 individuals identifies 18 new loci for fibrinogen concentration

    DEFF Research Database (Denmark)

    de Vries, Paul S; Chasman, Daniel I; Sabater-Lleal, Maria;

    2016-01-01

    Genome-wide association studies have previously identified 23 genetic loci associated with circulating fibrinogen concentration. These studies used HapMap imputation and did not examine the X chromosome. 1000 Genomes imputation provides better coverage of uncommon variants, and includes indels. We...... genome-wide significant fibrinogen loci of which 18 were newly identified. There were no genome-wide significant signals on the X chromosome. The lead variants of 5 significant loci were indels. We further identified 6 additional independent signals, including 3 rare variants, at two previously...... characterized loci: FGB and IRF1. Together the 41 loci explain 3% of the variance in plasma fibrinogen concentration....

  9. 27 CFR 24.246 - Materials authorized for the treatment of wine and juice.

    Science.gov (United States)

    2010-04-01

    ... million. 21 CFR 173.340 and 184.1505. Dimethyl dicarbonate: To sterilize and to stabilize wine... wine. 21 CFR 184.1077 (GRAS). Potassium carbonate and/or potassium bicarbonate To reduce excess natural... clarify and to stabilize wine The amount used shall not exceed 2 lbs/1000 gals. (0.24 g/L of wine. 21...

  10. 32 CFR Appendix C to Part 246 - Personnel Policies and Procedures

    Science.gov (United States)

    2010-07-01

    ... Unified Commands, the American Forces Information Service (AFIS), and the U.S. Army to the S&S. 2. As DoD employees, the S&S civilian personnel shall abide by 32 CFR part 40, the Department of Defense, the Unified... employment and include responsibilities, such as those in 32 CFR part 40, so that the S&S civilian...

  11. 32 CFR Appendix E to Part 246 - Stars and Stripes (S&S) Board of Directors

    Science.gov (United States)

    2010-07-01

    ... from the American Forces Information Service (AFIS) and one S&S may attend the meetings of the other S... DoD policy, the Unified Commands shall ask the Director of the AFIS for resolution. The S&S commander... Unified Commands shall forward the on-going strategic and corporate plan to the Director of the AFIS...

  12. The fate of 2,4,6-trinitrotoluene in Buphthalmum salicifolium and Senecio jacobea

    Czech Academy of Sciences Publication Activity Database

    Nepovím, Aleš; Soudek, Petr; Maršík, Petr; Forczek, Sándor; Matucha, Miroslav; Smrček, S.; Vaněk, Tomáš

    Gliwice : Silesian University of Technology, 2004. s. 91. [International Conference on Bioremediation of Soil and Groundwater. 05.09.2004-08.09.2004, Cracow] R&D Projects: GA ČR GP206/02/P065 Keywords : degradation * TNT * plant uptake Subject RIV: CE - Biochemistry

  13. Soft rotator model and {sup 246}Cm low-lying level scheme

    Energy Technology Data Exchange (ETDEWEB)

    Porodzinskij, Yu.V.; Sukhovitskij, E.Sh. [Radiation Physics and Chemistry Problems Inst., Minsk-Sosny (Belarus)

    1997-03-01

    Non-axial soft rotator nuclear model is suggested as self-consistent approach for interpretation of level schemes, {gamma}-transition probabilities and neutron interaction with even-even nuclei. (author)

  14. Coupled anaerobic/aerobic biodegradation of 2,4,6 trichlorophenol

    Institute of Scientific and Technical Information of China (English)

    2003-01-01

    Degradation of 2, 4, 6-trichlorophenol(TCP) with co-immobilizing anaerobic granular sludge and isolated aerobic bacterial specieswas studied in coupled anaerobic/aerobic integrated reactors. The synergism of aerobes and anaerobes within co-immobilized granule mightfacilitate degrading the TCP and exchange of anaerobic metabolites 4-CP, which promoted system organic removal efficiency and recovered fromorganic shock-loads more quickly. The biomass specific activities experiment further confirmed that strict anaerobes be not affected over thecourse of this experiment by the presence of an oxic environment, aerobic activity predominated in the outer co-immobilized granule layers,while the interior was characterized by anaerobic activity. The co-immobilized granule could thus enable both aerobic and anaerobic microbesfunction in the same reactor and thereby integrate the oxidative and reductive catabolism.

  15. N-(2,4,6-Trimethyl­phen­yl)maleamic acid

    OpenAIRE

    Gowda, B. Thimme; Tokarčík, Miroslav; Kožíšek, Jozef; Shakuntala, K.; Fuess, Hartmut

    2009-01-01

    The mol­ecular structure of the title compound, C13H15NO3, is stabilized by a short intra­molecular O—H⋯O hydrogen bond within the maleamic unit. In the crystal, inter­molecular N—H⋯O hydrogen bonds link mol­ecules into zigzag chains propagating in [010].

  16. Yeast Interacting Proteins Database: YBR246W, YDR520C [Yeast Interacting Proteins Database

    Lifescience Database Archive (English)

    Full Text Available a screen for mutants with increased levels of rDNA transcription; null mutants display a weak carboxypeptid...ene identified in a screen for mutants with increased levels of rDNA transcription; similar to S. kluyveri U... description Putative protein of unknown function; non-essential gene identified in a screen for mutants with increased levels...ative Zn(II)2Cys6 motif containing transcription factor; non-essential gene identified in a screen for mutants with increased levels

  17. 3-Nitrophenol–1,3,5-triazine-2,4,6-triamine (2/1

    Directory of Open Access Journals (Sweden)

    V. Sangeetha

    2013-06-01

    Full Text Available The asymmetric unit of the title compound, C3H6N6·2C6H5NO3, contains one melamine and two 3-nitrophenol molecules. The mean planes of the 3-nitrophenol molecules are almost orthogonal to the plane of melamine, making dihedral angles of 82.77 (4 and 88.36 (5°. In the crystal, molecules are linked via O—H...N, N—H...N and N—H...O hydrogen bonds, forming a three-dimensional network. The crystal also features weak C—H...π and π–π interactions [centroid–centroid distance = 3.9823 (9 Å].

  18. A meta-analysis of 120 246 individuals identifies 18 new loci for fibrinogen concentration

    NARCIS (Netherlands)

    P.S. de Vries (Paul); D.I. Chasman (Daniel); M. Sabater-Lleal (Maria); M.-H. Chen (Ming-Huei); J.E. Huffman (Jennifer E.); M. Steri (Maristella); W. Tang (Weihong); A. Teumer (Alexander); R.E. Marioni (Riccardo); V. Grossmann (Vera); J.J. Hottenga (Jouke Jan); S. Trompet (Stella); M. Müller-Nurasyid (Martina); J.H. Zhao (Jing Hua); J. Brody (Jennifer); M.E. Kleber (Marcus); X. Guo (Xiuqing); J.J. Wang (Jie Jin); P. Auer (Paul); J. Attia (John); L.R. Yanek (Lisa); T.S. Ahluwalia (Tarunveer Singh); J. Lahti (Jari); C. Venturini (Cristina); T. Tanaka (Toshiko); L.F. Bielak (Lawrence F.); P.K. Joshi (Peter); A. Rocanin-Arjo (Ares); I. Kolcic (Ivana); P. Navarro (Pau); L.M. Rose (Lynda); C. Oldmeadow (Christopher); H. Riess (Helene); J. Mazur (Johanna); S. Basu (Saonli); A. Goel (Anuj); Q. Yang (Qiong); M. Ghanbari (Mohsen); Gonnekewillemsen; A. Rumley (Ann); E. Fiorillo (Edoardo); A.J. de Craen (Anton); A. Grotevendt (Anne); R.A. Scott (Robert); K.D. Taylor (Kent D.); G.E. Delgado (Graciela E.); J. Yao (Jie); A. Kifley (Annette); C. Kooperberg (Charles); Q. Qayyum (Rehan); L. Lopez (Lornam); T.L. Berentzen (Tina L.); K. Räikkönen (Katri); Massimomangino; S. Bandinelli (Stefania); P.A. Peyser (Patricia A.); S. Wild (Sarah); D.-A. Tregouet (David-Alexandre); A.F. Wright (Alan); J. Marten (Jonathan); T. Zemunik (Tatijana); A.C. Morrison (Alanna); B. Sennblad (Bengt); G.H. Tofler (Geoffrey); M.P.M. de Maat (Moniek); E.J.C. de Geus (Eco); G.D. Lowe (Gordon D.); M. Zoledziewska (Magdalena); N. Sattar (Naveed); H. Binder (Harald); U. Völker (Uwe); M. Waldenberger (Melanie); K.-T. Khaw (Kay-Tee); B. McKnight (Barbara); J. Huang (Jian); N.S. Jenny (Nancy); E.G. Holliday (Elizabeth); L. Qi (Lihong); M.G. Mcevoy (Mark G.); D.M. Becker (Diane); J.M. Starr (John); A.-P. Sarin; P.G. Hysi (Pirro); D.G. Hernandez (Dena); M.A. Jhun (Min A.); H. Campbell (Harry); A. Hamsten (Anders); F. Sarin (Fernando); W.L. McArdle (Wendy); P. Eline Slagboom; T. Zeller (Tanja); W. Koenig (Wolfgang); B. Psaty (Brucem); T. Haritunians (Talin); J. Liu (Jingmin); A. Palotie (Aarno); A.G. Uitterlinden (André); D.J. Stott (David J.); A. Hofman (Albert); O.H. Franco (Oscar); O. Polasek (Ozren); I. Rudan (Igor); P.-E. Morange (P.); J.F. Wilson (James F.); S.L. Kardia (Sharon L.r); L. Ferrucci (Luigi); T.D. Spector (Timothy); J.G. Eriksson (Johan G.); T. Hansen (Torben); I.J. Deary (Ian); L.C. Becker (Lewis); R.J. Scott (Rodney); P. Mitchell (Paul); W. März (Winfried); N.J. Wareham (Nick J.); A. Peters (Annette); A. Greinacher (Andreas); P.S. Wild (Philipp S.); J.W. Jukema (Jan Wouter); D.I. Boomsma (Dorret I.); C. Hayward (Caroline); F. Cucca (Francesco); R.P. Tracy (Russell); H. Watkins (Hugh); A.P. Reiner (Alex P.); A.R. Folsom (Aaron); P.M. Ridker (Paul); C.J. O'Donnell (Christopher J.); N.L. Smith (Nicholas L.); D.P. Strachan (David P.); A. Dehghan (Abbas)

    2016-01-01

    textabstractGenome-wide association studies have previously identified 23 genetic loci associated with circulating fibrinogen concentration. These studies used HapMap imputation and did not examine the X-chromosome. 1000 Genomes imputation provides better coverage of uncommon variants, and includes

  19. 26 CFR 1.246-5 - Reduction of holding periods in certain situations.

    Science.gov (United States)

    2010-04-01

    ... section provides an anti-abuse rule. (ii) Portfolios. Notwithstanding paragraph (b)(1) of this section, a... respect to each of the stocks the value of which the position reflects. (vi) Anti-abuse rule... money. For purposes of paragraph (b)(2) of this section, an option to sell that is significantly out...

  20. Reduction Pathways of 2,4,6-Trinitrotoluene: An Electrochemical and Theoretical Study

    Czech Academy of Sciences Publication Activity Database

    Chua, C. K.; Pumera, M.; Rulíšek, Lubomír

    2012-01-01

    Roč. 116, č. 6 (2012), s. 4243-4251. ISSN 1932-7447 R&D Projects: GA MŠk LC512 Institutional research plan: CEZ:AV0Z40550506 Keywords : trinitrotoluene reduction * electrochemistry * quantum chemical calculations Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 4.814, year: 2012

  1. 40 CFR 246.200-4 - Recommended procedures: Levels of separation.

    Science.gov (United States)

    2010-07-01

    ...) SOLID WASTES SOURCE SEPARATION FOR MATERIALS RECOVERY GUIDELINES Requirements and Recommended Procedures... facilities. This separation should consist of (a) high-grade wastepaper and (b) all other waste. Facilities that produce large enough quantities of waste computer paper and cards to make their separation into...

  2. 40 CFR 246.201-9 - Recommended procedures: Public information and education.

    Science.gov (United States)

    2010-07-01

    ... AGENCY (CONTINUED) SOLID WASTES SOURCE SEPARATION FOR MATERIALS RECOVERY GUIDELINES Requirements and..., methods and level of separation should be conducted to inform and motivate householders and to secure their cooperation in separating their waste. This public information and education program...

  3. 40 CFR 246.200-10 - Recommended procedures: Public information and education.

    Science.gov (United States)

    2010-07-01

    ... AGENCY (CONTINUED) SOLID WASTES SOURCE SEPARATION FOR MATERIALS RECOVERY GUIDELINES Requirements and..., methods and level of separation should be conducted to inform and motivate office personnel and secure their cooperation in separating their waste. This public information and education program...

  4. 30 CFR 250.246 - What mineral resource conservation information must accompany the DPP or DOCD?

    Science.gov (United States)

    2010-07-01

    ... technology and recovery practices and procedures you will use to ensure optimum recovery of oil and gas or..., DEPARTMENT OF THE INTERIOR OFFSHORE OIL AND GAS AND SULPHUR OPERATIONS IN THE OUTER CONTINENTAL SHELF Plans... of oil and gas (e.g., secondary, tertiary, or other enhanced recovery practices). If you will not...

  5. Optical nonlinearity and piezoelectricity in 2,4,6-trimethylpyridinium perchlorate

    Science.gov (United States)

    Wojtaś, M.; Czupiński, O.; Tylczyński, Z.; Isakov, D.; Belsley, M.; Jakubas, R.

    2014-09-01

    [(CH3)3C5H2NH][ClO4] exhibits rich polymorphism, it undergoes four structural phase transitions: from phases I to II at 356/327 K (heating/cooling), II-III at 346/326, III-IV at 226 K and IV-V at 182/170 K. [(CH3)3C5H2NH][ClO4] reveals a strong optical nonlinearity over a wide temperature region with the SHG efficiency comparable to that of KDP. The piezoelectric properties were studied macroscopically by series resonance method over the phases III, IV and V as well as microscopically by means of piezoelectric force microscopy (PFM) in ambient conditions. One of the piezoelectric module at phase transition point at 226 K drops to the value twice smaller than in room temperature what up to now was not encountered in literature. Moreover the ferroelastic phase transition IV-V was observed by means of polarizing optical microscope. The choice of the point group of phase I (Pmmm) was confirmed by the SHG measurements. The updated phase diagram is presented.

  6. BIOTRANSFORMATION OF 2,4,6-TRINITROTOLUENE (TNT) BY A PLANT-ASSOCIATED FUNGUS FUSARIUM OXYSPORUM

    Science.gov (United States)

    The capability of a plant-associated fungus, Fusarium oxyvorum, to transform TNT in liquid cultures was investigated. TNT was transformed into 2-amino-4, 6-dinitrotoluene (2-A-DNT), 4-amino-2, 6-dinitrotoluene (4-A- DNT), and 2, 4-diamino-6-nitrotoluene (2, 4-DAT) via 2- and 4-hy...

  7. Influence of cosubstrates in the anaerobic biodegradation of 2,4,6-thricholorophenol and methanogenesis

    International Nuclear Information System (INIS)

    Chlorophenols, very toxic organic compounds, are widely distributed in soils and water. These substances are related to cellular damage as they have mutagenic and carcinogenic characteristics. Aromatic compounds have been eliminated from wastewater under methanogenic conditions; however, in most of the cases the elimination rates are low and some toxic intermediated might be accumulated. (Author)

  8. 2,4,6-Trimethyl-3,5-bis[(phenylcarbonothioylsulfanylmethyl]benzyl benzenecarbodithioate

    Directory of Open Access Journals (Sweden)

    M. Kannan

    2010-06-01

    Full Text Available In the title compound C33H30S6, the three pendant methylene benzodithioate groups lie to one side of the central benzene ring in a cis-cis-cis `tripod' arrangement. The dihedral angles between the central benzene ring and the three pendant rings are 72.54 (4, 89.68 (4 and 86.74 (4°. In the crystal structure, one of the benzene rings is disordered over two orientations in a 0.559 (13:0.441 (13 ratio.

  9. BIOTRANSFORMATION OF 2,4,6-TRINITROTOLUENE (TNT) IN ANABAENA SP. CULTURES. (R825513C013)

    Science.gov (United States)

    The perspectives, information and conclusions conveyed in research project abstracts, progress reports, final reports, journal abstracts and journal publications convey the viewpoints of the principal investigator and may not represent the views and policies of ORD and EPA. Concl...

  10. DESTRUCTION OF 2,4,6-TRINITROTOLUENE (TNT) BY FENTON OXIDATION. (R825549C043)

    Science.gov (United States)

    The perspectives, information and conclusions conveyed in research project abstracts, progress reports, final reports, journal abstracts and journal publications convey the viewpoints of the principal investigator and may not represent the views and policies of ORD and EPA. Concl...

  11. Crystal structure of 5-chloro-3-cyclohexylsulfinyl-2,4,6-trimethyl-1-benzofuran

    OpenAIRE

    Hong Dae Choi; Uk Lee

    2014-01-01

    In the title compound, C17H21ClO2S, the cyclohexyl ring adopts a chair conformation with the C—S bond in an equatorial orientation. In the crystal, molecules are linked by C—H...O and C—H...π hydrogen bonds and a Cl...π [3.594 (2) Å] contact into chains along the a-axis direction.

  12. Crystal structure of 5-chloro-3-cyclohexylsulfinyl-2,4,6-trimethyl-1-benzofuran

    Directory of Open Access Journals (Sweden)

    Hong Dae Choi

    2014-09-01

    Full Text Available In the title compound, C17H21ClO2S, the cyclohexyl ring adopts a chair conformation with the C—S bond in an equatorial orientation. In the crystal, molecules are linked by C—H...O and C—H...π hydrogen bonds and a Cl...π [3.594 (2 Å] contact into chains along the a-axis direction.

  13. Topological correspondence between crystal structure of 2,4,6-trimethylbenzene-1,3,5-tris(methanaminium) 2,4,6-trimethylbenzene-1,3,5-triacetate and cesium chloride

    Czech Academy of Sciences Publication Activity Database

    Podlaha, J.; Císařová, I.; Alexander, Daniel; Holý, Petr; Kraus, Tomáš; Závada, Jiří

    2000-01-01

    Roč. 65, č. 10 (2000), s. 1587-1596. ISSN 0010-0765 R&D Projects: GA ČR GA203/97/0025; GA ČR GA203/00/0138; GA AV ČR KSK2055603 Institutional research plan: CEZ:AV0Z4055905 Subject RIV: CC - Organic Chemistry Impact factor: 0.960, year: 2000

  14. APR-246/PRIMA-1MET rescues epidermal differentiation in skin keratinocytes derived from EEC syndrome patients with p63 mutations

    OpenAIRE

    Shen, Jinfeng; van den Bogaard, Ellen H.; Kouwenhoven, Evelyn N.; Vladimir J.N. Bykov; Rinne, Tuula; Zhang, Qiang; Tjabringa, Geuranne S.; Gilissen, Christian; Van Heeringen, Simon J.; Schalkwijk, Joost; Van Bokhoven, Hans; Wiman, Klas G.; Zhou, Huiqing

    2013-01-01

    p53 and p63 share extensive sequence and structure homology. p53 is frequently mutated in cancer, whereas mutations in p63 cause developmental disorders manifested in ectodermal dysplasia, limb defects, and orofacial clefting. We have established primary adult skin keratinocytes from ectrodactyly, ectodermal dysplasia, and cleft lip/palate (EEC) syndrome patients with p63 mutations as an in vitro human model to study the disease mechanism in the skin of EEC patients. We show that these patien...

  15. 48 CFR 52.246-19 - Warranty of Systems and Equipment under Performance Specifications or Design Criteria.

    Science.gov (United States)

    2010-10-01

    ... notice, specifying any failure or refusal of the Contractor to— (A) Present a detailed recommendation for... Contractor in which the Contractor must remedy the failure or refusal specified in the notice. (6) If the... reasonable expenses of care and disposition, as well as for excess costs incurred or to be incurred;...

  16. Identification of 3-Nitro-2,4,6-trihydroxybenzamide Derivatives as Photosynthetic Electron Transport Inhibitors by QSAR and Pharmacophore Studies.

    Science.gov (United States)

    Sharma, Mukesh C

    2016-06-01

    In the present investigation, quantitative structure-activity relationship (QSAR) analysis was performed on a data set consisting of structurally diverse compounds in order to investigate the role of their structural features on their photosynthetic electron transport Inhibitors. The best 2D-QSAR model was selected, having correlation coefficient r (2) = 0.8544 and cross-validated squared correlation coefficient q (2) = 0.7139 with external predictive ability of pred_r (2) = 0.7753. The results obtained in this study indicate that the presence of hydroxy and nitro groups, expressed by the SsOHcount and SddsN (nitro) count, is the most relevant molecular property determining efficiency of photosynthetic inhibitory. Molecular field analysis was used to construct the best k-nearest neighbor (kNN-MFA)-based 3D-QSAR model using SA-PLS method, showing good correlative and predictive capabilities in terms of [Formula: see text] and [Formula: see text]. The pharmacophore model includes three features viz. hydrogen bond donor, hydrogen bond acceptor, and one aromatic feature. The developed model was found to be predictive and can be used to design potent photosynthetic electron transport activities prior to their synthesis for further lead modification. PMID:26245276

  17. 2,4,6-Trimethylpyridinium perchlorate: Polar properties and correlations with molecular structure of organic-inorganic hybrid crystal

    Science.gov (United States)

    Wojtaś, M.; Gaģor, A.; Czupiński, O.; Pietraszko, A.; Jakubas, R.

    2009-11-01

    [(CH3)3C5H2NH][ClO4] has been synthesized and characterized by X-ray (at 344, 245, 180 and 115 K), calorimetric, dilatometric, dielectric and pyroelectric measurements. At room temperature the crystal structure is polar, space group Pmn21. It consists of discrete disordered [ClO4]- anions and ordered trimethylpyridinium cations giving the 3D network of hydrogen bonds. The compound reveals a rich polymorphism in the solid state. It undergoes four solid-solid phase transitions: from phases I to II at 356/327 K (heating/cooling), II→III at 346/326, III→IV at 226 K and IV→V at 182/170 K. [(CH3)3C5H2NH][ClO4] reveals a strong pyroelectric response over a wide temperature region (phases III, IV and V) with the spontaneous polarization changes ( ΔPs) of the order of 1.5-8×10-3 C/m2. The spontaneous polarization is irreversible over all the polar phases, however, the magnitude of the ΔPs in the vicinity of the phase transitions is characteristic of compounds with the ferroelectric order. The molecular mechanism of the successive phases transitions in the studied crystal is proposed.

  18. (2E,4E,6E-3-Methyl-7-(pyren-1-ylocta-2,4,6-trienoic acid

    Directory of Open Access Journals (Sweden)

    Stavros E. Bariamis

    2009-10-01

    Full Text Available The title compound, C25H20O2, was synthesized by a Wittig reaction between triphenyl[1-(pyren-1-ylethyl]phosphonium bromide and ethyl (2E,4E-3-methyl-6-oxohexa-2,4-dienoate, in the presence of n-butyl lithium, followed by saponification. It was obtained pure in the all-trans configuration following crystallization from ethyl acetate. The asymmetric unit contains two independent molecules (A and B, which are arranged almost parallel to each other within the crystal structure. The triene chain is not coplanar with the pyrene ring system, forming dihedral angles of 52.8 (1 and 42.2 (1° for molecules A and B, respectively. Intermolecular hydrogen bonds between the carboxyl groups of the molecules link them into centrosymmetric pairs, AA and BB, each with the R22(8 graph-set motif.

  19. Development and Application of Non-Traditional Vertebrate Models to Investigate Terrestrial Ecological Risk to 2,46-Trinitrotoluene Exposure

    OpenAIRE

    Johnson, Mark Steven

    1998-01-01

    Assessing ecological risk to wildlife exposed to anthropogenic contamination in soil has traditionally been problematic. Attempts to standardize an approach to evaluate risk for various community types in North America have been challenging, given the variation in terrestrial communities and the values in which policy makers are bound to protect. This has resulted in vague, yet flexible guidance from the U.S. Environmental Protection Agency and other interested parties (e.g., the U.S. Army ...

  20. A DUF-246 family glycosyltransferase-like gene affects male fertility and the biosynthesis of pectic arabinogalactans

    OpenAIRE

    Stonebloom, Solomon; Ebert, Berit; Xiong, Guangyan; Pattathil, Sivakumar; Birdseye, Devon; Lao, Jeemeng; Pauly, Markus; Hahn, Michael G.; Heazlewood, Joshua L; Scheller, Henrik Vibe

    2016-01-01

    Background Pectins are a group of structurally complex plant cell wall polysaccharides whose biosynthesis and function remain poorly understood. The pectic polysaccharide rhamnogalacturonan-I (RG-I) has two types of arabinogalactan side chains, type-I and type-II arabinogalactans. To date few enzymes involved in the biosynthesis of pectin have been described. Here we report the identification of a highly conserved putative glycosyltransferase encoding gene, Pectic ArabinoGalactan synthesis-Re...

  1. Enzymatic degradation of 2,4,6-TNT by cell suspension culture of .I.Rheum palmatum./I..

    Czech Academy of Sciences Publication Activity Database

    Nepovím, Aleš; Hubálek, Martin; Vaněk, Tomáš

    Geneva : COST, 1999. s. 13. [Plant enzymes involved in the metabolism of organic pollutants. COST Action /837./. 09.12.1999-11.12.1999, Geneva] R&D Projects: GA ČR GA206/99/P034 Institutional research plan: CEZ:AV0Z4055905 Subject RIV: CE - Biochemistry

  2. In-vitro degradation of 2,4,6-trinitrotoluene using plant tissue cultures of Solanum aviculare and Rheum palmatum

    Czech Academy of Sciences Publication Activity Database

    Nepovím, Aleš; Hubálek, Martin; Podlipná, Radka; Zeman, S.; Vaněk, Tomáš

    2004-01-01

    Roč. 4, č. 1 (2004), s. 46-49. ISSN 1618-0240 R&D Projects: GA ČR GP206/02/P065; GA MŠk OC 837.10; GA MŠk ME 493 Institutional research plan: CEZ:AV0Z4055905 Keywords : degradation * Solanum aviculare * Rheum palmatum Subject RIV: CE - Biochemistry

  3. Bis(2,4,6-triamino-1,3,5-triazin-1-ium 2-[bis(carboxylatomethylazaniumyl]acetate trihydrate

    Directory of Open Access Journals (Sweden)

    Kreshnik Hoxha

    2013-11-01

    Full Text Available The title compound, 2C3H7N6+·C6H7NO62−·3H2O, was obtained by mixing melamine and nitrilotriacetic acid in aqueous solution. There is proton transfer from the nitrilotriacteic acid to melamine to produce two melaminium cations and an internal proton transfer to generate the [HN(CH2COO]2− zwitterion. The melaminium cations are arranged in hydrogen-bonded tapes formed by N—H...N interactions. These tapes extend parallel to the [010] direction and are stacked parallel to the a axis at a mean separation of 3.3559 (11 Å. Between these tapes lie the anions and lattice water molecules. Further O—H...O and N—H...O hydrogen bonds exist between the water molecules, the anions, and the melaminium cations, generating a three-dimensional array. The crystal examined was found to be twinned by a twofold rotation about the direct lattice direction [100]. The two twin components were present in the ratio 0.5918:0.4082 (14.

  4. 2-Meth­oxy­anilinium 3-hy­droxy-2,4,6-trinitro­phenolate

    OpenAIRE

    Kalaivani, Doraisamyraja; Malarvizhi, Rangasamy; Thanigaimani, Kaliyaperumal; Muthiah, Packianathan Thomas

    2011-01-01

    The cation and anion of the title mol­ecular salt, C7H10NO+·C6H2N3O8 −, are linked via an N—H⋯O hydrogen bond. An intra­molecular O—H⋯O hydrogen bond is also found in the anion. In the crystal, the anions self-assemble via O—H⋯O hydrogen bonds, forming a C(9) supra­molecular chain the b axis. Further inter­molecular N—H⋯O inter­actions also occur.

  5. The Structure and Nonlinear Optical Properties of Octupolar Compound: 2,4,6-Tristyryl-s-triazine

    Institute of Scientific and Technical Information of China (English)

    Yue Zhi CUI; Qi FANG; Hong LEI; Gang XUE; Wen Tao YU

    2003-01-01

    The crystal of 2, 4, 6-tristyryl-s-triazine (TSTA) has been prepared and its crystal structure been determined to be in the polar non-centrosymmetric space group Cmc21. The molecular structure of TSTA is characterized by the slightly curved planar configuration and the octupolar C3v molecular symmetry. As expected, TSTA crystal shows a quite novel nonlinear optical (NLO) property with its powder second harmonic generating (SHG) intensity of 1.8 times as that of urea. It also shows excellent transparency (with the peak position of 322 nm in absorption spectrum) and good thermal stability (with the melting point of 225-229℃).

  6. Mineralogy and Temperature-induced Spectral Investigations of A-type Asteroids 246 Asporina and 446 Aeternitas

    Science.gov (United States)

    Reddy, V.; Hardersen, P. S.; Gaffey, M. J.; Abell, P. A.

    2005-01-01

    A-type asteroids are a relatively rare taxonomic class with no more than 17 known objects. They were first identified as a separate group of R-type asteroids based on broadband spectrophotometry by, and were later classified based on ECAS data by Tholen (1984). These asteroids have moderately high albedos (0.13-0.39), extremely reddish slopes shortward of 0.7 m and a strong absorption feature centered at approx. 1.05 m. More recent surveys like the Small Main-Belt Asteroid Spectroscopic Survey (SMASS) and SMASS II have expanded the taxonomic classes including the A-type, adding 12 new asteroids to the original five.

  7. 2,4,6-Triaminopyrimidine as a Novel Hinge Binder in a Series of PI3Kδ Selective Inhibitors.

    Science.gov (United States)

    Patel, Leena; Chandrasekhar, Jayaraman; Evarts, Jerry; Haran, Aaron C; Ip, Carmen; Kaplan, Joshua A; Kim, Musong; Koditek, David; Lad, Latesh; Lepist, Eve-Irene; McGrath, Mary E; Novikov, Nikolai; Perreault, Stephane; Puri, Kamal D; Somoza, John R; Steiner, Bart H; Stevens, Kirk L; Therrien, Joseph; Treiberg, Jennifer; Villaseñor, Armando G; Yeung, Arthur; Phillips, Gary

    2016-04-14

    Inhibition of phosphoinositide 3-kinase δ (PI3Kδ) is an appealing target for several hematological malignancies and inflammatory diseases. Herein, we describe the discovery and optimization of a series of propeller shaped PI3Kδ inhibitors comprising a novel triaminopyrimidine hinge binder. Combinations of electronic and structural strategies were employed to mitigate aldehyde oxidase mediated metabolism. This medicinal chemistry effort culminated in the identification of 52, a potent and highly selective inhibitor of PI3Kδ that demonstrates efficacy in a rat model of arthritis. PMID:26980109

  8. 2,4,6-trinitrotoluene (TNT) detection by laser photofragmentation-laser induced fluorescence (PF-LIF)

    International Nuclear Information System (INIS)

    The photofragmentation (PF) and subsequent nitric oxide NO laser induced fluorescence (LEF) is being developed to measure the concentration of energetic materials (EMs) in soil and other media. Laser radiation near 226 nm will photodissociate the EM to NO2, which predissociates into NO that gives an intense luminescence. The NO fluorescence intensity is related to the concentration of TNT present in the sample. The EM concentration is inferred from the intensity of the NO fluorescence. In our experiment, the PF-LIF signal was monitored at various TNT vapor pressures. The effect of foreign gas, such as N2, on the PF-LIF signal was studied at different foreign gas pressures

  9. DIFFUSIVE TRANSPORT OF 2,4,6-TNT FROM A CONTAMINATED SOIL TO OVERLYING WATER. (R825513C013)

    Science.gov (United States)

    The perspectives, information and conclusions conveyed in research project abstracts, progress reports, final reports, journal abstracts and journal publications convey the viewpoints of the principal investigator and may not represent the views and policies of ORD and EPA. Concl...

  10. TRANSFORMATION OF 2,4,6-TRINITROTOLUENE (TNT) BY THE AQUATIC PLANT MYRIOPHYLLUM SPICATUM. (R825513C013)

    Science.gov (United States)

    The perspectives, information and conclusions conveyed in research project abstracts, progress reports, final reports, journal abstracts and journal publications convey the viewpoints of the principal investigator and may not represent the views and policies of ORD and EPA. Concl...

  11. Discovery of Isotopes of the Transuranium Elements with 93 <= Z <= 98

    OpenAIRE

    Fry, C; Thoennessen, M

    2012-01-01

    One hundred and five isotopes of the transuranium elements neptunium, plutonium, americium, curium, berkelium and californium have so far been observed; the discovery of these isotopes is discussed. For each isotope a brief summary of the first refereed publication, including the production and identification method, is presented.

  12. Impaired epithelial differentiation of induced pluripotent stem cells from ectodermal dysplasia-related patients is rescued by the small compound APR-246/PRIMA-1MET

    OpenAIRE

    Shalom-Feuerstein, Ruby; Serror, Laura; Aberdam, Edith; Müller, Franz-Josef; Van Bokhoven, Hans; Wiman, Klas G.; Zhou, Huiqing; Aberdam, Daniel; PETIT Isabelle

    2013-01-01

    Ectodermal dysplasia is a group of congenital syndromes affecting a variety of ectodermal derivatives. Among them, ectrodactyly, ectodermal dysplasia, and cleft lip/palate (EEC) syndrome is caused by single point mutations in the p63 gene, which controls epidermal development and homeostasis. Phenotypic defects of the EEC syndrome include skin defects and limbal stem-cell deficiency. In this study, we designed a unique cellular model that recapitulated major embryonic defects related to EEC. ...

  13. Treatment with the smallpox antiviral tecovirimat (ST-246) alone or in combination with ACAM2000 vaccination is effective as a postsymptomatic therapy for monkeypox virus infection.

    Science.gov (United States)

    Berhanu, Aklile; Prigge, Jonathan T; Silvera, Peter M; Honeychurch, Kady M; Hruby, Dennis E; Grosenbach, Douglas W

    2015-07-01

    The therapeutic efficacies of smallpox vaccine ACAM2000 and antiviral tecovirimat given alone or in combination starting on day 3 postinfection were compared in a cynomolgus macaque model of lethal monkeypox virus infection. Postexposure administration of ACAM2000 alone did not provide any protection against severe monkeypox disease or mortality. In contrast, postexposure treatment with tecovirimat alone or in combination with ACAM2000 provided full protection. Additionally, tecovirimat treatment delayed until day 4, 5, or 6 postinfection was 83% (days 4 and 5) or 50% (day 6) effective. PMID:25896687

  14. Measurement of the solar 8B neutrino flux with 246 live days of Borexino and observation of the MSW vacuum-matter transition

    CERN Document Server

    Bellini, G; Bonetti, S; Buizza Avanzini, M; Caccianiga, B; Cadonati, L; Calaprice, F; Carraro, C; Chavarria, A; Dalnoki-Veress, F; D'Angelo, D; De Kerret, H; Derbin, A; Etenko, A; Fomenko, K; Franco, D; Galbiati, C; Gazzana, S; Giammarchi, M; Goeger-Neff, M; Goretti, A; Grieb, C; Hardy, a S; Aldo, Ianni; Andrea, Ianni; Joyce, M; Kobychev, V; Korga, G; Kryn, D; Laubenstein, M; Leung, M; Lewke, T; Litvinovich, E; Loer, B; Lombardi, P; Ludhova, L; Machulin, I; Manecki, S; Maneschg, W; Manuzio, G; Masetti, F; McCarty, K; Meindl, Q; Meroni, E; Miramonti, L; Misiaszek, M; Montanari, D; Muratova, V; Oberauer, L; Obolensky, M; Ortica, F; Pallavicini, M; Papp, L; Perasso, L; Perasso, S; Pocar, A; Raghavan, b R S; Ranucci, G; Razeto, A; Risso, P; Romani, A; Rountree, D; Sabelnikov, A; Saldanha, R; Salvo, C; Schönert, S; Simgen, H; Skorokhvatov, M; Smirnov, O; Sotnikov, A; Sukhotin, S; Suvorov, Y; Tartaglia, R; Testera, G; Vignaud, D; Vogelaar, R B; Von Feilitzsch, F; Wójcik, M; Wurm, M; Zaimidoroga, O; Zavatarelli, S; Zuzel, G

    2008-01-01

    We report the measurement of the 8B solar neutrinos interaction rate with the Borexino detector. The threshold energy of 2.8 MeV is the lowest for 8B achieved so far. The rate of 8B solar neutrino interaction as measured through their scattering on the target electrons is 0.26+-0.04(stat)+-0.02(syst) c/d/100 tons. This corresponds to an equivalent electron neutrino flux of (2.65+-0.44(stat)+-0.18(syst))x10^6 cm^-2 s^-1, as derived from the elastic scattering only, in good agreement with existing measurements and predictions. The corresponding 8B mean electron neutrino survival probability, assuming the BS07(GS98) Standard Solar Model, is 0.35+-0.10 at the effective energy of 8.6 MeV. The survival probability of the 0.862 MeV 7Be neutrinos was previously reported with a subset of these data as 0.56+-0.10. Eliminating the common sources of systematic errors, the ratio between the measured survival probabilities for 7Be and 8B neutrinos is 1.60+-0.33, 1.8 sigmas different form unity. For the first time we confir...

  15. Rowe Nicholas, Raising Dust : A cultural History of Dance in Palestine, I.B. Tauris, 2010, 246 p.

    Directory of Open Access Journals (Sweden)

    Krystel Khoury

    2011-04-01

    Full Text Available Raising Dust se présente comme une fouille archéologique tentant de dépoussiérer l'histoire passée et contemporaine de la danse en Palestine, en l'articulant au contexte politique fort mouvementé de ce territoire. L'objectif principal du livre est d'éclairerla façon dont la danse, en tant que pratique sociale et artistique, est reliée au politique ; comment les deux se font échoet peuvent être porteurs et reflets du changement social. À cet effet, l’auteur privilégie l'approche historique et ...

  16. Alterations of cholinergic markers in transgenic APPSWE/PS1DE9 and APPSWE/PS1A246E mouse models of Alzheimer´s disease

    Czech Academy of Sciences Publication Activity Database

    Machová, Eva; Jakubík, Jan; Michal, Pavel; Oksman, M.; Iivonen, H.; Tanila, H.; Doležal, Vladimír

    ISN, 2007. s. 52-52. [ISN Advanced School of Neurochemistry /8./. 15.08.2007-19.08.2007, Valladolid] R&D Projects: GA AV ČR(CZ) IAA500110703; GA MŠk(CZ) LC554 Institutional research plan: CEZ:AV0Z50110509 Keywords : spr2 * cholinergic markes * Alzheimer ´s disease Subject RIV: FH - Neurology

  17. Alterations of cholinergic markers in transgenic APPSWE/PS1DE9 and APPSWE/PS1A246E mouse models of Alzheimer´s disease

    Czech Academy of Sciences Publication Activity Database

    Machová, Eva; Jakubík, Jan; Michal, Pavel; Oksman, M.; Iivonen, H.; Tanila, H.; Doležal, Vladimír

    2007-01-01

    Roč. 102, Suppl.1 (2007), s. 133-133. ISSN 0022-3042. [Biennial meeting of the International Society for Neurochemistry /21./ and Annual meeting of the American Society for Neurochemistry /38./. 19.08.2007-24.08.2007, Cancun] R&D Projects: GA MŠk(CZ) LC554; GA AV ČR IAA500110703 Institutional research plan: CEZ:AV0Z50110509 Keywords : cpo1 * cholinergic markers * transgenic mouse model * Alzheimer ´s disease Subject RIV: FH - Neurology

  18. Synthesis and structure investigation of novel pyrimidine-2,4,6-trione derivatives of highly potential biological activity as anti-diabetic agent

    Science.gov (United States)

    Barakat, Assem; Soliman, Saied M.; Al-Majid, Abdullah Mohammed; Lotfy, Gehad; Ghabbour, Hazem A.; Fun, Hoong-Kun; Yousuf, Sammer; Choudhary, M. Iqbal; Wadood, Abdul

    2015-10-01

    Synthesis of (±)-1,3-dimethyl-5-(1-(3-nitrophenyl)-3-oxo-3-phenylpropyl)pyrimidine-2,4,6(1H,3H,5H)-trione (3) is reported. The structure of compound 3 was deduced by using spectroscopic methods, X-ray crystallography, and DFT calculations. The calculated geometric parameters were found to be in good agreement with the experimental data obtained from the X-ray structure. The NBO calculations were performed to predict the natural atomic charges at the different atomic sites and to study the different intramolecular charge transfer (ICT) interactions. The high LP(3)O6 →z BD*(2)O5-N3 ICT interaction energy (165.36 kcal/mol) indicated very strong n → π* electron delocalization while the small LP(2)O → BD*(1)C-H ICT interaction energies indicated that the C-H … O intramolecular interactions are weak. The 1H and 13C NMR chemical shifts calculated using GIAO method showed good agreement with the experimental data. The calculated electronic spectra of the studied compound using TD-DFT method showed intense electronic transition band at 243.9 nm (f = 0.2319) and a shoulder at 260.2 nm (f = 0.1483) which were due to H-4/H-2/H-1/H → L+2 and H-5 → L electronic excitations, respectively. Compound 3 (IC50 = 305 ± 3.8 μM) was identified as a potent inhibitor of α-glucosidase in vitro and showed several fold more inhibition than the standard drug acarbose (IC50 = 841 ± 1.73 μM). Molecular docking of the synthesized compound was discussed.

  19. Tolerance to, and uptake and degradation of 2,4,6-trinitrotoluene (TNT) are enhanced by the expression of a bacterial nitroreductase gene in Arabidopsis thaliana

    Czech Academy of Sciences Publication Activity Database

    Kurumata, M.; Takahashi, M.; Sakamoto, A.; Ramos, J. L.; Nepovím, Aleš; Vaněk, Tomáš; Hirata, T.; Mirokawa, H.

    2005-01-01

    Roč. 60, - (2005), s. 272-278. ISSN 0939-5075 R&D Projects: GA ČR(CZ) GP206/02/P065 Grant ostatní: EC(XE) QLK3-CT-2001-00345; JSPS(JP) RFTF96L00604; JSPS(JP) 13GS0023 Institutional research plan: CEZ:AV0Z4055905 Keywords : TNT * NTR * transgenic plant Subject RIV: CE - Biochemistry Impact factor: 0.602, year: 2005

  20. Synergy of aggregation pheromone with methyl (E,E,Z)-2,4,6-decatrienoate in attraction of brown marmorated stink bug, Halyomorpha halys

    Science.gov (United States)

    The male-produced aggregation pheromone of the brown marmorated stink bug ((BMSB), Halyomorpha halys (Stål) (Hemiptera: Pentatomidae)), recently identified as a mixture of (3S,6S,7R,10S)-10,11-epoxy-1-bisabolen-3-ol and (3S,6S,7R,10R)-10,11-epoxy-1-bisabolen-3-ol, offers new opportunities for manage...

  1. 246 Assessment of the Quality of Methodological Rigour and Reporting of Clinical Practice Guidelines for the Management of Allergic Rhinitis—Qugar Study

    OpenAIRE

    Padjas, Agnieszka; Schünemann, Holger,; Bousquet, Jean; Brozek, Jan

    2012-01-01

    Background To assess the methodological rigour and transparency of reporting in clinical practice guidelines for the management of allergic rhinitis (AR). Methods We systematically searched MEDLINE, TRIP database (including the National Guidelines Clearinghouse) and professional society websites for guidelines about the management of AR published after the year 2000. We assumed that older guidelines would no longer influence current clinical practice. If the guideline was updated after 2000 w...

  2. Assessing the acid properties of desilicated ZSM-5 by FTIR using CO and 2,4,6-trimethylpyridine (collidine) as molecular probes

    DEFF Research Database (Denmark)

    Holm, Martin Spangsberg; Svelle, S.; Joensen, F.;

    2009-01-01

    A series of desilicated ZSM-5 catalysts previously shown to have improved catalytic performance in the MTG (methanol-to-gasoline) reaction [M. Bjorgen, F. Joensen, M.S. Holm, U. Olsbye, K.-P. Lillerud, S. Svelle, Appl. Catal. A 345 (2008) 43] was subjected to thorough examination using FTIR...

  3. 40 CFR 721.6160 - Piperazinone, 1,1′,1″-[1,3,5- triazine-2,4,6-triyltris[(cyclohexylimino)-2,1-ethanediyl

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 30 2010-07-01 2010-07-01 false Piperazinone, 1,1â²,1â³- ]tris- -. 721.6160 Section 721.6160 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) TOXIC SUBSTANCES CONTROL ACT SIGNIFICANT NEW USES OF CHEMICAL SUBSTANCES Significant New Uses for Specific Chemical Substances § 721.6160 Piperazinone,...

  4. Synthesis and study of ruthenium(3) complexes with 1,3,5-triazine-2,4,6-triamine-N,N,N',N',N'',N''-hexaacetate

    International Nuclear Information System (INIS)

    In reaction of K2Ru(H2O)Cl5 with 1, 3, 5-triazine-2, 4, 6-triamine-N, N, N', N', N'', N)) - hexaacetate complexone complexes with the ratio Ru:L=2:1-Rusub(2)(Hsub(2)L)(Hsub(2)O)sub(4)Clsub(n) (n5(Ru2(H3L)Cl8)x6KCl (2) and also with Ru:L=1:1 - K4Na(RuLCl(OH)xH2O)x5.5H2O(0.5NaCl) (3) ratio are synthesized. Basing on the data of IR-spectra, pH-titration and X-ray electron spectra it is suggested that L in 1, 2 and 3 is coordinated with N, O atoms of iminodiacetate groups being in 1 and 2 bridge ligand. 1 complex is insoluble in water, contains fractional number of Cl ions, has low magnetic moment that testifies to its polymeric structure. Ru2O3 (1), Ru2O3, NaCl, KCl (2) and K2Ru4O4, Na2O, K2O (3) are results of complexonate thermolysis

  5. Comments on Li et al. Effects of in Utero Exposure to Dicyclohexyl Phthalate on Rat Fetal Leydig Cells. Int. J. Environ. Res. Public Health 2016, 13, 246

    Science.gov (United States)

    Svingen, Terje

    2016-01-01

    Profiling the expression levels of genes or proteins in tissues comprising two or more cell types is commonplace in biological sciences. Such analyses present particular challenges, however, for example a potential shift in cellular composition, or ‘cellularity’, between specimens. That is, does an observed change in expression level represent what occurs within individual cells, or does it represent a shift in the ratio of different cell types within the tissue? This commentary attempts to highlight the importance of considering cellularity when interpreting quantitative expression data, using the mammalian testis and a recent study on the effects of phthalate exposure on testis function as an example. PMID:27231928

  6. Catalytic dimerization of propene with a Bis(salicyladiminato)Nic le (II) catalyst using 2,4,6-trichlorophenol for isomerization reactions

    International Nuclear Information System (INIS)

    A bis(salicylaldiminato)nic le(II) catalyst was used for dimerization reactions of propene. The catalyst precursor was activated with a triethylaluminum/aluminum trichloride mixture in the presence of phosphines and 2, 4, 6-trichlorophenol. The influence of the various components on the catalytic activity and product distribution is shown.

  7. The unusual stability of TATB (1,3,5-triamino-2,4,6-trinitrobenzene): A review of the scientific literature

    Energy Technology Data Exchange (ETDEWEB)

    Rice, S.F.; Simpson, R.L.

    1990-07-04

    This review is intended as an up-to-date review of the scientific literature on TATB since its discovery as a high explosive. In particular, it focuses on clarifying our current understanding of the relationship between the structure of TATB and its unique thermal stability. We review a large number of different publications by many authors. A small portion of the work on TATB'' presented actually consists of experimental studies on TATB formulated as PBX-9502 or as LX-17. Where relevant, this distinction is indicated. However, inasmuch as this review focuses on thermal response and the relationship of chemical reactivity to the molecular and lattice structure of TATB as a pure material, results from these other formulations may not be directly applicable, and in general we have omitted them. 4 refs.

  8. Hydrogen-bonding patterns in bis[2,4,6-triazaniumylcyclohexane-1,3,5-tris(olate)-κ(3)O,O',O'']germanium(IV) tetrachloride hexahydrate.

    Science.gov (United States)

    Neis, Christian; Morgenstern, Bernd; Hegetschweiler, Kaspar

    2016-01-01

    A first preliminary report on the crystal structure of a hydrated salt formulated as [Ge(taci)2]Cl4·13H2O (taci is 1,3,5-triamino-1,3,5-trideoxy-cis-inositol) appeared more than 20 years ago [Ghisletta (1994). PhD thesis, ETH Zürich. Switzerland]. At that time it was not possible to discriminate unambiguously between the positions of some of the chloride ions and water O atoms, and disorder was thus postulated. In a new determination, a conclusive scheme of hydrogen bonding proves to be a particularly appealing aspect of the structure. Single crystals of the title compound, C12H30GeN6O6(4+)·4Cl(-)·6H2O or [Ge(taci)2]2Cl8·12H2O, were grown from an aqueous solution by slow evaporation of the solvent. The two [Ge(taci)2](4+) cations exhibit a double-adamantane-type structure with exclusive O-atom coordination and approximate D3d symmetry. The taci ligands adopt a zwitterionic form with deprotonated hydroxy groups and protonated amino groups. Both cations are hydrogen bonded to six water molecules. The structure of the hydration shell of the two cations is, however, slightly different. The {[Ge(taci)2]·6H2O}(4+) aggregates are interlinked in all three dimensions by further hydrogen bonds of the types N-H...Cl...H-N, N-H...O(H)2...H-N, (Ge)O...H-O(H)...H-N, N-H...O(H)-H...Cl...H-N, (Ge)O...H-O-H...Cl...H-N, N-H...O(H)-H...Cl...H-(H)O...H-N, (Ge)O...H-O-H...Cl...H-(H)O...H-N and Ge(O)...H-O-H...Cl...H-O-H...O(Ge). PMID:26742824

  9. Gas-phase uranium ion reactions with 2,4,6-Tri-t-butylphenol and 1,3,5-tri-t-butylbenzene

    International Nuclear Information System (INIS)

    This paper reports that abundant U+ ions were generated by Nd:YAG laser desorption from a uranium metal sample made by the splat technique. The stepwise reaction of U+ ions with 2, 4, 6,-tri-t-butylphenol (Ph'OH) initially produced a series of hydroxphenoxy-uranium ions. However, after an 800-ms reaction period at 3 x 10-7 torr, the predominant species was the uranium triphenoxide ion, U(OPh')3+. Reaction of U+ ions with 1, 3, 5,-tri-t-butylbenzene (Bz') showed, among other species, the molecular ion of the U(Bz')2 sandwich compound

  10. 1-(4,5-Dinitro-10-azatricyclo[6.3.1.02,7]dodeca-2,4,6-trien-10-yl-2,2,2-trifluoroethanone

    Directory of Open Access Journals (Sweden)

    Jin-Tang Wang

    2008-12-01

    Full Text Available In the title compound, C13H10F3N3O5, a derivative of andrographolide, the five-membered ring adopts an envelope conformation, while the non-planar six-membered ring has a chair conformation. An intramolecular C—H...F hydrogen bond results in the formation of a non-planar six-membered ring adopting a twisted conformation. In the crystal structure, intermolecular C—H...O hydrogen bonds link the molecules into centrosymmetric dimers.

  11. Crystal structure of the heptamolybdate(VI) (paramolybdate) ion, [Mo7O24]6-, in the ammonium and potassium tetrahydrate salts

    Science.gov (United States)

    Evans, H.T., Jr.; Gatehouse, B.M.; Leverett, P.

    1975-01-01

    The crystal structures of the isomorphous salts MI6 [Mo7O24],4H2O (M = NH4 or K) have been refined by three-dimensional X-ray diffraction methods. Unit cell dimensions of these monoclinic compounds, space group P21/C with Z = 4, are, ammonium salt: a = 8.3934 ?? 0.0008, b = 36.1703 ?? 0.0045, c = 10.4715 ?? 0.0011 A??, ?? = 115.958?? ?? 0.008??; and potassium salt: a = 8.15 ?? 0.02, b = 35.68 ?? 0.1, c = 10.30 ?? 0.02 A??, ?? = 115.2?? ?? 02??. By use of multiple Weissenberg patterns, 8197 intensity data (Mo-K?? radiation) for the ammonium compound and 2178 (Cu-K?? radiation) for the potassium compound were estimated visually and used to test and refine Lindqvist's proposed structure in the space group P21/c. Lindqvist's structure was confirmed and the full matrix least-squares isotropic refinement led to R 0.076 (ammonium) 0.120 (potassium), with direct unambiguous location of the cations and water molecules in the potassium compound.

  12. SOIL-WATER PARTITIONING AND MASS TRANSFER KINETICS OF 2,4,6 TNT IN HIGHLY CONTAMINATED SOIL. (R825513C013)

    Science.gov (United States)

    The perspectives, information and conclusions conveyed in research project abstracts, progress reports, final reports, journal abstracts and journal publications convey the viewpoints of the principal investigator and may not represent the views and policies of ORD and EPA. Concl...

  13. N-(2-Chloro­phen­yl)-2-(4,6-dimethyl­pyrimidin-2-ylsulfan­yl)acetamide

    OpenAIRE

    Li, Qiang; Wang, Wei; Wang, Hui; Gao, Yan; Qiu, Hong

    2009-01-01

    In the title compound, C14H14ClN3OS, the 4,6-dimethyl­pyrimidine ring and the chloro­benzene ring subtend a dihedral angle of 80.0 (2)°. The length of the Csp 2—S bond is significantly shorter than that of the Csp 3—S bond. The crystal structure is stabilized by inter­molecular N—H⋯O, C—H⋯O and C—H⋯N hydrogen bonding, and C—H⋯π inter­actions.

  14. Crystal structure of 5-chloro-3-cyclo­hexyl­sulfinyl-2,4,6-trimethyl-1-benzo­furan

    OpenAIRE

    Choi, Hong Dae; Lee, Uk

    2014-01-01

    In the title compound, C17H21ClO2S, the cyclo­hexyl ring adopts a chair conformation with the C—S bond in an equatorial orientation. In the crystal, mol­ecules are linked by C—H⋯O and C—H⋯π hydrogen bonds and a Cl⋯π [3.594 (2) Å] contact into chains along the a-axis direction.

  15. Evaluation of the endocrine activity of 2,4,6-tribromophenol, benzanthrone and benzophenone-2 based on Appendix 7.8-5 of REACH guidance document

    DEFF Research Database (Denmark)

    Duis, Karen; Holbech, Henrik; Velasco-Santamaría, Yohana M.

    Within a project funded by the German Federal Environment Agency, the practicability of Appendix 7.8-5 of REACH guidance document R.7b was evaluated using three case study substances. Shortcomings in the guidance were identified. An assessment of potential endocrine activity in aquatic vertebrate...

  16. Neutron multiplicities for the transplutonium nuclides

    International Nuclear Information System (INIS)

    This paper continues, with respect to the transplutonium nuclides, earlier efforts to collate and evaluate data from the scientific literature on the prompt neutron multiplicity distribution from fission and its first moment = ΣnuPnu. The isotopes considered here for which P/sub nu/ and or data (or both) were found in the literature are of americium (Am), curium (Cm), berkelium (Bk), californium (Cf), einsteinium (Es), fermium (Fm), and nobelium (No)

  17. TOWARD AN IMPROVED UNDERSTANDING OF STRUCTURE AND MAGNETISM IN NEPTUNIUM AND PLUTONIUM PHOSPHONATES AND SULFONATES

    Energy Technology Data Exchange (ETDEWEB)

    Albrecht-Schmitt, Thomas

    2012-03-01

    This grant supported the exploratory synthesis of new actinide materials with all of the actinides from thorium to californium with the exceptions of protactinium and berkelium. We developed detailed structure-property relationships that allowed for the identification of novel materials with selective ion-exchange, selective oxidation, and long-range magnetic ordering. We found novel bonding motifs and identified periodic trends across the actinide series. We identified structural building units that would lead to desired structural features and novel topologies. We also characterized many different spectroscopic trends across the actinide series. The grant support the preparation of approximately 1200 new compounds all of which were structurally characterized.

  18. Composition containing transuranic elements for use in the homeopathic treatment of aids

    International Nuclear Information System (INIS)

    A homeopathic remedy consisting of a composition containing one or more transuranic elements, particularly plutonium, for preventing and treating acquired immunodeficiency syndrome (AIDS) in humans, as well as seropositivity for human immunodeficiency virus (HIV). Said composition is characterized in that it uses any chemical or isotopic form of one or more transuranic elements (neptunium, plutonium, americium, curium, berkelium, californium or einsteinium), particularly plutonium, said form being diluted and dynamized according to conventional homeopathic methods, particularly the so-called Hahnemann and Korsakov methods, and provided preferably but not exclusively in the form of lactose and/or saccharose globules or granules impregnated with the active principle of said composition. (author)

  19. Detection of rare earth elements in Powder River Basin sub-bituminous coal ash using laser-induced breakdown spectroscopy (LIBS)

    Energy Technology Data Exchange (ETDEWEB)

    Tran, Phuoc [National Energy Technology Lab. (NETL), Pittsburgh, PA, (United State; Mcintyre, Dustin [National Energy Technology Lab. (NETL), Pittsburgh, PA, (United State

    2015-10-01

    We reported our preliminary results on the use of laser-induced breakdown spectroscopy to analyze the rare earth elements contained in ash samples from Powder River Basin sub-bituminous coal (PRB-coal). We have identified many elements in the lanthanide series (cerium, europium, holmium, lanthanum, lutetium, praseodymium, promethium, samarium, terbium, ytterbium) and some elements in the actinide series (actinium, thorium, uranium, plutonium, berkelium, californium) in the ash samples. In addition, various metals were also seen to present in the ash samples

  20. PROCEEDINGS OF THE SYMPOSIUM COMMEMORATING THE 25th ANNIVERSARY OF ELEMENTS 97 and 98 HELD ON JAN. 20, 1975

    Energy Technology Data Exchange (ETDEWEB)

    Seaborg, Glenn T.; Street Jr., Kenneth; Thompson, Stanley G.; Ghiorso, Albert

    1976-07-01

    This volume includes the talks given on January 20, 1975, at a symposium in Berkeley on the occasion of the celebration of the 25th anniversary of the discovery of berkelium and californium. Talks were given at this symposium by the four people involved in the discovery of these elements and by a number of people who have made significant contributions in the intervening years to the investigation of their nuclear and chemical properties. The papers are being published here, without editing, in the form in which they were submitted by the authors in the months following the anniversary symposium, and they reflect rather faithfully the remarks made on that occasion.

  1. Immunization with the SDPM1 peptide lowers amyloid plaque burden and improves cognitive function in the APPswePSEN1(A246E) transgenic mouse model of Alzheimer’s disease

    OpenAIRE

    Wang, Chiou-Miin; deVries, Sarah; Camboni, Marybeth; Glass, Matthew; Martin, Paul T.

    2010-01-01

    Vaccination has become an important therapeutic approach to the treatment of Alzheimer’s disease (AD), however, immunization with Aβ amyloid can have unwanted, potentially lethal, side effects. Here we demonstrate an alternative peptide-mimotope vaccine strategy using the SDPM1 peptide. SDPM1 is a 20 amino acid peptide bounded by cysteines that binds tetramer forms of Aβ1–40- and Aβ1–42-amyloid and blocks subsequent Aβ amyloid aggregation. Immunization of mice with SDPM1 induced peptide mimot...

  2. Aigle Denise, Le Fârs sous la domination mongole. Politique et fiscalité (xiiie-xive s.), Cahiers de Studia iranica, 31, Paris, 2005, 246 p.

    OpenAIRE

    Marie Favereau-Doumenjou

    2007-01-01

    Cet ouvrage aborde le thème de la domination mongole en Iran, en mêlant deux approches : l’une, « locale », est centrée sur le Fârs et l’autre, « globale », intègre cette province dans l’ensemble du système administratif et financier mis en place par les ilkhans. Cette double lecture permet à l’auteur d’analyser les processus politique et économique qui touchent une région assujettie aux Mongols sans la déconnecter pour autant de la réalité étatique. Ainsi, tout en suivant, en filigrane, ce q...

  3. Influence of a macromolecule on the bleaching process of photochromic 1-methyl-2,4,6-tetraphenyl-1,4-dihydropyridine: Approach based on the analysis of a chaotic signal

    Czech Academy of Sciences Publication Activity Database

    Nešpůrek, Stanislav; Pecen, Ladislav; Zmeškal, O.

    2008-01-01

    Roč. 1, č. 1 (2008), s. 179-203. ISSN 0973-7405 R&D Projects: GA AV ČR KAN401770651; GA AV ČR KAN400720701 Institutional research plan: CEZ:AV0Z40500505; CEZ:AV0Z10300504 Keywords : photochromism * photobleaching * chaotic signal Subject RIV: CF - Physical ; Theoretical Chemistry

  4. Synthesis and Structure of a 3D Manganese Coordination Polymer with 1,3-Bis(benzimidazol-1-ylmethyl)-2,4,6-trimethylbenzene and 1,5-Naphthalenedisulfonate

    Institute of Scientific and Technical Information of China (English)

    ZHOU Hui; DU Shao-Wu; LI Zhi-Hua

    2007-01-01

    The organic-inorganic hybrid polymer [Mn(mbbimb)2(1,5-nds)]n 1 has been synthesized using 1,5-naphthalenedisulfonate (1,5-nds) and 1,3-bis(benzimidazol-1-ylmethyl)- 2,4,structure analysis indicates that 1 crystallizes in monoclinic, space group C2/c with a=21.3546(17), b=11.8841(7), c=22.1588(16) (A), β=108.058(3)°, C60H54MnN8O6S2, Mr=1102.17, Z=4, V=5346.5(7)(A)3, Dc=1.369 g/cm3, μ=0.386 mm-1, F(000)=2300, S=1.091, R=0.0634 and wR=0.1559 for 4641 observed reflections (I > 2σ(I)). The Mn center is six-coordinated to furnish a distorted octahedral geometry, and the overall framework is a 6-connected 3D net.

  5. Multivariate functions for predicting the sorption of 2,4,6-trinitrotoluene (TNT) and 1,3,5-trinitro-1,3,5-tricyclohexane (RDX) among taxonomically distinct soils.

    Science.gov (United States)

    Katseanes, Chelsea K; Chappell, Mark A; Hopkins, Bryan G; Durham, Brian D; Price, Cynthia L; Porter, Beth E; Miller, Lesley F

    2016-11-01

    After nearly a century of use in numerous munition platforms, TNT and RDX contamination has turned up largely in the environment due to ammunition manufacturing or as part of releases from low-order detonations during training activities. Although the basic knowledge governing the environmental fate of TNT and RDX are known, accurate predictions of TNT and RDX persistence in soil remain elusive, particularly given the universal heterogeneity of pedomorphic soil types. In this work, we proposed a new solution for modeling the sorption and persistence of these munition constituents as multivariate mathematical functions correlating soil attribute data over a variety of taxonomically distinct soil types to contaminant behavior, instead of a single constant or parameter of a specific absolute value. To test this idea, we conducted experiments measuring the sorption of TNT and RDX on taxonomically different soil types that were extensively physical and chemically characterized. Statistical decomposition of the log-transformed, and auto-scaled soil characterization data using the dimension-reduction technique PCA (principal component analysis) revealed a strong latent structure based in the multiple pairwise correlations among the soil properties. TNT and RDX sorption partitioning coefficients (KD-TNT and KD-RDX) were regressed against this latent structure using partial least squares regression (PLSR), generating a 3-factor, multivariate linear functions. Here, PLSR models predicted KD-TNT and KD-RDX values based on attributes contributing to endogenous alkaline/calcareous and soil fertility criteria, respectively, exhibited among the different soil types: We hypothesized that the latent structure arising from the strong covariance of full multivariate geochemical matrix describing taxonomically distinguished soil types may provide the means for potentially predicting complex phenomena in soils. The development of predictive multivariate models tuned to a local soil's taxonomic designation would have direct benefit to military range managers seeking to anticipate the environmental risks of training activities on impact sites. PMID:27454101

  6. Bis[N-(2-hydroxyethyl-N-methyldithiocarbamato-κS][2,4,6-tris(pyridin-2-yl-1,3,5-triazine-κ3N1,N2,N6]zinc dioxane sesquisolvate

    Directory of Open Access Journals (Sweden)

    Edward R. T. Tiekink

    2012-03-01

    Full Text Available The asymmetric unit of the title compound, [Zn(C4H8NOS22(C18H12N6]·1.5C4H8O2, comprises a Zn-containing molecule and one and a half dioxane molecules as one of the solvent molecules is located about a crystallographic inversion centre. The approximately square-pyramidal N3S2 donor set is defined by two monodentate dithiocarbamate ligands and two pyridine and one triazine N atom from the tridentate triazine ligand. Molecules are connected into a supramolecular array via O—H...S and O—H...N hydrogen bonds. These stack along the b axis and the solvent molecules reside in the channels thus formed.

  7. Diaqua(trifluoroacetato-κ2O,O′[2,4,6-tri-2-pyridyl-1,3,5-triazine-κ3N2,N1,N6]manganese(II trifluoroacetate

    Directory of Open Access Journals (Sweden)

    Seik Weng Ng

    2009-05-01

    Full Text Available The MnII atom in the two independent ion-pairs of the title salt, [Mn(C2F3O2(C18H12N6(H2O2]C2F3O2, is N,N′,N′′-chelated by the neutral N-heterocycle and O,O′-chelated by the carboxylate ion, the five atoms involved in chelation comprising a pentagon around it. The apical sites of the trans-pentagonal bipyramidal coordination geometry are occupied by two water molecules. The cations and lattice anions are linked by O—H...O and O—H...N hydrogen bonds into a three-dimensional network.

  8. Zn(NO_3)_2·6H_2O/2,4,6-trichloro-1,3,5-triazine(TCT) a mild and selective system for nitration of phenols

    Institute of Scientific and Technical Information of China (English)

    Firouzeh; Nemati; Hossein; Kiani

    2010-01-01

    Certain phenols and naphthols were nitrated regioselectively with Zn(NO_3)_2·6H_2O/TCT in acetonitrile as solvent at room temperature and short reaction time in good yields.The reaction condition was mild.TCT is a cheap and commercially available reagent.It performed as an acid catalyst in this transformation.

  9. Synthesis and spectroscopic and structural characterization of the monomeric diborylphosphine and diphosphinoborane compounds PhP(BMes2)2 and MesB(PPh2)2 (Mes = 2,4,6-Me3C6H2)

    International Nuclear Information System (INIS)

    The synthesis and spectroscopic and first x-ray structural characterization of a diborylphosphine, PhP(BMes2)2 (1), and a diphosphinoborane, MesB(PPh2)2 (2), are described. The structure of 1 has a planar core that involves the phosphorus and two boron atoms and also the five substituent carbons. In addition, the B-P bond lengths are shortened, which suggests a close structural analogy between 1 and the allyl cation. In the case of 2, although the boron remains planar, both phosphorus centers are pyramidal with slightly longer B-P bonds than in 1. Both 1 and 2 are the first examples of their respective classes of compound to be well characterized. Crystal data with Mo Kα radiation (λ = 0.71069 /angstrom/) at 130 K are as follows. 1: a = 14.302 (4) /angstrom/, b = 15.701 (3) /angstrom/, c = 16.601 (6) /angstrom/, β = 109.61 (2)/degrees/; monoclinic, space group C2/c, Z = 4, R = 0.059. 2: a = 7.815 (2) /angstrom/, b = 8.723 (2) /angstrom/, c = 40.147 (10) /angstrom/, β = 94.90 (2)/degrees/; monoclinic, space group P21/n, Z = 4, R = 0.041. A listing of available 11B and 31P NMR data on compounds involving triply connected boron and phosphorus centers is also provided and discussed in the context of the data for 1 and 2. 25 references, 2 figures, 4 tables

  10. Photochemical Degradation of Lignin through αC—O Bond Cleavage of Non Phenolic Benzyl Aryl Ether Units. A Study of the Photochemistry of a(2',4',6'-Trimethyl-Phenoxy)-3,4 Dimethoxy Toluene

    International Nuclear Information System (INIS)

    The results of this study show that, even in the case of a complete chemical group protection (phenolic groups as aliphatic ethers, carbonyl groups reduced to CH2), the UV part of the sunlight near 300 nm can initiate a benzylic cleavage responsible for a subsequent yellowing of the lignin materials

  11. Environmental control implications of generating electric power from coal. Appendix C. Gasification/combined-cycle power generation: comparison of alternative systems. 1977 technology status report. [246 references w. abstracts

    Energy Technology Data Exchange (ETDEWEB)

    None

    1977-12-01

    The technical, economic, and environmental aspects of low-Btu gasification/combined-cycle power-generation (LBG/CCPG) plants are assessed, using available published data. Six base-case plants, based on three different gasifiers and two different coals, are investigated. A representative combined power cycle is selected for analysis, and material and energy balances for the six systems are developed. Emissions of various air pollutants, including sulfur dioxide and nitrogen oxides, and discharge rates of aqueous effluents are also calculated. The costs of electricity produced are derived for the six systems, using estimated plant-investment and operating costs. These costs and the emissions of various pollutants are compared with those for a conventional 500-MWe coal-based power plant using flue-gas cleaning and in compliance with the federal New Source Performance Standards. Finally, the commercialization potential of coal-based combined-cycle plants, based on the technical feasibility of building a first plant in the 1985 period and on economic viability, is evaluated. This evaluation is based on the current status of research and development programs for various components of the combined-cycle plant, such as gas turbines and fuel-gas-cleaning systems, and on the status of the demonstration plant.

  12. What Should Be the Future Direction of the Foreign Policy of the United States?: National Debate Topic for High Schools, 1979-1980, Pursuant to Public Law 88-246.

    Science.gov (United States)

    Library of Congress, Washington, DC. Congressional Research Service.

    This book provides information on the 1979-80 national high school debate topic (United States foreign policy). The volume begins with a group of articles selected to provide an overview of foreign policy considerations and a general context for discussions of the three propositions within the designated topic. The book also contains sections with…

  13. The Origin of Continents and Oceans : A. Wegener (translated by J. Biram from the 4th revised German edition, 1929) Dover, New York N.Y., 1966, 246 pp., 63 illus., paperbound U.S.$2.00

    NARCIS (Netherlands)

    Bemmelen, R.W. van

    1968-01-01

    In the old controversy between fixism and mobilism a new scientific tool, palaeomagnetism, has recently brought forward independent diagnostic facts. In the discussions about drift many authors quote Wegener's classic work. It is fortunate that it has now appeared in an excellent English translation

  14. An atomic beam source for actinide elements: concept and realization

    International Nuclear Information System (INIS)

    For ultratrace analysis of actinide elements and studies of their atomic properties with resonance ionization mass spectroscopy (RIMS), efficient and stable sources of actinide atomic beams are required. The thermodynamics and kinetics of the evaporation of actinide elements and oxides from a variety of metals were considered, including diffusion, desorption, and associative desorption. On this basis various sandwich-type filaments were studied. The most promising system was found to consist of tantalum as the backing material, an electrolytically deposited actinide hydroxide as the source of the element, and a titanium covering layer for its reduction to the metal. Such sandwich sources were experimentally proven to be well suited for the production of atomic beams of plutonium, curium, berkelium and californium at relatively low operating temperatures and with high and reproducible yields. (orig.)

  15. EC decay of 244Bk

    Science.gov (United States)

    Sodaye, Suparna; Tripathi, R.; Sudarshan, K.; Sharma, S. K.; Pujari, P. K.; Palit, R.; Mukhopadhyay, S.

    2014-12-01

    Berkelium isotopes have been produced in 11B-induced reaction on 238U. The EC decay of 244Bk → 244Cm has been studied by carrying out the single and coincidence measurements of the γ-rays emitted during the de-excitation of the 244Cm levels. Radiochemical separations have been carried out to minimize the contribution from the fission products and target. The new half-life of 244Bk is obtained as 5.02 ± 0.03 h, which is close to the theoretically calculated value. The relative intensities of the decay γ-rays have been re-evaluated. Based on the coincidence measurements, a tentative partial level scheme for 244Bk → 244Cm decay has been proposed.

  16. Nuclear fission and the transuranium elements

    International Nuclear Information System (INIS)

    Many of the transuranium elements are produced and isolated in large quantities through the use of neutrons furnished by nuclear fission reactions: plutonium (atomic number 94) in ton quantities; neptunium (93), americium (95), and curium (96) in kilogram quantities; berkelium (97) in 100 milligram quantities; californium (98) in gram quantities; and einsteinium (99) in milligram quantities. Transuranium isotopes have found many practical applications---as nuclear fuel for the large-scale generation of electricity, as compact, long-lived power sources for use in space exploration, as means for diagnosis and treatment in the medical area, and as tools in numerous industrial processes. Of particular interest is the unusual chemistry and impact of these heaviest elements on the periodic table. This account will feature these aspects. 9 refs., 5 figs

  17. Nuclear fission and the transuranium elements

    Energy Technology Data Exchange (ETDEWEB)

    Seaborg, G.T.

    1989-02-01

    Many of the transuranium elements are produced and isolated in large quantities through the use of neutrons furnished by nuclear fission reactions: plutonium (atomic number 94) in ton quantities; neptunium (93), americium (95), and curium (96) in kilogram quantities; berkelium (97) in 100 milligram quantities; californium (98) in gram quantities; and einsteinium (99) in milligram quantities. Transuranium isotopes have found many practical applications---as nuclear fuel for the large-scale generation of electricity, as compact, long-lived power sources for use in space exploration, as means for diagnosis and treatment in the medical area, and as tools in numerous industrial processes. Of particular interest is the unusual chemistry and impact of these heaviest elements on the periodic table. This account will feature these aspects. 9 refs., 5 figs.

  18. EC decay of 244Bk

    International Nuclear Information System (INIS)

    Berkelium isotopes have been produced in 11B-induced reaction on 238U. The EC decay of 244Bk → 244Cm has been studied by carrying out the single and coincidence measurements of the γ-rays emitted during the de-excitation of the 244Cm levels. Radiochemical separations have been carried out to minimize the contribution from the fission products and target. The new half-life of 244Bk is obtained as 5.02 ± 0.03 h, which is close to the theoretically calculated value. The relative intensities of the decay γ-rays have been re-evaluated. Based on the coincidence measurements, a tentative partial level scheme for 244Bk → 244Cm decay has been proposed. (paper)

  19. Production of transuranium elements

    International Nuclear Information System (INIS)

    The Radiochemical Engineering Development Center (REDC) has the programmatic responsibility for the Department of Energy's Transuranium Element Program. Principle elements from the program are einsteinium, berkelium, and fermium. Targets containing curium oxide mixed with aluminum powder are fabricated by the REDC and irradiated in the Oak Ridge National Laboratory (ORNL) High Flux Isotope Reactor. Following an irradiation period of 6-12 months, targets are returned to the REDC for chemical processing. Processing operations consists of aluminum dejacketing in a caustic-nitrate solution, filtration, acid dissolution, solvent extraction, anion exchange, and finally a cation exchange to recover the actinides. The processing operations take place in heavily shielded hot cell facilities and all operations are carried out remotely. The chemistry for the separations has been well established over the 26-yr. operating life of the facility

  20. Dicty_cDB: SLF529 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ... 246 2e-61 1 ( AU285051 ) Dictyostelium discoideum gamete cDNA clone:FCL-AC...... 246 2e-61 1 ( AU285021 ) Dictyostelium discoideum gamete cDNA clone:FCL-AA... 246 2e-61 1 ( AU285015 ) Dictyostelium discoideum game...te cDNA clone:FCL-AA... 246 2e-61 1 ( AU284890 ) Dictyostelium discoideum gamete cD...NA clone:FC-BO1... 246 2e-61 1 ( AU284628 ) Dictyostelium discoideum gamete cDNA clone:FC-BF1... 246 2e-61 1... ( AU284420 ) Dictyostelium discoideum gamete cDNA clone:FC-AT2... 246 2e-61 1 (

  1. Synthesis of 14C-labelled hexahydro-1,3,5-trinitro-1,3,5-triazine (RDX), 2,4,6-trinitrotoluene (TNT), nitrocellulose (NC) and glycidyl azide polymer (GAP) for use in assessing the biodegradation potential of these energetic compounds

    International Nuclear Information System (INIS)

    Within the framework of an R and D project on bioremediation of soils contaminated with energetic compounds, the biodegradation of energetic products such as hexogen (RDX), trinitrotoluene (TNT), nitrocellulose (NC) and glycidyl azide polymer (GAP) is under study. Microcosm assays must be performed with radioactive carbon-14 labelled products in order to follow the biodegradation process. 14C-RDX was prepared by nitration of hexamethylenetetramine (HMTA) according to the Hale process. 14C-ring and methyl labelled TNTs synthesized according to the Dorey and Carper procedure. 14C-cellulose was synthesized from 14C-glucose by Acetobacter xylinum. Nitration of the 14C-cellulose yielded 14C-nitrocellulose. 14C-glycidyl azide polymer was obtained by polymerization and azidation of 14C-epichlorohydrin (ECH) which was synthesized from 14C-glycerol. Hydrochlorination of 14C-glycerol and epoxidation of the resulting 14C-1,3-dichloro 2-propanol yielded 14C-ECH. The syntheses of these 14C-labelled explosives are described in this paper. (Author)

  2. Synthesis and herbicidal activity of N- [ 2- (4,6-dimethoxypyrimidin -2-yloxy) benzylidene ] substituted amine derivatives%N-[2-(4,6-二甲氧基嘧啶-2-氧基)苯亚甲基]取代胺类衍生物的合成及除草活性

    Institute of Scientific and Technical Information of China (English)

    李元祥

    2011-01-01

    Six title compounds (3a - 3f) were synthesized using 2-hydroxybenzaldehyde as starting material by substitute reaction,addition reaction and elimination reaction. Thereinto,3a -3d were new compounds. All of the synthesized compounds were confirmed by 1H NMR, MS and elemental analysis. The preliminary bioassay results showed that the inhibition rate of synthesized compounds to the Echinochloa crus-galli, Digitaria sanguinalis, Bluegrass ,Amaranthus retroflexus and Chenopodium album reached 80% , except 3f to the E. Crus-galli was 55% at the application rate of 150 g a. I. /hm2. The inhibition rate of some of the compounds to E. Crus-galli,Poa annua,A. Retroflexus or C. Album reached 100% at the application rate of 150 g/hm2.%以水杨醛为原料,经取代、加成和消除反应合成了6个标题化合物(3a~3f),其中4个(3a~3d)为新化合物,其结构经核磁共振氢谱、质谱和元素分析确认.初步的除草活性测试结果表明,在有效成分150 g/hm2的剂量下,除化合物3f对稗草Echinochloa crus-galli的抑制率为55%外,其余5个化合物对供试杂草的抑制率均在80%以上,部分化合物对稗草、早熟禾Poa annua、反枝苋Amaranthus retroflexus或小藜Chenopodium album的抑制率达100%.

  3. Le Fārs sous la domination mongole. Politique et fiscalité (XIIIe-XIVe s.). Paris, Association pour l’avancement des études iraniennes, 2005, 246 p., index. (Cahiers de Studia Iranica, n° 31)

    OpenAIRE

    Durand-Guédy, David

    2007-01-01

    Quels furent les effets de la domination mongole en Iran ? La question est fondamentale, mais la réponse n’est pas aussi évidente que ce l’on pouvait penser. C’est ce que montre Denise Aigle dans ce livre important à partir de l’exemple jamais étudié de la région semi-autonome du Fārs. Partant du constat que la trame générale de la domination mongole en Iran est désormais bien connue, D. Aigle postule que seul le changement de l’échelle d’analyse est en mesure de faire avancer nos connaissanc...

  4. Symbolae Turcologicae. Studies in Honour of LARS JOHANSON. On his Sixtieth Birthday 8 March 1996. Ed. by Ârpâd Berta, Bernt Brendemoen and Claus Schönig. Swedish Research Institute in Istanbul, 6, Uppsala 1996,246 s. [ISBN 9186884077; ISSN 110OO333

    OpenAIRE

    ÖLMEZ, Mehmet

    2015-01-01

    Ülkemizde hemen çoğunlukla dilbilimi ve Türkoloji ayrı birer bilim dalı olarak görülmüştür. Her ne kadar uygulamada her iki bilim daiminin ayrı olamayacağı söylene gelmişse de, şu an için, çok az bilimadamı her iki dalın ölçülerini kullanarak ürünler vermiştir. Yurtdışında ise Türkolojiyi ve dilbilimini özümseyerek çalışmalar yayımlamış, öğrenci yetiştirmiş bilimadamlarının sayısı biraz daha fazladır. Bunların başında da Prof. Dr. Lars Johanson gelmektedir, ic...

  5. Council directive of 15 July 1980 amending the directives laying down the basic safety standards for the health protection of the general public and workers against the dangers of ionizing radiation (Official Journal of the European Communities l 246 of 17.9.1980)

    International Nuclear Information System (INIS)

    As provided for in the Euratom Treaty, and in particular Article 30 thereof, basic standards for the protection of the health of workers and the general public against the dangers arising from ionizing radiations must be established to enable each Member State in accordance with Article 33 of the Euratom Treaty to lay down provisions by legislation, regulation or administrative action to ensure compliance with such standards, to take the necessary measures with regard to teaching, education and vocational training and to make these provisions in harmony with the provisions applicable in this field in the other Member States. On 2. February 1959, the Council adopted a Directive establishing basic safety standards. These were modified partially by the Directives of 5. March 1962, 27. October 1966 and 1. June 1976. The present edition reproduces the complete text of the Directive amending the Directives laying down the basic safety standards for the health protection of the general public and workers against the dangers of ionizing radiation, adopted by the Council on 15. July 1980. These new standards take into consideration increasing scientific knowledge in the field of radiological protection and radiobiology and the practical experience of applying these Directives in national laws

  6. Crystal structures and conformations of two Diels–Alder adduct derivatives: 1,8-bis(thiophen-2-yl-14-oxatetracyclo[6.5.1.02,7.09,13]tetradeca-2(7,3,5-trien-10-one and 1,8-diphenyl-14-oxatetracyclo[6.5.1.02,7.09,13] tetradeca-2,4,6-trien-10-one

    Directory of Open Access Journals (Sweden)

    S. Gopinath

    2015-02-01

    Full Text Available The title compounds, C21H16O2S2 (I and C25H20O2 (II, are products of a tandem `pincer' Diels–Alder reaction consisting of [2 + 2] cycloadditions between benzo[c]furan and cyclopentanone. Each comprises a fused tetracyclic ring system containing two five-membered rings (in envelope conformations with the O atom as the flap and six-membered rings (in boat conformations. In addition, two thiophene rings in (I and two phenyl rings in (II are attached to the tetracyclic ring system. The cyclopentanone ring adopts a twisted conformation in (I and an envelope conformation in (II. In (I, the thiophene rings are positionally disordered over two sets of sites, with occupancy ratios of 0.901 (2:0.099 (2 and 0.666 (2:0.334 (2. In (II, the oxygen atom of the cyclopentanone ring is rotationally disordered over two sites with an occupancy ratio of 0.579 (4:0.421 (4. The molecular structure of (I is stabilized by an intramolecular C—H...O hydrogen bond, which generates an S(7 ring motif. In the crystal, the molecules are linked via weak C—H...O hydrogen bonds, which generate R22(16 ring motifs in (I and C(8 chains in (II. In both structures, the crystal packing also features C—H...π interactions. The crystal studied of compound (I was twinned by non-merohedry. The twin component is related by the twin law [−1 0 0 −0.101 1 −0.484 0 0 −1] operated by a twofold rotation axis parallel to the b axis. The structure of (I was refined with a twin scale factor of 0.275 (2.

  7. Affinity labeling of two nucleotide sites on Na,K-ATPase using 2'(3')-O-(2,4,6-trinitrophenyl)8-azidoadenosine 5'-[alpha-32P]diphosphate (TNP-8N3-[alpha-32P]ADP) as a photoactivatable probe. Label incorporation before and after blocking the high affinity ATP site with fluorescein isothiocyanate.

    Science.gov (United States)

    Ward, D G; Cavieres, J D

    1998-12-11

    ATP and its analogues act on the minimal functional unit of Na, K-ATPase, the alpha beta protomer, with high and low affinity effects. Fluorescein isothiocyanate (FITC) irreversibly blocks the high affinity, or catalytic, ATP site, and yet the surviving K+-phosphatase activity of soluble FITC-modified alphabeta protomers can be photoinactivated by 2'(3')-O-trinitrophenyl (TNP)-8N3-ADP (Ward, D. G., and Cavieres, J. D. (1998) J. Biol. Chem. 273, 14277-14284). We have now used TNP-8N3-[alpha-32P]ADP as a photoaffinity label for Na,K-ATPase. The native enzyme can be photolabeled at 5 microM TNP-8N3-[alpha-32P]ADP, and ATP or FITC treatment prevents labeling of the alpha chain. At 25 microM, however, TNP-8N3-[alpha-32P]ADP can be incorporated in the FITC-modified alpha chain, concurrently with the inactivation of the K+-phosphatase activity, to an extrapolated level of 0.5-1.2 mol of 32P-probe per mol of alpha chain. Photoinactivation and labeling are prevented by TNP-ADP, vanadate, or strophanthidin and are promoted by Na+ or Mg2+, but not K+. The cation effects suggest that the fluorescein-modified enzyme incorporates the TNP-8N3-[alpha-32P]ADP. Mg complex preferentially, and the free probe when in the E1 enzyme form and after occupation of a low-affinity Na+ site. Partial trypsinolysis reveals that the point of TNP-8N3-[alpha-32P]ADP attachment is on the C-terminal 58-kDa fragment of the FITC-modified alpha chain. The affinity labeling of the fluorescein enzyme by TNP-8N3-[alpha-32P]ADP endorses the view that two nucleotide sites can be occupied simultaneously in each alpha subunit of Na,K-ATPase. PMID:9837964

  8. DOI: 10.4025/actascibiolsci.v33i3.8011 Acta Scientiarum. Biological Sciences Maringá, v. 33, n. 3, p. 239-246, 2011 Acute inflammatory response in Nile tilapia fed probiotic Lactobacillus plantarum in the diet = Resposta inflamatória aguda em tilápia do Nilo alimentada com probiótico, Lactobacillus plantarum na dieta

    Directory of Open Access Journals (Sweden)

    Geovana Dotta

    2011-07-01

    Full Text Available The present study evaluated the acute inflammatory response induced bycarrageenin (500 £gg injected in the swim bladder of Nile tilapia, after fed or not probiotic supplemented diet. Fifty four fish were distributed in six treatments and three replicates: Group A: Fish fed unsupplemented diet: 0.5 mL saline-injected fish; fish injected with 500 £gg carrageenin diluted in 0.5 mL saline; Non-injected. Group B: Fish fed probiotic supplemented diet: saline-injected fish; carrageenin-injected fish; Non-injected. Fifteen days after feeding the fish were injected with carrageenin or saline. After six hours, inflammatory exudate was collected, as well as the blood for hematocrit, red blood cell (RBC and white blood cell (WBC counts, differential count of leucocytes and phagocytic activity in the blood. Supplementation with probiotic did not influence the RBC, hematocrit and the numbers of lymphocytes and basophils in the blood. The number of neutrophils was significantly higher in supplemented fish injected with carrageenin. Glucose concentration in supplemented and non-injected fish was higher than that observed in the saline injected ones. Probiotic potentialized the migration of cells to the inflammatory focus in the animals injected with the carrageenin irritant. In fish injected with saline and carrageenin occurred the greatest phagocytic activity in the blood in relation to those treatments.Este trabalho avaliou a resposta inflamatoria aguda induzida por injecao de carragenina (500 ƒÝg na bexiga natatoria de tilapia do Nilo suplementada ou nao com probiotico na racao. Cinquenta e quatro animais foram distribuidos em seis tratamentos com tres repeticoes: Grupo A: peixes alimentados com racao naosuplementada: Controle (injecao de 0,5 mL de solucao salina esteril; Carragenina (injecao de500 £gg de carragenina; Nao-injetada. Grupo B: peixes alimentados com racao suplementada com probiotico: Controle; Carragenina; Nao-injetada. Apos 15 dias de alimentacao foi injetado carragenina ou salina. Apos 6h, realizou-se a coleta de exsudato e sangue para determinacao do hematocrito, contagens totais de eritrocitos, leucocitos, contagem diferencial de leucocitos e atividade fagocitaria no sangue. A suplementacao com probiotico na racao nao influenciou o numero total de eritrocitos, o hematocrito e os numeros de linfocitos e basofilos no sangue dos animais. O numero de neutrofilos foi maior nos peixes suplementados com probiotico einjetados com carragenina. A glicose nos peixes suplementados com probiotico nao-injetados foi maior do que nos injetados com salina. A suplementacao com probiotico potencializou a migracao de celulas para o foco inflamatorio nos injetados com o flogogeno carragenina. Empeixes injetados com salina e carragenina, ocorreu maior atividade fagocitaria no sangue em relacao aos demais tratamentos.

  9. Bis(μ-azido-κ2N1:N1bis{(acetato-κ2O,O′[2,4,6-tris(2-pyridyl-1,3,5-triazine-κ3N2,N1,N6]lead(II}

    Directory of Open Access Journals (Sweden)

    Edward R. T. Tiekink

    2011-10-01

    Full Text Available The complete dinuclear title complex, [Pb2(C2H3O22(N32(C18H12N62], is generated by the application of a crystallographic centre of inversion. The PbII atom is coordinated by three N atoms of the tridentate ligand, two O atoms derived from an asymmetrically coordinating acetate ligand, and two azido-N atoms derived from two asymmetrically bridging azido ligands. The metal coordination geometry can be described as a square anti-prism with one position occupied by an unseen lone pair of electrons. In the ligand, the two coordinating pyridine rings are almost co-planar with the central pyrazine ring [dihedral angles = 0.47 (17 and 0.83 (18°], but the terminal ring is twisted [dihedral angle = 19.76 (18°]. In the crystal, the presence of π–π interactions [ring centroid distance between pyridyl rings = 3.581 (2 Å] leads to supramolecular chains along the a-axis direction.

  10. Bis{μ-2-[(4,6-bis{(2-hydroxy-5-methylphenyl[(pyridin-2-ylmethyl]amino}-1,3,5-triazin-2-yl[(pyridin-2-yl-κNmethyl]amino-κN]-4-methylphenolato-1:2κ2O:O}bis[(nitrato-κ2O,O′zinc]–acetonitrile–water (2/4/1

    Directory of Open Access Journals (Sweden)

    Palanisami Uma Maheswari

    2012-02-01

    Full Text Available The title compound, [Zn2(C42H38N9O32(NO32]·2CH3CN·0.5H2O, is a bis-phenolate-bridged dinuclear ZnII complex. The asymmetric unit comprises half the zinc complex (the full complex is completed by the application of a centre of inversion, one acetonitrile solvent molecule and a quarter of a water molecule (located on a twofold axis with half-occupancy; H atoms were not located for this molecule. Each triazine-based multidentate ligand uses a phenolate group to bridge ZnII ions, generating a Zn2O2 core. The ZnII ions are five-coordinate, with an additional long Zn—O contact [2.6465 (16 Å], and include a semi-bidentate nitrate ion and a N,N′,O-tridentate mode of the ligand in the coordination sphere. Non-coordinating pyridine groups form intramolecular O—H...N hydrogen bonds with phenol groups. As suggested by the short O...O donor–acceptor distances between the disordered water molecules and phenol O atoms, these groups also participate in hydrogen bonding.

  11. High Aluminous Orthopyroxene in the Join (Mg_<0.754>Fe_<0.246>)SiO_3-Al_2O_3 at 10 and 15 kbar : Implications for the Stability of Orthopyroxene-spinel-quartz in the Granulite Facies Metamorphic Rocks

    OpenAIRE

    Arima, Makoto

    1987-01-01

    The solubility of alumina in orthopyroxene in a part of the join (Mg_Fe_)SiO_3-Al_2O_3 has been determined experimentally in a temperature range of 950-1200℃ at 10 and 15 kbar. The join studied consists of a single phase field of orthopyroxene solid solution (ss) and an assemblage of orthopyroxene (ss)+spinel (ss)+quartz. The alumina content of orthopyroxene coexisting with spinel and quartz increases with increasing temperature and pressure. The present results suggest, combined with previou...

  12. {μ-5-[1,3-Bis(2,4,6-trimethylphenyl-3H-imidazolium-2-yl]-2-(2-oxoethenyl-1κC1furan-3-yl-2κC3}-μ-hydrido-bis(tetracarbonylrhenium tetrahydrofuran 0.67-solvate

    Directory of Open Access Journals (Sweden)

    David C. Liles

    2012-03-01

    Full Text Available The title complex, [Re2(C27H25N2O2H(CO8]·0.67C4H8O, was formed as a product in the reaction of a rhenium(I–Fischer carbene complex with a free NHC carbene. The coordination environment about the two Re atoms is slightly distorted octahedral, including a bridging H atom. The imidazolium and furan groups are almost coplanar, whereas the mesityl substituents show an almost perpendicular arrangement with respect to both heterocyclic units. Molecules of the complex pack in such a way as to form channels parallel with the bc unit-cell face diagonal running through the unit face diagonal. These channels are partially occupied by tetrahydrofuran solvent molecules.

  13. Dicty_cDB: Contig-U10099-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ostelium discoideum vegetative cDNA clone:VS... 246 0.0 6 ( AU271815 ) Dictyostelium discoideum gamete cDNA ...clone:FC-IC0... 246 0.0 5 ( AU272000 ) Dictyostelium discoideum gamete cDNA clone:FC-IC0... 313 0.0 4 ( AU27...5198 ) Dictyostelium discoideum gamete cDNA clone:FC-IC1... 246 e-180 5 ( AU27519...9 ) Dictyostelium discoideum gamete cDNA clone:FC-IC1... 246 e-180 5 ( AU275139 ) Dictyostelium discoideum gamete... cDNA clone:FC-IC1... 246 e-180 5 ( AU275138 ) Dictyostelium discoideum gamete cDNA clone:FC-IC1... 246

  14. Dicty_cDB: SLG167 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 125 1 ( X55972 ) D. discoideum EF1-II gene for elongation factor 1 a... 246 4e-61 1 ( AU284939 ) Dictyostelium discoideum gamete... cDNA clone:FC-BQ1... 246 4e-61 1 ( AU284921 ) Dictyostelium discoideum gamete... cDNA clone:FC-BP2... 246 4e-61 1 ( AU284887 ) Dictyostelium discoideum gamete cDNA clone:F...C-BO1... 246 4e-61 1 ( AU284668 ) Dictyostelium discoideum gamete cDNA clone:FC-BG1... 246 4e-61 1 ( AU28451...5 ) Dictyostelium discoideum gamete cDNA clone:FC-BB0... 246 4e-61 1 ( AU284480 )

  15. Comparison of bioaugmented EGSB and GAC–FBB reactors and their combination with aerobic SBR for the abatement of chlorophenols

    OpenAIRE

    Puyol, Daniel; Monsalve, Víctor Manuel; Sanchís, Sonia; Sanz, José Luis; Fernández Mohedano, Ángel; Rodríguez, Juan José

    2015-01-01

    The biological abatement of 2,4,6-trichlorophenol (246TCP) and its chlorinated degradation byproducts using anaerobic and aerobic biological reactors coupled in series has been studied. The performance of an anaerobic fluidized bed biofilm reactor (FBBR) and expanded granular sludge bed (EGSB) reactors bioaugmented with Desulfitobacterium strains was compared within a wide range of 246TCP loading rates. The bioaugmentation of an EGSB reactor with Desulfitobacterium strains enhanced the chloro...

  16. 78 FR 42544 - Outer Continental Shelf (OCS), Gulf of Mexico (GOM), Oil and Gas Lease Sale, Western Planning...

    Science.gov (United States)

    2013-07-16

    ... Bureau of Ocean Energy Management Outer Continental Shelf (OCS), Gulf of Mexico (GOM), Oil and Gas Lease Sale, Western Planning Area (WPA) Lease Sales 238, 246, and 248 MMAA104000 AGENCY: Bureau of Ocean... Supplemental EIS for proposed WPA lease sales beginning with Lease Sale 238 (WPA Lease Sales 238, 246, and...

  17. Impact of nutrient composition on a degradative biofilm community

    DEFF Research Database (Denmark)

    Møller, Søren; Korber, Darren R.; Wolfaardt, Gideon M.; Molin, Søren; Caldwell, Douglas E.

    1997-01-01

    A microbial community was cultivated in flow cells with 2,4,6-trichlorobenzoic acid (2,4,6-TCB) as sole carbon and energy source and was examined with scanning confocal laser microscopy and fluorescent molecular probes. The biofilm community which developed under these conditions exhibited a char...

  18. Drug: D08222 [KEGG MEDICUS

    Lifescience Database Archive (English)

    Full Text Available D08222 Drug Milnacipran (INN) C15H22N2O 246.1732 246.348 D08222.gif Antidepressant ...rgic synapse map07027 Antidepressants map07234 Neurotransmitter transporter inhib...S N06A ANTIDEPRESSANTS N06AX Other antidepressants N06AX17 Milnacipran D08222 Milnacipran (INN) USP drug cla

  19. Unigene BLAST: CBRC-CELE-04-0018 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-CELE-04-0018 gnl|UG|Cel#S5711808 Caenorhabditis elegans Serpentine Receptor, c...lass H family member (srh-246) (srh-246) mRNA, complete cds /cds=p(1,993) /gb=NM_070881 /gi=17563411 /ug=Cel.29221 /len=993 1e-58 36% ...

  20. bu ke kao xu shu zhe zhi zai shen shi (不可靠叙述者之再审视)

    DEFF Research Database (Denmark)

    Hansen, Per Krogh

    2008-01-01

    Kinesisk oversættelse af "Reconsidering the Unreliable Narrator" in Semiotica 165 - 1/4 2007: 227-246. Oversætter: Shang Biwu.......Kinesisk oversættelse af "Reconsidering the Unreliable Narrator" in Semiotica 165 - 1/4 2007: 227-246. Oversætter: Shang Biwu....

  1. Drug: D03028 [KEGG MEDICUS

    Lifescience Database Archive (English)

    Full Text Available D03028 Drug Azanidazole (USAN/INN) C10H10N6O2 246.0865 246.2254 D03028.gif Antiprotozoa...asitics Agents against Amebiasis and other antiprotozoals Nitroimidazole derivatives Azanidazole [ATC:G01AF1

  2. Relationship between Indian summer monsoon rainfall and position of Pacific Ocean warm pool

    Digital Repository Service at National Institute of Oceanography (India)

    Gopinathan, C.K.; Sastry, J.S.

    stream_size 5 stream_content_type text/plain stream_name Indian_J_Mar_Sci_19_246.pdf.txt stream_source_info Indian_J_Mar_Sci_19_246.pdf.txt Content-Encoding ISO-8859-1 Content-Type text/plain; charset=ISO-8859-1 ...

  3. EST Table: FS919087 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available FS919087 E_FL_fufe_46E24_F_0 10/09/28 76 %/246 aa ref|XP_970542.1| PREDICTED: similar to brix...B12626-PA 10/09/10 76 %/246 aa gi|91090402|ref|XP_970542.1| PREDICTED: similar to brix domain-containing protein 2 [Tribolium castaneum] FS911686 fufe ...

  4. 40 CFR 437.44 - Effluent limitations attainable by the application of the best available technology economically...

    Science.gov (United States)

    2010-07-01

    ... provided in 40 CFR 125.30 through 125.32 or 437.40(b), any existing facility subject to this subpart which...-Cresol p-Cresol n-Decane Fluoranthene n-Octadecane Phenol Pyridine 2,4,6-trichlorophenol Metal parameters... parameters Acetone Acetophenone 2-Butanone o-Cresol p-Cresol Phenol Pyridine 2,4,6-trichlorophenol...

  5. 48 CFR 2152.070 - Applicable clauses.

    Science.gov (United States)

    2010-10-01

    ...-3Gratuities 52.203-5Covenant against Contingent Fees 52.203-6Restrictions on Subcontractor Sales to the...-7Insurance—Liability to Third Persons 52.232-9Limitation on Withholding of Payments 52.232-17Interest 52.232... Contracts) 52.246-4Inspection of Services—Fixed Price 52.246-25Limitation of Liability—Services...

  6. USING ROTIFER POPULATION DEMOGRAPHIC PARAMETERS TO ASSESS IMPACTS OF THE DEGRADATION PRODUCTS FROM TRINITROTOLUENE PHYTOREMEDIATION

    Science.gov (United States)

    The objective of this study was to evaluate the aquatic chronic lethal and sublethal toxicity effects from the phytoremediation of water contaminated with 2,4,6-trinitrotoluene (2,4,6-TNT) by the wetland plant species Myriophyllum aquaticum (parrot feather). Rotifers (Brachionus...

  7. 78 FR 64242 - Outer Continental Shelf (OCS), Gulf of Mexico (GOM), Oil and Gas Lease Sales, Western Planning...

    Science.gov (United States)

    2013-10-28

    ... Bureau of Ocean Energy Management Outer Continental Shelf (OCS), Gulf of Mexico (GOM), Oil and Gas Lease Sales, Western Planning Area (WPA) Lease Sales 238, 246, and 248 AGENCY: Bureau of Ocean Energy... proposed OCS oil and gas Lease Sales 238, 246, and 248, which are tentatively scheduled to be held...

  8. Impact of nutrient composition on a degradative biofilm community

    DEFF Research Database (Denmark)

    Møller, Søren; Korber, Darren R.; Wolfaardt, Gideon M.;

    1997-01-01

    A microbial community was cultivated in flow cells with 2,4,6-trichlorobenzoic acid (2,4,6-TCB) as sole carbon and energy source and was examined with scanning confocal laser microscopy and fluorescent molecular probes. The biofilm community which developed under these conditions exhibited a...... physicochemistry of degradative biofilm communities....

  9. Nuclear Chemistry Institute, Mainz University. Annual Report 1995

    International Nuclear Information System (INIS)

    The annual report of the Institut fuer Kernchemie addresses inter alia three main research activities. The first belongs to the area of basic research, covering studies in the fields of nuclear fission, chemistry of the super-heavy elements and of heavy-ion reactions extending from the Coulomb barrier to relativistic energies, and nuclear astrophysics in connection with the ''r process''. By means of laser technology, high-precision data could be measured of the ionization energies of berkelium and californium. Studies of atomic clusters in the vacuum of an ionization trap revealed interesting aspects. The second major activity was devoted to the analysis of environmental media, applying inter alia neutron activation analysis and resonance ionization mass spectroscopy (RIMS). The third activity resulted in the development of novel processes, or the enhancement of existing processes or methods, for applications in basic research work and in environmental analytics. Another item of interest is the summarizing report on the operation of the TRIGA research reactor. (orig./SR)

  10. Paul Scherrer Institute Scientific Report 1999. Volume I: Particles and Matter

    International Nuclear Information System (INIS)

    Although originally planned for fundamental research in nuclear physics, the particle beams of pions, muons, protons and neutrons are now used in a large variety of disciplines in both natural science and medicine. The beams at PSI have the world's highest intensities and therefore allow certain experiments to be performed, which would not be possible elsewhere. The highlight of research this year was the first-ever determination of the chemical properties of the superheavy element 107 Bohrium. This was undertaken, by an international team led by H. Gaeggeler of PSI's Laboratory for Radiochemistry. Bohrium was produced by bombarding a Berkelium target with Neon ions from the Injector I cyclotron and six atoms were detected after having passed through an online gas chromatography device. At the Laboratory for Particle Physics the focus has shifted from nuclear physics to elementary particle physics with about a fifty-fifty split between investigations of rare processes or particle decays using the high intensity muon, pion and recently also polarized neutron beams of PSI, and research at the highest energy frontier at CERN (Geneva) and DESY (Hamburg). Important space instrumentation has been contributed by the Laboratory for Astrophysics to the European Space Agency and NASA satellite programmes. The Laboratory for Micro and Nanotechnology continued to focus on research into molecular nanotechnology and SiGeC nanostructures, the latter with the aim of producing silicon based optoelectronics. Progress in 1999 in these topical areas is described in this report. A list of scientific publications in 1999 is also provided

  11. Investigations for the influence of geochemical parameters on the sorption and desorption of lanthanides and uranium onto opalinus clay as potential host rock for a repository

    International Nuclear Information System (INIS)

    The development of a disposal in deep geological formations for radioactive waste is a very important task for the future. The safety assessment for more than a hundred thousand years needs a full understanding of all processes of interaction between the radioactive waste and the surrounded formations. This work contributes to this understanding. The interaction between lanthanides (homologues of the actinides americium, curium and berkelium) / uranium and the host rock opalinus clay under influence of organic substances (NOM) have been analyzed and discussed. The complex system was split into 3 binary basic systems with the following interactions - Interactions between lanthanides / uranium and NOM - Interactions between lanthanides / uranium and the opalinus clay - Interactions between NOM and opalinus clay All binary systems can be influenced by geological parameters like pH, ion strength and competing cations. The sorption / desorption of the lanthanides onto the opalinus clay is analyzed via inductively coupled plasma mass spectrometry. For the investigation of the complexation behavior of metals with NOM we used capillary electrophoresis coupled with inductively coupled plasma mass spectrometry. Under these conditions the chosen model organic humic acid affected the sorption of the lanthanides onto opalinus clay favorably. The smaller organic compounds, which dominate in the composition of the clay organics, remobilized the metals after sorption onto clay and the sorption can be inhibited by NOM. Due to the reduced metal sorption onto Opalinus clay by NOM, a migration through the clay may be possible.

  12. Use of Low-cost Adsorbents to Chlorophenols and Organic Matter Removal of Petrochemical Wastewater

    Directory of Open Access Journals (Sweden)

    Aretha Moreira de Oliveira

    2013-11-01

    Full Text Available The removal of 2,4 diclorophenol (2,4-DCF and 2,4,6 trichlorophenol (2,4,6 TCF present in  petrochemical wastewater was evaluated using low-cost adsorbents, such as chitin, chitosan and coconut shells. Batch studies showed that the absorption efficiency for 2,4 DCF and 2,4,6 TCF follow the order: chitosan > chitin > coconut shells. Langmuir and Freundlich models have been applied to experimental isotherms data, to better understand the adsorption mechanisms. Petrochemical wastewater treatment with fixed bed column system using chitinous adsorbents showed a removal of COD (75% , TOG (90% and turbidity (74-89%.

  13. Wybrane cechy ruchu turystycznego w Słowińskim Parku Narodowym na podstawie badań ankietowych = The selected elements of the tourist activity in the Slowinski National Park in the base of the questionnaire survey

    OpenAIRE

    Parzych, Krzysztof

    2014-01-01

    Parzych Krzysztof. Wybrane cechy ruchu turystycznego w Słowińskim Parku Narodowym na podstawie badań ankietowych = The selected elements of the tourist activity in the Slowinski National Park in the base of the questionnaire survey. Journal of Health Sciences. 2014;4(13):246-256. ISSN 1429-9623 / 2300-665X. http://journal.rsw.edu.pl/index.php/JHS/article/view/2014%3B4%2813%29%3A246-256 http://www.ojs.ukw.edu.pl/index.php/johs/article/view/2014%3B4%2813%29%3A246-256 https://pbn.nau...

  14. AcEST: DK962280 [AcEST

    Lifescience Database Archive (English)

    Full Text Available TST39A01NGRL0013_H03 597 Adiantum capillus-veneris mRNA. clone: TST39A01NGRL0013_H03. 5' end seq ... ositives = 27/42 (64%) Frame = +1 Query: 121 SKLIRARAE LDERFRSSGRKAALWEEIAQALQKAEVSRDGQQ 246 +KL++++ ELDER ... ame = +1 Query: 43 PVLHDDGNVRKKDHKKRSKNWSMPETSKLIRARAE LDERFRSSGRKAALWEEIAQALQK- 219 P + D+ + K+ K++S+ + E ... , Positives = 24/39 (61%) Frame = +1 Query: 130 IRARAE LDERFRSSGRKAALWEEIAQALQKAEVSRDGQQ 246 IR+RA LDER S ... , Positives = 23/39 (58%) Frame = +1 Query: 130 IRARAE LDERFRSSGRKAALWEEIAQALQKAEVSRDGQQ 246 +R RAE LDE+ + ...

  15. Prompt neutron multiplicities for the transplutonium nuclides

    International Nuclear Information System (INIS)

    The direct determination of the average prompt neutron emission values is reviewed, and a method of comparing different sites of neutron emission multiplicity distribution values is described. Measured and recommended values are tabulated for these nuclides: 241Am, 242Am, 242Cm, 243Cm, 244Cm, 246Cm, 247Cm, 248Cm, 250Cm, 245Cm, 249Bk, 246Cf, 249Cf, 250Cf, 252Cf, 254Cf, 251Cf, 253Es, 254Es, 244Fm, 246Fm, 255Fm, 252No, 254Fm, 256Fm, 257Fm. 59 refs., 24 tabs

  16. Vladimír Bergauer a česká eugenika

    Czech Academy of Sciences Publication Activity Database

    Šimůnek, Michal V.

    Praha: Karolinum, 2006 - (Černý, K.; Svobodný, P.), s. 205-243 ISBN 80-246-1099-X Institutional research plan: CEZ:AV0Z80630520 Keywords : eugenics - phycians - biographies Subject RIV: AB - History

  17. Differentially expressed proteins in human MCF-7 breast cancer cells sensitive and resistant to paclitaxel

    Czech Academy of Sciences Publication Activity Database

    Pavlíková, N.; Bartoňová, I.; Balušíková, K.; Kopperová, D.; Halada, Petr; Kovář, J.

    2015-01-01

    Roč. 333, č. 1 (2015), s. 1-10. ISSN 0014-4827 Institutional support: RVO:61388971 Keywords : Breast cancer * Taxane resistance * 2-D electrophoresis Subject RIV: CE - Biochemistry Impact factor: 3.246, year: 2014

  18. "Salát" modernosti Václava Nebeského a Emil Filla. Jak psát o československém moderním umění?

    Czech Academy of Sciences Publication Activity Database

    Lahoda, Vojtěch

    Praha: Karolinum, 2012 - (Rakušanová, M.), s. 68-78 ISBN 978-80-246-2114-2 Institutional support: RVO:68378033 Keywords : historiography * "diverse" modernity * nationality * Czechness * national art * modernism Subject RIV: AL - Art, Architecture, Cultural Heritage

  19. Innovative potential in the regions of the Czech Republic, economic, societal and regional aspects

    Czech Academy of Sciences Publication Activity Database

    Kunc, J.; Klapka, Pavel; Frantál, Bohumil

    Brno : Masarykova univerzita, 2008, s. 246-251 ISBN 978-80-210-4600-9 Institutional research plan: CEZ:AV0Z30860518 Keywords : innovative potential * correlation analysis * regions of the Czech Republic Subject RIV: AH - Economics

  20. Epos o Gilgamešovi v pojetí sochaře Jana Koblasy

    Czech Academy of Sciences Publication Activity Database

    Nešlehová, Mahulena

    Praha: Karolinum, 2012 - (Rakušanová, M.), s. 18-32 ISBN 978-80-246-2114-2 Institutional support: RVO:68378033 Keywords : graphic art * 20th and 21th century Subject RIV: AL - Art, Architecture, Cultural Heritage

  1. Dicty_cDB: Contig-U14449-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available xlsnnnnnkknnnnnnnkeknn nkkrv*shlkiphqdlxnqih*mevvn*enqkvlkkvimxii*milifq...d = Plus / Plus Query: 187 gaaaagagtataatctcatctaaaaattcctcaccaagatctttanaat...taaaaattcctcaccaagatctttanaatcaaattcatta 246 Query: 247 aatggaagtagtaaattgagaaaatcaaaaggttttaaaaaaggtgattatgana...atcaaaaggttttaaaaaaggtgattatganaataat 306 Query: 307 atagatgatattgatattccaacttcat...ttgaagttgatcaacaaagattagataatganatt 120 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Sbjct:

  2. Sequence Classification: 894414 [

    Lifescience Database Archive (English)

    Full Text Available n S. cerevisiae, which is a model system for studying replication of positive-strand RNA viruses in their natural hosts; Yor246cp || http://www.ncbi.nlm.nih.gov/protein/6324820 ...

  3. Surface plasmon resonance enhanced upconversion luminescence in aqueous media for TNT selective detection.

    Science.gov (United States)

    Tu, Nina; Wang, Leyu

    2013-07-18

    We present a novel report on a surface plasmon resonance enhanced upconversion luminescence strategy in aqueous media for highly sensitive and selective detection of 2,4,6-trinitrotoluene (TNT). PMID:23739225

  4. Cenzurní zásahy do české kultury v letech 1948-1989

    Czech Academy of Sciences Publication Activity Database

    Adamová, Karolina

    Praha : Karolinum, 2004 - (Malý, K.; Soukup, L.), s. 281-306 ISBN 80-246-0863-4 Institutional research plan: CEZ:AV0Z7068917 Keywords : Czechoslovakia * Czech culture * censorhip Subject RIV: AG - Legal Sciences

  5. Kognitivní hnutí v americké psychologii

    Czech Academy of Sciences Publication Activity Database

    Sedláková, Miluše

    Praha : Universita Karlova, 2002, s. 210-280 ISBN 80-246-0300-4 Institutional research plan: CEZ:AV0Z7025918 Keywords : cognitive psychology * connectionism * history of psychology Subject RIV: AN - Psychology

  6. The Lacanian Destiny of the Signifier

    Czech Academy of Sciences Publication Activity Database

    Fulka, Josef

    Praha: Litteraria Pragensia, 2007 - (Fehr, J.; Kouba, P.), s. 220-246 ISBN 80-7308-139-3 Institutional research plan: CEZ:AV0Z90090514 Keywords : Psychoanalysis * Jacques Lacan * the symbolic * sexual difference Subject RIV: AA - Philosophy ; Religion

  7. Optická tloušťka atmosféry jako parametr pro stanovení obyvatelných zón exoplanet

    Czech Academy of Sciences Publication Activity Database

    Pintr, Pavel

    2013-01-01

    Roč. 58, č. 9 (2013), s. 243-246. ISSN 0447-6441 Institutional support: RVO:61389021 Keywords : Habitable zones * exoplanets * stellar spectral classes Subject RIV: JA - Electronics ; Optoelectronics, Electrical Engineering

  8. On the nature of γ′ phase cutting and its effect on high temperature and low stress creep anisotropy of Ni-base single crystal superalloys

    Czech Academy of Sciences Publication Activity Database

    Jácome, L. A.; Nörtershäuser, P.; Somsen, C.; Dlouhý, Antonín; Eggeler, G.

    2014-01-01

    Roč. 69, MAY (2014), s. 246-264. ISSN 1359-6454 Institutional support: RVO:68081723 Keywords : Ni-base single crystal superalloys * Creep * Anisotropy * Dislocation * Rafting Subject RIV: JG - Metallurgy Impact factor: 4.465, year: 2014

  9. K. Pavlištík

    Czech Academy of Sciences Publication Activity Database

    Stavělová, Daniela

    Praha : Divadelní ústav, 2001, s. 246. ISBN 80-7008-112-0 Institutional research plan: CEZ:AV0Z9058907 Keywords : dancer, choreographer, organizer Subject RIV: AC - Archeology, Anthropology, Ethnology

  10. Národnostní statut a snahy o řešení minoritní otázky ve třicátých letech

    Czech Academy of Sciences Publication Activity Database

    Němeček, Jan

    Praha: Karolinum, 2010 - (Malý, K.; Soukup, L.), s. 575-594 ISBN 978-80-246-1718-3 Institutional research plan: CEZ:AV0Z80150510 Keywords : minorities question * 20th century * law Subject RIV: EF - Botanics

  11. Women and the labor market in the Czech Republic: transition from a socialist to a social-democratic regime?

    Czech Academy of Sciences Publication Activity Database

    Hamplová, Dana

    Cheltenham : Edward Elgar Publishing, 2006 - (Blossfeld, H.; Hofmeister, H.), s. 224-246 ISBN 978 1 845426644 Institutional research plan: CEZ:AV0Z70280505 Keywords : mobility * women * labour market Subject RIV: AO - Sociology, Demography

  12. Celosvětový systém a (různé) globalizace

    Czech Academy of Sciences Publication Activity Database

    Suša, Oleg

    Praha : Karolinum, 2010 - (Šubrt, J.; Árnason, J.), s. 167-180 ISBN 978-80-246-1822-7 Institutional research plan: CEZ:AV0Z90090514 Keywords : globalisation * world system Subject RIV: AA - Philosophy ; Religion

  13. Pediatric Palliative Care: A Personal Story

    Medline Plus

    Full Text Available ... count__/__total__ Find out why Close Pediatric Palliative Care: A Personal Story NINRnews Subscribe Subscribed Unsubscribe 246 ... and her family. The story demonstrates how palliative care can positively influence a patient's and family's experience ...

  14. Loggerhead oceanic stage duration

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — This study involves analysis of skeletal growth marks in humerus bones of 246 juvenile loggerhead sea turtles (Caretta caretta) stranded dead along the Atlantic US...

  15. Sociální prostor

    Czech Academy of Sciences Publication Activity Database

    Osman, Robert

    1. Praha: Karolinum, UK Praha, 2014 - (Osman, R.; Matoušek, R.), s. 1-26 ISBN 978-80-246-2733-5 Institutional support: RVO:68145535 Keywords : geography * theory * cultural turn Subject RIV: DE - Earth Magnetism, Geodesy, Geography

  16. Nepůvodní druhy rostlin, možné příčiny a důsledky invazí

    Czech Academy of Sciences Publication Activity Database

    Pergl, Jan; Pyšek, Petr; Perglová, Irena

    Praha: Univerzita Karlova v Praze, 2015 - (Frouz, J.; Moldan, B.), s. 33-47 ISBN 978-80-246-2667-3 Institutional support: RVO:67985939 Keywords : invasions * biocontrol * traits Subject RIV: EH - Ecology, Behaviour

  17. Contrasting patterns of hot spell effects on morbidity and mortality for cardiovascular diseases in the Czech Republic, 1994-2009

    Czech Academy of Sciences Publication Activity Database

    Hanzlíková, Hana; Plavcová, E.; Kynčl, J.; Kříž, B.; Kyselý, J.

    2015-01-01

    Roč. 59, č. 11 (2015), s. 1673-1684. ISSN 0020-7128 Institutional support: RVO:67985530 Keywords : hot spells * cardiovascular disease * cerebrovascular disease Subject RIV: DE - Earth Magnetism, Geodesy, Geography Impact factor: 3.246, year: 2014

  18. Úvod obratem

    Czech Academy of Sciences Publication Activity Database

    Osman, Robert

    1. Praha : Karolinum, UK Praha, 2014 - (Osman, R.; Matoušek, R.), s. 9-18 ISBN 978-80-246-2733-5 Institutional support: RVO:68145535 Keywords : geography * theory * cultural turn Subject RIV: DE - Earth Magnetism, Geodesy, Geography

  19. Barokní zahrady v Čechách

    Czech Academy of Sciences Publication Activity Database

    Dobalová, Sylva

    Praha: Karolinum, 2015 - (Macek, P.; Biegel, R.; Bachtík, J.), s. 677-701 ISBN 978-80-246-2736-6 Institutional support: RVO:68378033 Keywords : Baroque gardens * grotto * landscape * orangery Subject RIV: AL - Art, Architecture , Cultural Heritage

  20. Nástěnná malba v kontextu barokní architektury

    Czech Academy of Sciences Publication Activity Database

    Mádl, Martin

    Praha: Karolinum, 2015 - (Macek, P.; Biegel, R.; Bachtík, J.), s. 653-675 ISBN 978-80-246-2736-6 Institutional support: RVO:68378033 Keywords : Baroque * architecture * ceiling painting Subject RIV: AL - Art, Architecture , Cultural Heritage