WorldWideScience

Sample records for berkelium 245

  1. Chemistry of berkelium: a review

    International Nuclear Information System (INIS)

    Hobart, D.E.; Peterson, J.R.

    1985-01-01

    Element 97 was first produced in December 1949, by the bombardment of americium-241 with accelerated alpha particles. This new element was named berkelium (Bk) after Berkeley, California, the city of its discovery [Thompson, Ghiorso, and Seaborg, Phys. Rev. 77, 838 (1950); 80, 781 (1950)]. In the 36 years since the discovery of Bk, a substantial amount of knowledge concerning the physicochemical properties of this relatively scarce transplutonium element has been acquired. All of the Bk isotopes of mass numbers 240 and 242 through 251 are presently known, but only berkelium-249 (β - decay, 0.125 MeV, t/sub 1/2/ = 325 days) is available in sufficient quantities for bulk chemical studies. About 0.7 gram of this isotope has been isolated at the HFIR/TRU Complex in Oak Ridge, Tennessee in the last 18 years. Over the same time period, the scale of experimental work using berkelium-249 has increased from the tracer level to bulk studies at the microgram level to solution and solid state investigations with milligram quantities. Extended knowledge of the physicochemical behavior of berkelium is important in its own right, because Bk is the first member of the second half of the actinide series. In addition, such information should enable more accurate extrapolations to the predicted behavior of heavier elements for which experimental studies are severely limited by lack of material and/or by intense radioactivity

  2. Berkelium (4) and cerium (4) extraction with tertiary amines

    International Nuclear Information System (INIS)

    Milyukova, M.S.; Malikov, D.A.; Myasoedov, B.V.

    1978-01-01

    Oxidation of indicator quantities of berkelium and cerium by a mixture of silver nitrate and ammonium persulfate in the solutions of nitric and sulfuric acid has been examined. The stability of the elements in a tetravalent state and their extraction by the solutions of ternary amines have been investigated. It has been established that berkelium and cerium oxidation under these conditions occurs under the effect of ions of divalent silver which is formed owing to oxidation of monovalent silver by peroxide sulfate ions. The following supposition has been put forward: a difference in the behaviour of tetravalent berkelium and cerium during their extraction by ternary amines is explained by their different stability in this state, but not by the formation of complex compounds with nitrate ions

  3. Citric complexes of trivalent cerium and berkelium

    International Nuclear Information System (INIS)

    Boulhassa, S.

    1977-01-01

    The extraction by thenoyltrifluoroacetone (TTA) in benzene of trivalent cerium, berkelium and californium, at the indicator scale, hydrolysis and complexation by citric acid of these cations are studied. The radionuclides used were 144 Ce, 249 Bk and 249 Cf respectively γ, β and α emitters. The solvent extraction technique of the elements by TTA in benzene from a perchloric medium at the ionic stength 0.1 was employed. The distribution coefficients D were measured by the γ, β or α radiometry. Cerium and berkelium, which have a comparable redox behavior, show in solution a relatively stable valency IV. Therefore the study by solvent extraction of their trivalent form required the standing up of complete reducing conditions of these elements and their stabilization in solution at the valency III. The thermodynamic data obtained for berkelium and californium contribute to understand the chemistry of these elements and permit to complete the third 'tetrad branch' of 5f elements from Cm 3+ to Es 3+ . This tetrad effect is a manifestation of thermodynamic consequence of the 'nephelauxetic effect'. As for Ce(III), the data confirm the pronounced acid property and may be show no neglected ligand effect for f 1 configuration [fr

  4. Chelation and stabilization of berkelium in oxidation state +IV

    Science.gov (United States)

    Deblonde, Gauthier J.-P.; Sturzbecher-Hoehne, Manuel; Rupert, Peter B.; An, Dahlia D.; Illy, Marie-Claire; Ralston, Corie Y.; Brabec, Jiri; de Jong, Wibe A.; Strong, Roland K.; Abergel, Rebecca J.

    2017-09-01

    Berkelium (Bk) has been predicted to be the only transplutonium element able to exhibit both +III and +IV oxidation states in solution, but evidence of a stable oxidized Bk chelate has so far remained elusive. Here we describe the stabilization of the heaviest 4+ ion of the periodic table, under mild aqueous conditions, using a siderophore derivative. The resulting Bk(IV) complex exhibits luminescence via sensitization through an intramolecular antenna effect. This neutral Bk(IV) coordination compound is not sequestered by the protein siderocalin—a mammalian metal transporter—in contrast to the negatively charged species obtained with neighbouring trivalent actinides americium, curium and californium (Cf). The corresponding Cf(III)-ligand-protein ternary adduct was characterized by X-ray diffraction analysis. Combined with theoretical predictions, these data add significant insight to the field of transplutonium chemistry, and may lead to innovative Bk separation and purification processes.

  5. Possible stabilization of the tetravalent oxidation state of berkelium and californium in acetonitrile with triphenylarsine oxide

    International Nuclear Information System (INIS)

    Payne, G.F.; Peterson, J.R.

    1987-01-01

    It appears that we may have prepared Bk(IV) nitrate.nTPAs0 and Bk(IV) perchlorate.nTPAs0 complexes which formed the corresponding Cf(IV) complexes through the beta decay of Bk-249. Definitive proof should come from similar experiments with quantities of Bk-249 large enough to allow spectrophotometric detection of the characteristic f→f transitions in these berkelium and californium species. It is clear, however, that TPAs0 and acetonitrile can play a pivotal role in the stabilization of lanact(IV) species

  6. 48 CFR 245.609 - Donations.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Donations. 245.609 Section 245.609 Federal Acquisition Regulations System DEFENSE ACQUISITION REGULATIONS SYSTEM, DEPARTMENT OF... Inventory 245.609 Donations. Agencies may donate, with GSA approval and without expense to the United States...

  7. Dicty_cDB: SLH245 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SL (Link to library) SLH245 (Link to dictyBase) - - - Contig-U01321-1 SLH245F (Link to Original site) SLH2...45F 294 - - - - - - Show SLH245 Library SL (Link to library) Clone ID SLH245 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/SL/SLH2-B/SLH245Q.Seq.d/ Representative seq. ID SLH24...5F (Link to Original site) Representative DNA sequence >SLH245 (SLH245Q) /CSM/SL/SLH2-B/SLH245Q.Seq.d/ CACCA...significant alignments: (bits) Value SLH245 (SLH245Q) /CSM/SL/SLH2-B/SLH245Q.Seq.d/ 513 e-145 SLF841 (SLF841

  8. 33 CFR 245.15 - Delegation.

    Science.gov (United States)

    2010-07-01

    ... 33 Navigation and Navigable Waters 3 2010-07-01 2010-07-01 false Delegation. 245.15 Section 245.15 Navigation and Navigable Waters CORPS OF ENGINEERS, DEPARTMENT OF THE ARMY, DEPARTMENT OF DEFENSE REMOVAL OF WRECKS AND OTHER OBSTRUCTIONS § 245.15 Delegation. District Engineers may undertake removal without prior...

  9. 8 CFR 245.6 - Interview.

    Science.gov (United States)

    2010-01-01

    ... 8 Aliens and Nationality 1 2010-01-01 2010-01-01 false Interview. 245.6 Section 245.6 Aliens and... ADMITTED FOR PERMANENT RESIDENCE § 245.6 Interview. Each applicant for adjustment of status under this part shall be interviewed by an immigration officer. This interview may be waived in the case of a child...

  10. 48 CFR 245.603 - Disposal methods.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Disposal methods. 245.603 Section 245.603 Federal Acquisition Regulations System DEFENSE ACQUISITION REGULATIONS SYSTEM, DEPARTMENT... Contractor Inventory 245.603 Disposal methods. ...

  11. 49 CFR 199.245 - Contractor employees.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 3 2010-10-01 2010-10-01 false Contractor employees. 199.245 Section 199.245... Prevention Program § 199.245 Contractor employees. (a) With respect to those covered employees who are contractors or employed by a contractor, an operator may provide by contract that the alcohol testing...

  12. 24 CFR 245.120 - Meeting space.

    Science.gov (United States)

    2010-04-01

    ... 24 Housing and Urban Development 2 2010-04-01 2010-04-01 false Meeting space. 245.120 Section 245... PARTICIPATION IN MULTIFAMILY HOUSING PROJECTS Tenant Organizations § 245.120 Meeting space. (a) Owners of... of any community room or other available space appropriate for meetings that is part of the...

  13. 8 CFR 245.5 - Medical examination.

    Science.gov (United States)

    2010-01-01

    ... 8 Aliens and Nationality 1 2010-01-01 2010-01-01 false Medical examination. 245.5 Section 245.5... THAT OF PERSON ADMITTED FOR PERMANENT RESIDENCE § 245.5 Medical examination. Pursuant to section 232(b) of the Act, an applicant for adjustment of status shall be required to have a medical examination by...

  14. 8 CFR 245a.32 - Ineligible aliens.

    Science.gov (United States)

    2010-01-01

    ... 8 Aliens and Nationality 1 2010-01-01 2010-01-01 false Ineligible aliens. 245a.32 Section 245a.32 Aliens and Nationality DEPARTMENT OF HOMELAND SECURITY IMMIGRATION REGULATIONS ADJUSTMENT OF STATUS TO... IMMIGRATION AND NATIONALITY ACT LIFE Act Amendments Family Unity Provisions § 245a.32 Ineligible aliens. The...

  15. 48 CFR 245.7302 - Competitive sales.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Competitive sales. 245..., DEPARTMENT OF DEFENSE CONTRACT MANAGEMENT GOVERNMENT PROPERTY Sale of Surplus Contractor Inventory 245.7302 Competitive sales. ...

  16. 48 CFR 245.608 - Screening of contractor inventory.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Screening of contractor inventory. 245.608 Section 245.608 Federal Acquisition Regulations System DEFENSE ACQUISITION REGULATIONS... Disposal of Contractor Inventory 245.608 Screening of contractor inventory. ...

  17. 48 CFR 245.7309-7 - Default.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Default. 245.7309-7 Section 245.7309-7 Federal Acquisition Regulations System DEFENSE ACQUISITION REGULATIONS SYSTEM... Default. If the successful Bidder fails to make full payment, remove property by the specified date, or...

  18. 43 CFR 24.5 - International agreements.

    Science.gov (United States)

    2010-10-01

    ... WILDLIFE POLICY: STATE-FEDERAL RELATIONSHIPS § 24.5 International agreements. (a) International conventions... 43 Public Lands: Interior 1 2010-10-01 2010-10-01 false International agreements. 24.5 Section 24... shall be to recommend that the United States negotiate and accede to only those international agreements...

  19. 48 CFR 245.7306 - Sales services.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Sales services. 245.7306... OF DEFENSE CONTRACT MANAGEMENT GOVERNMENT PROPERTY Sale of Surplus Contractor Inventory 245.7306 Sales services. When sale services are needed, the plant clearance officer will document the reasons in...

  20. 7 CFR 245.1 - General purpose and scope.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 4 2010-01-01 2010-01-01 false General purpose and scope. 245.1 Section 245.1 Agriculture Regulations of the Department of Agriculture (Continued) FOOD AND NUTRITION SERVICE, DEPARTMENT OF... SCHOOLS § 245.1 General purpose and scope. (a) This part established the responsibilities of State...

  1. 40 CFR 86.245-94 - [Reserved

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 18 2010-07-01 2010-07-01 false [Reserved] 86.245-94 Section 86.245-94 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) AIR PROGRAMS (CONTINUED) CONTROL OF... Year Gasoline-Fueled New Light-Duty Vehicles, New Light-Duty Trucks and New Medium-Duty Passenger...

  2. 24 CFR 245.125 - Tenant organizers.

    Science.gov (United States)

    2010-04-01

    ... 24 Housing and Urban Development 2 2010-04-01 2010-04-01 false Tenant organizers. 245.125 Section... PARTICIPATION IN MULTIFAMILY HOUSING PROJECTS Tenant Organizations § 245.125 Tenant organizers. (a) A tenant organizer is a tenant or non-tenant who assists tenants in establishing and operating a tenant organization...

  3. 48 CFR 245.7307 - Non-competitive sales.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Non-competitive sales. 245..., DEPARTMENT OF DEFENSE CONTRACT MANAGEMENT GOVERNMENT PROPERTY Sale of Surplus Contractor Inventory 245.7307 Non-competitive sales. ...

  4. 42 CFR 24.5 - Peer review.

    Science.gov (United States)

    2010-10-01

    ... 42 Public Health 1 2010-10-01 2010-10-01 false Peer review. 24.5 Section 24.5 Public Health PUBLIC....5 Peer review. An individual may not be considered for appointment into the SBRS unless his/her qualifications have been reviewed by a PHS peer review committee and the committee has recommended appointment to...

  5. 27 CFR 28.245 - Shipment to foreign-trade zone.

    Science.gov (United States)

    2010-04-01

    ... 27 Alcohol, Tobacco Products and Firearms 1 2010-04-01 2010-04-01 false Shipment to foreign-trade zone. 28.245 Section 28.245 Alcohol, Tobacco Products and Firearms ALCOHOL AND TOBACCO TAX AND TRADE... Consignment § 28.245 Shipment to foreign-trade zone. Where distilled spirits (including specially denatured...

  6. 32 CFR 245.21 - ESCAT air traffic priority list.

    Science.gov (United States)

    2010-07-01

    ... 32 National Defense 2 2010-07-01 2010-07-01 false ESCAT air traffic priority list. 245.21 Section 245.21 National Defense Department of Defense (Continued) OFFICE OF THE SECRETARY OF DEFENSE (CONTINUED) MISCELLANEOUS PLAN FOR THE EMERGENCY SECURITY CONTROL OF AIR TRAFFIC (ESCAT) ESCAT Air Traffic Priority List (EATPL) § 245.21 ESCAT air traffic...

  7. 24 CFR 990.245 - Types of appeals.

    Science.gov (United States)

    2010-04-01

    ... 24 Housing and Urban Development 4 2010-04-01 2010-04-01 false Types of appeals. 990.245 Section... THE PUBLIC HOUSING OPERATING FUND PROGRAM Appeals § 990.245 Types of appeals. (a) Streamlined appeal. This appeal would demonstrate that the application of a specific Operating Fund formula component has a...

  8. 48 CFR 245.7311-2 - Safety, security, and fire regulations.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Safety, security, and fire regulations. 245.7311-2 Section 245.7311-2 Federal Acquisition Regulations System DEFENSE ACQUISITION... Inventory 245.7311-2 Safety, security, and fire regulations. ...

  9. 48 CFR 1852.245-79 - Use of Government-owned property.

    Science.gov (United States)

    2010-10-01

    ...-owned facilities (real property or plant equipment), special test equipment, or special tooling... property. 1852.245-79 Section 1852.245-79 Federal Acquisition Regulations System NATIONAL AERONAUTICS AND... and Clauses 1852.245-79 Use of Government-owned property. As prescribed in 1845.106-70(i), insert the...

  10. 29 CFR 1952.245 - Where the plan may be inspected.

    Science.gov (United States)

    2010-07-01

    ... and copied during normal business hours at the following locations: Office of State Programs... 29 Labor 9 2010-07-01 2010-07-01 false Where the plan may be inspected. 1952.245 Section 1952.245..., DEPARTMENT OF LABOR (CONTINUED) APPROVED STATE PLANS FOR ENFORCEMENT OF STATE STANDARDS Alaska § 1952.245...

  11. 48 CFR 245.102 - Policy.

    Science.gov (United States)

    2010-10-01

    ... DEFENSE CONTRACT MANAGEMENT GOVERNMENT PROPERTY General 245.102 Policy. (1) Mapping, charting, and geodesy property. All Government-furnished mapping, charting, and geodesy (MC&G) property is under the control of...

  12. 6 CFR 27.245 - Review and approval of site security plans.

    Science.gov (United States)

    2010-01-01

    ... 6 Domestic Security 1 2010-01-01 2010-01-01 false Review and approval of site security plans. 27.245 Section 27.245 Domestic Security DEPARTMENT OF HOMELAND SECURITY, OFFICE OF THE SECRETARY CHEMICAL FACILITY ANTI-TERRORISM STANDARDS Chemical Facility Security Program § 27.245 Review and approval of site...

  13. 42 CFR 456.245 - Number of studies required to be performed.

    Science.gov (United States)

    2010-10-01

    ... 42 Public Health 4 2010-10-01 2010-10-01 false Number of studies required to be performed. 456.245 Section 456.245 Public Health CENTERS FOR MEDICARE & MEDICAID SERVICES, DEPARTMENT OF HEALTH AND HUMAN... Ur Plan: Medical Care Evaluation Studies § 456.245 Number of studies required to be performed. The...

  14. 27 CFR 24.245 - Use of carbon dioxide in still wine.

    Science.gov (United States)

    2010-04-01

    ... still wine. 24.245 Section 24.245 Alcohol, Tobacco Products and Firearms ALCOHOL AND TOBACCO TAX AND TRADE BUREAU, DEPARTMENT OF THE TREASURY LIQUORS WINE Storage, Treatment and Finishing of Wine § 24.245 Use of carbon dioxide in still wine. The addition of carbon dioxide to (and retention in) still wine...

  15. 48 CFR 252.245-7000 - Government-furnished mapping, charting, and geodesy property.

    Science.gov (United States)

    2010-10-01

    ... mapping, charting, and geodesy property. 252.245-7000 Section 252.245-7000 Federal Acquisition Regulations..., charting, and geodesy property. As prescribed in 245.107-70, use the following clause: Government-Furnished Mapping, Charting, and Geodesy Property (DEC 1991) (a) Definition—Mapping, charting, and geodesy (MC&G...

  16. 48 CFR 245.7101-4 - DD Form 1640, Request for Plant Clearance.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false DD Form 1640, Request for Plant Clearance. 245.7101-4 Section 245.7101-4 Federal Acquisition Regulations System DEFENSE... Forms 245.7101-4 DD Form 1640, Request for Plant Clearance. Use to request plant clearance assistance or...

  17. 20 CFR 663.245 - What is the individual employment plan?

    Science.gov (United States)

    2010-04-01

    ....245 Section 663.245 Employees' Benefits EMPLOYMENT AND TRAINING ADMINISTRATION, DEPARTMENT OF LABOR... jointly developed by the participant and the case manager that identifies the participant's employment goals, the appropriate achievement objectives, and the appropriate combination of services for the...

  18. FTIR spectroscopic study of biofilms formed by the rhizobacterium Azospirillum brasilense Sp245 and its mutant Azospirillum brasilense Sp245.1610

    Science.gov (United States)

    Tugarova, Anna V.; Scheludko, Andrei V.; Dyatlova, Yulia A.; Filip'echeva, Yulia A.; Kamnev, Alexander A.

    2017-07-01

    Biofilms are spatially and metabolically structured communities of microorganisms, representing a mode of their existence which is ubiquitous in nature, with cells localised within an extracellular biopolymeric matrix, attached to each other, at an interface. For plant-growth-promoting rhizobacteria (PGPR), the formation of biofilms is of special importance due to their primary localisation at the surface of plant root systems. In this work, FTIR spectroscopy was used, for the first time for bacteria of the genus Azospirillum, to comparatively study 6-day-mature biofilms formed on the surface of ZnSe discs by the rhizobacterium Azospirillum brasilense Sp245 and its mutant A. brasilense Sp245.1610. The mutant strain, having an Omegon Km insertion in the gene of lipid metabolism fabG1 on the plasmid AZOBR_p1, as compared to the wild-type strain Sp245 (see http://dx.doi.org/10.1134/S1022795413110112)

  19. 48 CFR 752.245-70 - Government property-USAID reporting requirements.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 5 2010-10-01 2010-10-01 false Government property-USAID reporting requirements. 752.245-70 Section 752.245-70 Federal Acquisition Regulations System AGENCY FOR... recommendation, USAID contracts, except for those for commercial items, must contain the following preface and...

  20. 8 CFR 245.2 - Application.

    Science.gov (United States)

    2010-01-01

    ... ADMITTED FOR PERMANENT RESIDENCE § 245.2 Application. (a) General—(1) Jurisdiction. USCIS has jurisdiction... on Form I-485, Application for Permanent Residence. The application must be accompanied by the..., deportation, or removal proceeding and who is in lawful V status shall not be deemed an abandonment of the...

  1. 12 CFR 19.245 - Notice of removal, suspension or debarment.

    Science.gov (United States)

    2010-01-01

    ... 12 Banks and Banking 1 2010-01-01 2010-01-01 false Notice of removal, suspension or debarment. 19.245 Section 19.245 Banks and Banking COMPTROLLER OF THE CURRENCY, DEPARTMENT OF THE TREASURY RULES OF PRACTICE AND PROCEDURE Removal, Suspension, and Debarment of Accountants From Performing Audit Services...

  2. 48 CFR 245.608-7 - Reimbursement of cost for transfer of contractor inventory.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Reimbursement of cost for transfer of contractor inventory. 245.608-7 Section 245.608-7 Federal Acquisition Regulations System... Reporting, Redistribution, and Disposal of Contractor Inventory 245.608-7 Reimbursement of cost for transfer...

  3. 17 CFR 245.100 - Definitions.

    Science.gov (United States)

    2010-04-01

    ... a management employee of the issuer. (d) The term derivative security has the meaning set forth in... security of the issuer means any equity security or derivative security relating to an issuer, whether or... 17 Commodity and Securities Exchanges 3 2010-04-01 2010-04-01 false Definitions. 245.100 Section...

  4. 7 CFR 245.9 - Special assistance certification and reimbursement alternatives.

    Science.gov (United States)

    2010-01-01

    ... school shall: (1) Amend its Free and Reduced Price Policy Statement, specified in § 245.10, to include a... REDUCED PRICE MEALS AND FREE MILK IN SCHOOLS § 245.9 Special assistance certification and reimbursement... children determined eligible for free or reduced price meals may, at its option, authorize the school to...

  5. 7 CFR 245.2 - Definitions.

    Science.gov (United States)

    2010-01-01

    ... combination of school districts or counties that is recognized in a State as an administrative agency for its... SCHOOLS § 245.2 Definitions. Adult means any individual 21 years of age or older. Commodity school means a school which does not participate in the National School Lunch Program under part 210 of this chapter...

  6. [Biofilm Formation by the Nonflagellated flhB1 Mutant of Azospirillum brasilense Sp245].

    Science.gov (United States)

    Shelud'ko, A V; Filip'echeva, Yu A; Shumiliva, E M; Khlebtsov, B N; Burov, A M; Petrova, L P; Katsy, E I

    2015-01-01

    Azospirillum brasilense Sp245 with mixed flagellation are able to form biofilms on various surfaces. A nonflagellated mutant of this strain with inactivated chromosomal copy of the flhB gene (flhB1) was shown to exhibit specific traits at the later stages of biofilm formation on a hydrophilic (glass) surface. Mature biofilms of the flhB1::Omegon-Km mutant Sp245.1063 were considerably thinner than those of the parent strain Sp245. The biofilms of the mutant were more susceptible to the forces of hydrodynamic shear. A. brasilense Sp245 cells in biofilms were not found to possess lateral flagella. Cells with polar flagella were, however, revealed by atomic force microscopy of mature native biofilms of strain Sp245. Preservation of a polar flagellum (probably nonmotile) on the cells of A. brasilense Sp245 may enhance the biofilm stability.

  7. 48 CFR 5152.245-9001 - Government property for installation support services (cost-reimbursement contracts).

    Science.gov (United States)

    2010-10-01

    ... installation support services (cost-reimbursement contracts). 5152.245-9001 Section 5152.245-9001 Federal... CONTRACT CLAUSES 5152.245-9001 Government property for installation support services (cost-reimbursement... Installation Support Services (Cost-Reimbursement Contracts) (OCT 1989) (DEV) (a) Government-furnished property...

  8. 40 CFR 1042.245 - Deterioration factors.

    Science.gov (United States)

    2010-07-01

    ... Section 1042.245 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) AIR POLLUTION CONTROLS CONTROL OF EMISSIONS FROM NEW AND IN-USE MARINE COMPRESSION-IGNITION ENGINES AND VESSELS... considered to rely on established technology for control of gaseous emissions, except that this does not...

  9. 8 CFR 245.11 - Adjustment of aliens in S nonimmigrant classification.

    Science.gov (United States)

    2010-01-01

    ... 8 Aliens and Nationality 1 2010-01-01 2010-01-01 false Adjustment of aliens in S nonimmigrant classification. 245.11 Section 245.11 Aliens and Nationality DEPARTMENT OF HOMELAND SECURITY IMMIGRATION... aliens in S nonimmigrant classification. (a) Eligibility. An application on Form I-854, requesting that...

  10. 8 CFR 245.23 - Adjustment of aliens in T nonimmigrant classification.

    Science.gov (United States)

    2010-01-01

    ... 8 Aliens and Nationality 1 2010-01-01 2010-01-01 false Adjustment of aliens in T nonimmigrant classification. 245.23 Section 245.23 Aliens and Nationality DEPARTMENT OF HOMELAND SECURITY IMMIGRATION... aliens in T nonimmigrant classification. (a) Eligibility of principal T-1 applicants. Except as described...

  11. 48 CFR 1852.245-70 - Contractor requests for Government-owned equipment.

    Science.gov (United States)

    2010-10-01

    ... the equipment and the reasons why contractor-owned property cannot be used, citing the applicable FAR... 1419, DOD Industrial Plant Equipment Requisition, or equivalent format, for each item requested and (ii... Government-owned equipment. 1852.245-70 Section 1852.245-70 Federal Acquisition Regulations System NATIONAL...

  12. 8 CFR 245.24 - Adjustment of aliens in U nonimmigrant status.

    Science.gov (United States)

    2010-01-01

    ... 8 Aliens and Nationality 1 2010-01-01 2010-01-01 false Adjustment of aliens in U nonimmigrant status. 245.24 Section 245.24 Aliens and Nationality DEPARTMENT OF HOMELAND SECURITY IMMIGRATION... aliens in U nonimmigrant status. (a) Definitions. As used in this section, the term: (1) Continuous...

  13. 40 CFR 80.245 - How does a small refiner apply for a sulfur baseline?

    Science.gov (United States)

    2010-07-01

    ... sulfur baseline? 80.245 Section 80.245 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY... Provisions § 80.245 How does a small refiner apply for a sulfur baseline? (a) Any refiner seeking small refiner status must apply for a refinery sulfur baseline by the deadline under § 80.235 for each of the...

  14. 8 CFR 245a.1 - Definitions.

    Science.gov (United States)

    2010-01-01

    ... English language competency, and attainment of these skills is measured either by successful completion of... language, (iii) learning, (iv) mobility, (v) self direction, (vi) capacity for independent living, and (vii... any other activity prohibited by section 245A(c)(6) of the Act is established during the process of...

  15. 8 CFR 245a.33 - Filing.

    Science.gov (United States)

    2010-01-01

    ... Nationality DEPARTMENT OF HOMELAND SECURITY IMMIGRATION REGULATIONS ADJUSTMENT OF STATUS TO THAT OF PERSONS ADMITTED FOR LAWFUL TEMPORARY OR PERMANENT RESIDENT STATUS UNDER SECTION 245A OF THE IMMIGRATION AND... notice to appear until 90 days from the date of the initial denial, to allow the alien the opportunity to...

  16. 19 CFR 24.5 - Filing identification number.

    Science.gov (United States)

    2010-04-01

    ... TREASURY CUSTOMS FINANCIAL AND ACCOUNTING PROCEDURE § 24.5 Filing identification number. (a) Generally..., the Social Security number. (2) If neither an Internal Revenue Service employer identification number nor a Social Security number has been assigned, the word “None” shall be written on the line provided...

  17. 48 CFR 245.7310-8 - Antitrust clearance.

    Science.gov (United States)

    2010-10-01

    ..., DEPARTMENT OF DEFENSE CONTRACT MANAGEMENT GOVERNMENT PROPERTY Sale of Surplus Contractor Inventory 245.7310-8... acceptance of its bid. Award shall be made only upon advice from the Department of Justice that the proposed sale would not create or maintain a situation inconsistent with the antitrust laws. ...

  18. 8 CFR 245a.17 - Citizenship skills.

    Science.gov (United States)

    2010-01-01

    ... Aliens and Nationality DEPARTMENT OF HOMELAND SECURITY IMMIGRATION REGULATIONS ADJUSTMENT OF STATUS TO... IMMIGRATION AND NATIONALITY ACT Legal Immigration Family Equity (LIFE) Act Legalization Provisions § 245a.17... the time of the interview, shall be afforded a second opportunity after 6 months (or earlier, at the...

  19. Degradation of 2,4,5-trichlorophenoxyacetic acid in aqueous solution by 60Co-γ irradiation

    International Nuclear Information System (INIS)

    Liu Yuanxia; Yu Yuan; Bao Huaying

    2010-01-01

    2,4,5-trichlorophenoxyacetic acid(2,4,5-T) is one kind of phenoxy-hydroxy-acid herbicides, also is one kind of Endocrine Disrupting Chemicals. The degradation of 2,4,5-T in aqueous solution by 60 Co-γ irradiation was investigated in the paper. The degradation effect of different influencing factors, such as absorbed dose and irradiation aura, was studied respectively. The degradation products were preliminarily analyzed by High Performance Liquid Chromatography, UV-Vis spectrophotometer and Ion Chromatography. The results showed that 2,4,5-T could be effectively degraded in aqueous solutions by 60 Co-γ irradiation. Meanwhile, the Chloride ion was detected in the solution, whose concentration increased with the growth of absorbed dose. It was found that although both e-aq and ·OH originated from water radiolysis could eliminate 2,4,5-T, the dechlorination effect and the degradation products were different. (authors)

  20. Selective Adsorption of Ethane over Ethylene in PCN-245: Impacts of Interpenetrated Adsorbent.

    Science.gov (United States)

    Lv, Daofei; Shi, Renfeng; Chen, Yongwei; Wu, Ying; Wu, Houxiao; Xi, Hongxia; Xia, Qibin; Li, Zhong

    2018-03-07

    The separation of ethane from ethylene using cryogenic distillation is an energy-intensive process in the industry. With lower energetic consumption, the adsorption technology provides the opportunities for developing the industry with economic sustainability. We report an iron-based metal-organic framework PCN-245 with interpenetrated structures as an ethane-selective adsorbent for ethylene/ethane separation. The material maintains stability up to 625 K, even after exposure to 80% humid atmosphere for 20 days. Adsorptive separation experiments on PCN-245 at 100 kPa and 298 K indicated that ethane and ethylene uptakes of PCN-245 were 3.27 and 2.39 mmol, respectively, and the selectivity of ethane over ethylene was up to 1.9. Metropolis Monte Carlo calculations suggested that the interpenetrated structure of PCN-245 created greater interaction affinity for ethane than ethylene through the crossing organic linkers, which is consistent with the experimental results. This work highlights the potential application of adsorbents with the interpenetrated structure for ethane separation from ethylene.

  1. 32 CFR 245.17 - U.S. civil and military air traffic control facilities.

    Science.gov (United States)

    2010-07-01

    ... 32 National Defense 2 2010-07-01 2010-07-01 false U.S. civil and military air traffic control facilities. 245.17 Section 245.17 National Defense Department of Defense (Continued) OFFICE OF THE SECRETARY OF DEFENSE (CONTINUED) MISCELLANEOUS PLAN FOR THE EMERGENCY SECURITY CONTROL OF AIR TRAFFIC (ESCAT) Procedures for Implementation of ESCAT §...

  2. The Influence of Irganox 245 on Crystallinity and Mechanics Stability of Polypropylene-Natural Rubber Poly blends

    International Nuclear Information System (INIS)

    Mashuri; Kristiawan Setia; Darminto; Aloma KK; Sudirman

    2008-01-01

    The influence of irganox 245 on crystallinity and mechanics stability of polyethylene (PP)- Natural Rubber (NR) poly blends exposure by sunlight for 12 weeks has been studied. For optimalization of antioxidant function to reduce oxidation in PP-NR (4:1) poly blends irganox 245 with variation concentration of 4 %, 6 %, 8 % and 10 % vol were added. Poly blends was made by blending method at 170 o C for 10 minutes with form an 30 rpm. The result showed that irganox 245 could not increasing adhesion at the interface between PP-NR, so PP-NR still immiscible blends. The optimal concentrations of irganox 245 as antioxidant on PP-NR poly blends is 8 % vol. PP-NR-irganox 245 8 % vol have decreasing tensile strength up to 6 % and increasing elongation at break up to 50 % in exposure by sunlight at long time 8 weeks but for 12 weeks tensile strength and elongation at break very weaks. Crystallinity and mechanics stability of PP-NR-irganox 245 8 % vol better than PP-NR poly blends, it is showed by slowly defects and decreasing crystallinity up to 9 % for exposure 12 weeks. (author)

  3. Peaceful berkelium

    Science.gov (United States)

    Trabesinger, Andreas

    2017-09-01

    The first new element produced after the Second World War has led a rather peaceful life since entering the period table -- until it became the target of those producing superheavy elements, as Andreas Trabesinger describes.

  4. CLONING AND CHARACTERIZATION OF A CHROMOSOMAL DNA REGION REQUIRED FOR GROWTH ON 2,4,5-T BY PSEUDOMONAS CEPACIA AC1100

    Science.gov (United States)

    A series of spontaneous 2,4,5-trichlorophenoxyacetic acid (2,4,5-T) nonmetabolizing mutants of Pseudomonas cepacia AC1100 were characterized to be defective in either 2,4,5-T uptake or conversion of this compound to 2,4,5-trichlorophenol (2,4,5-TCP). Two of these mutants, RHC22 a...

  5. Evaluation of various tests for the diagnosis of soil contamination by 2,4,5-trichlorophenol (2,4,5-TCP)

    International Nuclear Information System (INIS)

    Bello, D.; Trasar-Cepeda, C.; Leiros, M.C.; Gil-Sotres, F.

    2008-01-01

    Soil response to contamination with 2,4,5-triclorophenol was studied to test the validity of the concept of Generic Reference Levels (GRL), the main criterion used to define soil contamination. Soil samples were artificially contaminated with doses between 0 and 5000 mg kg -1 of 2,4,5-triclorophenol, and analysed by various tests. Where possible, the response of soils to the contaminant was modelled by a sigmoidal dose-response curve in order to estimate the ED 50 values. The tests provided different responses, but only microbial biomass-C and dehydrogenase and urease activities demonstrated soil deterioration in response to contamination. The results suggest that the diagnosis of soil contamination has been greatly simplified in the legislation by the provision of a single figure for each compound, and that the GRL concept could perhaps be substituted by measurement of ED 50 values, which better reflect the alteration of a soil due to the presence of a xenobiotic substance. - The concentration of a toxic substance present in a soil cannot be considered as the only criteria to classify such soil as contaminated

  6. 48 CFR 245.7101-3 - DD Form 1348-1, DoD Single Line Item Release/Receipt Document.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false DD Form 1348-1, DoD Single Line Item Release/Receipt Document. 245.7101-3 Section 245.7101-3 Federal Acquisition Regulations... PROPERTY Plant Clearance Forms 245.7101-3 DD Form 1348-1, DoD Single Line Item Release/Receipt Document...

  7. EPA Method 245.2: Mercury (Automated Cold Vapor Technique)

    Science.gov (United States)

    Method 245.2 describes procedures for preparation and analysis of drinking water samples for analysis of mercury using acid digestion and cold vapor atomic absorption. Samples are prepared using an acid digestion technique.

  8. Network Analysis of Plasmidomes: The Azospirillum brasilense Sp245 Case

    Science.gov (United States)

    Fondi, Marco

    2014-01-01

    Azospirillum brasilense is a nitrogen-fixing bacterium living in association with plant roots. The genome of the strain Sp245, isolated in Brazil from wheat roots, consists of one chromosome and six plasmids. In this work, the A. brasilense Sp245 plasmids were analyzed in order to shed some light on the evolutionary pathways they followed over time. To this purpose, a similarity network approach was applied in order to identify the evolutionary relationships among all the A. brasilense plasmids encoded proteins; in this context a computational pipeline specifically devoted to the analysis and the visualization of the network-like evolutionary relationships among different plasmids molecules was developed. This information was supplemented with a detailed (in silico) functional characterization of both the connected (i.e., sharing homology with other sequences in the dataset) and the unconnected (i.e., not sharing homology) components of the network. Furthermore, the most likely source organism for each of the genes encoded by A. brasilense plasmids was checked, allowing the identification of possible trends of gene loss/gain in this microorganism. Data obtained provided a detailed description of the evolutionary landscape of the plasmids of A. brasilense Sp245, suggesting some of the molecular mechanisms responsible for the present-day structure of these molecules. PMID:25610702

  9. High-Frequency Wireless Communications System: 2.45-GHz Front-End Circuit and System Integration

    Science.gov (United States)

    Chen, M.-H.; Huang, M.-C.; Ting, Y.-C.; Chen, H.-H.; Li, T.-L.

    2010-01-01

    In this article, a course on high-frequency wireless communications systems is presented. With the 145-MHz baseband subsystem available from a prerequisite course, the present course emphasizes the design and implementation of the 2.45-GHz front-end subsystem as well as system integration issues. In this curriculum, the 2.45-GHz front-end…

  10. Electrochemical oxidation of 2,4,5-trichlorophenoxyacetic acid by metal-oxide-coated Ti electrodes.

    Science.gov (United States)

    Maharana, Dusmant; Xu, Zesheng; Niu, Junfeng; Rao, Neti Nageswara

    2015-10-01

    Electrochemical oxidation of 2,4,5-trichlorophenoxyacetic acid (2,4,5-T) over metal-oxide-coated Ti anodes, i.e., Ti/SnO2-Sb/Ce-PbO2, Ti/SnO2-Sb and Ti/RuO2, was examined. The degradation efficiency of over 90% was attained at 20 min at different initial concentrations (0.5-20 mg L(-1)) and initial pH values (3.1-11.2). The degradation efficiencies of 2,4,5-T on Ti/SnO2-Sb/Ce-PbO2, Ti/SnO2-Sb and Ti/RuO2 anodes were higher than 99.9%, 97.2% and 91.5% at 30 min, respectively, and the respective total organic carbon removal ratios were 65.7%, 54.6% and 37.2%. The electrochemical degradation of 2,4,5-T in aqueous solution followed pseudo-first-order kinetics. The compounds, i.e., 2,5-dichlorohydroquinone and 2,5-dihydroxy-p-benzoquinone, have been identified as the main aromatic intermediates by liquid chromatography-mass spectrometry. The results showed that the energy efficiencies of 2,4,5-T (20 mg L(-1)) degradation with Ti/SnO2-Sb/Ce-PbO2 anode at the optimal current densities from 2 to 16 mA cm(-2) ranged from 8.21 to 18.73 kWh m(-3). Copyright © 2015 Elsevier Ltd. All rights reserved.

  11. 20 CFR 411.245 - What are a PM's responsibilities under the Ticket to Work program?

    Science.gov (United States)

    2010-04-01

    ... 20 Employees' Benefits 2 2010-04-01 2010-04-01 false What are a PM's responsibilities under the Ticket to Work program? 411.245 Section 411.245 Employees' Benefits SOCIAL SECURITY ADMINISTRATION THE... formats. For purposes of this section, accessible format means by media that is appropriate to a...

  12. 12 CFR 24.5 - Public welfare investment after-the-fact notice and prior approval procedures.

    Science.gov (United States)

    2010-01-01

    ... 12 Banks and Banking 1 2010-01-01 2010-01-01 false Public welfare investment after-the-fact notice and prior approval procedures. 24.5 Section 24.5 Banks and Banking COMPTROLLER OF THE CURRENCY... capital and surplus represented by the proposed investment and by the bank's aggregate outstanding public...

  13. 17 CFR 245.103 - Issuer right of recovery; right of action by equity security owner.

    Science.gov (United States)

    2010-04-01

    ..., conversion or termination of a derivative security) in violation of section 306(a)(1) of that Act of an... 17 Commodity and Securities Exchanges 3 2010-04-01 2010-04-01 false Issuer right of recovery; right of action by equity security owner. 245.103 Section 245.103 Commodity and Securities Exchanges...

  14. 48 CFR 245.606-70 - Instructions for completing DD Form 1342, DoD Property Record.

    Science.gov (United States)

    2010-10-01

    ... completing DD Form 1342, DoD Property Record. 245.606-70 Section 245.606-70 Federal Acquisition Regulations... completing DD Form 1342, DoD Property Record. (a) The contractor shall list excess industrial plant equipment (IPE) on DD Form 1342, DoD Property Record, and submit it to the Government property administrator for...

  15. 8 CFR 245.13 - Adjustment of status of certain nationals of Nicaragua and Cuba under Public Law 105-100.

    Science.gov (United States)

    2010-01-01

    ... of Nicaragua and Cuba under Public Law 105-100. 245.13 Section 245.13 Aliens and Nationality... PERMANENT RESIDENCE § 245.13 Adjustment of status of certain nationals of Nicaragua and Cuba under Public... section 241(a)(5) of the Act, if the alien: (1) Is a national of Nicaragua or Cuba; (2) Except as provided...

  16. Short-duration exposure to 2.45 GHz microwave radiation induces ...

    African Journals Online (AJOL)

    OBEMBE

    The genotoxic effects of 2.45 GHz microwave (MW) radiation on the testis ... electromagnetic radiation present in the environment and ..... intrinsic (quantum) energy is too low to dislodge an .... wave on brain enzymes of developing rat brain.

  17. 48 CFR 245.608-71 - Screening industrial plant equipment.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Screening industrial plant..., and Disposal of Contractor Inventory 245.608-71 Screening industrial plant equipment. (a) Reporting...) After 90th day. If DoD requirement is identified, and item is available, ship item against the...

  18. Short-duration exposure to 2.45 GHz microwave radiation induces ...

    African Journals Online (AJOL)

    OBEMBE

    The genotoxic effects of 2.45 GHz microwave (MW) radiation on the testis and ovary of Sprague Dawley rats was ... Microwave (MW) radiation is a non-ionizing electromagnetic radiation ..... microwave field and not in any way related to indirect.

  19. Total neutron cross sections of berkelium-249 and californium-249 below 100 eV

    International Nuclear Information System (INIS)

    Benjamin, R.W.; Harvey, J.A.; Hill, N.W.; Pandey, M.S.; Carlton, R.F.

    1979-01-01

    The neutron total cross sections of 249 Bk and 249 Cf have been measured from 0.03 to 100 eV using the Oak Ridge Electron Linear Accelerator (ORELA) as a source of pulsed neutrons. The 1.6 mm dia. cylindrical transmission samples contained initially up to 5.3 mg of 98% 249 Bk and 2% 249 Cf: 4.5 years later, when the final measurements were made, the composition of the samples had become 2.5% 249 Bk, 96.9% 249 Cf, and 0.6% 245 Cm. Samples were cooled with liquid nitrogen to reduce Doppler broadening. Thirty-nine resonances were identified in 249 Bk and analyzed using a single-level Breit-Wigner formalism. Fifty-five resonances were identified in 249 Cf and analyzed using an R-matrix multilevel formalism. Fifty-five resonances were identified in 249 Cf and analyzed using an R-matrix multilevel formalism. The resonance parameters obtained have been used to determine the average level spacings and the s-wave neutron and fission strength functions. Where possible, bound-level parameters were derived to fit the thermal neutron total cross section data

  20. CHARACTERIZATION AND NUCLEOTIDE SEQUENCE DETERMINATION OF A REPEAT ELEMENT ISOLATED FROM A 2,4,5,-T DEGRADING STRAIN OF PSEUDOMONAS CEPACIA

    Science.gov (United States)

    Pseudomonas cepacia strain AC1100, capable of growth on 2,4,5-trichlorophenoxyacetic acid (2,4,5-T), was mutated to the 2,4,5-T− strain PT88 by a ColE1 :: Tn5 chromosomal insertion. Using cloned DNA from the region flanking the insertion, a 1477-bp sequence (designated RS1100) wa...

  1. Short-duration exposure to 2.45 GHz microwave radiation induces ...

    African Journals Online (AJOL)

    ... disorganization in the testis of exposed group with increasing SARs. These results suggest that MW radiation has the potential to affect both male and female fertility adversely. Keywords: 2.45 GHz microwave radiation, histopathology, DNA single strand break, ovary, testis. African Journal of Biotechnology Vol. 12(2), pp.

  2. 47 CFR 24.245 - Reimbursement under the Cost-Sharing Plan.

    Science.gov (United States)

    2010-10-01

    ... 47 Telecommunication 2 2010-10-01 2010-10-01 false Reimbursement under the Cost-Sharing Plan. 24... 1850-1990 Mhz Band § 24.245 Reimbursement under the Cost-Sharing Plan. (a) Registration of reimbursement rights. (1) To obtain reimbursement, a PCS relocator must submit documentation of the relocation...

  3. 46 CFR 199.245 - Survival craft embarkation and launching arrangements.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 7 2010-10-01 2010-10-01 false Survival craft embarkation and launching arrangements... Passenger Vessels § 199.245 Survival craft embarkation and launching arrangements. (a) Each davit-launched liferaft must be arranged to be rapidly boarded by its full complement of persons. (b) All survival craft...

  4. Microwave-assisted rapid synthesis of methyl 2,4,5-trimethoxyphenylpropionate, a metabolite of Cordia alliodora.

    Science.gov (United States)

    Sinha, A K; Joshi, B P; Sharma, A; Kumar, J K; Kaul, V K

    2003-12-01

    Microwave assisted condensation of asaronaldehyde (2) with malonic acid in piperidine-AcOH provides 2,4,5-trimethoxycinnamic acid (3) in 87% yield within 4 min, which upon further reduction with PdCl2- HCOOH-aq. NaOH gives 3-(2,4,5-trimethoxy)phenyl propionic acid (4) in 88% yield within 3 min. Esterification of 4 with MeOH-H+ gives methyl 2,4,5-trimethoxyphenylpropionate (1), a metabolite of Cordia alliodora, in 94% yield within 3 min (overall 69% yield).

  5. 31 CFR 245.8 - Receipt or recovery of original check.

    Science.gov (United States)

    2010-07-01

    ... 31 Money and Finance: Treasury 2 2010-07-01 2010-07-01 false Receipt or recovery of original check... CHECKS § 245.8 Receipt or recovery of original check. (a) If the original check is received or recovered... of instructions with respect to the negotiability of such check. (b) If the original check is...

  6. The R245X mutation of PCDH15 in Ashkenazi Jewish children diagnosed with nonsyndromic hearing loss foreshadows retinitis pigmentosa.

    Science.gov (United States)

    Brownstein, Zippora; Ben-Yosef, Tamar; Dagan, Orit; Frydman, Moshe; Abeliovich, Dvorah; Sagi, Michal; Abraham, Fabian A; Taitelbaum-Swead, Riki; Shohat, Mordechai; Hildesheimer, Minka; Friedman, Thomas B; Avraham, Karen B

    2004-06-01

    Usher syndrome is a frequent cause of the combination of deafness and blindness due to retinitis pigmentosa (RP). Five genes are known to underlie different forms of Usher syndrome type I (USH1). In the Ashkenazi Jewish population, the R245X mutation of the PCDH15 gene may be the most common cause of USH1 (Ben-Yosef T, Ness SL, Madeo AC, Bar-Lev A, Wolfman JH, Ahmed ZM, Desnick RK, Willner JP, Avraham KB, Ostrer H, Oddoux C, Griffith AJ, Friedman TB N Engl J Med 348: 1664-1670, 2003). To estimate what percentage of Ashkenazi Jewish children born with profound hearing loss will develop RP due to R245X, we examined the prevalence of the R245X PCDH15 mutation and its carrier rate among Ashkenazi Jews in Israel. Among probands diagnosed with nonsyndromic hearing loss not due to mutations of connexin 26 (GJB2) and/or connexin 30 (GJB6), and below the age of 10, 2 of 20 (10%) were homozygous for the R245X mutation. Among older nonsyndromic deaf individuals, no homozygotes were detected, although one individual was heterozygous for R245X. The carrier rate of the R245X mutation among the normal hearing Ashkenazi population in Israel was estimated at 1%. Ashkenazi Jewish children with profound prelingual hearing loss should be evaluated for the R245X PCDH15 mutation and undergo ophthalmologic evaluation to determine whether they will develop RP. Rehabilitation can then begin before loss of vision. Early use of cochlear implants in such cases may rescue these individuals from a dual neurosensory deficit.

  7. 48 CFR 245.7309-8 - Variations in quantity or weight.

    Science.gov (United States)

    2010-10-01

    ... Inventory 245.7309-8 Variations in quantity or weight. When property is sold on a “unit price” basis, the Contractor reserves the right to vary by up to 15 percent the quantity or weight listed in the Invitation and... price shall be adjusted in accordance with the unit price and on the basis of the quantity or weight...

  8. Comparative study of electrochemical oxidation of herbicide 2,4,5-T: Kinetics, parametric optimization and mineralization pathway

    Directory of Open Access Journals (Sweden)

    Hicham Zazou

    2017-01-01

    Full Text Available Oxidative degradation of herbicide 2,4,5-T was studied by electrochemical advanced oxidation processes anodic oxidation and electro-Fenton (EF using Pt/carbon felt and BDD/carbon felt cells. The effect of main operating parameters on oxidation of 2,4,5-T and mineralization of its aqueous solution were investigated. The rate constant for oxidation of 2,4,5-T by ·≡OH was determined as (3.7 ± 0.2 × 109 M−1 s−1 using competition kinetics method. The EF process with BDD anode was shown to be very efficient reaching 94% mineralization in 3 h treatment. Based on identified aromatic intermediates, short-chain carboxylic acids, released inorganic ions and total organic carbon removal measurements, a plausible oxidation pathway for mineralization of 2,4,5-T by hydroxyl radical was proposed. In addition, the evolution of solution toxicity during treatment was monitored by Microtox method showing the formation of toxic aromatic/cyclic intermediates. The results showed also that EF process was able to remove efficiently toxic intermediates and consequently solution toxicity.

  9. Resolved 24.5 micron emission from massive young stellar objects

    Science.gov (United States)

    de Wit, W. J.; Hoare, M. G.; Fujiyoshi, T.; Oudmaijer, R. D.; Honda, M.; Kataza, H.; Miyata, T.; Okamoto, Y. K.; Onaka, T.; Sako, S.; Yamashita, T.

    2009-01-01

    Context: Massive young stellar objects (MYSO) are surrounded by massive dusty envelopes, whose physical structure and geometry are determined by the star formation process. Aims: Our principal aim is to establish the density structure of MYSO envelopes on scales of ~1000 AU. This constitutes an increase of a factor ~10 in angular resolution compared to similar studies performed in the (sub)mm. Methods: We have obtained diffraction-limited (0.6´´) 24.5 μm images (field of view of 40 arcsec×30 arcsec) of 14 well-known massive star formation regions with the COMICS instrument mounted on the 8.2 m Subaru telescope. We construct azimuthally averaged intensity profiles of the resolved MYSO envelopes and build spectral energy distributions (SEDs) from archival data and the COMICS 24.5 μm flux density. The SEDs range from near-infrared to millimeter wavelengths. Self-consistent 1-D radiative transfer models described by a density dependence of the form n(r) ∝ r-p are used to simultaneously compare the intensity profiles and SEDs to model predictions. Results: The images reveal the presence of discrete MYSO sources which are resolved on arcsecond scales, and, to first-order, the observed emission is circular on the sky. For many sources, the spherical models are capable of satisfactorily reproducing the 24.5 μm intensity profile, the 24.5 μm flux density, the 9.7 μm silicate absorption feature, and the submm emission. They are described by density distributions with p =1.0±0.25. Such distributions are shallower than those found on larger scales probed with single-dish (sub)mm studies. Other sources have density laws that are shallower/steeper than p=1.0 and there is evidence that these are viewed near edge-on or near face-on respectively. In these cases spherical models fail to provide good fits to the data. The images also reveal a diffuse component tracing somewhat larger scale structures, particularly visible in the regions S 140, AFGL 2136, IRAS 20126

  10. Z dependence of the N=152 deformed shell gap: In-beam γ-ray spectroscopy of neutron-rich 245,246Pu

    International Nuclear Information System (INIS)

    Makii, H.; Ishii, T.; Asai, M.; Tsukada, K.; Toyoshima, A.; Ichikawa, S.; Matsuda, M.; Makishima, A.; Kaneko, J.; Toume, H.; Shigematsu, S.; Kohno, T.; Ogawa, M.

    2007-01-01

    We have measured in-beam γ rays in the neutron-rich 246 Pu 152 and 245 Pu 151 nuclei by means of 244 Pu( 18 O, 16 O) 246 Pu and 244 Pu( 18 O, 17 O) 245 Pu neutron transfer reactions, respectively. The γ rays emitted from 246 Pu ( 245 Pu) were identified by selecting the kinetic energy of scattered 16 O ( 17 O) detected by Si ΔE-E detectors. The ground-state band of 246 Pu was established up to the 12 + state. We have found that the shell gap of N=152 is reduced in energy with decreasing atomic number by extending the systematics of the one-quasiparticle energies in N=151 nuclei into those in 245 Pu. This reduction of the shell gap clearly affects the 2 + energy of the ground-state band of 246 Pu

  11. The Effect of 2.45 GHz Microwave Radiation on Brain Cell Apoptosis in Sprague Dawley Rats

    International Nuclear Information System (INIS)

    Wan Saffiey Wan Abdullah; Rozaimah Abdul Rahim; Zulkifli Yusof

    2016-01-01

    Microwave radiation is a part of non-ionizing electromagnetic radiations present in the environment and is now being perceived as health risks. The study was performed to investigate the effect of 2.45 GHz microwave radiation on brain cell apoptosis in Sprague Dawley rat. In the research done, 32 Sprague Dawley rat were used and divided into four groups; control group, G1 (1 month exposure), G2 (2 months exposure) and G3 (3 months exposure). The presence of apoptotic activity in control group was compared molecularly with exposed group through DNA ladder test. Each exposed group were irradiated in GTEM cell at frequency of 2.45 GHz located at RF/ MW laboratory. There was presence of necrotic instead of apoptotic activity in brain cell and increase in weight of Sprague Dawley rat. Therefore the effect of 2.45GHz microwave radiation shown no presence of apoptosis and increase in weight of Sprague Dawley rat. (author)

  12. USP2-45 Is a Circadian Clock Output Effector Regulating Calcium Absorption at the Post-Translational Level.

    Directory of Open Access Journals (Sweden)

    Daniel Pouly

    Full Text Available The mammalian circadian clock influences most aspects of physiology and behavior through the transcriptional control of a wide variety of genes, mostly in a tissue-specific manner. About 20 clock-controlled genes (CCGs oscillate in virtually all mammalian tissues and are generally considered as core clock components. One of them is Ubiquitin-Specific Protease 2 (Usp2, whose status remains controversial, as it may be a cogwheel regulating the stability or activity of core cogwheels or an output effector. We report here that Usp2 is a clock output effector related to bodily Ca2+ homeostasis, a feature that is conserved across evolution. Drosophila with a whole-body knockdown of the orthologue of Usp2, CG14619 (dUsp2-kd, predominantly die during pupation but are rescued by dietary Ca2+ supplementation. Usp2-KO mice show hyperabsorption of dietary Ca2+ in small intestine, likely due to strong overexpression of the membrane scaffold protein NHERF4, a regulator of the Ca2+ channel TRPV6 mediating dietary Ca2+ uptake. In this tissue, USP2-45 is found in membrane fractions and negatively regulates NHERF4 protein abundance in a rhythmic manner at the protein level. In clock mutant animals (Cry1/Cry2-dKO, rhythmic USP2-45 expression is lost, as well as the one of NHERF4, confirming the inverse relationship between USP2-45 and NHERF4 protein levels. Finally, USP2-45 interacts in vitro with NHERF4 and endogenous Clathrin Heavy Chain. Taken together these data prompt us to define USP2-45 as the first clock output effector acting at the post-translational level at cell membranes and possibly regulating membrane permeability of Ca2+.

  13. 8 CFR 245.9 - Adjustment of status of certain nationals of the People's Republic of China under Public Law 102...

    Science.gov (United States)

    2010-01-01

    ... of the People's Republic of China under Public Law 102-404. 245.9 Section 245.9 Aliens and Nationality DEPARTMENT OF HOMELAND SECURITY IMMIGRATION REGULATIONS ADJUSTMENT OF STATUS TO THAT OF PERSON... of China under Public Law 102-404. (a) Principal applicant status. All nationals of the People's...

  14. 48 CFR 245.7206 - Transmitting DD Form 1342, DoD Property Record.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Transmitting DD Form 1342... Instructions 245.7206 Transmitting DD Form 1342, DoD Property Record. As a minimum, the plant clearance officer will provide the following information in a letter forwarding DD Forms 1342 to DSCR— (a) Number of DD...

  15. Rectenna Technology Program: Ultra light 2.45 GHz rectenna 20 GHz rectenna

    Science.gov (United States)

    Brown, William C.

    1987-01-01

    The program had two general objectives. The first objective was to develop the two plane rectenna format for space application at 2.45 GHz. The resultant foreplane was a thin-film, etched-circuit format fabricated from a laminate composed of 2 mil Kapton F sandwiched between sheets of 1 oz copper. The thin-film foreplane contains half wave dipoles, filter circuits, rectifying Schottky diode, and dc bussing lead. It weighs 160 grams per square meter. Efficiency and dc power output density were measured at 85% and 1 kw/sq m, respectively. Special testing techniques to measure temperature of circuit and diode without perturbing microwave operation using the fluoroptic thermometer were developed. A second objective was to investigate rectenna technology for use at 20 GHz and higher frequencies. Several fabrication formats including the thin-film scaled from 2.45 GHz, ceramic substrate and silk-screening, and monolithic were investigated, with the conclusion that the monolithic approach was the best. A preliminary design of the monolithic rectenna structure and the integrated Schottky diode were made.

  16. Preparation of miniantibodies to Azospirillum brasilense Sp245 surface antigens and their use for bacterial detection.

    Science.gov (United States)

    Dykman, Lev A; Staroverov, Sergei A; Guliy, Olga I; Ignatov, Oleg V; Fomin, Alexander S; Vidyasheva, Irina V; Karavaeva, Olga A; Bunin, Viktor D; Burygin, Gennady L

    2012-01-01

    This article reports the first preparation of miniantibodies to Azospirillum brasilense Sp245 surface antigens by using a combinatorial phage library of sheep antibodies. The prepared phage antibodies were used for the first time for lipopolysaccharide and flagellin detection by dot assay, electro-optical analysis of cell suspensions, and transmission electron microscopy. Interaction of A. brasilense Sp245 with antilipopolysaccharide and antiflagellin phage-displayed miniantibodies caused the magnitude of the electro-optical signal to change considerably. The electro-optical results were in good agreement with the electron microscopic data. This is the first reported possibility of employing phage-displayed miniantibodies in bacterial detection aided by electro-optical analysis of cell suspensions.

  17. Indoor Propagation Measurement for WLAN Systems Operating in 2.45 GHz ISM Band

    Directory of Open Access Journals (Sweden)

    P. Pechac

    2002-12-01

    Full Text Available For a planning of indoor Wireless LAN systems working in the ISMband, the signal propagation prediction is needed. In this article, themeasurement campaign based on two types of measurements at 2.45 GHz isintroduced. The first type of the measurement was a classicalnarrowband signal level measurement within indoor scenario withoutpresence of people. The aim of this measurement was to find empiricalparameters for COST231 Multi-Wall and One-Slope models. In order tostatistically describe the time varying nature of the received envelopeof the signal, at WLAN 2.45 GHz band, the second part of measurementcampaign was accomplished. In this case, the signal level was measuredusing commercial WLAN PCMCIA cards in two notebooks. Probabilitydensity functions and corresponding cumulative distribution functionswere set and discussed based on the specific locations and orientationof one of the notebooks. Results from both measurement campaigns werecompared and conclusions are drawn for the needs of practical planningof indoor WLAN systems coverage.

  18. 48 CFR 245.7101-2 - DD Form 1149, Requisition and Invoice Shipping Document.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false DD Form 1149, Requisition... Plant Clearance Forms 245.7101-2 DD Form 1149, Requisition and Invoice Shipping Document. Use for... DD Form 1149. This form may also be used to consolidate contractor inventory redistribution system...

  19. 5 CFR 531.245 - Computing locality rates and special rates for GM employees.

    Science.gov (United States)

    2010-01-01

    ... 5 Administrative Personnel 1 2010-01-01 2010-01-01 false Computing locality rates and special... Gm Employees § 531.245 Computing locality rates and special rates for GM employees. Locality rates and special rates are computed for GM employees in the same manner as locality rates and special rates...

  20. Draft Genome Sequence of the Sordariomycete Lecythophora (Coniochaeta) hoffmannii CBS 245.38.

    Science.gov (United States)

    Leonhardt, Sabrina; Büttner, Enrico; Gebauer, Anna Maria; Hofrichter, Martin; Kellner, Harald

    2018-02-15

    Lecythophora ( Coniochaeta ) hoffmannii , a soil- and lignocellulose-inhabiting sordariomycete (Ascomycota) that can also live as a facultative tree pathogen causing soft rot, belongs to the family Coniochaetaceae. The strain CBS 245.38 sequenced here was assembled into 869 contigs, has a size of 30.8 Mb, and comprises 10,596 predicted protein-coding genes. Copyright © 2018 Leonhardt et al.

  1. Use of Powder PEG-3350 as a Sole Bowel Preparation: Clinical Case Series of 245 Patients.

    Science.gov (United States)

    Arora, Manish; Okolo, Patrick I

    2008-07-01

    To assess the efficacy of low-volume powder polyethylene glycol (PEG)-3350 as a sole bowel preparation for colonoscopy. This case series examined 245 consecutive patients (a mixture of inpatients and outpatients undergoing screening colonoscopy) at a hospital endoscopy center over a 2-year period. The patients received powder PEG-3350 in the amount of 204 g dissolved in 32 oz of water and taken in 3 divided doses 1 hour apart with 8 oz of water in between each dose. Colon preparation scores (CPS) were used to assess the quality of colon cleansing. The results obtained from the 245 patients were collated and compared to those of patients receiving sodium phosphate, the historical control. The mean CPS was calculated to be 3.43, with a standard deviation of 1.12. Of the 245 patients, 92 were scored with a grade of 4, and 5 patients had incomplete colonoscopies secondary to failure of bowel preparation (CPS=0). Among the remaining patients, 22 and 26 were graded as poor (CPS=1) or fair (CPS=2) bowel preparations, respectively. The low-volume powder PEG-3350 formula used in our case series showed effective colon cleansing and may be considered for use as a sole bowel preparation.

  2. Effects of Wi-Fi (2.45 GHz) Exposure on Apoptosis, Sperm Parameters and Testicular Histomorphometry in Rats: A Time Course Study.

    Science.gov (United States)

    Shokri, Saeed; Soltani, Aiob; Kazemi, Mahsa; Sardari, Dariush; Mofrad, Farshid Babapoor

    2015-01-01

    In today's world, 2.45-GHz radio-frequency radiation (RFR) from industrial, scientific, medical, military and domestic applications is the main part of indoor-outdoor electromagnetic field exposure. Long-term effects of 2.45-GHz Wi-Fi radiation on male reproductive system was not known completely. Therefore, this study aimed to investigate the major cause of male infertility during short- and long-term exposure of Wi-Fi radiation. This is an animal experimental study, which was conducted in the Department of Anatomical Sciences, Faculty of Medicine, Zanjan University of Medical Sciences, Zanjan, IRAN, from June to August 2014. Three-month-old male Wistar rats (n=27) were exposed to the 2.45 GHz radiation in a chamber with two Wi-Fi antennas on opposite walls. Animals were divided into the three following groups: I. control group (n=9) including healthy animals without any exposure to the antenna, II. 1-hour group (n=9) exposed to the 2.45 GHz Wi-Fi radiation for 1 hour per day during two months and III.7-hour group (n=9) exposed to the 2.45 GHz Wi-Fi radiation for 7 hours per day during 2 months. Sperm parameters, caspase-3 concentrations, histomorphometric changes of testis in addition to the apoptotic indexes were evaluated in the exposed and control animals. Both 1-hour and 7-hour groups showed a decrease in sperm parameters in a time dependent pattern. In parallel, the number of apoptosis-positive cells and caspase-3 activity increased in the seminiferous tubules of exposed rats. The seminal vesicle weight reduced significantly in both1-hour or 7-hour groups in comparison to the control group. Regarding to the progressive privilege of 2.45 GHz wireless networks in our environment, we concluded that there should be a major concern regarding the timedependent exposure of whole-body to the higher frequencies of Wi-Fi networks existing in the vicinity of our living places.

  3. Similarity Theory Based Radial Turbine Performance and Loss Mechanism Comparison between R245fa and Air for Heavy-Duty Diesel Engine Organic Rankine Cycles

    Directory of Open Access Journals (Sweden)

    Lei Zhang

    2017-01-01

    Full Text Available Organic Rankine Cycles using radial turbines as expanders are considered as one of the most efficient technologies to convert heavy-duty diesel engine waste heat into useful work. Turbine similarity design based on the existing air turbine profiles is time saving. Due to totally different thermodynamic properties between organic fluids and air, its influence on turbine performance and loss mechanisms need to be analyzed. This paper numerically simulated a radial turbine under similar conditions between R245fa and air, and compared the differences of the turbine performance and loss mechanisms. Larger specific heat ratio of air leads to air turbine operating at higher pressure ratios. As R245fa gas constant is only about one-fifth of air gas constant, reduced rotating speeds of R245fa turbine are only 0.4-fold of those of air turbine, and reduced mass flow rates are about twice of those of air turbine. When using R245fa as working fluid, the nozzle shock wave losses decrease but rotor suction surface separation vortex losses increase, and eventually leads that isentropic efficiencies of R245fa turbine in the commonly used velocity ratio range from 0.5 to 0.9 are 3%–4% lower than those of air turbine.

  4. Experimental comparison of R123 and R245fa as working fluids for waste heat recovery from heavy-duty diesel engine

    International Nuclear Information System (INIS)

    Shu, Gequn; Zhao, Mingru; Tian, Hua; Huo, Yongzhan; Zhu, Weijie

    2016-01-01

    Organic Rankine Cycle (ORC) on-board is a solution for vehicles to save energy and reduce emission. Considering the characteristics of waste heat from vehicle, the criterions of the suitable working fluid are very strict. R123 and R245fa have been widely used in companies and labs, however, the difference of their properties under different engine conditions still requires further study. During this research, a series of experiments have been done to compare the performance of these two working fluids, what's more, to determine under which engine conditions they are suitable separately. These experimental comparisons are new and important for the targeting design of ORC for vehicles. The result shows that, considering the difference of thermodynamic properties and the limited cooling capacity on board, R123 shows its advantage for the waste heat recovery at heavy duty, while R245fa is more suitable at light-and-medium duty. These properties make R123 suitable for the ORC designed for long-haul heavy-duty truck, while R245fa is suggested for city bus. The following performance test of R123 for waste heat recovery from heavy-duty diesel engine shows that the maximum fuel consumption improvement can be as much as 2.8%. - Highlights: • R123 is more suitable for heavy duty and steady working condition. • R245fa shows its advantage at light-and-medium duty and varying working condition. • R123 suits better for long-haul heavy-duty truck, while R245fa for city bus. • The maximum fuel consumption improvement is as much as 2.8%.

  5. Electrochemical decontamination of waters by advanced oxidation processes (aops: Case of the mineralization of 2,4,5-t on bdd electrode

    Directory of Open Access Journals (Sweden)

    Birame Boye

    2004-12-01

    Full Text Available In the present work, herbicide 2,4,5-trichlorophenoxyacetic acid, more commonly known as 2,4,5-T herbicide, has been completely mineralized (i.e. transformed into CO2 and H2O in saturated aqueous solutions using a semi-industrial electrochemical cell that contains a boron doped diamond anode and a zirconium cathode. We have performed cyclic voltammetry, chronoamperometry and bulk electrolysis to give the optimization characteristics of the degradation of such a compound and its by-products. Bulk electrolysis in the potential region of electrolyte decomposition leads to the complete destruction of 2,4,5-T and its degradation intermediates by means of the electrogeneration of the highly reactive hydroxyl radicals. The evolution of the chemical oxygen demand (COD and the instant current efficiency (ICE during the degradation process is perfectly predicted by a theoretical mathematical model. HPLC and GC-MS have also been performed to highlight the evolution of the mother product and its degradation intermediates. Kinetic analysis of the obtained results has shown a fast destruction of the mother herbicide asserting a diffusion-controlled process. 2,4,5-trichlorophenol and quinone-based organic compounds have been depicted as aromatic intermediates, all of them transformed into short chains carboxylic acids before complete mineralization happens.

  6. Operation characteristic and performance comparison of organic Rankine cycle (ORC) for low-grade waste heat using R245fa, R123 and their mixtures

    International Nuclear Information System (INIS)

    Feng, Yong-qiang; Hung, Tzu-Chen; He, Ya-Ling; Wang, Qian; Wang, Shuang; Li, Bing-xi; Lin, Jaw-Ren; Zhang, Wenping

    2017-01-01

    Highlights: • Experimental comparison using R123, R245fa and their mixtures has been investigated. • The basic operation parameters and the detailed operation characteristics of pure and mixture working fluids are addressed. • The mixture owns a relatively higher pump power consumption, 10–50% higher than that of R245fa and 2–47% higher than that of R123. • The highest system generating efficiency of 4.53% is obtained by 0.67R245fa/0.33R123. - Abstract: The operation characteristic and performance comparison of low-grade organic Rankine cycle (ORC) using R245fa, R123 and their mixtures have been investigated. The heat source temperature is set to be 120 °C, while the mass flow rate is controlled by adjusting the pump frequency. The basic operation parameters are first examined, while the detailed operation characteristics of pure and mixture working fluids are addressed. The system overall performance, including thermal efficiency and system generating efficiency, for pure and mixture working fluids are explored. The experimental results show that the mixtures own a relatively higher pump power consumption and enhancing the pump performance is also significant for ORC application. Whether the mixtures exhibit better thermodynamic performance than the pure working fluids depend on the operation parameters and mass fraction of mixtures. 0.67R245fa/0.33R123 owns the highest maximum net electricity output of 1.67 kW, 4.38% higher than that of R245fa and 63.73% higher than that of R123. Compared to the pure working fluids, the mixture working fluids own a better thermodynamic performance and a moderate economic performance.

  7. [Isolation and purification of Mn-peroxidase from Azospirillum brasilense Sp245].

    Science.gov (United States)

    Kupriashina, M A; Selivanov, N Iu; Nikitina, V E

    2012-01-01

    Homogenous Mn-peroxidase of a 26-fold purity grade was isolated from a culture of Azospirillum brasilense Sp245 cultivated on a medium containing 0.1 mM pyrocatechol. The molecular weight of the enzyme is 43 kD as revealed by electrophoresis in SDS-PAAG. It was shown that the use of pyrocatechol and 2,2'-azino-bis(3-ethylbenzotiazoline-6-sulfonate) at concentrations of 0.1 and I mM as inductors increased the Mn-peroxidase activity by a factor of 3.

  8. Chromosomal flhB1 gene of the alphaproteobacterium Azospirillum brasilense Sp245 is essential for correct assembly of both constitutive polar flagellum and inducible lateral flagella.

    Science.gov (United States)

    Filip'echeva, Yulia; Shelud'ko, Andrei; Prilipov, Alexei; Telesheva, Elizaveta; Mokeev, Dmitry; Burov, Andrei; Petrova, Lilia; Katsy, Elena

    2018-03-01

    Azospirillum brasilense has the ability of swimming and swarming motility owing to the work of a constitutive polar flagellum and inducible lateral flagella, respectively. The interplay between these flagellar systems is poorly understood. One of the key elements of the flagellar export apparatus is the protein FlhB. Two predicted flhB genes are present in the genome of A. brasilense Sp245 (accession nos. HE577327-HE577333). Experimental evidence obtained here indicates that the chromosomal coding sequence (CDS) AZOBR_150177 (flhB1) of Sp245 is essential for the production of both types of flagella. In an flhB1:: Omegon-Km mutant, Sp245.1063, defects in polar and lateral flagellar assembly and motility were complemented by expressing the wild-type flhB1 gene from plasmid pRK415. It was found that Sp245.1063 lost the capacity for slight but statistically significant decrease in mean cell length in response to transfer from solid to liquid media, and vice versa; in the complemented mutant, this capacity was restored. It was also shown that after the acquisition of the pRK415-harbored downstream CDS AZOBR_150176, cells of Sp245 and Sp245.1063 ceased to elongate on solid media. These initial data suggest that the AZOBR_150176-encoded putative multisensory hybrid sensor histidine kinase-response regulator, in concert with FlhB1, plays a role in morphological response of azospirilla to changes in the hardness of a milieu.

  9. Electrochemical decontamination of waters by advanced oxidation processes (aops): Case of the mineralization of 2,4,5-t on bdd electrode

    OpenAIRE

    Birame Boye; Enric Brillas; Beatrice Marselli; Pierre-Alain Michaud; Christos Comninellis; Mor Marième Dieng

    2004-01-01

    In the present work, herbicide 2,4,5-trichlorophenoxyacetic acid, more commonly known as 2,4,5-T herbicide, has been completely mineralized (i.e. transformed into CO2 and H2O) in saturated aqueous solutions using a semi-industrial electrochemical cell that contains a boron doped diamond anode and a zirconium cathode. We have performed cyclic voltammetry, chronoamperometry and bulk electrolysis to give the optimization characteristics of the degradation of such a compound and its by-products. ...

  10. Thermodynamic analysis and comparison between CO_2 transcritical power cycles and R245fa organic Rankine cycles for low grade heat to power energy conversion

    International Nuclear Information System (INIS)

    Li, L.; Ge, Y.T.; Luo, X.; Tassou, S.A.

    2016-01-01

    Highlights: • CO_2 is a promising working fluid to be applied in low-grade power generation systems. • Thermodynamic models of CO_2 transcritical power cycles (T-CO_2) and R245fa ORC were developed. • Energy and exergy analyses were carried out for T-CO_2 and R245fa ORC systems. • Optimal system designs are existed for both T-CO_2 and R245fa ORC systems. - Abstract: In this paper, a theoretical study is conducted to investigate and compare the performance of CO_2 transcritical power cycles (T-CO_2) and R245fa organic Rankine cycles (ORCs) using low-grade thermal energy to produce useful shaft or electrical power. Each power cycle consists of typical Rankine cycle components, such as a working fluid pump, gas generator or evaporator, turbine with electricity generator, air cooled condenser and recuperator (internal heat exchanger). The thermodynamic models of both cycles have been developed and are applied to calculate and compare the cycle thermal and exergy efficiencies at different operating conditions and control strategies. The simulation results show that the system performances for both cycles vary with different operating conditions. When the heat source (waste heat) temperature increases from 120 °C to 260 °C and heat sink (cooling air) temperature is reduced from 20 °C to 0 °C, both thermal efficiencies of R245fa ORC and T-CO_2 with recuperator can significantly increase. On the other hand, R245fa ORC and T-CO_2 exergy efficiencies increase with lower heat sink temperatures and generally decrease with higher heat source temperatures. In addition, with the same operating conditions and heat transfer assumptions, the thermal and exergy efficiencies of R245fa ORCs are both slightly higher than those of T-CO_2. However, the efficiencies of both cycles can be enhanced by installing a recuperator in each system at specified operating conditions. Ultimately, optimal operating states can be predicted, with particular focus on the working fluid expander

  11. Status of the high current permanent magnet 2.45 GHz ECR ion source at Peking University

    International Nuclear Information System (INIS)

    Peng, S.X.; Song, Z.Z.; Yu, J.X.; Ren, H.T.; Zhang, M.; Yuan, Z.X.; Lu, P.N.; Zhao, J.; Chen, J.E.; Guo, Z.Y.; Lu, Y.R.

    2012-01-01

    Several compact 2.45 GHz Electron Cyclotron Resonance Ion Sources (ECRIS) have been developed at Peking University for ion implantation, for the Separated Function Radio Frequency Quadrupole project (SFRFQ) and for the Peking University Neutron Imaging Facility project (PKUNIFTY). Studies on 2.45 GHz ECR ion sources are concentrated on methods of microwave coupling and microwave window design, magnetic field generation and configuration, as well as the extraction electrodes structure. Investigation also covers the influence of the size of plasma chamber on the discharge efficiency and species factor. Up to now, our sources have produced 25 mA of O + ions, 40 mA of He + ions, 10 mA of N + ions, 100 mA of H + ions and 83 mA of D + ions, respectively. The paper is followed by the slides of the presentation. (authors)

  12. Tannic acid Catalyzed an Efficient Synthesis of 2,4,5-Triaryl-1H-Imidazole

    Directory of Open Access Journals (Sweden)

    Shitole Nana Vikram

    2013-05-01

    Full Text Available Tannic acid (C76H52O46 has been found to be an efficient catalyst for one-pot synthesis of 2,4,5-triaryl substituted imidazoles by the reaction of an arylaldehyde, benzyl/benzoin and an ammonium acetate. The short reaction time and excellent yields making this protocol practical and economically attractive.

  13. A steady-state mechanism can account for the properties of inositol 2,4,5-trisphosphate-stimulated Ca2+ release from permeabilized L1210 cells.

    Science.gov (United States)

    Loomis-Husselbee, J W; Dawson, A P

    1993-01-01

    We have investigated the effects of sub-maximal Ins(2,4,5)P3 concentrations on the Ca2+ permeability of the residual undischarged Ca2+ stores in electroporated or digitonin-permeabilized L1210 cells by measuring Ca(2+)-efflux rate after addition of the ATPase inhibitor thapsigargin. Low concentrations of Ins(2,4,5)P3, causing rapid discharge of a small proportion of the releasable Ca2+, result in a substantial stimulation of Ca2+ efflux after thapsigargin addition. This indicates firstly that in the absence of thapsigargin there must have been a substantial, counterbalancing, increase in rate of Ca2+ pumping, and secondly that the increased Ca2+ permeability is more consistent with a steady state than with a quantal model of Ca2+ release. Similar increases in passive Ca2+ permeability are produced by addition of concentrations of ionomycin which produce equivalent changes in Ca2+ loading to those produced by Ins(2,4,5)P3, although the time course and initial rate of Ca2+ release are very much slower. In the presence of a Ca(2+)-buffering system, the time course of Ca2+ release by Ins(2,4,5)P3 becomes superimposable on that of ionomycin, indicating that the initial rapid phase of Ins(2,4,5)P3-stimulated Ca2+ is at least partially due to positive feedback from extravesicular Ca2+. PMID:8382056

  14. 48 CFR 1852.245-73 - Financial reporting of NASA property in the custody of contractors.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 6 2010-10-01 2010-10-01 true Financial reporting of NASA... CONTRACT CLAUSES Texts of Provisions and Clauses 1852.245-73 Financial reporting of NASA property in the custody of contractors. As prescribed in 1845.106-70(d), insert the following clause: Financial Reporting...

  15. [Changes in Cell Surface Properties and Biofilm Formation Efficiency in Azospirillum brasilense Sp245 Mutants in the Putative Genes of Lipid Metabolism mmsB1 and fabG1].

    Science.gov (United States)

    Shumilova, E; Shelud'ko, A V; Filip'echeva, Yu A; Evstigneeva, S S; Ponomareva, E G; Petrova, L P; Katsy, E I

    2016-01-01

    The previously obtained insertion mutants ofAzospirillum brasilense Sp245 in the genes mmsBl and fabG1 (strains SK039 and Sp245.1610, respectively) were characterized by impaired flagellation and motility. The putative products of expression of these genes are 3-hydroxyisobutyrate dehydrogenase and 3-oxoacyl-[acyl-carrier protein] reductase, respectively. In the present work, A. brasilense- Sp245 strains SK039 and Sp245.1610 were found to have differences in the content of 3-hydroxyhexadecanoic, hexadecanoic, 3-hydroxytetradecanoic, hexadecenoic, octadecenoic, and nonadecanoic acids in their lipopolysaccharide prepa- rations, as well as in cell hydrophobicity and hemagglutination activity and dynamics of cell aggregation, in biomass amount, and in the relative content of lipopolysaccharide antigens in mature biofilms formed on hydrophilic or hydrophobic surfaces.

  16. Zinc (II) [tetra(4-methylphenyl)] Porphyrin: a Novel and Reusable Catalyst for Efficient Synthesis of 2,4,5-trisubstituted Imidazoles Under Ultrasound Irradiation

    Energy Technology Data Exchange (ETDEWEB)

    Safari, Javad; Khalili, Shiva Dehghan; Banitaba, Sayed Hossein; Dehghani, Hossein [Univ. of Kashan, Kashan (Iran, Islamic Republic of)

    2011-10-15

    An efficient three-component one-step synthesis of 2,4,5-trisubstituted imidazoles by condensation reaction of 1,2-diketones or α-hydroxyketones with aromatic aldehydes and ammonium acetate using Zinc (II) [tetra (4-methylphenyl)] porphyrin as a novel and reusable catalyst under ultrasound irradiation at ambient temperature is described. In this method, α-hydroxyketones as well as 1,2-diketones were converted to their corresponding 2,4,5-trisubstituted imidazoles in excellent yields.

  17. 2,4,5-trihydroxy-3-methylacetophenone: A cellulosic chromophore as a case study of aromaticity

    Science.gov (United States)

    Nele Sophie Zwirchmayr; Thomas Elder; Markus Bacher; Andreas Hofinger-Horvath; Paul Kosma; Thomas. Rosenau

    2017-01-01

    The title compound (2,4,5-trihydroxy-3-methylacetophenone, 1) was isolated as chromophore from aged cellulosic pulps. The peculiar feature of the compound is its weak aromatic system that can be converted into nonaromatic (quinoid or cyclic aliphatic) tautomers, depending on the conditions and reaction partners. In alkaline media, the participation of quinoid canonic...

  18. Discovery of 245 Hz burst oscillations from the accreting millisecond pulsar IGR J17511-3057

    NARCIS (Netherlands)

    Watts, A.L.; Altamirano, D.; Markwardt, C.B.; Strohmayer, T.E.

    2009-01-01

    RXTE observations of the bursting accreting millisecond X-ray pulsar IGR J17511-3057 (ATEL #2196, #2197, #2198) showed a short Type I X-ray burst on September 14th 2009. We detect strong burst oscillations at 245 Hz, very close to the spin frequency. Maximum Leahy power is in the range 130-215 in 3

  19. Fission cross section of 245Cm from 10-3 eV to 104 eV

    International Nuclear Information System (INIS)

    White, R.M.; Browne, J.C.; Howe, R.E.; Landrum, J.H.; Becker, J.A.

    1979-01-01

    The neutron-induced fission cross section of 245 Cm measured from .001 eV to 10 keV using the LLL 100-MeV Linac. The resonance data are analyzed with a multilevel-multichannel R-matrix code. The statistical distribution of R-matrix parameters extracted from the analysis are investigated and comparisons are made with previous work. 4 reference

  20. Remote powering platform for implantable sensor systems at 2.45 GHz.

    Science.gov (United States)

    Kazanc, Onur; Yilmaz, Gurkan; Maloberti, Franco; Dehollain, Catherine

    2014-01-01

    Far-field remotely powered sensor systems enable long distance operation for low-power sensor systems. In this work, we demonstrate a remote powering platform with a miniaturized antenna and remote powering base station operating at 2.45 GHz. The rectenna, which is the energy receiving and conversion element of the sensor system, is designed and measured. The measurements for the tag are performed within 15 cm distance from the remote powering base station. The realized gain of the tag antenna is measured as -3.3 dB, which is 0.5 dB close to the simulations, where simulated realized gain is -2.8 dB.

  1. Rats exposed to 2.45GHz of non-ionizing radiation exhibit behavioral changes with increased brain expression of apoptotic caspase 3.

    Science.gov (United States)

    Varghese, Rini; Majumdar, Anuradha; Kumar, Girish; Shukla, Amit

    2018-03-01

    In recent years there has been a tremendous increase in use of Wi-Fi devices along with mobile phones, globally. Wi-Fi devices make use of 2.4GHz frequency. The present study evaluated the impact of 2.45GHz radiation exposure for 4h/day for 45days on behavioral and oxidative stress parameters in female Sprague Dawley rats. Behavioral tests of anxiety, learning and memory were started from day 38. Oxidative stress parameters were estimated in brain homogenates after sacrificing the rats on day 45. In morris water maze, elevated plus maze and light dark box test, the 2.45GHz radiation exposed rats elicited memory decline and anxiety behavior. Exposure decreased activities of super oxide dismutase, catalase and reduced glutathione levels whereas increased levels of brain lipid peroxidation was encountered in the radiation exposed rats, showing compromised anti-oxidant defense. Expression of caspase 3 gene in brain samples were quantified which unraveled notable increase in the apoptotic marker caspase 3 in 2.45GHz radiation exposed group as compared to sham exposed group. No significant changes were observed in histopathological examinations and brain levels of TNF-α. Analysis of dendritic arborization of neurons showcased reduction in number of dendritic branching and intersections which corresponds to alteration in dendritic structure of neurons, affecting neuronal signaling. The study clearly indicates that exposure of rats to microwave radiation of 2.45GHz leads to detrimental changes in brain leading to lowering of learning and memory and expression of anxiety behavior in rats along with fall in brain antioxidant enzyme systems. Copyright © 2017 Elsevier B.V. All rights reserved.

  2. Mineralization of 2,4-Dichlorophenoxyacetic Acid (2,4-D) and Mixtures of 2,4-D and 2,4,5-Trichlorophenoxyacetic Acid by Phanerochaete chrysosporium

    Science.gov (United States)

    Yadav, J. S.; Reddy, C. A.

    1993-01-01

    Evidence is presented for mineralization of 2,4-dichlorophenoxyacetic acid (2,4-D) in nutrient-rich media (high-nitrogen and malt extract media) by wild-type Phanerochaete chrysosporium and by a peroxidase-negative mutant of this organism. Mass balance analysis of [U-ring-14C]2,4-D mineralization in malt extract cultures showed 82.7% recovery of radioactivity. Of this, 38.6% was released as 14CO2 and 27.0, 11.2, and 5.9% were present in the aqueous, methylene chloride, and mycelial fractions, respectively. 2,4-D and 2,4,5-trichlorophenoxyacetic acid (2,4,5-T) were simultaneously mineralized when presented as a mixture, and mutual inhibition of degradation was not observed. In contrast, a relatively higher rate of mineralization of 2,4-D and 2,4,5-T was observed when these compounds were tested as mixtures than when they were tested alone. PMID:16349039

  3. [Mutants of bacterium Azospirillum brasilense Sp245 with Omegon insertion in mmsB or fabG genes of lipid metabolism are defective in motility and flagellation].

    Science.gov (United States)

    Kovtunov, E A; Shelud'ko, A V; Chernyshova, M P; Petrova, L P; Katsy, E I

    2013-11-01

    Bacteria Azospirillum brasilense have mixed flagellation: in addition to the polar flagellum, numerous lateral flagella are formed in their cells on medium with increased density. Flagella determine the active swimming and swarming capacities of azospirilla. Using A. brasilense Sp245 as an example, we showed that the Omegon-Km artificial transposon insertion into the chromosomal gene for 3-hydroxyisobutyrate dehydrogenase (mmsB) was concurrent with the appearance of significant defects in the formation of polar flagella and with the paralysis of lateral flagella. The Sp245 mutant with the Omegon insertion into the plasmid AZOBR_p1-borne gene for 3-oxoacyl-[acyl-carrier protein]-reductase (fabG) showed the complete loss of flagella and the swarming capacity, as well as significant defects in polar flagellar assembly (though some cells are still motile in liquid medium). The viability of the A. brasilense Sp245 mutants with the Omegon insertion into the mmsB or fabG gene was not reduced. No considerable differences in the fatty acid composition of whole cell lipid extracts were found for the A. brasilense Sp245 strain and its mmsB and fabG mutants.

  4. Electron temperature profiles in axial field 2.45 GHz ECR ion source with a ceramic chamber

    Science.gov (United States)

    Abe, K.; Tamura, R.; Kasuya, T.; Wada, M.

    2017-08-01

    An array of electrostatic probes was arranged on the plasma electrode of a 2.45 GHz microwave driven axial magnetic filter field type negative hydrogen (H-) ion source to clarify the spatial plasma distribution near the electrode. The measured spatial distribution of electron temperature indicated the lower temperature near the extraction hole of the plasma electrode corresponding to the effectiveness of the axial magnetic filter field geometry. When the ratio of electron saturation current to the ion saturation current was plotted as a function of position, the obtained distribution showed a higher ratio near the hydrogen gas inlet through which ground state hydrogen molecules are injected into the source. Though the efficiency in producing H- ions is smaller for a 2.45 GHz source than a source operated at 14 GHz, it gives more volume to measure spatial distributions of various plasma parameters to understand fundamental processes that are influential on H- production in this type of ion sources.

  5. Breakdown transient study of plasma distributions in a 2.45 GHz hydrogen discharge

    Energy Technology Data Exchange (ETDEWEB)

    Cortázar, O.D., E-mail: daniel.cortazar@uclm.es [Universidad de Castilla-La Mancha, ETSII-INEI, Applied Mechanics and Projects Department, C.J. Cela s/n, 13170 Ciudad Real (Spain); Megía-Macías, A. [ESS Bilbao Consortium, Polígono Ugaldeguren-III Pol. A 7B, 48170-Zamudio, Vizcaya (Spain); Tarvainen, O.; Koivisto, H. [University of Jyväskylä, Department of Physics, PO Box 35 (YFL), 40500 Jyväskylä (Finland)

    2015-05-01

    Plasma distribution transients associated with the breakdown of a 2.45 GHz hydrogen discharge similar to high current microwave ion sources are studied by means of an ultra-fast frame image acquisition system in visible light range. Eight different plasma distributions have been studied by photographing the 2D projections of the discharge through a transparent plasma electrode. The temporal evolution of images in Balmer-alpha and Fulcher band wavelengths have been recorded associated to atomic and molecular excitation and ionization processes. Some unexpected plasma distributions transient behaviors during breakdown are reported.

  6. Performance comparison of low-grade ORCs (organic Rankine cycles) using R245fa, pentane and their mixtures based on the thermoeconomic multi-objective optimization and decision makings

    International Nuclear Information System (INIS)

    Feng, Yongqiang; Hung, TzuChen; Zhang, Yaning; Li, Bingxi; Yang, Jinfu; Shi, Yang

    2015-01-01

    Based on the thermoeconomic multi-objective optimization and decision makings, considering both exergy efficiency and LEC (levelized energy cost), the performance comparison of low-grade ORCs (organic Rankine cycles) using R245fa, pentane and their mixtures has been investigated. The effects of mass fraction of R245fa and four key parameters on the exergy efficiency and LEC are examined. The Pareto-optimal solutions are selected from the Pareto optimal frontier obtained by NSGA-II algorithm using three decision makings, including Shannon Entropy, LINMAP and TOPSIS. The deviation index is introduced to evaluate different decision makings. Research demonstrates that as the mass fraction of R245fa increasing, the exergy efficiency decreases first and then increases, while LEC presents a reverse trend. The optimum values from TOPSIS decision making are selected as the preferred Pareto-optimal solution for its lowest deviation index. The Pareto-optimal solutions for pentane, R245fa, and 0.5pentane/0.5R245fa in pairs of (exergy efficiency, LEC) are (0.5425, 0.104), (0.5502, 0.111), and (0.5212, 0.108), respectively. The mixture working fluids present lower thermodynamic performance and moderate economic performance than the pure working fluids under the Pareto optimization. - Highlights: • The thermoeconomic comparison between pure and mixture working fluids is investigated. • The Pareto-optimal solutions with bi-objective function using three decision makings are obtained. • The optimum values from TOPSIS decision making are selected as the preferred Pareto-optimal solution. • The mixture yields lower thermodynamic performance and moderate economic performance.

  7. Yields of fission products produced by thermal-neutron fission of 245Cm

    International Nuclear Information System (INIS)

    Dickens, J.K.; McConnell, J.W.

    1981-01-01

    Absolute yields have been determined for 105 gamma rays emitted in the decay of 95 fission products representing 54 mass chains created during thermal-neutron fission of 245 Cm. These results include 17 mass chains for which no prior yield data exist. Using a Ge(Li) detector, spectra were obtained of gamma rays between 30 sec and 0.3 yr after very short irradiations of thermal neutrons on a 1 μg sample of 245 Cm. On the basis of measured gamma-ray yields and known nuclear data, total chain mass yields and relative uncertainties were obtained for 51 masses between 84 and 156. The absolute overall normalization uncertainty is 239 Pu and for 252 Cf(s.f.); the influences of the closed shells Z=50, N=82 are not as marked as for thermal-neutron fission of 239 Pu but much more apparent than for 252 Cf(s.f.). Information on the charge distribution along several isobaric mass chains was obtained by determining fractional yields for 12 fission products. The charge distribution width parameter, based upon data for the heavy masses, A=128 to 140, is independent of mass to within the uncertainties of the measurements. Gamma-ray assignments were made for decay of short-lived fission products for which absolute gamma-ray transition probabilities are either not known or in doubt. Absolute gamma-ray transition probabilities were determined as (51 +- 8)% for the 374-keV gamma ray from decay of 110 Rh, (35 +- 7)% for the 1096-keV gamma ray from decay of 133 Sb, and (21.2 +- 1.2)% for the 255-keV gamma ray from decay of 142 Ba

  8. 24 CFR 245.417 - Initial submission of materials to HUD: Conversion of residential units to a nonresidential use...

    Science.gov (United States)

    2010-04-01

    ... HUD: Conversion of residential units to a nonresidential use, or to cooperative housing or... Covered Action § 245.417 Initial submission of materials to HUD: Conversion of residential units to a nonresidential use, or to cooperative housing or condominiums. In the case of a conversion of residential units...

  9. Synthesis and crystal structure of a new homoleptic tetraarylruthenium(IV) complex Ru(2,4,5-Me{sub 3}C{sub 6}H{sub 2}){sub 4}

    Energy Technology Data Exchange (ETDEWEB)

    Wang, Chang-Jiu; Wu, Xiu-Li; Ma, Xiu-Fang; Jia, Ai-Quan; Zhang, Qian-Feng [Anhui Univ. of Technology, Anhui (China). Inst. of Molecular Engineering and Applied Chemistry and Anhui Province Key Lab. of Metallurgy Engineering and Resources Recycling

    2017-08-01

    Treatment of [Ru(acac){sub 3}] (acac-=acetylacetonate) with (2,4,5-Me{sub 3}C{sub 6}H{sub 2})MgBr, followed by column chromatography in air, afforded the homoleptic tetraaryl-ruthenium(IV) complex [Ru(2,4,5-Me{sub 3}C{sub 6}H{sub 2}){sub 4}] (1) in moderate yield. The product was characterized by proton NMR spectroscopy and microanalyses. Its crystal structure has also been established by X-ray crystallography.

  10. 2.45 GHz Class E Power Amplifier for a Transmitter Combining LINC and EER

    Directory of Open Access Journals (Sweden)

    M. Dirix

    2009-01-01

    Full Text Available A 10 W class-E RF power amplifier (PA is designed and fabricated using a Cree GaN HEMT. The proposed PA uses an innovative input circuit to optimize band with. At 2.45 GHz the PA achieves a PAE of 60 % at an outputpower of 40 dBm. The resulting amplifier is simulated and constructed using a transmissionline topology. Two of these amplifiers are fabricated on a single board for outphasing application. Their suitability for outphasing application and supply modulation is investigated. 

  11. Preparation and electrochemical properties of La_0_._7_0Mg_xNi_2_._4_5Co_0_._7_5Al_0_._3_0 (x = 0, 0.30, 0.33, 0.36, 0.39) hydrogen storage alloys

    International Nuclear Information System (INIS)

    Tian, Xiao; Wei, Wei; Duan, Ruxia; Zheng, Xinyao; Zhang, Huaiwei; Tegus, O.; Li, Xingguo

    2016-01-01

    The as-cast alloy with the composition of La_0_._7_0Ni_2_._4_5Co_0_._7_5Al_0_._3_0 was prepared by vacuum arc melting. La–Mg–Ni-based La_0_._7_0Mg_xNi_2_._4_5Co_0_._7_5Al_0_._3_0 hydrogen storage alloy has been synthesized by high-energy vibratory milling blending of the La_0_._7_0Ni_2_._4_5Co_0_._7_5Al_0_._3_0 as-cast alloy and elemental Mg, followed by an isothermal annealing. The microstructures and electrochemical properties of the La_0_._7_0Ni_2_._4_5Co_0_._7_5Al_0_._3_0 and La_0_._7_0Mg_xNi_2_._4_5Co_0_._7_5Al_0_._3_0 alloys were investigated by XRD, SEM and electrochemical measurements. The XRD analysis and Rietveld refinement showed that the as-cast La_0_._7_0Ni_2_._4_5Co_0_._7_5Al_0_._3_0 alloy consists of single LaNi_5 phase, whereas the La_0_._7_0Mg_xNi_2_._4_5Co_0_._7_5Al_0_._3_0 alloys contain the LaNi_5 and (La, Mg)_2Ni_7. The electrochemical measurements indicated that the maximum discharge capacity and discharge potential characteristic of the La_0_._7_0Mg_xNi_2_._4_5Co_0_._7_5Al_0_._3_0 alloys increases first and then decreases with increasing x. The maximum discharge capacity and discharge potential characteristic of alloy reaches the optimum when x is 0.36. The cyclic stability of the La_0_._7_0Mg_xNi_2_._4_5Co_0_._7_5Al_0_._3_0 alloy with a smaller quantity of Mg is better than that of the alloy with a larger quantity of Mg. - Highlights: • La–Mg–Ni-based alloy was synthesized by melting, milling and subsequent annealing. • Mg atoms exist in the La_2Ni_7 phase prior to LaNi_5 phase. • The La_0_._7_0Mg_xNi_2_._4_5Co_0_._7_5Al_0_._3_0 alloys consist of the LaNi_5 and (La, Mg)_2Ni_7. • The more Mg element the alloys contain, the easier aggregation Mg atom is. • The C_m_a_x of La_0_._7_0Mg_xNi_2_._4_5Co_0_._7_5Al_0_._3_0 alloy first increases and then decreases with rising x.

  12. A Alexander von Humboldt, el Ciudadano Universal, en su natalicio 245

    Directory of Open Access Journals (Sweden)

    José Leonardo De Sousa

    2018-04-01

    Full Text Available Hace 245 años, en la escala del tiempo del planeta, Alexander von Humboldt vislumbró la luz de la vida el día 14 de septiembre de 1769. A nuestro entender fue el máximo y, quizás, uno de los últimos exponentes de ese movimiento del Enciclopedismo Europeo conocido como la Ilustración . Tal fue su contribución al conocimiento integral del territorio americano que fue calificado por el Libertador Simón Bolívar como el “ descubridor científico del Nuevo Mundo ” y declarado como Ciudadano Mexicano, en 1827, por Guadalupe Victoria (primer presidente de México y luego, como Benemérito de la Patria por el presidente mexicano Benito Juárez.

  13. Experimental studies of 2.45 GHz ECR ion sources for the production of high intensity currents

    International Nuclear Information System (INIS)

    Coly, A.

    2010-12-01

    This thesis is the result of a collaboration between the Pantechnik company and the LPSC (Laboratory of subatomic physics and cosmology of Grenoble). It consisted in the development of a new test bench dedicated to the characterization of a 2.45 GHz ECR ion sources with the aim of the production of high currents beams for industrial purposes. Two ECR ions sources with different magnetic structures have been tested around the same RF injection system. A new 2.45 GHz ECRIS, named SPEED, featuring a dipolar magnetic field at the extraction has been designed and tested. A study of the beam extraction in the dipolar magnetic field is proposed. First tests have shown a total ionic current density of about 10 mA/cm 2 with a 900 W RF power. Tests with hydrogen plasma have shown a maximum of current on the H 2 + species. Recommendations are given to modify the magnetic structure to improve the H + production yield. The MONO1000 ion source has been tested at high RF power with a wave guide type injection system. Intense total ionic current densities have been measured up to about 95 mA/cm 2 with a diode extraction system. First results using an improved 5 electrode extraction system are presented. (author)

  14. The strontium isotopic composition of interstitial waters from sites 245 and 336 of the deep sea drilling project

    International Nuclear Information System (INIS)

    Hawkesworth, C.J.; Elderfield, H.

    1978-01-01

    Measurements of 87 Sr/ 86 Sr ratios of interstitial waters from leg 25, site 245 and leg 38, site 336 of the Deep Sea Drilling Project show that the enrichment of Sr 2+ with depth is caused both by the alteration of volcanic material and by the introduction of strontium derived from calcium carbonate. 87 Sr/ 86 Sr ratios range from 0.70913 to 0.70794 at site 245 and from 0.70916 to 0.70694 at site 336. The low ratios compared with contemporaneous seawater reflect the release of Sr from a volcanic source having, according to material-balance calculations, a 87 Se/ 86 Sr ratio of about 0.7034 at site 336. At this site the source appears to be volcanic ash and not basaltic basement which acts as a sink for Sr 2+ during in situ low-temperature weathering. The volcanic contribution to the strontium enrichment in the basal interstitial waters varies from 50% at site 336. The remaining Sr 2+ is derived from Sr-rich biogenic carbonate during diagenetic recrystallization to form Sr-poor calcite. (Auth.)

  15. Experimental evidence of E × B plasma rotation in a 2.45 GHz hydrogen discharge

    Energy Technology Data Exchange (ETDEWEB)

    Cortázar, O. D., E-mail: daniel.cortazar@uclm.es [Institute for Energy Research-INEI, University of Castilla-La Mancha, C.J. Cela s/n, 13170 Ciudad Real (Spain); Megía-Macías, A. [CERN, BE-ABP-HSL Department, CH1211 Geneva (Switzerland); E.S.S. Bilbao, Polígono Ugaldeguren III, A-7B, 48170 Zamudio (Spain); Tarvainen, O.; Koivisto, H. [Department of Physics, Accelerator Laboratory, University of Jyväskylä, PO Box 35 (YFL), 40500 Jyväskylä (Finland)

    2015-12-15

    An experimental observation of a rotating plasma structure in a 2.45 GHz microwave-driven hydrogen discharge is reported. The rotation is presumably produced by E × B drift. The formation of the rotating plasma structure is sensitive to the strength of the off-resonance static magnetic field. The rotation frequency is on the order of 10 kHz and is affected by the neutral gas pressure and applied microwave power.

  16. Experimental evidence of E × B plasma rotation in a 2.45 GHz hydrogen discharge

    International Nuclear Information System (INIS)

    Cortázar, O. D.; Megía-Macías, A.; Tarvainen, O.; Koivisto, H.

    2015-01-01

    An experimental observation of a rotating plasma structure in a 2.45 GHz microwave-driven hydrogen discharge is reported. The rotation is presumably produced by E × B drift. The formation of the rotating plasma structure is sensitive to the strength of the off-resonance static magnetic field. The rotation frequency is on the order of 10 kHz and is affected by the neutral gas pressure and applied microwave power

  17. [Insertional mutation in the AZOBR_p60120 gene is accompanied by defects in the synthesis of lipopolysaccharide and calcofluor-binding polysaccharides in the bacterium Azospirillum brasilense Sp245].

    Science.gov (United States)

    Katsy, E I; Prilipov, A G

    2015-03-01

    In the bacterium Azospirillum brasilense Sp245, extracellular calcofluor-binding polysaccharides (Cal+ phenotype) and two types of lipopolysaccharides, LPSI and LPSII, were previously identified. These lipopolysaccharides share the same repeating O-polysaccharide unit but have different antigenic structures and different charges of their O-polysaccharides and/or core oligosaccharides. Several dozens of predicted genes involved in the biosynthesis of polysaccharides have been localized in the AZOBR_p6 plasmid of strain Sp245 (GenBank accession no. HE577333). In the present work, it was demonstrated that an artificial transposon Omegon-Km had inserted into the central region of the AZOBR_p60120 gene in the A. brasilense Sp245 LPSI- Cal- KM252 mutant. In A. brasilense strain Sp245, this plasmid gene encodes a putative glycosyltransferase containing conserved domains characteristic of the enzymes participating in the synthesis of O-polysaccharides and capsular polysaccharides (accession no. YP004987664). In mutant KM252, a respective predicted protein is expected to be completely inactivated. As a result of the analysis of the EcoRI fragment of the AZOBR_p6 plasmid, encompassing the AZOBR_p60120 gene and a number of other loci, novel data on the structure of AZOBR_p6 were obtained: an approximately 5-kb gap (GenBank accession no. KM189439) was closed in the nucleotide sequence of this plasmid.

  18. Computation of temperature elevation in rabbit eye irradiated by 2.45-GHz microwaves with different field configurations.

    Science.gov (United States)

    Hirata, Akimasa; Watanabe, Soichi; Taki, Masao; Fujiwara, Osamu; Kojima, Masami; Sasaki, Kazuyuki

    2008-02-01

    This study calculated the temperature elevation in the rabbit eye caused by 2.45-GHz near-field exposure systems. First, we calculated specific absorption rate distributions in the eye for different antennas and then compared them with those observed in previous studies. Next, we re-examined the temperature elevation in the rabbit eye due to a horizontally-polarized dipole antenna with a C-shaped director, which was used in a previous study. For our computational results, we found that decisive factors of the SAR distribution in the rabbit eye were the polarization of the electromagnetic wave and antenna aperture. Next, we quantified the eye average specific absorption rate as 67 W kg(-1) for the dipole antenna with an input power density at the eye surface of 150 mW cm(-2), which was specified in the previous work as the minimum cataractogenic power density. The effect of administrating anesthesia on the temperature elevation was 30% or so in the above case. Additionally, the position where maximum temperature in the lens appears is discussed due to different 2.45-GHz microwave systems. That position was found to appear around the posterior of the lens regardless of the exposure condition, which indicates that the original temperature distribution in the eye was the dominant factor.

  19. Global emissions of the hydrofluorocarbons (HFCs) HFC-365mfc, HFC-245fa, HFC-227ea, and HFC-236fa based on atmospheric observations

    Science.gov (United States)

    Vollmer, M. K.; Miller, B. R.; Rigby, M. L.; Reimann, S.; Muhle, J.; Agage, Soge, Snu Members, Kopri Members

    2010-12-01

    We report on the atmospheric measurements and global emissions of the hydrofluorocarbons (HFCs) HFC-365mfc (CH3CH2CF2CF3, 1,1,1,3,3-pentafluorobutane), HFC-245fa (CHF2CH2CF3, 1,1,1,3,3-pentafluoropropane), HFC-227ea (CF3CHFCF3, 1,1,1,2,3,3,3-heptafluoropropane), and HFC-236fa (CF3CH2CF3, 1,1,1,3,3,3-hexafluoropropane). These measurements are from in-situ observations at stations of AGAGE (Advanced Global Atmospheric Gases Experiment) and SOGE (System for Observations of Halogenated Greenhouse Gases in Europe), and from the Korean station Gosan. We also report on flask sample measurements from the Antarctic stations King Sejong and Troll, and extend our records back to the 1970s using archived air samples of both hemispheres. All data are used in a global 12-box 2-dimensional atmospheric transport model to derive global abundances and emission estimates. All four HFCs have strongly increased in the atmosphere in recent years with growth rates at nearly 10 %, resulting in dry air mole fractions at the end of 2009 of 0.49 ppt for HFC-365mfc, 1.00 ppt for HFC-245fa, and 0.51 ppt for HFC-227ea. HFC-236fa, for which we report the first atmospheric measurements, is less abundant and has grown to 0.069 ppt at the end of 2009. Our model results show rapidly growing emissions of HFC-365mfc and HFC-245fa after 2002 but surprisingly these have now started to decline to globally 2.7 kt/yr (HFC-365mfc) and 6.1 kt/yr (HFC-245fa). On the other hand HFC-227ea and HFC-236fa show uninterrupted growth in their emissions of 2.5 kt/yr and 0.2 kt/yr at the end of 2009.

  20. Mutagenicity of 1-Ethyl-2,4,5-triphenyl-1H-imidazole and Six Derivatives in Salmonella typhimurium

    OpenAIRE

    KORKMAZ, Ferhan; Korkmaz, Ferhan; MERCANGOZ, Ayse

    2010-01-01

     Newly synthesized 1-Ethyl-2,4,5-triphenyl-1H-imidazole and its six derivatives were tested by Ames assay. In order to reveal the mutagenic activities of the compounds, two different mutant strains of Salmonella typhimurium (TA98 and TA100) were used in an Ames assay with/without S9 microsomal fraction from rat liver. It was found that the compounds have no mutagenic activities.          &nb...

  1. Emittance studies of the 2.45 GHz permanent magnet ECR ion source

    Science.gov (United States)

    Zelenak, A.; Bogomolov, S. L.; Yazvitsky, N. Yu.

    2004-05-01

    During the past several years different types of permanent magnet 2.45 GHz (electron cyclotron resonance) ion sources were developed for production of singly charged ions. Ion sources of this type are used in the first stage of DRIBs project, and are planned to be used in the MASHA mass separator. The emittance of the beam provided by the source is one of the important parameters for these applications. An emittance scanner composed from a set of parallel slits and rotary wire beam profile monitor was used for the studying of the beam emittance characteristics. The emittance of helium and argon ion beams was measured with different shapes of the plasma electrode for several ion source parameters: microwave power, source potential, plasma aperture-puller aperture gap distance, gas pressure. The results of measurements are compared with previous simulations of ion optics.

  2. Emittance studies of the 2.45 GHz permanent magnet ECR ion source

    International Nuclear Information System (INIS)

    Zelenak, A.; Bogomolov, S.L.; Yazvitsky, N.Yu.

    2004-01-01

    During the past several years different types of permanent magnet 2.45 GHz (electron cyclotron resonance) ion sources were developed for production of singly charged ions. Ion sources of this type are used in the first stage of DRIBs project, and are planned to be used in the MASHA mass separator. The emittance of the beam provided by the source is one of the important parameters for these applications. An emittance scanner composed from a set of parallel slits and rotary wire beam profile monitor was used for the studying of the beam emittance characteristics. The emittance of helium and argon ion beams was measured with different shapes of the plasma electrode for several ion source parameters: microwave power, source potential, plasma aperture-puller aperture gap distance, gas pressure. The results of measurements are compared with previous simulations of ion optics

  3. Microwave radiation (2.45 GHz)-induced oxidative stress: Whole-body exposure effect on histopathology of Wistar rats.

    Science.gov (United States)

    Chauhan, Parul; Verma, H N; Sisodia, Rashmi; Kesari, Kavindra Kumar

    2017-01-01

    Man-made microwave and radiofrequency (RF) radiation technologies have been steadily increasing with the growing demand of electronic appliances such as microwave oven and cell phones. These appliances affect biological systems by increasing free radicals, thus leading to oxidative damage. The aim of this study was to explore the effect of 2.45 GHz microwave radiation on histology and the level of lipid peroxide (LPO) in Wistar rats. Sixty-day-old male Wistar rats with 180 ± 10 g body weight were used for this study. Animals were divided into two groups: sham exposed (control) and microwave exposed. These animals were exposed for 2 h a day for 35 d to 2.45 GHz microwave radiation (power density, 0.2 mW/cm 2 ). The whole-body specific absorption rate (SAR) was estimated to be 0.14 W/kg. After completion of the exposure period, rats were sacrificed, and brain, liver, kidney, testis and spleen were stored/preserved for determination of LPO and histological parameters. Significantly high level of LPO was observed in the liver (p body microwave exposure, compared to the control group. Based on the results obtained in this study, we conclude that exposure to microwave radiation 2 h a day for 35 d can potentially cause histopathology and oxidative changes in Wistar rats. These results indicate possible implications of such exposure on human health.

  4. Residues in blackcurrants, fodder peas, spinach and potatoes treated with sublethal doses of 2,4,5-T to simulate wind drift damage

    DEFF Research Database (Denmark)

    Løkke, Hans; Odgaard, Peder

    1981-01-01

    concentrations declined in the same period due to growth dilution. In spinach leaves from old plants, treated with 0.1 kg ha-1, 0.05 mg of 2,4,5-T kg-1 was found 14 days after treatment. Fodder peas showed no residues (

  5. Chronic exposure of a honey bee colony to 2.45 GHz continuous wave microwaves

    Science.gov (United States)

    Westerdahl, B. B.; Gary, N. E.

    1981-01-01

    A honey bee colony (Apis mellifera L.) was exposed 28 days to 2.45 GHz continuous wave microwaves at a power density (1 mW/sq cm) expected to be associated with rectennae in the solar power satellite power transmission system. Differences found between the control and microwave-treated colonies were not large, and were in the range of normal variation among similar colonies. Thus, there is an indication that microwave treatment had little, if any, effect on (1) flight and pollen foraging activity, (2) maintenance of internal colony temperature, (3) brood rearing activity, (4) food collection and storage, (5) colony weight, and (6) adult populations. Additional experiments are necessary before firm conclusions can be made.

  6. Plasmid AZOBR_p1-borne fabG gene for putative 3-oxoacyl-[acyl-carrier protein] reductase is essential for proper assembly and work of the dual flagellar system in the alphaproteobacterium Azospirillum brasilense Sp245.

    Science.gov (United States)

    Filip'echeva, Yulia A; Shelud'ko, Andrei V; Prilipov, Alexei G; Burygin, Gennady L; Telesheva, Elizaveta M; Yevstigneyeva, Stella S; Chernyshova, Marina P; Petrova, Lilia P; Katsy, Elena I

    2018-02-01

    Azospirillum brasilense can swim and swarm owing to the activity of a constitutive polar flagellum (Fla) and inducible lateral flagella (Laf), respectively. Experimental data on the regulation of the Fla and Laf assembly in azospirilla are scarce. Here, the coding sequence (CDS) AZOBR_p1160043 (fabG1) for a putative 3-oxoacyl-[acyl-carrier protein (ACP)] reductase was found essential for the construction of both types of flagella. In an immotile leaky Fla - Laf - fabG1::Omegon-Km mutant, Sp245.1610, defects in flagellation and motility were fully complemented by expressing the CDS AZOBR_p1160043 from plasmid pRK415. When pRK415 with the cloned CDS AZOBR_p1160045 (fliC) for a putative 65.2 kDa Sp245 Fla flagellin was transferred into the Sp245.1610 cells, the bacteria also became able to assemble a motile single flagellum. Some cells, however, had unusual swimming behavior, probably because of the side location of the organelle. Although the assembly of Laf was not restored in Sp245.1610 (pRK415-p1160045), this strain was somewhat capable of swarming motility. We propose that the putative 3-oxoacyl-[ACP] reductase encoded by the CDS AZOBR_p1160043 plays a role in correct flagellar location in the cell envelope and (or) in flagellar modification(s), which are also required for the inducible construction of Laf and for proper swimming and swarming motility of A. brasilense Sp245.

  7. Flight, orientation, and homing abilities of honeybees following exposure to 2.45-GHz CW microwaves.

    Science.gov (United States)

    Gary, N E; Westerdahl, B B

    1981-01-01

    Foraging-experienced honeybees retained normal flight, orientation, and memory functions after 30 minutes' exposure to 2.45-GHz CW microwaves at power densities from 3 to 50 mW/cm2. These experiments were conducted at power densities approximating and exceeding those that would be present above receiving antennas of the proposed solar power satellite (SPS) energy transmission system and for a duration exceeding that which honeybees living outside a rectenna might be expected to spend within the rectenna on individual foraging trips. There was no evidence that airborne invertebrates would be significantly affected during transient passage through microwaves associated with SPS ground-based microwave receiving stations.

  8. Directed evolution of the periodic table: probing the electronic structure of late actinides.

    Science.gov (United States)

    Marsh, M L; Albrecht-Schmitt, T E

    2017-07-25

    Recent investigations of the coordination chemistry and physical properties of berkelium (Z = 97) and californium (Z = 98) have revealed fundamental differences between post-curium elements and lighter members of the actinide series. This review highlights these developments and chronicles key findings and concepts from the last half-century that have helped usher in a new understanding of the evolution of electronic structure in the periodic table.

  9. Atmospheric histories and global emissions of the anthropogenic hydrofluorocarbons HFC-365mfc, HFC-245fa, HFC-227ea, and HFC-236fa

    Science.gov (United States)

    Vollmer, Martin K.; Miller, Benjamin R.; Rigby, Matthew; Reimann, Stefan; Mühle, Jens; Krummel, Paul B.; O'Doherty, Simon; Kim, Jooil; Rhee, Tae Siek; Weiss, Ray F.; Fraser, Paul J.; Simmonds, Peter G.; Salameh, Peter K.; Harth, Christina M.; Wang, Ray H. J.; Steele, L. Paul; Young, Dickon; Lunder, Chris R.; Hermansen, Ove; Ivy, Diane; Arnold, Tim; Schmidbauer, Norbert; Kim, Kyung-Ryul; Greally, Brian R.; Hill, Matthias; Leist, Michael; Wenger, Angelina; Prinn, Ronald G.

    2011-04-01

    We report on ground-based atmospheric measurements and emission estimates of the four anthropogenic hydrofluorocarbons (HFCs) HFC-365mfc (CH3CF2CH2CF3, 1,1,1,3,3-pentafluorobutane), HFC-245fa (CHF2CH2CF3, 1,1,1,3,3-pentafluoropropane), HFC-227ea (CF3CHFCF3, 1,1,1,2,3,3,3-heptafluoropropane), and HFC-236fa (CF3CH2CF3, 1,1,1,3,3,3-hexafluoropropane). In situ measurements are from the global monitoring sites of the Advanced Global Atmospheric Gases Experiment (AGAGE), the System for Observations of Halogenated Greenhouse Gases in Europe (SOGE), and Gosan (South Korea). We include the first halocarbon flask sample measurements from the Antarctic research stations King Sejong and Troll. We also present measurements of archived air samples from both hemispheres back to the 1970s. We use a two-dimensional atmospheric transport model to simulate global atmospheric abundances and to estimate global emissions. HFC-365mfc and HFC-245fa first appeared in the atmosphere only ˜1 decade ago; they have grown rapidly to globally averaged dry air mole fractions of 0.53 ppt (in parts per trillion, 10-12) and 1.1 ppt, respectively, by the end of 2010. In contrast, HFC-227ea first appeared in the global atmosphere in the 1980s and has since grown to ˜0.58 ppt. We report the first measurements of HFC-236fa in the atmosphere. This long-lived compound was present in the atmosphere at only 0.074 ppt in 2010. All four substances exhibit yearly growth rates of >8% yr-1 at the end of 2010. We find rapidly increasing emissions for the foam-blowing compounds HFC-365mfc and HFC-245fa starting in ˜2002. After peaking in 2006 (HFC-365mfc: 3.2 kt yr-1, HFC-245fa: 6.5 kt yr-1), emissions began to decline. Our results for these two compounds suggest that recent estimates from long-term projections (to the late 21st century) have strongly overestimated emissions for the early years of the projections (˜2005-2010). Global HFC-227ea and HFC-236fa emissions have grown to average values of 2.4 kt yr-1

  10. Effect of a 2.45-GHz radiofrequency electromagnetic field on neutrophil chemotaxis and phagocytosis in differentiated human HL-60 cells.

    Science.gov (United States)

    Koyama, Shin; Narita, Eijiro; Suzuki, Yoshihisa; Taki, Masao; Shinohara, Naoki; Miyakoshi, Junji

    2015-01-01

    The potential public health risks of radiofrequency (RF) fields have been discussed at length, especially with the use of mobile phones spreading extensively throughout the world. In order to investigate the properties of RF fields, we examined the effect of 2.45-GHz RF fields at the specific absorption rate (SAR) of 2 and 10 W/kg for 4 and 24 h on neutrophil chemotaxis and phagocytosis in differentiated human HL-60 cells. Neutrophil chemotaxis was not affected by RF-field exposure, and subsequent phagocytosis was not affected either compared with that under sham exposure conditions. These studies demonstrated an initial immune response in the human body exposed to 2.45-GHz RF fields at the SAR of 2 W/kg, which is the maximum value recommended by the International Commission for Non-Ionizing Radiation Protection (ICNIRP) guidelines. The results of our experiments for RF-field exposure at an SAR under 10 W/kg showed very little or no effects on either chemotaxis or phagocytosis in neutrophil-like human HL-60 cells. © The Author 2014. Published by Oxford University Press on behalf of The Japan Radiation Research Society and Japanese Society for Radiation Oncology.

  11. RRS "Discovery" Cruise D279, 04 Apr - 10 May 2004. A Transatlantic hydrography section at 24.5N

    OpenAIRE

    Cunningham, S.A.

    2005-01-01

    The cruise report describes the acquisition and processing of transatlantic hydrographic, velocity, chemistry and other measurements made during three cruises in Spring 2004 at 24.5°N. Measurements were made from shallow water near Africa to shallow water just off Palm Springs beach on the eastern seaboard of the USA. During the principal cruise, RRS Discovery Cruise D279 (4 April to 10 May 2004), 125 full depth CTD and lowered acoustic Doppler current profiler (LADP) stations were complete...

  12. Design and Measurement of a 2.45 Ghz On-Body Antenna Optimized for Hearing Instrument Applications

    DEFF Research Database (Denmark)

    Kvist, Søren Helstrup; Jakobsen, Kaj Bjarne; Thaysen, Jesper

    2012-01-01

    A balanced PIFA-inspired antenna design is presented for use with the 2:45 GHz ear-to-ear radio channel. The antenna is designed such that the radiated electric fields are primarily polarized normal to the surface of the head, in order to obtain a high on-body path gain (jS21 j). The antenna...... structure can be made conformal to the outer surface of a hearing instrument, such that the bandwidth of the antenna is optimized given the available volume. The radiation patterns, ear-to-ear path gain and available bandwidth is measured and compared to the simulated results. It is found that the antenna...

  13. Crystal structure of triaqua(1,10-phenanthroline-κ2N,N′(2,4,5-trifluoro-3-methoxybenzoato-κO1cobalt(II 2,4,5-trifluoro-3-methoxybenzoate

    Directory of Open Access Journals (Sweden)

    Junshan Sun

    2014-11-01

    Full Text Available The title salt, [Co(C8H4F3O3(C12H8N2(H2O3](C8H4F3O3, was obtained under solvothermal conditions by the reaction of 2,4,5-trifluoro-3-methoxybenzoic acid with CoCl2 in the presence of 1,10-phenanthroline (phen. The CoII ion is octahedrally coordinated by two N atoms [Co—N = 2.165 (2 and 2.129 (2 Å] from the phen ligand, by one carboxylate O atom [Co—O = 2.107 (1 Å] and by three O atoms from water molecules [Co—O = 2.093 (1, 2.102 (1 and 2.114 (1 Å]. The equatorial positions of the slightly distorted octahedron are occupied by the N atoms, the carboxylate O and one water O atom. An intra- and intermolecular O—H...O hydrogen-bonding network between the water-containing complex cation and the organic anion leads to the formation of ribbons parallel to [010].

  14. Study of the rhizobacterium Azospirillum brasilense Sp245 using Mössbauer spectroscopy with a high velocity resolution: Implication for the analysis of ferritin-like iron cores

    Science.gov (United States)

    Alenkina, I. V.; Oshtrakh, M. I.; Tugarova, A. V.; Biró, B.; Semionkin, V. A.; Kamnev, A. A.

    2014-09-01

    The results of a comparative study of two samples of the rhizobacterium Azospirillum brasilense (strain Sp245) prepared in different conditions and of human liver ferritin using Mössbauer spectroscopy with a high velocity resolution demonstrated the presence of ferritin-like iron (i.e. iron similar to that found in ferritin-like proteins) in the bacterium. Mössbauer spectra of these samples were fitted in two ways: as a rough approximation using a one quadrupole doublet fit (the homogeneous iron core model) and using a superposition of quadrupole doublets (the heterogeneous iron core model). Both results demonstrated differences in the Mössbauer parameters for mammalian ferritin and for bacterial ferritin-like iron. Moreover, some differences in the Mössbauer parameters were observed between the two samples of A. brasilense Sp245 related to the differences in their preparation conditions.

  15. Flexible indium-gallium-zinc-oxide Schottky diode operating beyond 2.45 GHz.

    Science.gov (United States)

    Zhang, Jiawei; Li, Yunpeng; Zhang, Binglei; Wang, Hanbin; Xin, Qian; Song, Aimin

    2015-07-03

    Mechanically flexible mobile phones have been long anticipated due to the rapid development of thin-film electronics in the last couple of decades. However, to date, no such phone has been developed, largely due to a lack of flexible electronic components that are fast enough for the required wireless communications, in particular the speed-demanding front-end rectifiers. Here Schottky diodes based on amorphous indium-gallium-zinc-oxide (IGZO) are fabricated on flexible plastic substrates. Using suitable radio-frequency mesa structures, a range of IGZO thicknesses and diode sizes have been studied. The results have revealed an unexpected dependence of the diode speed on the IGZO thickness. The findings enable the best optimized flexible diodes to reach 6.3 GHz at zero bias, which is beyond the critical benchmark speed of 2.45 GHz to satisfy the principal frequency bands of smart phones such as those for cellular communication, Bluetooth, Wi-Fi and global satellite positioning.

  16. Spectroscopic study of {sup 206,207,208}Pb isotopes by high resolution analysis of 24.5 MeV proton scattering; Etude spectroscopique des isotopes 206, 207 et 208 du plomb par analyse a haute resolution de la diffusion de protons de 24,5 MeV

    Energy Technology Data Exchange (ETDEWEB)

    Vallois, G [Commissariat a l' Energie Atomique, Saclay (France). Centre d' Etudes Nucleaires

    1968-03-01

    {sup 206,207,208}pb have been studied by 24.5 MeV proton inelastic scattering with a resolution of 20 keV. The angular distributions of the differential cross-sections corresponding to the different excited levels have been measured in a large angular region and analysed with the DWBA.This work shows that it exists between 4 and 5 MeV of excitation energy some strongly excited levels corresponding to transfer momenta l = 2, 4, 6 and 8. The single particle-hole models do not explain these states; so it will probably be necessary to introduce some several particle - hole configurations. (author) [French] Les isotopes 206, 207 et 208 du plomb ont ete etudies par diffusion inelastique de protons de 24,5 MeV avec une resolution de 20 keV. Les distributions angulaires des sections efficaces differentielles correspondant aux differents niveaux excites ont ete mesurees sur un large domaine angulaire et analysees a l'aide de la DWBA. Ce travail met en evidence l'existence, entre 4 et 5 MeV d'excitation, de niveaux fortement excites correspondant a des moments de transfert de 2, 4, 6 et 8. Les modeles a simple particule-trou ne rendant pas compte de ces niveaux, il faudra sans doute recourir a des configurations a plusieurs particules-trous pour les expliquer. (auteur)

  17. Review of fission product yields and delayed neutron data for the actinides NP-237, PU-242, AM-242M, AM-243, CM-243 and CM-245

    International Nuclear Information System (INIS)

    Mills, R.W.

    1990-07-01

    A review of fission product yields and delayed neutron data for Np-237, Pu-242, Am-242m, Am-243, Cm-243 and Cm-245 has been undertaken. Gaps in understanding and inconsistencies in existing data were identified and priority areas for further experimental, theoretical and evaluation investigation detailed

  18. Safety analysis report for packaging: neutron shipping cask, model 0.5T

    International Nuclear Information System (INIS)

    Peterson, R.T.

    1976-01-01

    The Safety Analysis Report for Packaging demonstrates that the neutron shipping cask can safely transport, in solid or powder form, all isotopes of uranium, plutonium, americium, curium, berkelium, californium, einsteinium, and fermium. The shipping cask and its contents are described. It also evaluates transport conditions, structural parameters (e.g., load resistance, pressure and impact effects, lifting and tiedown devices), and shielding. Finally, it discusses compliance with Chapter 0529 of the Energy Research and Development Administration Manual

  19. R245fa Flow Boiling inside a 4.2 mm ID Microfin Tube

    Science.gov (United States)

    Longo, G. A.; Mancin, S.; Righetti, G.; Zilio, C.

    2017-11-01

    This paper presents the R245fa flow boiling heat transfer and pressure drop measurements inside a mini microfin tube with internal diameter at the fin tip of 4.2 mm, having 40 fins, 0.15 mm high with a helix angle of 18°. The tube was brazed inside a copper plate and electrically heated from the bottom. Sixteen T-type thermocouples are located in the copper plate to monitor the wall temperature. The experimental measurements were carried out at constant mean saturation temperature of 30 °C, by varying the refrigerant mass velocity between 100 kg m-2 s-1 and 300 kg m-2 s-1, the vapour quality from 0.15 to 0.95, at two different heat fluxes: 30 and 60 kW m-2. The experimental results are presented in terms of two-phase heat transfer coefficient, onset dryout vapour quality, and frictional pressure drop. Moreover, the experimental measurements are compared against the most updated models for boiling heat transfer coefficient and frictional pressure drop estimations available in the open literature for microfin tubes.

  20. Assessing the efficacy of co-inoculation of wheat seedlings with the associative bacteria Paenibacillus polymyxa 1465 and Azospirillum brasilense Sp245.

    Science.gov (United States)

    Yegorenkova, Irina V; Tregubova, Kristina V; Burygin, Gennady L; Matora, Larisa Y; Ignatov, Vladimir V

    2016-03-01

    Co-inoculation of associative bacteria, which have high nitrogen-fixing activity, tolerance for environmental conditions, and the ability to compete with the natural microflora, is used widely to enhance the growth and yields of agricultural plants. We evaluated the ability of 2 co-inoculated plant-growth-promoting rhizobacteria, Paenibacillus polymyxa 1465 and Azospirillum brasilense Sp245, to colonize roots of wheat (Triticum aestivum L. 'Saratovskaya 29') seedlings, and we assessed the morphometric parameters of wheat early in its development. Analysis by ELISA with polyclonal antibodies raised against the exopolysaccharide of P. polymyxa 1465 and the lipopolysaccharide of A. brasilense Sp245 demonstrated that the root-colonizing activity of A. brasilense was higher when the bacterium was co-inoculated with P. polymyxa than when it was inoculated singly. Immunofluorescence microscopy with Alexa Fluor 532-labeled antibodies revealed sites of attachment of co-inoculated P. polymyxa and A. brasilense and showed that the 2 bacteria colonized similar regions of the roots. Co-inoculation exerted a negative effect on wheat seedling development, inhibiting root length by 17.6%, total root weight by 11%, and total shoot weight by 12%. Under certain conditions, dual inoculation of wheat may prove ineffective, apparently owing to the competition between the rhizobacteria for colonization sites on the plant roots. The findings from this study may aid in developing techniques for mixed bacterial inoculation of cultivated plants.

  1. Spectroscopic study of 206,207,208Pb isotopes by high resolution analysis of 24.5 MeV proton scattering

    International Nuclear Information System (INIS)

    Vallois, G.

    1968-03-01

    206,207,208 pb have been studied by 24.5 MeV proton inelastic scattering with a resolution of 20 keV. The angular distributions of the differential cross-sections corresponding to the different excited levels have been measured in a large angular region and analysed with the DWBA.This work shows that it exists between 4 and 5 MeV of excitation energy some strongly excited levels corresponding to transfer momenta l = 2, 4, 6 and 8. The single particle-hole models do not explain these states; so it will probably be necessary to introduce some several particle - hole configurations. (author) [fr

  2. Mössbauer spectroscopic study of 57Fe metabolic transformations in the rhizobacterium Azospirillum brasilense Sp245

    Science.gov (United States)

    Kamnev, Alexander A.; Tugarova, Anna V.; Kovács, Krisztina; Biró, Borbála; Homonnay, Zoltán; Kuzmann, Ernő

    2014-04-01

    Preliminary 57Fe transmission Mössbauer spectroscopic data were obtained for the first time for live cells of the plant-growth-promoting rhizobacterium Azospirillum brasilense (wild-type strain Sp245) grown aerobically with 57FeIII-nitrilotriacetate (NTA) complex as a sole source of iron. The results obtained have shown that live cells actively reduce part of the assimilated iron(III) to iron(II), the latter amounting up to 33 % of total cellular iron after 18 h of growth, and 48 % after additional 3 days of storage of the dense wet cell suspension in nutrient-free saline solution in air at room temperature (measured at 80 K). The cellular iron(II) was found to be represented by two quadrupole doublets of different high-spin forms, while the parameters of the cellular iron(III) were close to those typical for bacterioferritins.

  3. Determination of the Pion Charge Form Factor at Q2=1.60 and 2.45 (GeV/c)2

    International Nuclear Information System (INIS)

    Horn, T.; Beise, E. J.; Breuer, H.; Chang, C. C.; King, P. M.; Liu, J.; Roos, P. G.; Aniol, K.; Margaziotis, D. J.; Arrington, J.; Holt, R. J.; Potterveld, D.; Reimer, P.; Zheng, X.; Barrett, B.; Sarty, A.; Blok, H. P.; Tvaskis, V.; Boeglin, W.; Markowitz, P.

    2006-01-01

    The 1 H(e,e ' π + )n cross section was measured at four-momentum transfers of Q 2 =1.60 and 2.45 GeV 2 at an invariant mass of the photon nucleon system of W=2.22 GeV. The charged pion form factor (F π ) was extracted from the data by comparing the separated longitudinal pion electroproduction cross section to a Regge model prediction in which F π is a free parameter. The results indicate that the pion form factor deviates from the charge-radius constrained monopole form at these values of Q 2 by one sigma, but is still far from its perturbative quantum chromodynamics prediction

  4. Developmental odontogenic cysts of jaws: a clinical study of 245 cases.

    Science.gov (United States)

    Yazdani, Javad; Kahnamouii, Shiva Solahaye

    2009-01-01

    The aim of this study was to investigate the relative frequency of developmental odontogenic cysts in an Iranian population. In this study 245 cysts from both jaws, treated in the Faculty of Dentistry at Tabriz University of Medical Sciences during a 10-year period from 1998 to 2008, were analyzed in order to evaluate the incidence of such cysts. We had permission from all the patients. Case histories of 65% of male and 35% of female patients were analyzed. The age of the patients varied from 14 to 64 years, with an average of 33.21 ± 10.89. In this 10-year study of odontogenic cysts, 97 cases were developmental odontogenic cysts with the following inci-dence: dentigerous cyst, 44%; odontogenic keratocyst, 36%; primordial cyst, 9%; Gorlin cyst, 2%; lateral periodontal cyst, 3%; eruption cyst, 3%; and gingival cyst, 3% (adults 2%, infants 1%). A total of 60% of the cysts were found in the mandible and 40% in the maxilla. Regarding the mandible, the molar region was involved in 47% of the cases, premolar region in 33% and anterior region in 20% (total = 100%). Regarding the maxilla, the canine-to-canine region was involved in 52% of the cases, premolar region in 20% and molar region in 28% (total = 100%). An important finding in this study was the fact that 39% of the jaw cysts were developmental odontogenic cysts and the most common developmental odontogenic cysts were dentigerous cyst and OKC (odontogenic keratocyst).

  5. Effect of exposure to 2.45 GHz microwave on DNA repair genes transcription in cultured cells

    International Nuclear Information System (INIS)

    Perrin, A.; Bachelet, C.; Fournier, C.; Peinnequin, A.; Leveque, P.; Collin, A.

    2006-01-01

    The aim of the study was to investigate, in vitro, the effect of 2.45 GHz continuous (C.W.) and pulsed (P.W.) electromagnetic field exposure combined with a known mutagen on the induction of enzymes implicated in the DNA repair pathway. Microwaves do not create bonds breaks within molecules and there is no clear hypothesis for a possible mechanism supporting a biological action. Nevertheless, an indirect influence of microwaves during an intermediary step of the complex sequence of events involved in mutagenesis cannot yet be excluded. Highly sensitive real-time R.T.q.P.C.R. was used to monitor transcriptional variations of DNA repair genes. The experiments were carried out using the monocyte human cell line T.H.P.1 with the genotoxic compound 4- nitro-quinoline-N-oxide (4-N.Q.O.). The carrier frequency was 2.45 GHz C.W. and P.W. (1 khz repetition time, 10 % duty cycle) with the same power density corresponding to an average specific absorption rate (S.A.R.) value of 0.19 W/kg in the biological samples. Non exposed (sham) and exposed (P.W. and C.W.) cell culture plates were incubated simultaneously in three identical incubators in the presence of 4-N.Q.O., under shaking, at 37 Celsius degrees. Specially designed incubators were integrated in three identical anechoic chambers equipped with waveguide antennas. Care was taken to increase the reproducibility of the experiments and to avoid false positive or misinterpretation of the results. The presence or the absence of the electromagnetic field was the only difference between the sham and exposed assays. The different exposure conditions were applied alternatively in the three anechoic chambers in order to avoid cage effects. The temperature inside the cell plates was measured with an optic fiber probe (Luxtron). Numerical dosimetry was calculated using the Finite Difference Time Domain method. A time-scaled form of the heat transfer equation allowed to calculate the temperature distribution inside the petri dishes

  6. Safety analysis report for packaging: neutron shipping cask, model 4T

    International Nuclear Information System (INIS)

    Peterson, R.T.

    1977-01-01

    This Safety Analysis Report for Packaging demonstrates that the neutron shipping cask can safely transport, in solid or powder form, all isotopes of uranium, plutonium, americium, curium, berkelium, californium, einsteinium, and fermium. The cask and its contents are described. It also evaluates transport conditions, structural parameters (e.g., load resistance, pressure and impact effects, lifting and tiedown devices), and shielding. Finally, it discusses compliance with Chapter 0529 of the Energy Research and Development Administration Manual, Safety Standards for the Packaging of Fissile and Other Radioactive Materials

  7. Chelation and stabilization of berkelium in oxidation state +IV

    Czech Academy of Sciences Publication Activity Database

    Deblonde, G. J.-P.; Sturzbecher-Hoehne, M.; Rupert, P. B.; An, D. D.; Illy, M.-C.; Ralston, C. Y.; Brabec, Jiří; de Jong, W. A.; Strong, R. K.; Abergel, R. J.

    2017-01-01

    Roč. 9, č. 9 (2017), s. 843-849 ISSN 1755-4330 Institutional support: RVO:61388955 Keywords : bioorganic chemistry * chemical bonding * mass spectrometry Subject RIV: CF - Physical ; Theoretical Chemistry OBOR OECD: Physical chemistry Impact factor: 25.870, year: 2016

  8. Developmental odontogenic cysts of jaws: a clinical study of 245 cases

    Directory of Open Access Journals (Sweden)

    Javad Yazdani

    2009-06-01

    Full Text Available Background and aims. The aim of this study was to investigate the relative frequency of developmental odontogenic cysts in an Iranian population. Materials and methods. In this study 245 cysts from both jaws, treated in the Faculty of Dentistry at Tabriz University of Medical Sciences during a 10-year period from 1998 to 2008, were analyzed in order to evaluate the incidence of such cysts. We had permission from all the patients. Case histories of 65% of male and 35% of female patients were analyzed. The age of the patients varied from 14 to 64 years, with an average of 33.21 ± 10.89. Results. In this 10-year study of odontogenic cysts, 97 cases were developmental odontogenic cysts with the following incidence: dentigerous cyst, 44%; odontogenic keratocyst, 36%; primordial cyst, 9%; Gorlin cyst, 2%; lateral periodontal cyst, 3%; eruption cyst, 3%; and gingival cyst, 3% (adults 2%, infants 1%. A total of 60% of the cysts were found in the mandible and 40% in the maxilla. Regarding the mandible, the molar region was involved in 47% of the cases, premolar region in 33% and anterior region in 20% (total = 100%. Regarding the maxilla, the canine-to-canine region was involved in 52% of the cases, premolar region in 20% and molar region in 28% (total = 100%. Conclusion. An important finding in this study was the fact that 39% of the jaw cysts were developmental odontogenic cysts and the most common developmental odontogenic cysts were dentigerous cyst and OKC (odontogenic keratocyst.

  9. NRC Microwave Refractive Index Gas Thermometry Implementation Between 24.5 K and 84 K

    Science.gov (United States)

    Rourke, P. M. C.

    2017-07-01

    The implementation of microwave refractive index gas thermometry at the National Research Council between 24.5 K and 84 K is reported. A new gas-handling system for accurate control and measurement of experimental gas pressure has been constructed, and primary thermometry measurements have been taken using a quasi-spherical copper resonator and helium gas at temperatures corresponding to three defining fixed points of the International Temperature Scale of 1990 (ITS-90). These measurements indicate differences between the thermodynamic temperature T and ITS-90 temperature T_{90} of ( T - T_{90} ) = -0.60 ± 0.56 mK at T_{90} = 24.5561 K, ( T - T_{90} ) = -2.0 ± 1.3 mK at T_{90} = 54.3584 K, and ( T - T_{90} ) = -4.0 ± 2.9 mK at T_{90} = 83.8058 K. The present results at T_{90} = 24.5561 K and T_{90} = 83.8058 K agree with previously reported measurements from other primary thermometry techniques of acoustic gas thermometry and dielectric constant gas thermometry, and the result at T_{90} = 54.3584 K provides new information in a temperature region where there is a gap in other recent data sets.

  10. Actinides

    International Nuclear Information System (INIS)

    Martinot, L.; Fuger, J.

    1985-01-01

    The oxidation behavior of the actinides is explained on the basis of their electronic structure. The actinide elements, actinium, thorium, protactinium, uranium, neptunium, plutonium, americium, curium, berkelium, californium, einsteinium, fermium, mendelevium, nobelium, and laurencium are included. For all except the last three elements, the points of discussion are oxidation states, Gibbs energies and potentials, and potential diagram for the element in acid solution; and thermodynamic properties of these same elements are tabulated. References are cited following discussion of each element with a total of 97 references being cited. 13 tables

  11. Measurement of the Neutron Capture Cross Sections of $^{233}$U, $^{237}$Np, $^{240,242}$Pu, $^{241,243}$Am and $^{245}$Cm with a Total Absorption Calorimeter at n_TOF

    CERN Multimedia

    Beer, H; Wiescher, M; Cox, J; Rapp, W; Embid, M; Dababneh, S

    2002-01-01

    Accurate and reliable neutron capture cross section data for actinides are necessary for the poper design, safety regulation and precise performance assessment of transmutation devices such as Fast Critical Reactors or Accelerator Driven Systems (ADS). The goal of this proposal is the measurement of the neutron capture cross sections of $^{233}$U, $^{237}$Np, $^{240,242}$Pu, $^{241,243}$Am and $^{245}$Cm at n_TOF with an accuracy of 5~\\%. $^{233}$U plays an essential role in the Th fuel cycle, which has been proposed as a safer and cleaner alternative to the U fuel cycle. The capture cross sections of $^{237}$Np,$^{240,242}$Pu, $^{241,243}$Am and $^{245}$Cm play a key role in the design and optimization of a strategy for the Nuclear Waste Transmutation. A high accuracy can be achieved at n_TOF in such measurements due to a combination of features unique in the world: high instantaneous neutron fluence and excellent energy resolution of the facility, innovative Data Acquisition System based on flash ADCs and t...

  12. (Vapour + liquid) equilibrium data for the {1,1-difluoroethane (R152a) + 1,1,1,3,3-pentafluoropropane (R245fa)} system at temperatures from (323.150 to 353.150) K

    International Nuclear Information System (INIS)

    Yang, Lixiang; Gong, Maoqiong; Guo, Hao; Dong, Xueqiang; Wu, Jianfeng

    2015-01-01

    Highlights: • VLE data for (R152a + R245fa) system were measured at temperatures. • The experiments were based on the static-analytic method. • VLE data were correlated using PR–vdWs and PR–HV–NRTL models. - Abstract: In this paper, (vapour + liquid) equilibrium (VLE) for the {1,1-difluoroethane (R152a) + 1,1,1,3,3-pentafluoropropane (R245fa)} system was determined by a static-analytical method at T = (323.150 to 353.150) K. Values of the VLE were correlated by the Peng–Robison equation of state (PR EoS) using two different models, the van der Waals (vdWs) mixing rule and the Huron–Vidal (HV) mixing rule involving the non-random two-liquid (NRTL) activity coefficient model. The correlated results show good agreement with the experimental values. For the two models, the maximum average absolute deviations of the vapour phase mole fraction are 0.0034 and 0.0035, respectively.

  13. Theoretical and Experimental Analysis of Low-Drag Supersonic Inlets Having a Circular Cross Section and a Central Body at Mach Numbers 3.30, 2.75, and 2.45

    Science.gov (United States)

    Ferri, Antonio; Nucci, Louis M

    1954-01-01

    Contains theoretical and experimental analysis of circular inlets having a central body at Mach numbers of 3.30, 2.75, and 2.45. The inlets have been designed in order to have low drag and high pressure recovery. The pressure recoveries obtained are of the same order of magnitude as those previously obtained by inlets having very large external drag.

  14. Fission Cross-section Measurements of (233)U, (245)Cm and (241,243)Am at CERN n_TOF Facility

    CERN Document Server

    Calviani, M; Andriamonje, S; Chiaveri, E; Vlachoudis, V; Colonna, N; Meaze, M H; Marrone, S; Tagliente, G; Terlizzi, R; Belloni, F; Abbondanno, U; Fujii, K; Milazzo, P M; Moreau, C; Aerts, G; Berthoumieux, E; Dridi, W; Gunsing, F; Pancin, J; Perrot, L; Plukis, A; Alvarez, H; Duran, I; Paradela, C; Alvarez-Velarde, F; Cano-Ott, D; Gonzalez-Romero, E; Guerrero, C; Martinez, T; Villamarin, D; Vicente, M C; Andrzejewski, J; Marganiec, J; Assimakopoulos, P; Karadimos, D; Karamanis, D; Papachristodoulou, C; Patronis, N; Audouin, L; David, S; Ferrant, L; Isaev, S; Stephan, C; Tassan-Got, L; Badurek, G; Jericha, E; Leeb, H; Oberhummer, H; Pigni, M T; Baumann, P; Kerveno, M; Lukic, S; Rudolf, G; Becvar, F; Krticka, M; Calvino, F; Capote, R; Carrillo De Albornoz, A; Marques, L; Salgado, J; Tavora, L; Vaz, P; Cennini, P; Dahlfors, M; Ferrari, A; Gramegna, F; Herrera-Martinez, A; Kadi, Y; Mastinu, P; Praena, J; Sarchiapone, L; Wendler, H; Chepel, V; Ferreira-Marques, R; Goncalves, I; Lindote, A; Lopes, I; Neves, F; Cortes, G; Poch, A; Pretel, C; Couture, A; Cox, J; O'brien, S; Wiescher, M; Dillman, I; Heil, M; Kappeler, F; Mosconi, M; Plag, R; Voss, F; Walter, S; Wisshak, K; Dolfini, R; Rubbia, C; Domingo-Pardo, C; Tain, J L; Eleftheriadis, C; Savvidis, I; Frais-Koelbl, H; Griesmayer, E; Furman, W; Konovalov, V; Goverdovski, A; Ketlerov, V; Haas, B; Haight, R; Reifarth, R; Igashira, M; Koehler, P; Kossionides, E; Lampoudis, C; Lozano, M; Quesada, J; Massimi, C; Vannini, G; Mengoni, A; Oshima, M; Papadopoulos, C; Vlastou, R; Pavlik, A; Pavlopoulos, P; Plompen, A; Rullhusen, P; Rauscher, T; Rosetti, M; Ventura, A

    2011-01-01

    Neutron-induced fission cross-sections of minor actinides have been measured using the n_TOF white neutron source at CERN, Geneva, as part of a large experimental program aiming at collecting new data relevant for nuclear astrophysics and for the design of advanced reactor systems. The measurements at n_TOF take advantage of the innovative features of the n_TOF facility, namely the wide energy range, high instantaneous neutron flux and good energy resolution. Final results on the fission cross-section of 233U, 245Cm and 243Am from thermal to 20 MeV are here reported, together with preliminary results for 241Am. The measurement have been performed with a dedicated Fast Ionization Chamber (FIC), a fission fragment detector with a very high efficiency, relative to the very well known cross-section of 235U, measured simultaneously with the same detector.

  15. Purification and characterization of β-Fructosidase with inulinase activity from Aspergillus niger - 245

    Directory of Open Access Journals (Sweden)

    Vinícius D'Arcadia Cruz

    1998-01-01

    Full Text Available Aspergillus niger - 245, a strain isolated from soil samples showed good β-fructosidase activity when inoculated in medium formulated with dahlia extract tubers. The enzyme was purified by precipitation in ammonium sulphate and percolated in DEAE-Sephadex A-50 and CM-cellulose columns, witch showed a single peack in all the purification steps, maintaining the I/S ratio between 0.32 to, 0.39. Optimum pH for inulinase activity (I was between 4.0 - 4.5 and for invertase activity (S between 2.5 and 5.0. The optimum temperature was 60O.C for both activities and no loss in activity was observed when it was maintained at this temperature for 30 min. The Km value was 1.44 and 5.0, respectively, for I and S and Vm value 10.48 and 30.55, respectively. The I activity was strongly inhibited by Hg2+ and Ag+ and 2 x 10-3 M of glucose, but not by fructose at the same concentration. The enzyme showed an exo-action mechanism, acting on the inulin of different origins. In assay conditions total hydrolysis of all the frutans was obtained, although it has shown larger activity on the chicory inulin than that one from artichoke Jerusalem and dahlia, in the first 30 min. The obtained results suggested that the enzyme presented good potential for industrial application in the preparing the fructose syrupsAspergillus niger - 245, isolado do solo mostrou boa atividade de b-frutosidase meio formulado com extrato de tubérculos de dahlia. A enzima foi purificada por precipitação em sulfato de amônia e percolada em colunas de DEAE-Sephadex A-50 e CM-celulose, produzindo um único pico em todas as fases de purificação e mantendo a relação I/S entre 0,32 a 0,39. O pH ótimo para a atividade de inulinase (I foi encontrado entre 4,0 - 4.5 e para a atividade de invertase (S em 2,5 e 5,0. A temperatura ótima foi de 60O.C para ambas as atividades e nenhuma perda foi observada quando mantida nesta temperatura por 30 min. Os valores de Km foram de 1,44 e 5

  16. 2.45 GHz Rectenna Designed for Wireless Sensors Operating at 500 C

    Science.gov (United States)

    Ponchak, George E.; Schwartz, Zachary D.; Jordan, Jennifer L.; Downey, Alan N.; Neudeck, Philip G.

    2004-01-01

    High temperature wireless sensors that operate at 500 C are required for aircraft engine monitoring and performance improvement These sensors would replace currently used hard-wired sensors and lead to a substantial reduction in mass. However, even if the sensor output data is transmitted wirelessly to a receiver in the cooler part of the engine, and the associated cables are eliminated, DC power cables are still required to operate the sensors and power the wireless circuits. To solve this problem, NASA is developing a rectenna, a circuit that receives RF power and converts it to DC power. The rectenna would be integrated with the wireless sensor, and the RF transmitter that powers the rectenna would be located in the cooler part of the engine. In this way, no cables to or from the sensors are required. Rectennas haw been demonstrated at ambient room temperature, but to date, no high temperature rectennas haw been reported. In this paper, we report the first rectenna designed for 2.45 GHz operation at 500 C. The circuit consists of a microstrip dipole antenna, a stripline impedance matching circuit, and a stripline low pass filter to prevent transmission of higher harmonics created by the rectifying diode fabricated on an Alumina substrate. The rectifying diode is the gate to source junction of a 6H Sic MESFET and the capacitor and load resistor are chip elements that are each bonded to the Alumina substrate. Each element and the hybrid, rectenna circuit haw been characterized through 500 C.

  17. Critical heat flux of R134A and R245FA in a 2.2 mm circular tube

    Energy Technology Data Exchange (ETDEWEB)

    Tibirica, Cristiano Bigonha; Ribatski, Gherhardt [Universidade de Sao Paulo (EESC/USP), Sao Carlos, SP (Brazil). Escola de Engenharia. Dept. de Engenharia Mecanica], E-mails: bigonha@sc.usp.br, ribatski@sc.usp.br; Szczukiewicz, Sylwia; Thome, John Richard [Ecole Polytechnique Federale de Lausanne (LTCM/EPFL) (Switzerland). Lab. of Heat and Mass Transfer], Emails: sylwia.szczukiewicz@epfl.ch, john.thome@epfl.ch

    2010-07-01

    Critical heat flux (CHF) during flow boiling is generally related to a drastic decrease in the heat transfer coefficient and it is the maximum operational heat flux that can be achieved under safe operation. Due to such a fact, this topic has attracted great attention of the academic society dealing with boiling heat transfer and also in the industrial sector involved with the dissipation of high heat flux densities. In the specific case of high heat flux densities, micro-channel flow boiling is a promising technique for pursuing this objective. The boundary where microscale effects start in flow boiling is still an open issue in the literature and a 3 mm internal diameter (ID) threshold value, as suggested by Kandlikar and Grande (2003) is frequently adopted to characterize this point. Considering the needs for a better understanding of the micro/macro transition, this paper presents new experimental critical heat flux results in saturated flow boiling conditions for a macro/micro-scale tube. The data were obtained in a horizontal 2.20 mm ID stainless steel tube with heating lengths of 361 and 154 mm, R134a and R245fa as working fluids, mass velocities ranging from 100 to 1500 kg/m{sup 2s}, critical heat fluxes from 25 to 300 kW/m2, exit saturation temperatures of 25, 31 and 35 degree C, and critical vapor qualities ranging from 0.55 to 1. The experimental results show that critical heat flux increases with increasing mass velocity and inlet subcooling but decreases with increasing saturation temperature and heated length. The data also indicated a higher CHF for R245fa when compared with R134a at similar conditions. The experimental data were compared against the following CHF predictive methods: Katto and Ohno (1984), Shah (1987), Zhang et al. (2006) and Ong and Thome(2010). Katto and Ohno (1984) and Ong and Thome (2010) best predicted the database with a mean average error smaller than 15%. Both correlations include low and high pressure fluids in their

  18. Comment on 'degradation of polychlorinated dibenzo-p-dioxin and dibenzofuran contaminants in 2,4,5-T by photoassisted iron-catalyzed hydrogen peroxide by J.J. Pignatello and L.Q. Huang, Wat. Res. 27, 1731-1736 (1993)'

    Digital Repository Service at National Institute of Oceanography (India)

    Sarkar, A.

    and PCDFs is not well illustrated. The entraction of triplicate samples of aqueous 2,4,5-T gave wide range of standard deviation which is statistically unaccetpable. No proper justification is provided to elucidate on unusual increase in concentration...

  19. Joint Institute for Nuclear Research Data Analysis Guide - Berkelium Edition

    International Nuclear Information System (INIS)

    Henderson, R.A.

    2009-01-01

    This is a data analysis guide to the JINR system developed by Roger Henderson. It is intended as a complete guide to the data format and the calibration parameters utilized for the analysis of the data. This guide will provide the basic structure of the data files, the description of the individual data items, and the basic equations developed for the calculation of the results. Currently (7/17/2009), calculation of the calibration parameters is not a covered topic. It is intended that this will be covered in a future update

  20. Erratum to "Solar Sources and Geospace Consequences of Interplanetary Magnetic Clouds Observed During Solar Cycle 23-Paper 1" [J. Atmos. Sol.-Terr. Phys. 70(2-4) (2008) 245-253

    Science.gov (United States)

    Gopalswamy, N.; Akiyama, S.; Yashiro, S.; Michalek, G.; Lepping, R. P.

    2009-01-01

    One of the figures (Fig. 4) in "Solar sources and geospace consequences of interplanetary magnetic Clouds observed during solar cycle 23 -- Paper 1" by Gopalswamy et al. (2008, JASTP, Vol. 70, Issues 2-4, February 2008, pp. 245-253) is incorrect because of a software error in t he routine that was used to make the plot. The source positions of various magnetic cloud (MC) types are therefore not plotted correctly.

  1. A short and facile synthesis of 2-(1Z)-(3-hydroxy-3,7-dimethylocta-1,6-dienyl)-1,4-benzenediol and 1-(3'-methoxypropanoyl)-2,4,5-trimethoxybenzene isolated from Cordia alliodora.

    Science.gov (United States)

    Kaur, Sukhbir; Singh, Vasundhara; Kumar, Gulshan; Kad, G L; Singh, Jasvinder

    2010-03-01

    A novel synthesis of 2-(1Z)-(3-hydroxy-3,7-dimethylocta-1,6-dienyl)-1,4-benzenediol and 1-(3'-methoxypropanoyl)-2,4,5-trimethoxybenzene has been carried out by making use of an easily available starting material, acceleration by MW irradiation and the use of water as a green solvent in the key steps.

  2. Analysis of gene expression in a human-derived glial cell line exposed to 2.45 GHz continuous radiofrequency electromagnetic fields

    International Nuclear Information System (INIS)

    Sakurai, Tomonori; Narita, Eijiro; Miyakoshi, Junji; Kiyokawa, Tomoko; Suzuki, Yukihisa; Taki, Masao

    2011-01-01

    The increasing use of mobile phones has aroused public concern regarding the potential health risks of radiofrequency (RF) fields. We investigated the effects of exposure to RF fields (2.45 GHz, continuous wave) at specific absorption rate (SAR) of 1, 5, and 10 W/kg for 1, 4, and 24 h on gene expression in a normal human glial cell line, SVGp12, using DNA microarray. Microarray analysis revealed 23 assigned gene spots and 5 non-assigned gene spots as prospective altered gene spots. Twenty-two genes out of the 23 assigned gene spots were further analyzed by reverse transcription-polymerase chain reaction to validate the results of microarray, and no significant alterations in gene expression were observed. Under the experimental conditions used in this study, we found no evidence that exposure to RF fields affected gene expression in SVGp12 cells. (author)

  3. Studies on the effect of the axial magnetic field on the x-ray bremsstrahlung in a 2.45 GHz permanent magnet microwave ion source

    International Nuclear Information System (INIS)

    Kumar, Narender; Rodrigues, G.; Lakshmy, P. S.; Mathur, Y.; Ahuja, R.; Kanjilal, D.; Baskaran, R.

    2014-01-01

    A compact microwave ion source has been designed and developed for operation at a frequency of 2.45 GHz. The axial magnetic field is based on two permanent magnet rings, operating in the “off-resonance” mode and is tunable by moving the permanent magnets. In order to understand the electron energy distribution function, x-ray bremsstrahlung has been measured in the axial direction. Simulation studies on the x-ray bremsstrahlung have been carried out to compare with the experimental results. The effect of the axial magnetic field with respect to the microwave launching position and the position of the extraction electrode on the x-ray bremsstrahlung have been studied

  4. Studies on the effect of the axial magnetic field on the x-ray bremsstrahlung in a 2.45 GHz permanent magnet microwave ion source

    Energy Technology Data Exchange (ETDEWEB)

    Kumar, Narender; Rodrigues, G., E-mail: gerosro@gmail.com; Lakshmy, P. S.; Mathur, Y.; Ahuja, R.; Kanjilal, D. [Inter University Accelerator Centre, Aruna Asaf Ali Marg, New Delhi (India); Baskaran, R. [Indira Gandhi Centre for Atomic Research, Kalpakkam, Tamilnadu (India)

    2014-02-15

    A compact microwave ion source has been designed and developed for operation at a frequency of 2.45 GHz. The axial magnetic field is based on two permanent magnet rings, operating in the “off-resonance” mode and is tunable by moving the permanent magnets. In order to understand the electron energy distribution function, x-ray bremsstrahlung has been measured in the axial direction. Simulation studies on the x-ray bremsstrahlung have been carried out to compare with the experimental results. The effect of the axial magnetic field with respect to the microwave launching position and the position of the extraction electrode on the x-ray bremsstrahlung have been studied.

  5. Studies on the effect of the axial magnetic field on the x-ray bremsstrahlung in a 2.45 GHz permanent magnet microwave ion source.

    Science.gov (United States)

    Kumar, Narender; Rodrigues, G; Lakshmy, P S; Baskaran, R; Mathur, Y; Ahuja, R; Kanjilal, D

    2014-02-01

    A compact microwave ion source has been designed and developed for operation at a frequency of 2.45 GHz. The axial magnetic field is based on two permanent magnet rings, operating in the "off-resonance" mode and is tunable by moving the permanent magnets. In order to understand the electron energy distribution function, x-ray bremsstrahlung has been measured in the axial direction. Simulation studies on the x-ray bremsstrahlung have been carried out to compare with the experimental results. The effect of the axial magnetic field with respect to the microwave launching position and the position of the extraction electrode on the x-ray bremsstrahlung have been studied.

  6. Radiological safety considerations in the design and operation of the ORNL Transuranium Research Laboratory (TRL)

    International Nuclear Information System (INIS)

    Haynes, C.E.

    1976-01-01

    The Transuranium Research Laboratory (TRL) is the central facility at Oak Ridge National Laboratory (ORNL) for chemical and physical research involving transuranium elements. Transuranium Research Laboratory investigations are about equally divided between studies of inorganic and structural chemistry of the heavy elements and nuclear structure and properties of their isotopes. Elements studied include neptunium, plutonium, americium, curium, berkelium, californium, and einsteinium, each in microgram-to-gram quantities depending upon availability and experimental requirements. This paper describes an eight-step safety procedure followed in planning and approving individual research projects. This procedure should provide an optimum margin of safety and should permit the accomplishment of successful research

  7. Composition containing transuranic elements for use in the homeopathic treatment of aids

    International Nuclear Information System (INIS)

    Lustig, D.

    1996-01-01

    A homeopathic remedy consisting of a composition containing one or more transuranic elements, particularly plutonium, for preventing and treating acquired immunodeficiency syndrome (AIDS) in humans, as well as seropositivity for human immunodeficiency virus (HIV). Said composition is characterized in that it uses any chemical or isotopic form of one or more transuranic elements (neptunium, plutonium, americium, curium, berkelium, californium or einsteinium), particularly plutonium, said form being diluted and dynamized according to conventional homeopathic methods, particularly the so-called Hahnemann and Korsakov methods, and provided preferably but not exclusively in the form of lactose and/or saccharose globules or granules impregnated with the active principle of said composition. (author)

  8. PROCEEDINGS OF THE SYMPOSIUM COMMEMORATING THE 25th ANNIVERSARY OF ELEMENTS 97 and 98 HELD ON JAN. 20, 1975

    Energy Technology Data Exchange (ETDEWEB)

    Seaborg, Glenn T.; Street Jr., Kenneth; Thompson, Stanley G.; Ghiorso, Albert

    1976-07-01

    This volume includes the talks given on January 20, 1975, at a symposium in Berkeley on the occasion of the celebration of the 25th anniversary of the discovery of berkelium and californium. Talks were given at this symposium by the four people involved in the discovery of these elements and by a number of people who have made significant contributions in the intervening years to the investigation of their nuclear and chemical properties. The papers are being published here, without editing, in the form in which they were submitted by the authors in the months following the anniversary symposium, and they reflect rather faithfully the remarks made on that occasion.

  9. TOWARD AN IMPROVED UNDERSTANDING OF STRUCTURE AND MAGNETISM IN NEPTUNIUM AND PLUTONIUM PHOSPHONATES AND SULFONATES

    Energy Technology Data Exchange (ETDEWEB)

    Albrecht-Schmitt, Thomas

    2012-03-01

    This grant supported the exploratory synthesis of new actinide materials with all of the actinides from thorium to californium with the exceptions of protactinium and berkelium. We developed detailed structure-property relationships that allowed for the identification of novel materials with selective ion-exchange, selective oxidation, and long-range magnetic ordering. We found novel bonding motifs and identified periodic trends across the actinide series. We identified structural building units that would lead to desired structural features and novel topologies. We also characterized many different spectroscopic trends across the actinide series. The grant support the preparation of approximately 1200 new compounds all of which were structurally characterized.

  10. Comparative Analysis of the Effects of Severe Plastic Deformation and Thermomechanical Training on the Functional Stability of Ti50.5Ni24.5Pd25 High-Temperature Shape Memory Alloy

    Science.gov (United States)

    Atli, K. C.; Karaman, I.; Noebe, R. D.; Maier, H. J.

    2010-01-01

    We compare the effectiveness of a conventional thermomechanical training procedure and severe plastic deformation via equal channel angular extrusion to achieve improved functional stability in a Ti50.5Ni24.5Pd25 high-temperature shape memory alloy. Thermomechanical testing indicates that both methods result in enhanced shape memory characteristics, such as reduced irrecoverable strain and thermal hysteresis. The mechanisms responsible for the improvements are discussed in light of microstructural findings from transmission electron microscopy.

  11. Three novel variants (p.Glu178Lys, p.Val245Met, p.Ser250Phe) of the phenylalanine hydroxylase (PAH) gene impair protein expression and function in vitro.

    Science.gov (United States)

    Zong, Yanan; Liu, Ning; Ma, Shanshan; Bai, Ying; Guan, Fangxia; Kong, Xiangdong

    2018-08-20

    Phenylketonuria (PKU) is the most common inherited metabolic disease, an autosomal recessive disorder affecting >10,000 newborns each year globally. It can be caused by over 1000 different naturally occurring mutations in the phenylalanine hydroxylase (PAH) gene. We analyzed three novel naturally occurring PAH gene variants: p.Glu178Lys (c.532G>A), p.Val245Met (c.733G>A) and p.Ser250Phe (c.749C>T). The mutant effect on the PAH enzyme structure and function was predicted by bioinformatics software. Vectors expressing the corresponding PAH variants were generated for expression in E. coli and in HEK293T cells. The RNA expression of the three PAH variants was measured by quantitative reverse transcription polymerase chain reaction (RT-qPCR). The mutant PAH protein levels were determined by sodium dodecyl sulfate-polyacrylamide gel electrophoresis (SDS-PAGE), western blot and enzyme-linked immunosorbent assay (ELISA). All three variants were predicted to be pathogenic by bioinformatics analysis. The transcription of the three PAH variants was similar to the wild type PAH gene in HEK293T cells. In contrast, the levels of mutant PAH proteins decreased significantly compared to the wild type control, in both E. coli and HEK293T cells. Our results indicate that the three novel PAH gene variants (p.Glu178Lys, p.Val245Met, p.Ser250Phe) impair PAH protein expression and function in prokaryotic and eukaryotic cells. Copyright © 2018. Published by Elsevier B.V.

  12. Plasma parameter diagnosis using hydrogen emission spectra of a quartz-chamber 2.45 GHz ECRIS at Peking University

    Science.gov (United States)

    Wu, WenBin; Ren, HaiTao; Peng, ShiXiang; Xu, Yuan; Wen, JiaMei; Zhang, Tao; Zhang, JingFeng; Zhang, AiLin; Sun, Jiang; Guo, ZhiYu; Chen, JiaEr

    2018-04-01

    A quartz-chamber 2.45 GHz electron cyclotron resonance ion source (ECRIS) was designed for diagnostic purposes at Peking University [Patent Number: ZL 201110026605.4]. This ion source can produce a maximum 84 mA hydrogen ion beam at 50 kV with a duty factor of 10%. The root-mean-square (RMS) emittance of this beam is less than 0.12π mm mrad. In our initial work, the electron temperature and electron density inside the plasma chamber had been measured with the line intensity ratio of noble gases. Based on these results, the atomic and molecular emission spectra of hydrogen were applied to determine the dissociation degree of hydrogen and the vibrational temperature of hydrogen molecules in the ground state, respectively. Measurements were performed at gas pressures from 4×10-4 to 1×10-3 Pa and at input peak RF power ranging from 1000 to 1800 W. The dissociation degree of hydrogen in the range of 0.5%-10% and the vibrational temperature of hydrogen molecules in the ground state in the range of 3500-8500 K were obtained. The plasma processes inside this ECRIS chamber were discussed based on these results.

  13. Dielectric Properties and Oxidation Roasting of Molybdenite Concentrate by Using Microwave Energy at 2.45 GHz Frequency

    Science.gov (United States)

    Yonglin, Jiang; Bingguo, Liu; Peng, Liu; Jinhui, Peng; Libo, Zhang

    2017-12-01

    Conversion of electromagnetic energy into heat depends largely on the dielectric properties of the material being treated. Therefore, determining the dielectric properties of molybdenite concentrate and its microwave power penetration depth in relation to a temperature increment at the commercial frequency of 2.45 GHz is necessary to design industrial microwave processing units. In this study, the dielectric constants increased as the temperature increased in the entire experimental range. The loss factor presented an opposite trend, except for 298 K to 373 K (25 °C to 100 °C) in which a cavity perturbation resonator was used. The plots of nonlinear surface fitting indicate that the increase in dielectric loss causes a considerable decrease in penetration depth, but the dielectric constants exert a small positive effect. The thermogravimetric analysis (TGA-DSC) of the molybdenite concentrate was carried out to track its thermal decomposition process, aim to a dielectric analysis during the microwave heating. MoO3 was prepared from molybdenite concentrate through oxidation roasting in a microwave heating system and a resistance furnace, respectively. The phase transitions and morphology evolutions during oxidation roasting were characterized through X-ray diffraction and scanning electron microscopy. Results show that microwave thermal technique can produce high-purity molybdenum trioxide.

  14. Experimental Study and Fractal Analysis on the Anisotropic Performance of Explosively Welded Interfaces of 304 Stainless Steel/245 Carbon Steel

    Science.gov (United States)

    Fu, Yanshu; Qiu, Yaohui; Li, Yulong

    2018-05-01

    The mechanical anisotropy of an explosive welding composite plate made of 304 stainless steel/245 steel was studied through shear experiments performed on explosively welded wavy interfaces along several orientation angles. The results indicated that the strength and the fracture energy of samples significantly varied with the orientation angles. The fracture surfaces of all samples were observed using a scanning electron microscope and through three-dimensional structure microscopy. The periodic features of all the fracture surfaces were clearly shown in different fracture modes. The fractal dimension of the fracture surfaces was calculated based on the fractal geometry by the box-counting method in MATLAB. The cohesive element model was used to analyze the fracture energy according to the physical dependence of the fractal dimension on thermodynamic entropy and interface separation energy. The fracture energy was an exponential function of the fractal dimension value, which was in good agreement with the experimental results. All results were validated for effective use in the application of anisotropy analysis to the welded interface and structural optimization of explosively welded composite plates.

  15. Granular activated carbon adsorption and microwave regeneration for the treatment of 2,4,5-trichlorobiphenyl in simulated soil-washing solution

    International Nuclear Information System (INIS)

    Liu Xitao; Yu Gang; Han Wenya

    2007-01-01

    The treatment of 2,4,5-trichlorobiphenyl (PCB29) in simulated soil-washing solution by granular activated carbon (GAC) adsorption and microwave (MW) regeneration was investigated in this study. The PCB29 adsorption process was carried out in a continuous flow adsorption column. After adsorption, the PCB29-loaded GAC was dried at 103 deg. C, and regenerated in a quartz reactor by 2450 MHz MW irradiation at 700 W for 5 min. The efficacy of this procedure was analyzed by determining the rates and amounts of PCB29 adsorbed in successive adsorption/MW regeneration cycles. Effects of the regeneration on the textural properties and the PCB29 adsorption capacity of GAC were examined. It was found that after several adsorption/MW regeneration cycles, the adsorption rate of GAC increased, whereas, the adsorption capacity decreased, which could be explained according to the change of textural properties. Most of the PCB29 adsorbed on GAC was degraded within 3 min under MW irradiation, and the analysis of degradation products by GC-MS demonstrated that PCB29 experienced dechlorination during this treatment

  16. Distribution of blood types in a sample of 245 New Zealand non-purebred cats.

    Science.gov (United States)

    Cattin, R P

    2016-05-01

    To determine the distribution of feline blood types in a sample of non-pedigree, domestic cats in New Zealand, whether a difference exists in this distribution between domestic short haired and domestic long haired cats, and between the North and South Islands of New Zealand; and to calculate the risk of a random blood transfusion causing a severe transfusion reaction, and the risk of a random mating producing kittens susceptible to neonatal isoerythrolysis. The results of 245 blood typing tests in non-pedigree cats performed at the New Zealand Veterinary Pathology (NZVP) and Gribbles Veterinary Pathology laboratories between the beginning of 2009 and the end of 2014 were retrospectively collated and analysed. Cats that were identified as domestic short or long haired were included. For the cats tested at Gribbles Veterinary Pathology 62 were from the North Island, and 27 from the South Island. The blood type distribution differed between samples from the two laboratories (p=0.029), but not between domestic short and long haired cats (p=0.50), or between the North and South Islands (p=0.76). Of the 89 cats tested at Gribbles Veterinary Pathology, 70 (79%) were type A, 18 (20%) type B, and 1 (1%) type AB; for NZVP 139/156 (89.1%) cats were type A, 16 (10.3%) type B, and 1 (0.6%) type AB. It was estimated that 18.3-31.9% of random blood transfusions would be at risk of a transfusion reaction, and neonatal isoerythrolysis would be a risk in 9.2-16.1% of random matings between non-pedigree cats. The results from this study suggest that there is a high risk of complications for a random blood transfusion between non-purebred cats in New Zealand. Neonatal isoerythrolysis should be considered an important differential diagnosis in illness or mortality in kittens during the first days of life.

  17. Two Zinc(II) metal-organic frameworks with mixed ligands of 5-amino-tetrazolate and l,2,4,5-benzenetetracarboxylate: Synthesis, structural diversity and photoluminescent properties

    Energy Technology Data Exchange (ETDEWEB)

    Wang, Xiao-Bing [Department of Chemistry, Shaoguan University, Shaoguan, Guangdong 512005 (China); Lu, Wen-Guan, E-mail: lwg@sgu.edu.cn [Department of Chemistry, Shaoguan University, Shaoguan, Guangdong 512005 (China); Zhong, Di-Chang [School of Chemistry and Chemical Engineering, Gannan Normal University, Ganzhou 341000 (China)

    2017-06-15

    The reactions of Zn(NO{sub 3}){sub 2}·6H{sub 2}O with mixed ligands of 5-amino-tetrazole (Hatz) and l,2,4,5-benzenetetracarboxylic acid (H{sub 4}btec) under hydro(solvo)thermal conditions, gave two three-dimensional (3D) porous metal-organic frameworks (MOFs) of ([Zn{sub 3}(atz){sub 2}(btec)(DMF){sub 2}]·DMF·2H{sub 2}O){sub n} (1) and [Zn{sub 2}(Hprz)(atz)(btec)(H{sub 2}O)]{sub n} (2) in the absence and presence of piperazine (prz), respectively. 1 and 2 were characterized by infrared spectra (IR), elemental analyses (EA) and single-crystal/powder X-ray diffraction. In 1, the adjacent 1D [Zn{sub 3}(btec)]{sub n}{sup 2n+} chains are linked together by atz{sup −} ligands to form a 3D porous MOF with 1D tetragonal channels filled with coordinated and guest DMF, and lattice water molecules. In 2, the adjacent 2D [Zn{sub 2}(btec)]{sub n} wavelike sheets are pillared through atz{sup −} ligands to generate a 3D layered-pillared porous MOF with 1D open channels, which are occupied by coordinated Hprz{sup +} cations and coordinated water molecules. Additionally, thermal stabilities and photoluminescent properties of both compounds in the solid-state at room temperature have been investigated and discussed in detail. - Graphical abstract: Two new MOFs constructed from Zn(II) salts with mixed ligands of 5-amino-tetrazole and l,2,4,5-benzenetetracarboxylic acid were synthesized under different reaction conditions. Structural diversities indicate that the reaction solvent system or the presence of organic base play crucial roles in modulating structures of these compounds. And more, their thermal stability and luminescence are also discussed. - Highlights: • Two new Zn(II) MOFs based on mixed ligands were synthesized. • The two Zn(II) MOFs exhibit different structural motifs. • The two Zn(II) MOFs are photoluminscent in the solid state at room temperature.

  18. Synthesis, characterization and catalytic application of silica supported tin oxide nanoparticles for synthesis of 2,4,5-tri and 1,2,4,5-tetrasubstituted imidazoles under solvent-free conditions

    Directory of Open Access Journals (Sweden)

    Ashok V. Borhade

    2017-02-01

    Full Text Available Highly efficient and eco-friendly, one pot synthesis of 1,2,4,5-tetra substituted imidazoles and 2,4,5-trisubstituted imidazoles was reported under solvent free conditions using nanocrystalline silica supported tin oxide (SiO2:SnO2 as a catalyst with excellent yield. The present methodology offers several advantages such as mild reaction conditions, short reaction time, good yield, high purity of product, recyclable catalyst without a noticeable decrease in catalytic activity and can be used for large scale synthesis. The synthesized SiO2:SnO2 nanocrystalline catalyst was characterized by XRD, BET surface area and TEM techniques.

  19. Banana peel: a potential substrate for laccase production by Aspergillus fumigatus VkJ2.4.5 in solid-state fermentation.

    Science.gov (United States)

    Vivekanand, V; Dwivedi, Pallavi; Pareek, Nidhi; Singh, Rajesh P

    2011-09-01

    In solid-state fermentation, among various solid supports evaluated, banana peel was found to be an ideal support and resulted into higher levels of laccase (6281.4 ± 63.60 U l(-1)) along with notable levels of manganese peroxidase production (1339.0 ± 131.23 U l(-1)) by Aspergillus fumigatus VkJ2.4.5. Maximum levels of laccase was achieved under derived conditions consisting of 80% of moisture level, 6 days of incubation period, 6% inoculum level, and an aeration level of 2.5 l min(-1). A column-tray bioreactor was designed to scale up and economize the enzyme production in three successive cycles of fermentation using the same fungal biomass. Thermal and pH stability profiles revealed that enzyme was stable up to 50°C and at varying pH range from 5-9 for up to 2 h. The apparent molecular weight of laccase was found to be 34 ± 1 kDa. MALDI-TOF/TOF analysis of the protein showed significant homology with maximum identity of 67% to other laccases reported in database.

  20. Bioremediation of soils co-contaminated with heavy metals and 2,4,5-trichlorophenol by fruiting body of Clitocybe maxima.

    Science.gov (United States)

    Liu, Hongying; Guo, Shanshan; Jiao, Kai; Hou, Junjun; Xie, Han; Xu, Heng

    2015-08-30

    Pot experiments were performed to investigate the single effect of 2,4,5-trichlorophenol (TCP) or heavy metals (Cu, Cd, Cu+Cd) and the combined effects of metals-TCP on the growth of Clitocybe maxima together with the accumulation of heavy metals as well as dissipation of TCP. Results showed a negative effect of contaminations on fruiting time and biomass of the mushroom. TCP decreased significantly in soils accounting for 70.66-96.24% of the initial extractable concentration in planted soil and 66.47-91.42% in unplanted soil, which showed that the dissipation of TCP was enhanced with mushroom planting. Higher biological activities (bacterial counts, soil respiration and laccase activity) were detected in planted soils relative to unplanted controls, and the enhanced dissipation of TCP in planted soils might be derived from the increased biological activities. The metals accumulation in mushroom increased with the augment of metal load, and the proportion of acetic acid (HOAc) extractable metal in soils with C. maxima was larger than that in unplanted soils, which may be an explanation of metal uptake by C. maxima. These results suggested that the presence of C. maxima was effective in promoting the bioremediation of soil contaminated with heavy metals and TCP. Copyright © 2015 Elsevier B.V. All rights reserved.

  1. Synthesis of the isotopes of elements 118 and 116 in the 249Cf and 245Cm+48Ca fusion reactions

    International Nuclear Information System (INIS)

    Oganessian, Y T; Utyonkov, V K; Lobanov, Y V; Abdullin, F S; Polyakov, A N; Sagaidak, R N; Shirokovsky, I V; Tsyganov, Y S; Voinov, A A; Gulbekian, G G; Bogomolov, S L; Gikal, B N; Mezentsev, A N; Iliev, S; Subbotin, V G; Sukhov, A M; Subotic, K; Zagrebaev, V I; Vostokin, G K; Itkis, M G; Moody, K J; . Patin, J B; Shaughnessy, D A; Stoyer, M A; Stoyer, N J; Wilk, P A; Kenneally, J M; Landrum, J H; Wild, J F; Lougheed, R W

    2006-01-01

    The decay properties of 290 116 and 291 116, and the dependence of their production cross sections on the excitation energies of the compound nucleus, 293 116, have been measured in the 245 Cm( 48 Ca,xn) 293-x 116 reaction. These isotopes of element 116 are the decay daughters of element 118 isotopes, which are produced via the 249 Cf+ 48 Ca reaction. They performed the element 118 experiment at two projectile energies, corresponding to 297 118 compound nucleus excitation energies of E* = 29.2 ± 2.5 and 34.4 ± 2.3 MeV. During an irradiation with a total beam dose of 4.1 x 10 19 48 Ca projectiles, three similar decay chains consisting of two or three consecutive α decays and terminated by a spontaneous fission (SF) with high total kinetic energy of about 230 MeV were observed. The three decay chains originated from the even-even isotope 294 118 (E α = 11.65 ± 0.06 MeV, T α = 0.89 -0.31 +1.07 ms) produced in the 3n-evaporation channel of the 249 Cf+ 48 Ca reaction with a maximum cross section of 0.5 -0.3 +1.6 pb

  2. Chemical consequences of radioactive decay. 1. Study of 249Cf ingrowth into crystalline 249BkBr3: a new crystalline phase of CfBr3

    International Nuclear Information System (INIS)

    Young, J.P.; Haire, R.G.; Peterson, J.R.; Ensor, D.D.; Fellows, R.L.

    1980-01-01

    Spectrophotometric and x-ray powder diffraction methods have been applied to a study of the ingrowth of californium-249 by β - decay of berkelium-249 in crystalline 249 BkBr 3 . It was found that the Cf daughter grows in with the same oxidation state and crystal structure as the parent. Thus, six-coordinate BkBr 3 (AlCl 3 -type monoclinic structure) generates six-coordinate CfBr 3 , and eight-coordinate BkBr 3 (PuBr 3 -type orthorhombic structure) generates eight-coordinate CfBr 3 , a previously unknown form of CfBr 3 . It was also found that the daughter Cf(III) in the BkBr 3 parent compound can be reduced to Cf(II) by treatment with H 2 , as it can in pure CfBr 3 . 5 figures

  3. Nuclear fission and the transuranium elements

    International Nuclear Information System (INIS)

    Seaborg, G.T.

    1989-02-01

    Many of the transuranium elements are produced and isolated in large quantities through the use of neutrons furnished by nuclear fission reactions: plutonium (atomic number 94) in ton quantities; neptunium (93), americium (95), and curium (96) in kilogram quantities; berkelium (97) in 100 milligram quantities; californium (98) in gram quantities; and einsteinium (99) in milligram quantities. Transuranium isotopes have found many practical applications---as nuclear fuel for the large-scale generation of electricity, as compact, long-lived power sources for use in space exploration, as means for diagnosis and treatment in the medical area, and as tools in numerous industrial processes. Of particular interest is the unusual chemistry and impact of these heaviest elements on the periodic table. This account will feature these aspects. 9 refs., 5 figs

  4. Nuclear fission and the transuranium elements

    Energy Technology Data Exchange (ETDEWEB)

    Seaborg, G.T.

    1989-02-01

    Many of the transuranium elements are produced and isolated in large quantities through the use of neutrons furnished by nuclear fission reactions: plutonium (atomic number 94) in ton quantities; neptunium (93), americium (95), and curium (96) in kilogram quantities; berkelium (97) in 100 milligram quantities; californium (98) in gram quantities; and einsteinium (99) in milligram quantities. Transuranium isotopes have found many practical applications---as nuclear fuel for the large-scale generation of electricity, as compact, long-lived power sources for use in space exploration, as means for diagnosis and treatment in the medical area, and as tools in numerous industrial processes. Of particular interest is the unusual chemistry and impact of these heaviest elements on the periodic table. This account will feature these aspects. 9 refs., 5 figs.

  5. Design and simulation for the pulse high-voltage DC power supply (HVPS) of 1.2 MW/2.45 GHz HT-7U lower hybrid current drive system

    International Nuclear Information System (INIS)

    Huang Yiyun; Kuang Guangli; Xu Weihua; Liu Baohua; Lin Jianan; Wu Junshuan; Zheng Guanghua; Yang Chunshen

    2000-01-01

    The superconducting tokamak HT-7U has been designed by the Institute of Plasma Physics since 1998 and will be set up before 2003. The 1.2 MW/2.45 GHz HT-7U LHCD (Lower hybrid current drive) system which being the most efficient non-induction device can heat the plasma and drive the plasma current has been efficiently in operation now, and a particular design of the 2.8 MW/-35 kV high-voltage DC power supply has been already completed and will apply to the klystron of LHCD on HT-7 and the future HT-7U, and the project of the power supply has been examined and approved professionally by an authorized group of high-level specialist in the Institute of Plasma Physics. The detailed design of the power supply and the simulation results are referred

  6. Development of occlusal traits and dental arch space from adolescence to adulthood: a 25-year follow-up study of 245 untreated subjects.

    Science.gov (United States)

    Jonsson, Teitur; Arnlaugsson, Sigurjon; Saemundsson, Sigurdur Runar; Magnusson, Thordur Eydal

    2009-04-01

    The purpose of this study was to examine longitudinally the development of specific occlusal traits and space conditions in an Icelandic sample. The sample comprised 245 adolescents examined clinically in the late mixed or permanent dentition and again 25 years later. All subjects were orthodontically untreated, and all had the full complement of teeth at both examinations. A significant increase in the prevalence of mandibular anterior crowding and mesial molar relationships and a decrease in the prevalence of excessive overjet and maxillary anterior spacing were seen. The persistence of malocclusion traits ranged from 17.9% to 53.4% for maxillary anterior spacing and crowding, mandibular spacing, overjet, overbite, and distal molar occlusion, whereas anterior mandibular crowding and molar crossbite were still found in 72.7% and 75.0%, respectively, at the second examination. Normal occlusal traits and space conditions at adolescence stayed mostly unchanged, with the exception of 11.2% of the subjects, who developed mandibular anterior crowding between the first and second examinations. Deterioration of normal occlusal traits and space relationships was uncommon in this study, whereas self-correction of malocclusion traits and space anomalies was relatively frequent.

  7. Abatement of fluorinated compounds using a 2.45 GHz microwave plasma torch with a reverse vortex plasma reactor

    Energy Technology Data Exchange (ETDEWEB)

    Kim, J.H.; Cho, C.H.; Shin, D.H. [Plasma Technology Research Center, National Fusion Research Institute, 814-2 Oxikdo-dong, Gunsan-city, Jeollabuk-do (Korea, Republic of); Hong, Y.C., E-mail: ychong@nfri.re.kr [Plasma Technology Research Center, National Fusion Research Institute, 814-2 Oxikdo-dong, Gunsan-city, Jeollabuk-do (Korea, Republic of); Shin, Y.W. [Plasma Technology Research Center, National Fusion Research Institute, 814-2 Oxikdo-dong, Gunsan-city, Jeollabuk-do (Korea, Republic of); School of Advanced Green Energy and Environments, Handong Global University, Heunghae-eup, Buk-gu, Pohang-city, Gyeongbuk (Korea, Republic of)

    2015-08-30

    Highlights: • We developed a microwave plasma torch with reverse vortex reactor (RVR). • We calculated a volume fraction and temperature distribution of discharge gas and waste. • The performance of reverse vortex reactor increased from 29% to 43% than conventional vortex reactor. - Abstract: Abatement of fluorinated compounds (FCs) used in semiconductor and display industries has received an attention due to the increasingly stricter regulation on their emission. We have developed a 2.45 GHz microwave plasma torch with reverse vortex reactor (RVR). In order to design a reverse vortex plasma reactor, we calculated a volume fraction and temperature distribution of discharge gas and waste gas in RVR by ANSYS CFX of computational fluid dynamics (CFD) simulation code. Abatement experiments have been performed with respect to SF{sub 6}, NF{sub 3} by varying plasma power and N{sub 2} flow rates, and FCs concentration. Detailed experiments were conducted on the abatement of NF{sub 3} and SF{sub 6} in terms of destruction and removal efficiency (DRE) using Fourier transform infrared (FTIR). The DRE of 99.9% for NF{sub 3} was achieved without an additive gas at the N{sub 2} flow rate of 150 liter per minute (L/min) by applying a microwave power of 6 kW with RVR. Also, a DRE of SF{sub 6} was 99.99% at the N{sub 2} flow rate of 60 L/min using an applied microwave power of 6 kW. The performance of reverse vortex reactor increased about 43% of NF{sub 3} and 29% of SF{sub 6} abatements results definition by decomposition energy per liter more than conventional vortex reactor.

  8. Model of the expansion process for R245fa in an Organic Rankine Cycle (ORC)

    International Nuclear Information System (INIS)

    Luján, J.M.; Serrano, J.R.; Dolz, V.; Sánchez, J.

    2012-01-01

    An Organic Rankine Cycle (ORC) is considered as one of the most environmental-friendly ways to convert different kinds of low temperature energies, i.e. solar, geothermal, biomass and thermal energy of exhaust gases into electrical energy. Two important facts about the ORC must be considered: An organic fluid is selected as the working fluid and a high expansion ratio is usually presented in the machinery due to thermodynamic and efficiency factors. In the past, the pre-design of turbomachinery has been based on the usage of ideal fluid laws, but the real gas effects have a significant influence in the ORC working condition, due to its proximity to the saturation vapor line. In this article, the Equations of State (EoS) (Ideal gas, Redlich-Kwong-Soave and Peng–Robinson) have been evaluated in a typical ORC expansion in order to observe the inaccuracies of the ideal gas model with different thermodynamic variables. Finally an isothermal process followed by an isochoric process is proposed to reproduce the thermodynamic process of the organic fluid expansion by means of simpler equations. In the last point of this paper, several examples of this expansion process have been calculated, in order to analyze the proposed methodologies. It has been concluded that in typical expansion process of ORC (2.5 MPa-0.1 MPa and 1.6MPa-0.1 MPa), the PR and RKS equations show deviations between 6% and 8% in specific energy. These deviations are very low compared with the ideal gas equation whose deviations are above 100%. - Highlights: ► Evaluate the ideal gas behaviour of R245fa in typical working conditions of an Organic Rankine Cycle (ORC). ► Compare the ideal behaviour with other simple equations of state for real gas. ► Decide which equation of state has the highest precision in typical working conditions of an ORC. ► Derive the most important thermodynamic variables in each equation of state and decide the most accurate equation. ► Evaluate the speci c output

  9. Fate of the herbicides 2,4,5-T, atrazine, and DNOC in a shallow, anaerobic aquifer investigated by in situ passive diffusive emitters and laboratory batch experiments

    DEFF Research Database (Denmark)

    Arildskov, N.P.; Pedersen, Philip Grinder; Albrechtsen, Hans-Jørgen

    2001-01-01

    simultaneously with tritiated water (HTO) as tracer in the depth interval 3 to 4 rubs (meters below surface) by use of passive diffusive emitters. Atrazine and 2,4,5-T were persistent during the approximately 18 days residence time in the aquifer. In contrast, DNOC was rapidly removed from the water phase...... to 4 rubs and from 8 to 9 rubs. In these incubations, formation of Fe2+ and depletion of sulfate showed iron and sulfate reduction in sediment from 3 to 3.5 rubs and sulfate reduction in 3.5 to 4 rubs sediment. In sediment from 8 to 9 rubs, the dominant redox process was methane formation. In sediment...... first-order kinetics, and when normalized to the sediment/water-ratio, the field and laboratory derived rate constants compared well. The DNOC degradation in the methanogenic incubations (8 to 9 rubs) was up to 50 times faster than in the sediments from 3 to 4 rubs, likely due to the low redox potential....

  10. Experimental (FT-IR and FT-Raman) and theoretical (HF and DFT) investigation, NMR, NBO, electronic properties and frequency estimation analyses on 2,4,5-trichlorobenzene sulfonyl chloride

    Science.gov (United States)

    Gayathri, R.; Arivazhagan, M.

    2012-11-01

    The present work deals with the structural, electronic, and vibrational analyses of the biomolecule 2,4,5-trichlorobenzene sulfonyl chloride (TCBSC). TCBSC is a novel pharmaceutical compound used in dyes, pesticides, pigments, fluorescence brighteners and intermediate for agricultural chemicals in the manufacture of insecticides. Quantum chemical calculation of geometrical structure and energies of TCBSC was carried out by density functional theory (B3LYP) and ab initio (HF) methods at 6-311+G(d,p) and 6-311++G(d,p) standard basis set. The stability of the molecule arising from hyperconjugative interaction and charge delocalization has been analyzed using natural bond orbital (NBO) analysis. NMR analysis shows that the isotropic chemical shifts of carbon and hydrogen atom of TCBSC are giving the reasonable shielding to the molecule. Another interesting property shows nonlinear optical (NLO) behavior. Moreover, we have not only simulated highest occupied molecular orbital (HOMO) and lowest unoccupied molecular orbital (LUMO) but also determined the transition state and energy band gap.

  11. Origin of the 2.45 eV luminescence band observed in ZnO epitaxial layers grown on c-plane sapphire by chemical vapour deposition

    International Nuclear Information System (INIS)

    Saroj, R K; Dhar, S

    2014-01-01

    Zinc oxide epitaxial layers have been grown on c-plane sapphire substrates by the chemical vapour deposition (CVD) technique. A structural study shows (0001)-oriented films with good crystalline quality. The temperature and excitation power dependence of the photoluminescence (PL) characteristics of these layers is studied as a function of various growth parameters, such as the growth temperature, oxygen flow rate and Zn flux, which suggest that the origin of the broad visible luminescence (VL), which peaks at 2.45 eV, is the transition between the conduction band and the Zn vacancy acceptor states. A bound excitonic transition observed at 3.32 eV in low temperature PL has been identified as an exciton bound to the neutral Zn vacancy. Our study also reveals the involvement of two activation processes in the dynamics of VL, which has been explained in terms of the fluctuation of the capture barrier height for the holes trapped in Zn vacancy acceptors. The fluctuation, which might be a result of the inhomogeneous distribution of Zn vacancies, is found to be associated with an average height of 7 and 90 meV, respectively, for the local and global maxima. (paper)

  12. 2.45-GHz microwave irradiation adversely affects reproductive function in male mouse, Mus musculus by inducing oxidative and nitrosative stress.

    Science.gov (United States)

    Shahin, S; Mishra, V; Singh, S P; Chaturvedi, C M

    2014-05-01

    Electromagnetic radiations are reported to produce long-term and short-term biological effects, which are of great concern to human health due to increasing use of devices emitting EMR especially microwave (MW) radiation in our daily life. In view of the unavoidable use of MW emitting devices (microwaves oven, mobile phones, Wi-Fi, etc.) and their harmful effects on biological system, it was thought worthwhile to investigate the long-term effects of low-level MW irradiation on the reproductive function of male Swiss strain mice and its mechanism of action. Twelve-week-old mice were exposed to non-thermal low-level 2.45-GHz MW radiation (CW for 2 h/day for 30 days, power density = 0.029812 mW/cm(2) and SAR = 0.018 W/Kg). Sperm count and sperm viability test were done as well as vital organs were processed to study different stress parameters. Plasma was used for testosterone and testis for 3β HSD assay. Immunohistochemistry of 3β HSD and nitric oxide synthase (i-NOS) was also performed in testis. We observed that MW irradiation induced a significant decrease in sperm count and sperm viability along with the decrease in seminiferous tubule diameter and degeneration of seminiferous tubules. Reduction in testicular 3β HSD activity and plasma testosterone levels was also noted in the exposed group of mice. Increased expression of testicular i-NOS was observed in the MW-irradiated group of mice. Further, these adverse reproductive effects suggest that chronic exposure to nonionizing MW radiation may lead to infertility via free radical species-mediated pathway.

  13. CW/Pulsed H- ion beam generation with PKU Cs-free 2.45 GHz microwave driven ion source

    Science.gov (United States)

    Peng, S. X.; Ren, H. T.; Xu, Y.; Zhang, T.; Zhang, A. L.; Zhang, J. F.; Zhao, J.; Guo, Z. Y.; Chen, J. E.

    2015-04-01

    Circular accelerators used for positron emission tomography (PET, i.e. accelerator used for make radio isotopes) need several mA of CW H- ion beam for their routine operation. Other facilities, like Space Radio-Environment Simulate Assembly (SPRESA), require less than 10 mA pulsed mode H- beam. Caesium free negative hydrogen ion source is a good choice for those facilities because of its compact structure, easy operation and low cost. Up to now, there is no H- source able to produce very intense H- beams with important variation of the duty factor[1]. Recently, a new version of 2.45 GHz microwave H- ion source was designed at PKU, based on lessons learnt from the previous one. This non cesiated source is very compact thanks to its permanent magnet configuration. Special attention was paid on the design of the discharge chamber structure, electron dumping and extraction system. Source test to produce H- ion beams in pulsed and CW mode was carried out on PKU ion source test bench. In CW mode, a 10.8 mA/30keV H- beam with rms emittance about 0.16 π.mm.mrad has been obtained with only 500 W rf power. The power efficiency reaches 21 mA/kW. In pulsed mode with duty factor of 10% (100Hz/1ms), this compact source can easily deliver 20 mA H- ion beam at 35 keV with rms emittance about 0.2 π.mm.mrad when RF power is set at 2.2 kW (peak power). Several hour successive running operation in both modes and totaling more than 200 hours proves its high quality. The outside dimension of this new H- source body is ϕ116 mm × 124 mm, and the entire H- source infrastructure, including rf matching section, plasma chamber and extraction system, is ϕ310 × 180 mm. The high voltage region is limited with in a ϕ310 mm × 230 mm diagram. Details are given in this paper.

  14. FDTD analysis of temperature elevation in the lens of human and rabbit models due to near-field and far-field exposures at 2.45 GHz

    International Nuclear Information System (INIS)

    Oizumi, T.; Laakso, I.; Hirata, A.; Fujiwara, O.; Watanabe, S.; Taki, M.; Kojima, M.; Sasaki, H.; Sasaki, K.

    2013-01-01

    The eye is said to be one of the most sensitive organs to microwave heating. According to previous studies, the possibility of microwave-induced cataract formation has been experimentally investigated in rabbit and monkey eyes, but not for the human eye due to ethical reasons. In the present study, the temperature elevation in the lens, the skin around the eye and the core temperature of numerical human and rabbit models for far-field and near-field exposures at 2.45 GHz are investigated. The temperature elevations in the human and rabbit models were compared with the threshold temperatures for inducing cataracts, thermal pain in the skin and reversible health effects such as heat exhaustion or heat stroke. For plane-wave exposure, the core temperature elevation is shown to be essential both in the human and in the rabbit models as suggested in the international guidelines and standards. For localised exposure of the human eye, the temperature elevation of the skin was essential, and the lens temperature did not reach its threshold for thermal pain. On the other hand, the lens temperature elevation was found to be dominant for the rabbit eye. (authors)

  15. FDTD analysis of temperature elevation in the lens of human and rabbit models due to near-field and far-field exposures at 2.45 GHz.

    Science.gov (United States)

    Oizumi, Takuya; Laakso, Ilkka; Hirata, Akimasa; Fujiwara, Osamu; Watanabe, Soichi; Taki, Masao; Kojima, Masami; Sasaki, Hiroshi; Sasaki, Kazuyuki

    2013-07-01

    The eye is said to be one of the most sensitive organs to microwave heating. According to previous studies, the possibility of microwave-induced cataract formation has been experimentally investigated in rabbit and monkey eyes, but not for the human eye due to ethical reasons. In the present study, the temperature elevation in the lens, the skin around the eye and the core temperature of numerical human and rabbit models for far-field and near-field exposures at 2.45 GHz are investigated. The temperature elevations in the human and rabbit models were compared with the threshold temperatures for inducing cataracts, thermal pain in the skin and reversible health effects such as heat exhaustion or heat stroke. For plane-wave exposure, the core temperature elevation is shown to be essential both in the human and in the rabbit models as suggested in the international guidelines and standards. For localised exposure of the human eye, the temperature elevation of the skin was essential, and the lens temperature did not reach its threshold for thermal pain. On the other hand, the lens temperature elevation was found to be dominant for the rabbit eye.

  16. The smell of fear: innate threat of 2,5-dihydro-2,4,5-trimethylthiazoline, a single molecule component of a predator odor

    Science.gov (United States)

    Rosen, Jeffrey B.; Asok, Arun; Chakraborty, Trisha

    2015-01-01

    In the last several years, the importance of understanding what innate threat and fear is, in addition to learning of threat and fear, has become evident. Odors from predators are ecologically relevant stimuli used by prey animals as warnings for the presence of danger. Of importance, these odors are not necessarily noxious or painful, but they have innate threat-like properties. This review summarizes the progress made on the behavioral and neuroanatomical fundamentals of innate fear of the predator odor, 2,5-dihydro-2,4,5-trimethylthiazoline (TMT), a component of fox feces. TMT is one of several single molecule components of predator odors that have been isolated in the last several years. Isolation of these single molecules has allowed for rapid advances in delineating the behavioral constraints and selective neuroanatomical pathways of predator odor induced fear. In naïve mice and rats, TMT induces a number of fear and defensive behaviors, including robust freezing, indicating it is an innate threat stimulus. However, there are a number of behavioral constraints that we do not yet understand. Similarly, while some of the early olfactory sensory pathways for TMT-induced fear are being delineated, the pathways from olfactory systems to emotional and motor output regions are less well understood. This review will focus on what we know and what we still need to learn about the behavior and neuroanatomy of TMT-induced fear. PMID:26379483

  17. Desain Beam Shaping Assembly (BSA berbasis D-D Neutron Generator 2,45 MeV untuk Uji Fasilitas BNCT

    Directory of Open Access Journals (Sweden)

    Desman P. Gulo

    2015-12-01

    Full Text Available Boron Neutron Capture Therapy (BNCT is one of the cancer treatments that are being developed in nowadays. In order to support BNCT treatment for cancer that exists in underneath skin like breast cancer, the facility needs a generator that is able to produce epithermal neutron. One of the generator that is able to produce neutron is D-D neutron generator with 2.45 MeV energy. Based on the calculation of this paper, we found that the total production of neutron per second (neutron yield from Neutron Generator (NG by PSTA-BATAN Yogyakarta is 2.55×1011 n/s. The energy and flux that we found is in the range of quick neutron. Thus, it needs to be moderated to the level of epithermal neutron which is located in the interval energy of 1 eV to 10 KeV with 109 n/cm2s flux. This number is the recommendation standard from IAEA. Beam Shaping Assembly (BSA is needed in order to moderate the quick neutron to the level of epithermal neutron. One part of BSA that has the responsibility in moderating the quick neutron to epithermal neutron is the moderator. The substance of moderator used in this paper is MgF2 and A1F3. The thickness of moderator has been set in in such a way by using MCNPX software in order to fulfill the standard of IAEA. As the result of optimizing BSA moderator, the data obtain epithermal flux with the total number of 4.64×108 n/cm2/s for both of moderators with the thickness of moderator up to 15 cm. At the end of this research, the number of epithermal flux does not follow the standard of IAEA. This is because the flux neutron that is being produced by NG is relatively small. In conclusion, the NG from PSTA-BATAN Yogyakarta is not ready to be used for the BNCT treatment facility for the underneath skin cancer like breast cancer.

  18. WE-DE-207B-05: Measuring Spatial Resolution in Digital Breast Tomosynthesis: Update of AAPM Task Group 245

    Energy Technology Data Exchange (ETDEWEB)

    Scaduto, DA; Hu, Y-H; Zhao, W [Stony Brook Medicine, Stony Brook, NY (United States); Goodsitt, M; Chan, H-P [University Michigan, Ann Arbor, MI (United States); Olafsdottir, H [Image Owl, 105 Reykjavik (Iceland); Das, M [University Houston, Houston, TX (United States); Fredenberg, E [Philips Healthcare, Solna (Sweden); Geiser, W [UT MD Anderson Cancer Center, Houston, TX (United States); Goodenough, D [The George Washington University, Washington, DC (United States); Heid, P [ARCADES, Marseille (France); Liu, B [Massachusetts General Hospital, Boston, MA (United States); Mainprize, J [Sunnybrook Health Sciences Centre, North York, ON (Canada); Reiser, I [The University of Chicago, Chicago, IL (United States); Van Engen, R [LRCB, Nijmegen (Netherlands); Varchena, V [CIRS Inc., Norfolk, VA (United States); Vecchio, S [I.M.S., Pontecchio Marconi (Italy); Glick, S [Food and Drug Administration, Silver Spring, MD (United States)

    2016-06-15

    Purpose: Spatial resolution in digital breast tomosynthesis (DBT) is affected by inherent/binned detector resolution, oblique entry of x-rays, and focal spot size/motion; the limited angular range further limits spatial resolution in the depth-direction. While DBT is being widely adopted clinically, imaging performance metrics and quality control protocols have not been standardized. AAPM Task Group 245 on Tomosynthesis Quality Control has been formed to address this deficiency. Methods: Methods of measuring spatial resolution are evaluated using two prototype quality control phantoms for DBT. Spatial resolution in the detector plane is measured in projection and reconstruction domains using edge-spread function (ESF), point-spread function (PSF) and modulation transfer function (MTF). Spatial resolution in the depth-direction and effective slice thickness are measured in the reconstruction domain using slice sensitivity profile (SSP) and artifact spread function (ASF). An oversampled PSF in the depth-direction is measured using a 50 µm angulated tungsten wire, from which the MTF is computed. Object-dependent PSF is derived and compared with ASF. Sensitivity of these measurements to phantom positioning, imaging conditions and reconstruction algorithms is evaluated. Results are compared from systems of varying acquisition geometry (9–25 projections over 15–60°). Dependence of measurements on feature size is investigated. Results: Measurements of spatial resolution using PSF and LSF are shown to depend on feature size; depth-direction spatial resolution measurements are shown to similarly depend on feature size for ASF, though deconvolution with an object function removes feature size-dependence. A slanted wire may be used to measure oversampled PSFs, from which MTFs may be computed for both in-plane and depth-direction resolution. Conclusion: Spatial resolution measured using PSF is object-independent with sufficiently small object; MTF is object

  19. Identification of the new isotope sup 2 sup 4 sup 1 Bk

    CERN Document Server

    Asai, M; Ichikawa, S; Nagame, Y; Nishinaka, I; Akiyama, K; Toyoshima, A; Kaneko, T; Sakama, M; Haba, H; Oura, Y; Kojima, Y; Shibata, M

    2003-01-01

    A new neutron-deficient berkelium isotope sup 2 sup 4 sup 1 Bk produced in the sup 2 sup 3 sup 9 Pu( sup 6 Li, 4n) reaction has been identified using a gas-jet coupled on-line isotope separator. Cm K and L X-rays associated with the EC decay of sup 2 sup 4 sup 1 Bk were observed in the mass-241 fraction, and three gamma transitions were attributed to the EC decay of sup 2 sup 4 sup 1 Bk through X-gamma coincidences. The half-life of sup 2 sup 4 sup 1 Bk was determined to be 4.6+-0.4 min which is 1/2-1/4 of that of theoretical predictions. The half-life value and the observed gamma transitions can be consistently explained as a consequence of the allowed EC transition of pi 7/2 sup + [633] -> nu 7/2 sup + [624]. (orig.)

  20. Reactor production of 252Cf and transcurium isotopes

    International Nuclear Information System (INIS)

    Alexander, C.W.; Halperin, J.; Walker, R.L.; Bigelow, J.E.

    1990-01-01

    Berkelium, californium, einsteinium, and fermium are currently produced in the High Flux Isotope Reactor (HFIR) and recovered in the Radiochemical Engineering Development Center (REDC) at the Oak Ridge National Laboratory (ORNL). All the isotopes are used for research. In addition, 252 Cf, 253 Es, and 255 Fm have been considered or are used for industrial or medical applications. ORNL is the sole producer of these transcurium isotopes in the western world. A wide range of actinide samples were irradiated in special test assemblies at the Fast Flux Test Facility (FFTF) at Hanford, Washington. The purpose of the experiments was to evaluate the usefulness of the two-group flux model for transmutations in the special assemblies with an eventual goal of determining the feasibility of producing macro amounts of transcurium isotopes in the FFTF. Preliminary results from the production of 254g Es from 252 Cf will be discussed. 14 refs., 5 tabs

  1. Actinide metals

    Energy Technology Data Exchange (ETDEWEB)

    Brown, Paul L. [Geochem Australia, Kiama, NSW (Australia); Ekberg, Christian [Chalmers Univ. of Technology, Goeteborg (Sweden). Nuclear Chemistry/Industrial Materials Recycling

    2016-07-01

    All isotopes of actinium are radioactive and exist in aqueous solution only in the trivalent state. There have been very few studies on the hydrolytic reactions of actinium(III). The hydrolysis reactions for uranium would only be important in alkaline pH conditions. Thermodynamic parameters for the hydrolysis species of uranium(VI) and its oxide and hydroxide phases can be determined from the stability and solubility constants. The hydrolytic behaviour of neptunium(VI) is quite similar to that of uranium(VI). The solubility constant of NpO{sub 2}OH(am) has been reported a number of times for both zero ionic strength and in fixed ionic strength media. Americium can form four oxidation states in aqueous solution, namely trivalent, tetravalent, pentavalent and hexavalent. Desire, Hussonnois and Guillaumont determined stability constants for the species AmOH{sup 2+} for the actinides, plutonium(III), americium(III), curium(III), berkelium(III) and californium(III) using a solvent extraction technique.

  2. Actinide metals

    International Nuclear Information System (INIS)

    Brown, Paul L.; Ekberg, Christian

    2016-01-01

    All isotopes of actinium are radioactive and exist in aqueous solution only in the trivalent state. There have been very few studies on the hydrolytic reactions of actinium(III). The hydrolysis reactions for uranium would only be important in alkaline pH conditions. Thermodynamic parameters for the hydrolysis species of uranium(VI) and its oxide and hydroxide phases can be determined from the stability and solubility constants. The hydrolytic behaviour of neptunium(VI) is quite similar to that of uranium(VI). The solubility constant of NpO 2 OH(am) has been reported a number of times for both zero ionic strength and in fixed ionic strength media. Americium can form four oxidation states in aqueous solution, namely trivalent, tetravalent, pentavalent and hexavalent. Desire, Hussonnois and Guillaumont determined stability constants for the species AmOH 2+ for the actinides, plutonium(III), americium(III), curium(III), berkelium(III) and californium(III) using a solvent extraction technique.

  3. Nuclear Chemistry Institute, Mainz University. Annual Report 1995

    International Nuclear Information System (INIS)

    Denschlag, H.O.

    1996-03-01

    The annual report of the Institut fuer Kernchemie addresses inter alia three main research activities. The first belongs to the area of basic research, covering studies in the fields of nuclear fission, chemistry of the super-heavy elements and of heavy-ion reactions extending from the Coulomb barrier to relativistic energies, and nuclear astrophysics in connection with the ''r process''. By means of laser technology, high-precision data could be measured of the ionization energies of berkelium and californium. Studies of atomic clusters in the vacuum of an ionization trap revealed interesting aspects. The second major activity was devoted to the analysis of environmental media, applying inter alia neutron activation analysis and resonance ionization mass spectroscopy (RIMS). The third activity resulted in the development of novel processes, or the enhancement of existing processes or methods, for applications in basic research work and in environmental analytics. Another item of interest is the summarizing report on the operation of the TRIGA research reactor. (orig./SR) [de

  4. The impact of electromagnetic radiation (2.45 GHz, Wi-Fi) on the female reproductive system: The role of vitamin C.

    Science.gov (United States)

    Saygin, Mustafa; Ozmen, Ozlem; Erol, Onur; Ellidag, Hamit Yasar; Ilhan, Ilter; Aslankoc, Rahime

    2018-01-01

    The present study investigated the effects of applied continuous 2.45 GHz electromagnetic radiation (EMR), which might cause physiopathological or morphological changes in the ovarian, fallopian tubal, and uterine tissues of rats. We proposed that the addition of vitamin C (Vit C) may reduce these severe effects. Eighteen female Sprague Dawley rats were randomly divided into three groups with six animals in each: Sham, EMR (EMR, 1 h/day for 30 days), and EMR + Vit C (EMR, 1 h/day for 30 days 250 mg/kg/daily). Total oxidant status (TOS) and oxidative stress index (OSI) levels increased ( p = 0.011 and p = 0.002, respectively) in the EMR-only group in ovarian tissues. In all tissues, TOS and OSI levels significantly decreased in the Vit C-treated group in ovarian, fallopian tubal, and uterine tissues ( p < 0.05). Anti-müllerian hormone levels significantly increased in the EMR group ( p < 0.05) and decreased in the Vit C-treated groups. Estrogen (E2) levels were unchanged in the EMR group, as the differences were not statistically significant. Immunohistochemical examination of the ovaries revealed significant increases in Caspase-3 expressions in the epithelial cells of the EMR group ( p < 0.05). In the EMR group, hyperemia was observed in uterine tissues. Also, Caspase-3 and Caspase-8 were significantly increased in the EMR group ( p < 0.001). Caspase-3 was significantly diminished with Vit C application in the ovarian and uterine tissues ( p < 0.05). Caspase-8 was significantly diminished only in uterine tissues ( p < 0.05). These results indicate that prolonged EMR exposure induced physiopathological changes in the ovarian, fallopian tubal, and uterine tissues due to oxidative damage. Under the conditions of this study, Vit C may have protective effects on female reproductive system against oxidative damage.

  5. Remarkably High Stability of Late Actinide Dioxide Cations: Extending Chemistry to Pentavalent Berkelium and Californium.

    Science.gov (United States)

    Dau, Phuong D; Vasiliu, Monica; Peterson, Kirk A; Dixon, David A; Gibson, John K

    2017-12-06

    Actinyl chemistry is extended beyond Cm to BkO 2 + and CfO 2 + through transfer of an O atom from NO 2 to BkO + or CfO + , establishing a surprisingly high lower limit of 73 kcal mol -1 for the dissociation energies, D[O-(BkO + )] and D[O-(CfO + )]. CCSD(T) computations are in accord with the observed reactions, and characterize the newly observed dioxide ions as linear pentavalent actinyls; these being the first Bk and Cf species with oxidation states above IV. Computations of actinide dioxide cations AnO 2 + for An=Pa to Lr reveal an unexpected minimum for D[O-(CmO + )]. For CmO 2 + , and AnO 2 + beyond EsO 2 + , the most stable structure has side-on bonded η 2 -(O 2 ), as An III peroxides for An=Cm and Lr, and as An II superoxides for An=Fm, Md, and No. It is predicted that the most stable structure of EsO 2 + is linear [O=Es V =O] + , einsteinyl, and that FmO 2 + and MdO 2 + , like CmO 2 + , also have actinyl(V) structures as local energy minima. The results expand actinide oxidation state chemistry, the realm of the distinctive actinyl moiety, and the non-periodic character towards the end of the periodic table. © 2017 Wiley-VCH Verlag GmbH & Co. KGaA, Weinheim.

  6. Early plant growth and biochemical responses induced by Azospirillum brasilense Sp245 lipopolysaccharides in wheat (Triticum aestivum L.) seedlings are attenuated by procyanidin B2.

    Science.gov (United States)

    Vallejo-Ochoa, Juan; López-Marmolejo, Mariel; Hernández-Esquivel, Alma Alejandra; Méndez-Gómez, Manuel; Suárez-Soria, Laura Nicolasa; Castro-Mercado, Elda; García-Pineda, Ernesto

    2018-03-01

    This study analyzes the effects of procyanidin B2 on early wheat plant growth and plant biochemical responses promoted by lipopolysaccharides (LPS) derived from the rhizobacteria Azospirillum brasilense Sp245. Measurements of leaf, root length, fresh weight, and dry weight showed in vitro plant growth stimulation 4 days after treatment with A. brasilense as well as LPS. Superoxide anion (O 2 ·- ) and hydrogen peroxide (H 2 O 2 ) levels increased in seedling roots treated with LPS (100 μg mL -1 ). The chlorophyll content in leaf decreased while the starch content increased 24 h after treatment in seedling roots. The LPS treatment induced a high increase in total peroxidase (POX) (EC 1.11.1.7) activity and ionically bound cell wall POX content in roots, when compared to respective controls. Early plant growth and biochemical responses observed in wheat seedlings treated with LPS were inhibited by the addition of procyanidin B2 (5 μg mL -1 ), a B type proanthocyanidin (PAC), plant-derived polyphenolic compound with binding properties of LPS. All results suggest first that the ionically bound cell wall POX enzymes could be a molecular target of A. brasilense LPS, and second that the recognition or association of LPS by plant cells is required to activate plant responses. This last event could play a critical role during plant growth regulation by A. brasilense LPS.

  7. Evaluation of thermal neutron cross-sections and resonance integrals of protactinium, americium, curium, and berkelium isotopes

    International Nuclear Information System (INIS)

    Belanova, T.S.

    1994-12-01

    Data on the thermal neutron fission and capture cross-sections as well as their corresponding resonance integrals are reviewed and analysed. The data are classified according to the form of neutron spectra under investigation. The weighted mean values of the cross-sections and resonance integrals for every type of neutron spectra were adopted as evaluated data. (author). 87 refs, 2 tabs

  8. Extraction of transplutonium elements from carbonate solutions by alkylpyrocatechol

    International Nuclear Information System (INIS)

    Karalova, Z.K.; Myasoedov, B.F.; Rodionova, L.M.; Kuznetsova, V.S.

    1983-01-01

    Extraction of americium, berkelium as well as Ce, Eu, Th, U, Zr, Cs, Fe with solution of 4(α, α-dioctylethyl)pyrocatechol (DOP) in toluene from carbonate solutions to determine conditions of their separation has been studied. It is established that americium extraction is quite sensitive to the changes of potassium carbonate concentration. The maximum extraction of americium (R >90%) is observed in the case of 0.1-0.5 mol/l of K 2 CO 3 solutions and the minimum one (R=2.5%) - in the case of 8 mol/l K 2 CO 3 . Americium extraction increases sharply when sodium hydroxide is introduced in carbonate solutions. It is shown that varying sodium hydroxide concentration it is possible to achieve qualitative extraction of americium even from saturated solution of potassium carbonate. Reextraction of TPE is easily realized with 3 mol/l HCl solution. The system K 2 CO 3 (KOH)-DOP proved to be perspective for Am separation from Bk, Ce, Cs, actinoid elements as well as from Fe

  9. Pivotal Advance: Eosinophilia in the MES rat strain is caused by a loss-of-function mutation in the gene for cytochrome b(-245), alpha polypeptide (Cyba).

    Science.gov (United States)

    Mori, Masayuki; Li, Guixin; Hashimoto, Maiko; Nishio, Ayako; Tomozawa, Hiroshi; Suzuki, Nobuyoshi; Usami, Shin-ichi; Higuchi, Keiichi; Matsumoto, Kiyoshi

    2009-09-01

    MES is a rat strain that spontaneously develops severe blood eosinophilia as a hereditary trait. Herein, we report that eosinophilia in MES rats is caused by a loss-of-function mutation in the gene for cytochrome b(-245), alpha polypeptide (Cyba; also known as p22(phox)), which is an essential component of the superoxide-generating NADPH oxidase complex. The MES rat has a deletion of four nucleotides, including the 5' splice donor GpT of intron 4 of the Cyba gene. As a consequence of the deletion, a 51-nucleotide sequence of intron 4 is incorporated into the Cyba transcripts. Leukocytes from the MES strain lack both CYBA protein and NADPH oxidase activity. Nevertheless, unlike patients with chronic granulomatous disease, who suffer from infections with pathogens due to similar genetic defects in NADPH oxidase, MES rats retain normal innate immune defense against Staphylococcus aureus infection. This is due to large quantities of peritoneal eosinophils in MES rats, which phagocytose and kill the bacteria. MES rat has a balance defect due to impaired formation of otoconia in the utricles and saccules. Eosinophilia of the MES rat was normalized by introduction of a normal Cyba transgene. The mechanisms by which impairment of NADPH oxidase leads to eosinophilia in the MES rat are elusive. However, our study highlights the essential role of NADPH oxidase in homeostatic regulation of innate immunity beyond conventional microbicidial functions.

  10. Probing photochromic properties by correlation of UV-visible and infra-red absorption spectroscopy: a case study with cis-1,2-dicyano-1,2-bis(2,4,5-trimethyl-3-thienyl)ethene.

    Science.gov (United States)

    Spangenberg, Arnaud; Piedras Perez, Jose Alejandro; Patra, Abhijit; Piard, Jonathan; Brosseau, Arnaud; Métivier, Rémi; Nakatani, Keitaro

    2010-02-01

    Quantification of the relative composition of the isomers in a photochromic system at any irradiation time interval is a critical issue in determining absolute quantum yields. For this purpose, we have developed a simple and convenient protocol involving combination of UV-visible and infra-red absorption spectroscopy. Photochromic cyclization reaction of cis-l,2-dicyano-l,2-bis(2,4,5-trimethyl-3-thieny1)ethene (CMTE) is analyzed to demonstrate the efficiency of the proposed methodology. This approach is based on the fact that the two isomers show distinctive infra-red bands. Detailed investigations of the UV-visible and infra-red spectra of the mixture obtained at different irradiation times in CCl(4) supported by quantum chemical computations lead to the unambiguous estimation of molar absorption coefficients of the closed isomer (epsilon(CF) = 4650 L mol(-1) cm(-1) at 512 nm). It facilitates the first determination of absolute quantum yields of this reversible photochromic reaction in CCl(4) by fitting the UV-visible spectral data (Phi(OF-->CF) = 0.41 +/- 0.05 and Phi(CF-->OF) = 0.12 +/- 0.02 at 405 nm and 546 nm, respectively).

  11. Synthesis of 14C-labelled polychlorobiphenyls derived from the labelled 4-chloro-, 2,5-dichloro-, 3,4-dichloro-, 2,3-dichloro-2,4,5-trichloro- and 2,3,6-trichloroanilines

    International Nuclear Information System (INIS)

    Bergman, A.; Bamford, I.; Wachtmeister, C.A.

    1981-01-01

    [ 14 C]Aniline hydrogen sulphate was acetylated, and the acetanilide obtained was chlorinated with N-chlorosuccinimide to 2-chloro, 4-chloro- and 2,4-dichloroacet[ 14 C]anilide. The labelled 2- and 4-chloroacet[ 14 C]anilides were hydrolyzed and treated with aluminium chloride, hydrogen chloride and chlorine in dry dichloromethane to give the major products 2,5-dichloro-and 3,4-dichloro[ 14 C]aniline. The labelled 2,3-dichloro- and 2,3,6-trichloroanilines were obtained as minor products from the chlorination of 2-chloro[ 14 C]aniline, likewise 2,4,5-trichloroaniline was obtained from 4-chloro[ 14 C]aniline. The [ 14 C]anilines prepared were coupled with benzene, 1,4-dichloro-, 1,2-dichloro- or 1,3-dichlorobenzene to give 4-chloro-, 2,3',4',5-tetrachloro-, 2,3,3',4'-tetrachloro-, 3,3',4,4'-tetrachloro-, 2,2',5,5'-tetrachloro-, 2,2',3,3'-tetrachloro-, 2,2',3,5',6-pentachloro-, 2,2',4,4',5-pentachloro- and 2,3',4,5,5'-pentachloro[ 14 C]biphenyl. 3,4-Dichloro[ 14 C]aniline and biphenyls prepared from this aniline were found to be contaminated by bromoanalogues. The origin of these have been studied. (author)

  12. 48 CFR 245.601 - Definitions.

    Science.gov (United States)

    2010-10-01

    ... further military or lethal use. (3) Production scrap means material left over from the normal production process that has only remelting or reprocessing value, e.g., textile and metal clippings, borings, and...

  13. 32 CFR 245.5 - Terms.

    Science.gov (United States)

    2010-07-01

    ... defense sector. A geographical subdivision of an air defense region. Air traffic control system command... ESCAT has been implemented. National Airspace System (NAS). The NAS consists of the overall environment.... Security control authorization (SCA). Authorization for an EATPL category eight aircraft to take off when...

  14. 8 CFR 245.1 - Eligibility.

    Science.gov (United States)

    2010-01-01

    ...) Documentation showing commingling of financial resources; (D) Birth certificates of children born to the... individual has no control, if the inaction is acknowledged by that individual or organization (as, for example, where a designated school official certified under § 214.2(f) of this chapter or an exchange...

  15. Monoxenic liquid culture with Escherichia coli of the free-living nematode Panagrolaimus sp. (strain NFS 24-5), a potential live food candidate for marine fish and shrimp larvae.

    Science.gov (United States)

    Ayub, Farhana; Seychelles, Laurent; Strauch, Olaf; Wittke, Martina; Ehlers, Ralf-Udo

    2013-09-01

    The free-living, bacterial-feeding nematode Panagrolaimus sp. (strain NFS 24-5) has potential for use as live food for marine shrimp and fish larvae. Mass production in liquid culture is a prerequisite for its commercial exploitation. Panagrolaimus sp. was propagated in monoxenic liquid culture on Escherichia coli and parameters, like nematode density, population dynamics and biomass were recorded and compared with life history table data. A mean maximum nematode density of 174,278 mL(-1) and a maximum of 251,000 mL(-1) were recorded on day 17 after inoculation. Highest average biomass was 40 g L(-1) at day 13. The comparison with life history table data indicated that the hypothetical potential of liquid culture is much higher than documented during this investigation. Nematode development is delayed in liquid culture and egg production per female is more than five times lower than reported from life history trait analysis. The latter assessed a nematode generation time of 7.1 days, whereas the process time at maximum nematode density in liquid culture was 16 days indicating that a reduction of the process time can be achieved by further investigating the influence of nematode inoculum density on population development. The results challenge future research to reduce process time and variability and improve population dynamics also during scale-up of the liquid culture process.

  16. Management of nuclear materials in an R ampersand D environment at the Los Alamos National Laboratory

    International Nuclear Information System (INIS)

    Behrens, R.G.; Roth, S.B.; Jones, S.R.

    1991-01-01

    Los Alamos National Laboratory is a multidisciplinary R ampersand D organization and, as such, its nuclear materials inventory is diverse. Accordingly, major inventories of isotopes such as Pu-238, Pu-239, Pu-242, U-235, Th, tritium, and deuterium, and lesser amounts of isotopes of Am, Cm, Np and exotic isotopes such as berkelium must be managed in accordance with Department of Energy Orders and Laboratory policies. Los Alamos also acts as a national resource for many one-of-a-kind materials which are supplied to universities, industry, and other government agencies within the US and throughout the world. Management of these materials requires effective interaction and communication with many nuclear materials custodians residing in over forty technical groups as well as effective interaction with numerous outside organizations. This paper discusses the role, philosophy, and organizational structure of Nuclear Materials Management at Los Alamos and also briefly presents results of two special nuclear materials management projects: 1- Revision of Item Description Codes for use in the Los Alamos nuclear material data base and 2- The recommendation of new economic discard limits for Pu-239. 2 refs., 1 fig

  17. Application of biochemical fingerprinting and fatty acid methyl ester profiling to assess the effect of the pesticide Atradex on aquatic microbial communities

    International Nuclear Information System (INIS)

    Littlefield-Wyer, J.G.; Brooks, P.; Katouli, M.

    2008-01-01

    We investigated changes in biomass, biochemical fingerprints, fatty acid methyl ester (FAME) profile and functional status of the natural aquatic microbial communities upon impact of an Atradex pulse. The Atradex was applied to microcosm tanks at concentrations ranging from 24.5 μg L -1 to 245 mg L -1 . The biomass of all microbial communities declined to a minimum level on day 4 with the effect being more pronounced in treated groups. Similarity between microbial communities also decreased on day 4 with the greatest change occurring at a concentration of 245 mg L -1 Atradex. After 8 days exposure to Atradex, microbial communities in all treated groups (except tanks spiked with 245 mg L -1 Atradex) recovered and showed similar metabolic fingerprints and FAME profiles to those of controls. Our results indicate that exposure to an Atradex pulse at concentration above 245 mg L -1 , may irreversibly change the structure and functional status of aquatic microbial communities. - Atradex at concentration above 245 mg L -1 may irreversibly change the structure and functional status of aquatic microbial communities

  18. 78 FR 76074 - Department of State Acquisition Regulation

    Science.gov (United States)

    2013-12-16

    ... DOSAR Sec. Sec. 652.245-70(a)(3) and 652.245-71, on the theory that Part 45 governs the management and... expectancy to exceed two years. (b) The contracting officer shall insert the clause at 652.245-71, Special... property when put into use; and is of a durable nature with an estimated useful life expectancy to exceed...

  19. Stable Isotope Geochemistry of Extremely Well-Preserved 2.45-Billion-Year-Old Hydrothermal Systems in the Vetreny Belt, Baltic Shield: Insights into Paleohydrosphere

    Science.gov (United States)

    Zakharov, D. O.; Bindeman, I. N.

    2015-12-01

    The early Paleoproterozoic was an eventful period in the Earth's history. The first portions of free oxygen emerged in the atmosphere, Snowball Earth glaciations happened several times and the first supercontinent broke up due to extensive rifting. These events should have affected the stable isotopic composition of the hydrosphere. In this study, we use rocks that were altered in underwater hydrothermal systems to investigate the stable isotopic composition of the hydrosphere 2.39-2.45 billion years ago (hereinafter, Ga). Extremely low-δ18O (down to -27.5‰ SMOW) rocks from 2.39 Ga metamorphosed subglacial hydrothermal systems of the Belomorian belt, Baltic Shield formed at near-equatorial latitudes suggesting a Snowball (or Slushball) Earth glaciation. These results motivated us to look at temporally and geographically close hydrothermal systems from the unmetamorhposed 2.45 Ga Vetreny Belt rift. The length of the rift is 250 km and it is composed of high-Mg basalts, mafic-ultramafic intrusions and sedimentary successions. We examined several localities of high-Mg basalt flows that include astonishingly fresh pillow lavas, often with preserved volcanic glass, eruptive breccias, and hydrothermal alteration zones. Collected samples serve a great textural evidence of water-rock interaction that occurred in situ while basalts were cooling. The preliminary results from coexisting quartz and epidote (T, D18O=311°C), and from coexisting calcite and quartz (T, D18O=190°C) yield values of δ18O of involved water between -1.6 and -0.9 ‰. The values of δ13C in calcites vary between -4.0 and -2.3 ‰. It is likely that hydrothermal fluids operated in the Vetreny Belt rift were derived from seawater that is no different from modern oceanic water in terms of δ18O. Apparently, the rift was a Paleoproterozoic analog of the modern Red Sea, filled with oceanic water. The result is important because the Vetreny Belt rift predates the onset of Snowball Earth glaciation at 2

  20. 32 CFR 245.12 - Amplifying instructions.

    Science.gov (United States)

    2010-07-01

    ... flights, agricultural and forest fire flights, border patrol flights, and other essential civil air... Defense Sector (NEADS) Boston, Chicago, Cleveland, Minneapolis, New York, Indianapolis, Kansas City...

  1. Reference: 245 [Arabidopsis Phenome Database[Archive

    Lifescience Database Archive (English)

    Full Text Available ve intracellular breakdown whereby cytosol and organelles are encapsulated in vesicles, which are then engul...fed and digested by lytic vacuoles/lysosomes. In yeast, this encapsulation employ

  2. 46 CFR 172.245 - Survival conditions.

    Science.gov (United States)

    2010-10-01

    ... seals to cargo hopper gates; or (ii) Guillotine doors in bulkheads in way of the conveyor belt. ... inches (50 mm) when the vessel is in the equilibrium position. (e) Progressive flooding. In the design...

  3. Publications | Page 245 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    The network evolves. For the 19 young scholars brought together by the Poverty Research Network, the... Information for Change 2011: Digital Publishing in West Africa. Wednesday, 11 May 2011, saw the fifth Information for Change workshop, held in Lagos as part of the 10th Nigeria International Book Fair. The range of.

  4. 48 CFR 245.7308 - Antitrust notification.

    Science.gov (United States)

    2010-10-01

    ... action would tend to create or maintain a situation inconsistent with the antitrust laws. (c) If the Attorney General advises that the proposed disposition is inconsistent with the antitrust laws, do not... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Antitrust notification...

  5. 24 CFR 245.115 - Protected activities.

    Science.gov (United States)

    2010-04-01

    ... operation of a tenant organization: (1) Distributing leaflets in lobby areas; (2) Placing leaflets at or... management representatives. In order to preserve the independence of tenant organizations, management... discuss a specific issue or issues; and (9) Formulating responses to owner's requests for: (i) Rent...

  6. 20 CFR 627.245 - Work experience.

    Science.gov (United States)

    2010-04-01

    ...) Definition. Work experience means a short-term or part-time training assignment with a public or private... requirements. It is prohibited in the private for-profit sector. (b) Suitability. Work experience should be...

  7. To eat or not to eat? Indicators for reduced food intake in 91,245 patients hospitalized on nutritionDays 2006-2014 in 56 countries worldwide: a descriptive analysis.

    Science.gov (United States)

    Schindler, Karin; Themessl-Huber, Michael; Hiesmayr, Michael; Kosak, Sigrid; Lainscak, Mitja; Laviano, Alessandro; Ljungqvist, Olle; Mouhieddine, Mohamed; Schneider, Stéphane; de van der Schueren, Marian; Schütz, Tatjana; Schuh, Christian; Singer, Pierre; Bauer, Peter; Pichard, Claude

    2016-11-01

    Inadequate nutrition during hospitalization is strongly associated with poor patient outcome, but ensuring adequate food intake is not a priority in clinical routine worldwide. This lack of priority results in inadequate and unbalanced food intake in patients and huge amounts of wasted food. We evaluate the main factors that are associated with reduced meal intake in hospitalized patients and the differences between geographical regions. We conducted a descriptive analysis of data from 9 consecutive, annual, and cross-sectional nutritionDay samples (2006-2014) in a total of 91,245 adult patients in 6668 wards in 2584 hospitals in 56 countries. A general estimation equation methodology was used to develop a model for meal intake, and P-value thresholding was used for model selection. The proportion of patients who ate a full meal varied widely (24.7-61.5%) across world regions. The factors that were most strongly associated with reduced food intake on nutritionDay were reduced intake during the previous week (OR: 0.20; 95% CI: 0.17, 0.22), confinement to bed (OR: 0.49; 95% CI: 0.44, 0.55), female sex (OR: 0.53; 95% CI: 0.5, 0.56), younger age (OR: 0.74; 95% CI: 0.64, 0.85) and older age (OR: 0.80; 95% CI: 0.74; 0.88), and low body mass index (OR: 0.84; 95% CI: 0.79, 0.90). The pattern of associated factors was homogenous across world regions. A set of factors that are associated with full meal intake was identified and is applicable to patients hospitalized in any region of the world. Thus, the likelihood for reduced food intake is easily estimated through access to patient characteristics, independent of world regions, and enables the easy personalization of food provision. This trial was registered at clinicaltrials.gov as NCT02820246. © 2016 American Society for Nutrition.

  8. The creation of new nuclei

    International Nuclear Information System (INIS)

    Armbruster, P.; Hessberger, F.P.

    1998-01-01

    In the last 60 years physicists have created 20 artificial elements beyond uranium. In 1934 Enrico Fermi predicted the creation of new elements by bombarding atoms with neutrons. This method led to the discovery of neptunium (Z=93), plutonium, americium, curium, berkelium, californium, einsteinium and fermium (Z=100). In fact the capture of a neutron is followed by a beta-decay which increases the atomic number (Z) by one unit. Beyond Z=100 beta-decay no more occurs so a new approach was necessary. Between the American Lawrence Berkeley Laboratory and the Russian Dubna Institute a fierce competition broke out to produce new elements by bombarding transuranium nuclei with light elements such as helium, carbon, nitrogen. This new method required heavy equipment: ion accelerator and detectors but led to the creation of all the elements from Z=101 to Z=106. A new idea was to provoke the fusion of heavy nuclei such as lead and bismuth with colliding argon, nickel or zinc ion beams. This method called 'cold fusion' opened the way to reach the nuclei beyond Z=107. In 1996 the element Z=112 was the last discovered. The next step could be the element Z=114 for which a particular stability is expected. (A.C.)

  9. Characterization of a Viking Blade Fabricated by Traditional Forging Techniques

    Science.gov (United States)

    Vo, H.; Frazer, D.; Bailey, N.; Traylor, R.; Austin, J.; Pringle, J.; Bickel, J.; Connick, R.; Connick, W.; Hosemann, P.

    2016-12-01

    A team of students from the University of California, Berkeley, participated in a blade-smithing competition hosted by the Minerals, Metals, and Materials Society at the TMS 2015 144th annual meeting and exhibition. Motivated by ancient forging methods, the UC Berkeley team chose to fabricate our blade from historical smithing techniques utilizing naturally-occurring deposits of iron ore. This approach resulted in receiving the "Best Example of a Traditional Blade Process/Ore Smelting Technique" award for our blade named "Berkelium." First, iron-enriched sand was collected from local beaches. Magnetite (Fe3O4) was then extracted from the sand and smelted into individual high- and low-carbon steel ingots. Layers of high- and low-carbon steels were forge-welded together, predominantly by hand, to form a composite material. Optical microscopy, energy dispersive spectroscopy, and Vickers hardness mechanical testing were conducted at different stages throughout the blade-making process to evaluate the microstructure and hardness evolution during formation. It was found that the pre-heat-treated blade microstructure was composed of ferrite and pearlite, and contained many nonmetallic inclusions. A final heat treatment was performed, which caused the average hardness of the blade edge to increase by more than a factor of two, indicating a martensitic transformation.

  10. Fluorescence and excitation spectra of Bk3+, Cf3+, and Es3+ ions in single crystals of LaCl3

    International Nuclear Information System (INIS)

    Hessler, J.P.; Caird, J.A.; Carnall, W.T.; Crosswhite, H.M.; Sjoblom, R.K.; Wagner, F. Jr.

    1978-01-01

    Dye laser techniques have been used to study the energy level structure of the heavier actinides in single crystals of lanthanum chloride. In the case of einsteinium, fluorescence was detected and measured from the following manifolds: J = 5 at 0.984 μm -1 , J = 4 at 1.572 μm -1 , J = 6 at 2.930 μm -1 . This fluorescence was observed to the five lowest manifolds: J = 8, 5, 7, 2, 6. For californium, fluorescence has been detected from the manifolds: J = 11/2 at 1.190 μm -1 , J = 7/2 at 1.389 μm -1 , J = 5/2 at 1.977 μm -1 . This fluorescence was observed to the three lowest manifolds: J = 15/2, 9/2, 11/2. The fluorescence manifolds of berkelium are J = 6 at 1.540 μm -1 , and J = 4 at 1.953 μm -1 . The three lowest manifolds, J = 6, 5, and 4, have been observed in fluorescence. Absorption spectra data have yielded crystal-field splitting measurements in the higher manifolds of Es + . The location of the manifolds in general confirmed earlier approximate free-ion level structure calculations based on assumed regularities in the energy level parameters derived from spectra of the actinide ions through Cf + . 2 figures

  11. Oxidation-reduction properties of americium, curium, berkelium, californium, einsteinium and fermium, and thermodynamic consequences for the 5f series

    International Nuclear Information System (INIS)

    Samhoun, K.

    1976-01-01

    The amalgamation of 5f elements from Am to Fm has been studied by using 241 Am, 244 Cm, 249 Bk, 249 Cf, 252 Cf, 253 Es, 254 Es, 252 Fm and 255 Fm with two electrochemical methods, radiocoulometry and radiopolarography, perfectly adapted to investigate extremely diluted solutions when the concentration of electroactive species is as low as 10 -16 M. The theory of radiocoulometry has been developed in the general cases of reversible and irreversible electrode process. It has been used to interpret the experimental data on the kinetic curves of amalgamation, and to estimate the standard rate constant of the electrode process in complexing medium (citric). On the other hand the radiopolarographic method has been applied to study the mechanism of reduction at the dropping mercury electrode of cations M 3+ in aqueous medium to the metal M with formation of amalgam. The results are exploited into two directions: 1- Acquisition of some data concerning the oxidation-reduction properties of elements from Am to Fm. Therefore the standard electrode E 0 [M(III-0)] potentials for Bk, Cf and Es, and the standard electrode E 0 [M(II-0)] potential for Fm are estimated and the relative stability of each oxidation state (from II to VII) of 5f elements is discussed; 2- Acquisition of unknown thermodynamic data on transcalifornium elements. Correlations between 4f and 5f elements are precised and some divergences appear for the second half of 4f and 5f series (i.e. for 65 [fr

  12. Experimental investigation of moderately high temperature water source heat pump with non-azeotropic refrigerant mixtures

    Energy Technology Data Exchange (ETDEWEB)

    Zhang, Shengjun; Wang, Huaixin; Guo, Tao [Department of Thermal Energy and Refrigeration Engineering, School of Mechanical Engineering, Tianjin University, Tianjin 300072 (China)

    2010-05-15

    Experimental investigations were carried out on non-azeotropic refrigerant mixtures, named M1A (mass fraction of 20%R152a and 80%R245fa), M1B (mass fraction of 37% R152a and 63%R245fa) and M1C (mass fraction of 50%R152a and 50%R245fa), based on a water-to-water heat pump system in the condensing temperature range of 70-90 C with a cycle temperature lift of 45 C. Performance of R245fa was tested for comparison. Unfair factors in experimental comparative evaluation research with the same apparatus were identified and corrected. Experimental cycle performance of the mixtures were tested and compared with improved experimental assessment methodology. The results show that all of the mixtures deliver higher discharge temperature, higher heating capacity, higher COP and higher {epsilon}{sub h,c} than R245fa. M1B presents the most excellent cycle performance and is recommended as working fluid for moderate/high temperature heat pump. (author)

  13. 1-Methyl-2-[(E-2,4,5-trimethoxystyryl]pyridinium iodideThis paper is dedicated to the late His Majesty King Chulalongkorn (King Rama V of Thailand for his numerous reforms to modernize the country on the occasion of Chulalongkorn Day (Piyamaharaj Day which fell on the 23rd October.

    Directory of Open Access Journals (Sweden)

    Hoong-Kun Fun

    2010-12-01

    Full Text Available In the title compound, C17H20NO3+·I−, the cation exists in the E configuration. The pyridinium and benzene rings are close to coplanar, with a dihedral angle of 7.43 (12° between them. The three methoxy groups of 2,4,5-trimethoxyphenyl are essentially coplanar with the benzene plane, with C—O—C—C torsion angles of 1.0 (3, −1.9 (3 and 3.6 (3°. A weak intramolecular C—H...O interaction generates an S(6 ring motif. In the crystal, the cations are stacked in columns in an antiparallel manner along the a axis through π–π interactions, with a centroid–centroid distance of 3.7714 (16 Å. The iodide anion is situated between the columns and linked to the cation by a weak C—H...I interaction.

  14. OSSOS. IV. Discovery of a Dwarf Planet Candidate in the 9:2 Resonance with Neptune

    Science.gov (United States)

    Bannister, Michele T.; Alexandersen, Mike; Benecchi, Susan; Chen, Ying-Tung; Delsanti, Audrey; Fraser, Wesley C.; Gladman, Brett; Granvik, Mikael; Grundy, Will M.; Guilbert-Lepoutre, Aurelie; hide

    2016-01-01

    We report the discovery and orbit of a new dwarf planet candidate, 2015 RR245, by the Outer Solar System Origins Survey (OSSOS). The orbit of 2015 RR245 is eccentric (e 0.586), with a semimajor axis near 82 au, yielding a perihelion distance of 34 au. 2015 RR245 has g - r 0.59 +/- 0.11 and absolute magnitude Hr 3.6 +/- 0.1; for an assumed albedo of pV 12, the object has a diameter of approximately 670 km. Based on astrometric measurements from OSSOS and Pan-STARRS1, we find that 2015 RR245 is securely trapped on ten-megayear timescales in the 9:2 mean-motion resonance with Neptune. It is the first trans-Neptunian object (TNO) identied in this resonance. On hundred-megayear timescales, particles in 2015 RR245-like orbits depart and sometimes return to the resonance, indicating that 2015 RR245 likely forms part of the long-lived metastable population of distant TNOs that drift between resonance sticking and actively scattering via gravitational encounters with Neptune. The discovery of a 9:2 TNO stresses the role of resonances in the long-term evolution of objects in the scattering disk and reinforces the view that distant resonances are heavily populated in the current solar system. This object further motivates detailed modeling of the transient sticking population.

  15. Interspecific cooperation: enhanced growth, attachment and strain-specific distribution in biofilms through Azospirillum brasilense-Pseudomonas protegens co-cultivation.

    Science.gov (United States)

    Pagnussat, Luciana A; Salcedo, Florencia; Maroniche, Guillermo; Keel, Christoph; Valverde, Claudio; Creus, Cecilia M

    2016-10-01

    Plant-growth-promoting bacteria belonging to Azospirillum and Pseudomonas genera are major inhabitants of the rhizosphere. Both are increasingly commercialized as crops inoculants. Interspecific interaction in the rhizosphere is critical for inoculants aptness. The objective of this work was to evaluate Azospirillum and Pseudomonas interaction in mixed biofilms by co-cultivation of the model strains Azospirillum brasilense Sp245 and Pseudomonas protegens CHA0. The results revealed enhanced growth of both strains when co-cultured in static conditions. Moreover, Sp245 biofilm formed in plastic surfaces was increased 2-fold in the presence of CHA0. Confocal microscopy revealed highly structured mixed biofilms showing Sp245 mainly on the bottom and CHA0 towards the biofilm surface. In addition, A. brasilense biofilm was thicker and denser when co-cultured with P. protegens. In a colony-colony interaction assay, Sp245 changed nearby CHA0 producing small colony phenotype, which accounts for a diffusible metabolite mediator; though CHA0 spent medium did not affect Sp245 colony phenotype. Altogether, these results point to a cooperative interaction between A. brasilense Sp245 and P. protegens CHA0 in which both strains increase their static growth and produce structured mixed biofilms with a strain-specific distribution. © FEMS 2016. All rights reserved. For permissions, please e-mail: journals.permissions@oup.com.

  16. Researching Identity and Interculturality

    DEFF Research Database (Denmark)

    Lønsmann, Dorte

    2016-01-01

    Review of: Researching Identity and Interculturality / by F. Dervin and K. Risager (eds.). Routledge 2015, 245 pp.......Review of: Researching Identity and Interculturality / by F. Dervin and K. Risager (eds.). Routledge 2015, 245 pp....

  17. The Impact of Proposed Radio Frequency Radiation Standards on Military Operations.

    Science.gov (United States)

    1985-03-01

    ocular imperfections are very prevalent in the population at large and often encountered during routine ophthalmological examinations. ".’. Detailed...females (FM) at audio) No significant germ-cell nmtagenesls In Rat 2.45 (CW) 50 4.7-0.9 106 X 240 75 weekly breedings No significant germ-cell...mutagenesls in Rat 2.45 (CU) 100 2 5 X 300 7S ". . weekly breedings , * SAM, except decrease in pregnancies, Rat 2.45 (CW) 280 5.6 20 X 240 7i s.U , Indilcating

  18. Somatic embryogenesis in Malaysian cultivars of sweet potato (Ipomoea batatas L.).

    OpenAIRE

    De Silva, Angela Ee

    2017-01-01

    Three Malaysian sweet potato cultivars, namely Ipomoea batatas (L.) cv. Gendut, Jalomas and Telong, were investigated for their abilities to produce somatic embryos. Shoot meristems were used as the starting materials and cultured on Murashige and Skoog basal media (Murashige and Skoog, 1962) in the presence of auxin 2,4-dichlorophenoxyacetic acid (2,4-D) or 2,4,5-trichlorophenoxyacetic acid (2,4,5-T). Auxin 2,4,5-T at 5 µM was most effective for the initiation of primary embryogenic formati...

  19. 75 FR 43611 - U S Rail Corporation-Construction and Operation Exemption-Brookhaven Rail Terminal

    Science.gov (United States)

    2010-07-26

    ... postmarked no later than August 10, 2010 to: Troy Brady, Environmental Protection Specialist, Surface... Troy Brady by phone at (202) 245-0301, by fax at (202) 245-0454, or by e-mail at troy[email protected

  20. Slow Food: por um alimento bom, limpo e justo

    OpenAIRE

    Porazzi, Fabiele

    2012-01-01

    REVIEW:PETRINI, Carlo. Slow Food: princípios da nova gastronomia. Trad. de Renata Lúcia Botina. São Paulo: Editora Senac, 2009. 245 p. RESEÑA:PETRINI, Carlo. Slow Food: princípios da nova gastronomia. Trad. de Renata Lúcia Botina. São Paulo: Editora Senac, 2009. 245 p. http://dx.doi.org/10.5007/1807-1384.2012v9n1p384 RESENHA:PETRINI, Carlo. Slow Food: princípios da nova gastronomia. Trad. de Renata Lúcia Botina. São Paulo: Editora Senac, 2009. 245 p.

  1. Browse Title Index

    African Journals Online (AJOL)

    Items 201 - 245 of 245 ... Vol 1, No 1 (2002), Systemic conditions among dental patients in Benin City, Nigeria ... in Benin City: a study of surgical treatment of 50 patients, Abstract ... Univentricular Heart in Two Nigerian Adolescents, Abstract PDF.

  2. Errata to: Characteristics of humic acid fluvic acids in Arabian Sea sediments

    Digital Repository Service at National Institute of Oceanography (India)

    Sardessai, S.

    stream_size 1 stream_content_type text/plain stream_name Indian_J_Mar_Sci_24_245.pdf.txt stream_source_info Indian_J_Mar_Sci_24_245.pdf.txt Content-Encoding ISO-8859-1 Content-Type text/plain; charset=ISO-8859-1 ...

  3. 75 FR 2555 - Homeland Security Science and Technology Advisory Committee

    Science.gov (United States)

    2010-01-15

    ... Technology Advisory Committee will meet January 26-28, 2010, at the Department of Homeland Security, 1120..., Science and Technology Directorate, Department of Homeland Security, 245 Murray Lane, Bldg. 410... Burse, Science and Technology Directorate, Department of Homeland Security, 245 Murray Lane, Bldg. 410...

  4. 48 CFR 245.7310-5 - Controlled substances.

    Science.gov (United States)

    2010-10-01

    ... (Bureau of Narcotics and Dangerous Drugs) to buy controlled substances as a medical practitioner, dealer... hallucinogenic drugs, shall be subject to the following special conditions: (a) Controlled Substances. Bids will... represents and warrants that it is registered under The Comprehensive Drug Abuse Prevention and Control Act...

  5. 245 HUMANISM AND THE LAW: TOWARDS AFRICAN ...

    African Journals Online (AJOL)

    Ike Odimegwu

    economic, political, cultural, religious, technological, scientific, and ... others ethical and political. Goicoechea .... Sartre of ethical relativism based on the latter's thesis that “we ..... proves to be a permanent thorn in the flesh of this theory. Yet.

  6. 7 CFR 245.6a - Verification requirements.

    Science.gov (United States)

    2010-01-01

    ... by FNS, FNS may substitute alternatives for the sample size and sample selection criteria in... Agriculture Regulations of the Department of Agriculture (Continued) FOOD AND NUTRITION SERVICE, DEPARTMENT OF... lieu of income information and that may be used for direct verification purposes: (i) The Food Stamp...

  7. 24 CFR 245.10 - Applicability of part.

    Science.gov (United States)

    2010-04-01

    ... program or the Section 202 Supportive Housing for the Elderly program; or (7) The project receives.... Section 221(d)(3) BMIR Program means the below-market interest rate mortgage insurance program under...

  8. 48 CFR 1552.245-70 - Government property.

    Science.gov (United States)

    2010-10-01

    ... contractor may maintain the record as a system noting all components of the system under the main component... all components of the system under the main component or maintain individual records for each item... Government. f. Lease versus purchase analysis shall be furnished with the request to acquire property on...

  9. 48 CFR 52.245-1 - Government Property.

    Science.gov (United States)

    2010-10-01

    ... tangible capital asset including the purchase price of the asset and costs necessary to prepare the asset... disclose and report to the Property Administrator the need for replacement and/or capital rehabilitation... be submitted for all aircraft regardless of condition, flight safety critical aircraft parts, and...

  10. 48 CFR 245.7303 - Formal bid procedures.

    Science.gov (United States)

    2010-10-01

    ... descriptions attached. (d) In addition to mailing or delivering notice of the proposed sale to prospective... type of sale, i.e., sealed bid, spot bid, auction; and (G) The location of the property. (f) The plant..., signed by the witnessing Government representative. ...

  11. 24 CFR 245.405 - Applicability of subpart.

    Science.gov (United States)

    2010-04-01

    ...) Conversion of a project from project-paid utilities to tenant-paid utilities, or a reduction in tenant utility allowances. (b) Conversion of residential units in a multifamily housing project to a... corporation or association. Conversion of a project to a cooperative or of a portion of a project to...

  12. 42 CFR 403.245 - Loss of certification.

    Science.gov (United States)

    2010-10-01

    ... fact. (c) If a policy that displays the emblem, or that has been marketed as a certified policy without the emblem, loses certification, the insuring organization must notify each holder of the policy, or...

  13. 77 FR 32655 - DHS Data Privacy and Integrity Advisory Committee

    Science.gov (United States)

    2012-06-01

    ... Officer, Data Privacy and Integrity Advisory Committee, Department of Homeland Security, 245 Murray Lane..., DHS Data Privacy and Integrity Advisory Committee, Department of Homeland Security, 245 Murray Lane SW... DEPARTMENT OF HOMELAND SECURITY Office of the Secretary [Docket No. DHS-2012-0029] DHS Data...

  14. Photo-triggered solvent-free metamorphosis of polymeric materials.

    Science.gov (United States)

    Honda, Satoshi; Toyota, Taro

    2017-09-11

    Liquefaction and solidification of materials are the most fundamental changes observed during thermal phase transitions, yet the design of organic and polymeric soft materials showing isothermal reversible liquid-nonliquid conversion remains challenging. Here, we demonstrate that solvent-free repeatable molecular architectural transformation between liquid-star and nonliquid-network polymers that relies on cleavage and reformation of a covalent bond in hexaarylbiimidazole. Liquid four-armed star-shaped poly(n-butyl acrylate) and poly(dimethyl siloxane) with 2,4,5-triphenylimidazole end groups were first synthesized. Subsequent oxidation of the 2,4,5-triphenylimidazoles into 2,4,5-triphenylimidazoryl radicals and their coupling with these liquid star polymers to form hexaarylbiimidazoles afforded the corresponding nonliquid network polymers. The resulting nonliquid network polymers liquefied upon UV irradiation and produced liquid star-shaped polymers with 2,4,5-triphenylimidazoryl radical end groups that reverted to nonliquid network polymers again by recoupling of the generated 2,4,5-triphenylimidazoryl radicals immediately after terminating UV irradiation.The design of organic and polymeric soft materials showing isothermal reversible liquid-nonliquid conversion is challenging. Here, the authors show solvent-free repeatable molecular architectural transformation between liquid-star and non-liquid-network polymers by the cleavage and reformation of covalent bonds in the polymer chain.

  15. 75 FR 75444 - Defense Federal Acquisition Regulation Supplement; Government Property (DFARS Case 2009-D008)

    Science.gov (United States)

    2010-12-03

    ... clauses. (a) Use the clause at 252.245-7000, Government-Furnished Mapping, Charting, and Geodesy Property, in solicitations and contracts when mapping, charting, and geodesy property is to be furnished. (b... Government-Furnished Mapping, Charting, and Geodesy Property. As prescribed in 245.107(a), use the following...

  16. Resonance – Journal of Science Education | Indian Academy of ...

    Indian Academy of Sciences (India)

    Homi Bhabha Centre for Science Education: Admission to PhD Programme in Science Education - 2018 · More Details Abstract Fulltext PDF. pp 244-244 Information and Announcements. Physics Training and Talent Search · More Details Abstract Fulltext PDF. pp 245-245 Flowering Trees. Gymnosporia montana Benth.

  17. The Transplutonium. The superheavy nuclei found in the micas of Madagascar and their interests

    International Nuclear Information System (INIS)

    Raoelina Andriambololona

    1976-01-01

    Since June 1976, evidence for the existence of superheavy elements is discussed about. After having recalled artificial elements with atomic numbers Z of wich go from Z=95 (Americium) to Z=107 (built in 1976), superheavy elements having Z greater than 110 are considered. They have been discovered by american searchers in giant halos seen in Madagascar micas. The samples have been recoked in the Fort-Dauphin region (Haut Mandrare). The corresponding numbers Z are 114, 115, 116, 124, 125, 125, 126, 127. It seems that the existence of Z=126 element should be accepted with a greater degree of confidence. But different experiences done by other groups seem to show the evidence of superheavy elements in micas looks weaker. Nevertheless, it is interesting to investigate the evidence or the non-evidence of those elements. We estimate the mass numbers A of those superheavy elements in the liquid drop model if we assume that they are stable versus β. The results thus obtained agree with the shell-model ones within 4 % approximation. We propose if the evidence of superheavies is confirmed to give the name of madagascarium to one of them (Z=126) by similitude with francium, lutetium, polonium, berkelium, americium, europium, ...Their evidence was first conjectured in Madagascar micas in 1976. Superheavy nuclei are to be distinguished from hypernuclei. [fr

  18. Modeling and Re-Engineering of Azotobacter vinelandii Alginate Lyase to Enhance Its Catalytic Efficiency for Accelerating Biofilm Degradation.

    Science.gov (United States)

    Jang, Chul Ho; Piao, Yu Lan; Huang, Xiaoqin; Yoon, Eun Jeong; Park, So Hee; Lee, Kyoung; Zhan, Chang-Guo; Cho, Hoon

    2016-01-01

    Alginate is known to prevent elimination of Pseudomonas aeruginosa biofilms. Alginate lyase (AlgL) might therefore facilitate treatment of Pseudomonas aeruginosa-infected cystic fibrosis patients. However, the catalytic activity of wild-type AlgL is not sufficiently high. Therefore, molecular modeling and site-directed mutagenesis of AlgL might assist in enzyme engineering for therapeutic development. AlgL, isolated from Azotobacter vinelandii, catalyzes depolymerization of alginate via a β-elimination reaction. AlgL was modeled based on the crystal structure template of Sphingomonas AlgL species A1-III. Based on this computational analysis, AlgL was subjected to site-directed mutagenesis to improve its catalytic activity. The kcat/Km of the K194E mutant showed a nearly 5-fold increase against the acetylated alginate substrate, as compared to the wild-type. Double and triple mutants (K194E/K245D, K245D/K319A, K194E/K245D/E312D, and K194E/K245D/K319A) were also prepared. The most potent mutant was observed to be K194E/K245D/K319A, which has a 10-fold improved kcat value (against acetylated alginate) compared to the wild-type enzyme. The antibiofilm effect of both AlgL forms was identified in combination with piperacillin/tazobactam (PT) and the disruption effect was significantly higher in mutant AlgL combined with PT than wild-type AlgL. However, for both the wild-type and K194E/K245D/K319A mutant, the use of the AlgL enzyme alone did not show significant antibiofilm effect.

  19. Modeling and Re-Engineering of Azotobacter vinelandii Alginate Lyase to Enhance Its Catalytic Efficiency for Accelerating Biofilm Degradation.

    Directory of Open Access Journals (Sweden)

    Chul Ho Jang

    Full Text Available Alginate is known to prevent elimination of Pseudomonas aeruginosa biofilms. Alginate lyase (AlgL might therefore facilitate treatment of Pseudomonas aeruginosa-infected cystic fibrosis patients. However, the catalytic activity of wild-type AlgL is not sufficiently high. Therefore, molecular modeling and site-directed mutagenesis of AlgL might assist in enzyme engineering for therapeutic development. AlgL, isolated from Azotobacter vinelandii, catalyzes depolymerization of alginate via a β-elimination reaction. AlgL was modeled based on the crystal structure template of Sphingomonas AlgL species A1-III. Based on this computational analysis, AlgL was subjected to site-directed mutagenesis to improve its catalytic activity. The kcat/Km of the K194E mutant showed a nearly 5-fold increase against the acetylated alginate substrate, as compared to the wild-type. Double and triple mutants (K194E/K245D, K245D/K319A, K194E/K245D/E312D, and K194E/K245D/K319A were also prepared. The most potent mutant was observed to be K194E/K245D/K319A, which has a 10-fold improved kcat value (against acetylated alginate compared to the wild-type enzyme. The antibiofilm effect of both AlgL forms was identified in combination with piperacillin/tazobactam (PT and the disruption effect was significantly higher in mutant AlgL combined with PT than wild-type AlgL. However, for both the wild-type and K194E/K245D/K319A mutant, the use of the AlgL enzyme alone did not show significant antibiofilm effect.

  20. Index-2015

    Indian Academy of Sciences (India)

    IAS Admin

    Schizophrenia (10) 893 (GA). Seagrass (3) 245 (FA). Seaweeds (3) 245 (FA). Secretion (8) 711 (GA). Sheaves (6) 483 (GA). Shrikhande graph (10) 903 (GA). Silencers (4) 320 (GA). Silica cell wall (10) 919 (GA). Simultaneous congruences (3) 206 (GA). Single-molecule spectroscopy (SMS) (2) 151. (GA). Site-directed spin ...

  1. 48 CFR 211.274-6 - Contract clauses.

    Science.gov (United States)

    2010-10-01

    ... Valuation, in solicitations and contracts that— (i) Require item identification or valuation, or both, in... the clause at— (i) FAR 52.245-1, Government Property; or (ii) FAR 52.245-2, Government Property...— (1) Contain the clause at 252.211-7003, Item Identification and Valuation; and (2) Require the...

  2. DIOXINS AND ENDOMETRIOSIS: COHORT STUDY OF WOMEN IN WEST VIRGINIA

    Science.gov (United States)

    Kanawha Valley of West Virginia has a history of 2,3,7,8-tetrachlorodibenzo-p-dioxin contamination (dioxin, TCDD). The bulk of the dioxin found in this area appears to be derived from the production of 2,4,5-trichlorophenoxyacetic acid (2,4,5-T) and the disposal of associated wa...

  3. Reduction of subacute uterine inversion by Haultain's method: A ...

    African Journals Online (AJOL)

    2017-12-08

    Dec 8, 2017 ... and attempted the Huntington manoeuvre [2,4,5] during which the round ligaments are identified and upward traction is applied on them, while a cupped hand in the vagina pushes the inverted uterus upwards. Unfortunately, this attempt was unsuccessful. The. Haultain[2,4,5] procedure was then performed ...

  4. 75 FR 78240 - Notice of Receipt of Several Pesticide Petitions Filed for Residues of Pesticide Chemicals in or...

    Science.gov (United States)

    2010-12-15

    ... soybean field trials. Contact: James M. Stone, (703) 305-7391; e-mail address: stone[email protected] . 5. PP... residues of the herbicide fluazifop-p- butyl, butyl(R)-2-[4-[[5-(trifluoromethyl)-2- pyridinyl]oxy]phenoxy]propanoate, and the free and conjugated forms of the resolved isomer of fluazifop, (R)-2-[4-[[5...

  5. Design and experimental investigation of a 1 kW organic Rankine cycle system using R245fa as working fluid for low-grade waste heat recovery from steam

    International Nuclear Information System (INIS)

    Muhammad, Usman; Imran, Muhammad; Lee, Dong Hyun; Park, Byung Sik

    2015-01-01

    Highlights: • A 1 kW organic Rankine cycle test rig for waste heat recovery was investigated for net electric power output. • Low grade steam (1–3 bar) was used directly in evaporator as heat source. • Effect of superheating of working fluid on system performance was studied. • The maximum electric power output and thermal efficiency is 1016 W and 5.75% respectively. - Abstract: This work presents an experimental investigation of a small scale (1 kW range) organic Rankine cycle system for net electrical power output ability, using low-grade waste heat from steam. The system was designed for waste steam in the range of 1–3 bar. After the organic Rankine cycle system was designed and thermodynamic simulation was performed, equipment selection and construction of test rig was carried out. R245fa was used as working fluid, a scroll type expansion directly coupled with electrical generator produced a maximum electrical power output of 1.016 kW with 0.838 kW of net electrical power output. The thermal efficiency of the system was 5.64%, net efficiency was 4.66% and expander isentropic efficiency was 58.3% at maximum power output operation point. Maximum thermal efficiency was 5.75% and maximum expander isentropic efficiency obtained was 77.74% during the experiment. Effect of superheating of working fluid at expander inlet was also investigated which show that an increase in the degree of superheating by 1 °C reduces thermal efficiency of system by 0.021% for current system. The results indicated that the measured electric power output and enthalpy determined power output (after accounting for isentropic efficiency) differed by 40%. Similarly, the screw pump converted 42.25% of electric power to the enthalpy determined pumping power delivered to the working fluid. Both expander and screw pump were losing power in electric and mechanical losses (generator/motor) presenting a need of further development of these components for better efficiency. Heat loss in

  6. Molecular characterization of a genomic region in a Lactococcus bacteriophage that is involved in its sensitivity to the phage defense mechanism AbiA.

    Science.gov (United States)

    Dinsmore, P K; Klaenhammer, T R

    1997-05-01

    A spontaneous mutant of the lactococcal phage phi31 that is insensitive to the phage defense mechanism AbiA was characterized in an effort to identify the phage factor(s) involved in sensitivity of phi31 to AbiA. A point mutation was localized in the genome of the AbiA-insensitive phage (phi31A) by heteroduplex analysis of a 9-kb region. The mutation (G to T) was within a 738-bp open reading frame (ORF245) and resulted in an arginine-to-leucine change in the predicted amino acid sequence of the protein. The mutant phi31A-ORF245 reduced the sensitivity of phi31 to AbiA when present in trans, indicating that the mutation in ORF245 is responsible for the AbiA insensitivity of phi31A. Transcription of ORF245 occurs early in the phage infection cycles of phi31 and phi31A and is unaffected by AbiA. Expansion of the phi31 sequence revealed ORF169 (immediately upstream of ORF245) and ORF71 (which ends 84 bp upstream of ORF169). Two inverted repeats lie within the 84-bp region between ORF71 and ORF169. Sequence analysis of an independently isolated AbiA-insensitive phage, phi31B, identified a mutation (G to A) in one of the inverted repeats. A 118-bp fragment from phi31, encompassing the 84-bp region between ORF71 and ORF169, eliminates AbiA activity against phi31 when present in trans, establishing a relationship between AbiA and this fragment. The study of this region of phage phi31 has identified an open reading frame (ORF245) and a 118-bp DNA fragment that interact with AbiA and are likely to be involved in the sensitivity of this phage to AbiA.

  7. 40 CFR 80.250 - How is the small refiner sulfur baseline and volume determined?

    Science.gov (United States)

    2010-07-01

    ...=Baseline volume. VI=Volume of gasoline batch i. n = Total number of batches of gasoline produced from....245(a)(3); or, for a foreign refinery, the total number of batches of gasoline produced and imported... gasoline produced and imported into the U.S. pursuant to § 80.245(c)(2)). i = Individual batch of gasoline...

  8. Evaluation of an Innovative Technology for Treatment of Water Contaminated with Perchlorate and Organic Compounds

    Science.gov (United States)

    2009-03-26

    2004). Exposure to perchlorate can result in negative health effects including hypothyroidism and various other thyroid disorders (NRC, 2005). Ion...level (DWEL) of 24.5 µg/L (U. S. EPA, 2006a). This dose is based on a 154-pound adult consuming 2 liters of water per day that contains 24.5 µg/L of

  9. Novel polyvinyl alcohol-bioglass 45S5 based composite nanofibrous membranes as bone scaffolds

    International Nuclear Information System (INIS)

    Shankhwar, Nisha; Kumar, Manishekhar; Mandal, Biman B.; Srinivasan, A.

    2016-01-01

    Composite nanofibrous membranes based on sol-gel derived 45SiO 2 24.5CaO 24.5 Na 2 O 6 P 2 O 5 (bioglass, BG) and 43SiO 2 24.5CaO 24.5 Na 2 O 6 P 2 O 5 2Fe 2 O 3 (magnetic bioglass, MBG) blended with polyvinyl alcohol (PVA) have been electrospun. These low cost membranes were mostly amorphous in structure with minor crystalline (sodium calcium phosphate) precipitates. All membranes were biodegradable. Among these, the composites exhibited higher tensile strength, better proliferation of human osteosarcoma MG63 cells and higher alkaline phosphatase enzyme activity than the bare PVA membrane, indicating their potential in bone tissue engineering. The magnetic PVA-MBG scaffold was also found to be a promising candidate for magnetic hyperthermia application. - Highlights: • Electrospun low-cost PVA-45S5 bioglass (BG) nanofibrous membranes • PVA-BG membranes containing 2 wt.% Fe 2 O 3 exhibit spontaneous magnetization. • BG fillers strongly enhanced mechanical strength and bioresponse of membranes. • Membranes show promise for bone scaffold and hyperthermia applications.

  10. Metal chloride hydrates as Lewis acid catalysts in multicomponent synthesis of 2,4,5-triarylimidazoles or 2,4,5-triaryloxazoles

    Energy Technology Data Exchange (ETDEWEB)

    Marques, Marcelo V. [Departamento de Engenharia de Processos, Fundacao de Ciencia e Tecnologia, Cachoeirinha, RS (Brazil); Russowsky, Dennis, E-mail: dennis@iq.ufrgs.br [Laboratorio de Sinteses Organicas, Instituto de Quimica, Universidade Federal do Rio Grande do Sul, Porto Alegre-RS (Brazil); Ruthner, Marcelo M.; Fontoura, Luiz A.M. [Curso de Quimica, Universidade Luterana do Brasil, Canoas, RS (Brazil)

    2012-07-01

    A series of nine metal chloride hydrates (ZnCl{sub 2}.2H{sub 2}O, SnCl{sub 2}.2H{sub 2}O, CdCl{sub 2}.2H{sub 2}O, MnCl{sub 2}.4H{sub 2}O, CoCl{sub 2}.6H{sub 2}O, SrCl{sub 2}.6H{sub 2}O, NiCl{sub 2}.6H{sub 2}O, CrCl{sub 3}.6H{sub 2}O and CeCl{sub 3}.7H{sub 2}O) was investigated as mild and inexpensive Lewis acid catalysts to promote the multicomponent synthesis of triarylimidazoles. Reactions starting from benzil showed the best results when SnCl{sub 2}.2H{sub 2}O was used, while for benzoin as the starting material, CeCl{sub 3}.7H{sub 2}O was more efficient. All reactions were performed in EtOH as solvent. These catalysts were also successfully employed in the synthesis of triaryloxazoles. (author)

  11. ALENCE OF DIABETES LITUS AND IMPAIRED GLUCOSE ...

    African Journals Online (AJOL)

    Its. The crude prevalences for diabetes mellitus and IGT e 2.45% and 2.7% respectively. The age-adjusted valences using a standard world population were 4.5% nfidence interval (CI) 1.54 -7.42) and 5.1% (CI 2.45- 5.51) diabetes and IGT respectively. The prevalence of diabetes similar in male and female workers (P ...

  12. Low Mach and Peclet number limit for a model of stellar tachocline and upper radiative zones

    Czech Academy of Sciences Publication Activity Database

    Donatelli, D.; Ducomet, B.; Kobera, M.; Nečasová, Šárka

    2016-01-01

    Roč. 2016, Č. 245 (2016), s. 1-31 ISSN 1072-6691 R&D Projects: GA ČR GA16-03230S Institutional support: RVO:67985840 Keywords : Navier-Stokes-Fourier-Poisson system * radiation transfer * compressible magnetohydrodynamics Subject RIV: BA - General Math ematics Impact factor: 0.954, year: 2016 http://ejde. math .txstate.edu/Volumes/2016/245/abstr.html

  13. effect of blending various collectors at bulk flotation of copper and ...

    African Journals Online (AJOL)

    It was established that the use of the other reagents such as PAX, SIPX, DANFLOAT123, DANAFLOAT 245 would be costly as compared to SEX. Cost of DANFLOAT 245 and 123 are $1.28 and $1.33 per kg respectively as compared to SEX at $1.23 per kg whereas SIPX and PAX are also slightly higher than SEX making ...

  14. Triphenylbis(2,4,5-trifluoro-3-methoxybenzoatoantimony(V

    Directory of Open Access Journals (Sweden)

    Daqi Wang

    2008-10-01

    Full Text Available In the title compound, [Sb(C6H53(C8H4F3O32], the Sb atom lies on an inversion centre and exhibits a trigonal bipyramidal geometry with the axial positions occupied by the O atoms of two carboxylate groups and the equatorial positions occupied by C atoms of the phenyl groups. Intramolecular C—H...O hydrogen bonds stabilize the molecular conformation. In the crystal structure, molecules are connected by intermolecular C—H...O hydrogen-bonding interactions, forming a layer structure parallel to (overline{2}01.

  15. 48 CFR 245.7309-13 - Eligibility of bidders.

    Science.gov (United States)

    2010-10-01

    ... civilian employee of the Department of Defense or the United States Coast Guard whose duties include any functional or supervisory responsibility for disposal of contractor inventory; (b) A member of the United... responsibility for disposal of contractor inventory; (c) An agent, employee or immediate member of the household...

  16. 48 CFR 245.7305 - Sale approval and award.

    Science.gov (United States)

    2010-10-01

    ... that the sale price is fair and reasonable, taking into consideration— (i) Knowledge or tests of the market; (ii) Current published prices for the property; (iii) The nature, condition, quantity, and...) Approve award to the responsible bidder whose bid is most advantageous to the Government, price and other...

  17. Dicty_cDB: VHE245 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 4e-11 BC114006_1( BC114006 |pid:none) Bos taurus L-pipecolic acid oxidas... 71 4e-11 AY892312_1( AY892312 |p... reading fra... 70 8e-11 AF134593_1( AF134593 |pid:none) Homo sapiens L-pipecolic acid oxid... 70 8e-11 prot

  18. 48 CFR 245.7001 - Selection, appointment, and termination.

    Science.gov (United States)

    2010-10-01

    ... REGULATIONS SYSTEM, DEPARTMENT OF DEFENSE CONTRACT MANAGEMENT GOVERNMENT PROPERTY Appointment of Property... officers, the appointment authority shall consider experience, training, education, business acumen, judgment, character, and ethics. ...

  19. 48 CFR 245.608-5 - Special items screening.

    Science.gov (United States)

    2010-10-01

    ..., would otherwise be classified as industrial plant equipment (IPE), other plant equipment (OPE), or automatic data processing equipment (ADPE). (2) The plant clearance officer will perform the initial... SYSTEM, DEPARTMENT OF DEFENSE CONTRACT MANAGEMENT GOVERNMENT PROPERTY Reporting, Redistribution, and...

  20. 8 CFR 245a.12 - Filing and applications.

    Science.gov (United States)

    2010-01-01

    ... Legalization adjustment of status, unless the Director refers the applicant for a personal interview at a local... any further requests for evidence regarding the application and, if eligible, how an interview will be... to filing the application but prior to the interview, or at the time of the interview. (e) Burden of...

  1. 40 CFR 61.245 - Test methods and procedures.

    Science.gov (United States)

    2010-07-01

    ...: EC15NO91.055 Where: HT = Net heating value of the sample, MJ/scm (BTU/scf); where the net enthalpy per mole....740 × 10 7 (g-mole) (MJ)/(ppm-scm-kcal) (metric units); or 4.674 × 108 ((g-mole) (Btu)/(ppm-scf-kcal)) (English units) Ci = Concentration of sample component “i” in ppm, as measured by Method 18 of appendix A...

  2. Novel polyvinyl alcohol-bioglass 45S5 based composite nanofibrous membranes as bone scaffolds

    Energy Technology Data Exchange (ETDEWEB)

    Shankhwar, Nisha [Department of Physics, Indian Institute of Technology Guwahati, Guwahati 781039 (India); Kumar, Manishekhar; Mandal, Biman B. [Department of Biosciences and Bioengineering, Indian Institute of Technology Guwahati, Guwahati 781039 (India); Srinivasan, A., E-mail: asrini@iitg.ernet.in [Department of Physics, Indian Institute of Technology Guwahati, Guwahati 781039 (India)

    2016-12-01

    Composite nanofibrous membranes based on sol-gel derived 45SiO{sub 2} 24.5CaO 24.5 Na{sub 2}O 6 P{sub 2}O{sub 5} (bioglass, BG) and 43SiO{sub 2} 24.5CaO 24.5 Na{sub 2}O 6 P{sub 2}O{sub 5} 2Fe{sub 2}O{sub 3} (magnetic bioglass, MBG) blended with polyvinyl alcohol (PVA) have been electrospun. These low cost membranes were mostly amorphous in structure with minor crystalline (sodium calcium phosphate) precipitates. All membranes were biodegradable. Among these, the composites exhibited higher tensile strength, better proliferation of human osteosarcoma MG63 cells and higher alkaline phosphatase enzyme activity than the bare PVA membrane, indicating their potential in bone tissue engineering. The magnetic PVA-MBG scaffold was also found to be a promising candidate for magnetic hyperthermia application. - Highlights: • Electrospun low-cost PVA-45S5 bioglass (BG) nanofibrous membranes • PVA-BG membranes containing 2 wt.% Fe{sub 2}O{sub 3} exhibit spontaneous magnetization. • BG fillers strongly enhanced mechanical strength and bioresponse of membranes. • Membranes show promise for bone scaffold and hyperthermia applications.

  3. Radiochemical studies of neutron deficient actinide isotopes

    International Nuclear Information System (INIS)

    Williams, K.E.

    1978-04-01

    The production of neutron deficient actinide isotopes in heavy ion reactions was studied using alpha, gamma, x-ray, and spontaneous fission detection systems. A new isotope of berkelium, 242 Bk, was produced with a cross-section of approximately 10 μb in reactions of boron on uranium and nitrogen on thorium. It decays by electron capture with a half-life of 7.0 +- 1.3 minutes. The alpha-branching ratio for this isotope is less than 1% and the spontaneous fission ratio is less than 0.03%. Studies of (Heavy Ion, pxn) and (Heavy Ion, αxn) transfer reactions in comparison with (Heavy ion, xn) compound nucleus reactions revealed transfer reaction cross-sections equal to or greater than the compound nucleus yields. The data show that in some cases the yield of an isotope produced via a (H.I.,pxn) or (H.I.,αxn) reaction may be higher than its production via an xn compound nucleus reaction. These results have dire consequences for proponents of the ''Z 1 + Z 2 = Z/sub 1+2/'' philosophy. It is no longer acceptable to assume that (H.I.,pxn) and (H.I.,αxn) product yields are of no consequence when studying compound nucleus reactions. No evidence for spontaneous fission decay of 228 Pu, 230 Pu, 232 Cm, or 238 Cf was observed indicating that strictly empirical extrapolations of spontaneous fission half-life data is inadequate for predictions of half-lives for unknown neutron deficient actinide isotopes

  4. Investigations for the influence of geochemical parameters on the sorption and desorption of lanthanides and uranium onto opalinus clay as potential host rock for a repository

    International Nuclear Information System (INIS)

    Moeser, Christina

    2010-01-01

    The development of a disposal in deep geological formations for radioactive waste is a very important task for the future. The safety assessment for more than a hundred thousand years needs a full understanding of all processes of interaction between the radioactive waste and the surrounded formations. This work contributes to this understanding. The interaction between lanthanides (homologues of the actinides americium, curium and berkelium) / uranium and the host rock opalinus clay under influence of organic substances (NOM) have been analyzed and discussed. The complex system was split into 3 binary basic systems with the following interactions - Interactions between lanthanides / uranium and NOM - Interactions between lanthanides / uranium and the opalinus clay - Interactions between NOM and opalinus clay All binary systems can be influenced by geological parameters like pH, ion strength and competing cations. The sorption / desorption of the lanthanides onto the opalinus clay is analyzed via inductively coupled plasma mass spectrometry. For the investigation of the complexation behavior of metals with NOM we used capillary electrophoresis coupled with inductively coupled plasma mass spectrometry. Under these conditions the chosen model organic humic acid affected the sorption of the lanthanides onto opalinus clay favorably. The smaller organic compounds, which dominate in the composition of the clay organics, remobilized the metals after sorption onto clay and the sorption can be inhibited by NOM. Due to the reduced metal sorption onto Opalinus clay by NOM, a migration through the clay may be possible.

  5. Early versus late diagnosis in community-acquired bacterial meningitis

    DEFF Research Database (Denmark)

    Bodilsen, J; Brandt, C T; Sharew, A

    2018-01-01

    OBJECTIVES: To examine clinical characteristics and outcome of patients with late diagnosis of community-acquired bacterial meningitis (CABM). METHODS: We conducted a chart review of all adults with proven CABM in three centres in Denmark from 1998 through to 2014. Patients were categorized...... as early diagnosis of CABM immediately on admission, or late diagnosis if CABM was not listed in referral or admission records and neither lumbar puncture nor antibiotic therapy for meningitis was considered immediately on admission. We used modified Poisson regression analysis to compute adjusted relative...... differences (p 65 years (56/113, 50% versus 67/245, 27%), neck stiffness (35/97, 36% versus 183/234, 78%), concomitant pneumonia (26/113, 23% versus 26/245, 11%), and meningococcal meningitis (6/113, 5% versus 52/245, 21%). These variables...

  6. Investigation of Laser Plasma Chemistry in CO2-N-2-H2O Using O-18 Labeled Water

    Czech Academy of Sciences Publication Activity Database

    Ferus, Martin; Kubelík, Petr; Juha, Libor; Civiš, Svatopluk

    2009-01-01

    Roč. 39, 3-4 (2009), s. 245-245 ISSN 0169-6149 R&D Projects: GA MŠk LC510; GA MŠk(CZ) LC528; GA ČR GA203/06/1278; GA MŠk LA08024 Institutional research plan: CEZ:AV0Z40400503; CEZ:AV0Z10100523 Keywords : LIDB plasma * atmosphere * isotopes Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 2.053, year: 2009

  7. Above-threshold structure in {sup 244}Cm neutron-induced fission cross section

    Energy Technology Data Exchange (ETDEWEB)

    Maslov, V.M. [Radiation Physics and Chemistry Problems Inst., Minsk-Sosny (Belarus)

    1997-03-01

    The quasi-resonance structure appearing above the fission threshold in neutron-induced fission cross section of {sup 244}Cm(n,f) is interpreted. It is shown to be due to excitation of few-quasiparticle states in fissioning {sup 245}Cm and residual {sup 244}Cm nuclides. The estimate of quasiparticle excitation thresholds in fissioning nuclide {sup 245}Cm is consistent with pairing gap and fission barrier parameters. (author)

  8. Highly stable palladium-loaded TiO{sub 2} nanotube array electrode for the electrocatalytic hydrodehalogenation of polychlorinated biphenyls

    Energy Technology Data Exchange (ETDEWEB)

    Cui, Chunyue; Wu, Juan; Xin, Yanjun [Qingdao Agricultural University, Qingdao (China); Han, Yanhe [Beijing Institute of Petrochemical Technology, Beijing (China)

    2015-06-15

    Palladized TiO{sub 2} nanotube array electrode was prepared for the electrocatalytic hydrodehalogenation (HDH) of 2,4,5-trichlorobiphenyl (2,4,5-PCB). The TiO{sub 2} nanotube array electrode was successfully fabricated by anodic oxidation method, and Pd was loaded onto the TiO{sub 2} nanotubes by electrochemical deposition. The morphology and structure of the nanotube array electrodes with and without Pd catalysts were evaluated by scanning electron microscopy (SEM), X-ray diffraction (XRD), and X-ray photoelectron spectroscopy (XPS). The results showed that the diameters and lengths of the TiO{sub 2} nanotubes were 30-50 nm and 200-400 nm, respectively. The particle size of the Pd was about 12 nm. Electrocatalytic HDH of 2,4,5-PCB with the Pd/TiO{sub 2} nanotube array electrode was performed in H-cell reactor. Under a constant potential of -1.0 V, the HDH efficiency of 2,4,5-PCB was 90% and the biphenyl yield was 83% (15% current efficiency) within 180min at the Pd/TiO{sub 2} nanotube array electrode. Compared with the Pd/Ti electrode, the Pd/TiO{sub 2} nanotube array electrode exhibited higher HDH efficiency and stability. Additionally, the effect of the primary HDH factors was also investigated.

  9. A Flow Rate Control Approach on Off-Design Analysis of an Organic Rankine Cycle System

    Directory of Open Access Journals (Sweden)

    Ben-Ran Fu

    2016-09-01

    Full Text Available This study explored effects of off-design heat source temperature (TW,in or flow rate (mW on heat transfer characteristics and performance of an organic Rankine cycle system by controlling the flow rate of working fluid R245fa (i.e., the operation flow rate of R245fa was controlled to ensure that R245fa reached saturation liquid and vapor states at the outlets of the preheater and evaporator, respectively. The results showed that the operation flow rate of R245fa increased with TW,in or mW; higher TW,in or mW yielded better heat transfer performance of the designed preheater and required higher heat capacity of the evaporator; heat transfer characteristics of preheater and evaporator differed for off-design TW,in and mW; and net power output increased with TW,in or mW. The results further indicated that the control strategy should be different for various off-design conditions. Regarding maximum net power output, the flow rate control approach is optimal when TW,in or mW exceeds the design point, but the pressure control approach is better when TW,in or mW is lower than the design point.

  10. A region in urokinase plasminogen receptor domain III controlling a functional association with alpha5beta1 integrin and tumor growth

    DEFF Research Database (Denmark)

    Chaurasia, Pratima; Aguirre-Ghiso, Julio; Liang, Olin D

    2006-01-01

    PAR(wt) or the uPAR(S245A) mutant. Transfecting uPAR(wt) into cells with low endogenous levels of uPAR, inactive integrin, low ERK activity, and a dormant phenotype in vivo restores these functions and reinstates growth in vivo. In contrast, transfection of the same cells with uPAR(S245A) elicits only very small...... and tumor growth implicates it as a possible specific target for cancer therapy....

  11. Superior Volumetic Modulated Arc Therapy Planning Solution for Prostate Patients

    Science.gov (United States)

    2014-07-01

    reconstructing 3D objects from their 2D projections. It is written in Java allowing for greater platform flexibility and for user-defined routines written as... angular range) and Fig. 3(b) (which is a head phantom from [17]). The widely used Shepp–Logan phantom [18] can also be described using the elemental...limited angular range. (b) 245 × 245 digitization of a head phantom from [17], with local inhomogeneities present. Fig. 4 – Two 25 × 25 digitizations

  12. Liquid-air partition coefficients of 1,1-difluoroethane (HFC152a), 1,1,1-trifluoroethane (HFC143a), 1,1,1,2-tetrafluoroethane (HFC134a), 1,1,1,2,2-pentafluoroethane (HFC125) and 1,1,1,3,3-pentafluoropropane (HFC245fa).

    Science.gov (United States)

    Ernstgård, Lena; Lind, Birger; Andersen, Melvin E; Johanson, Gunnar

    2010-01-01

    Blood-air and tissue-blood coefficients (lambda) are essential to characterize the uptake and disposition of volatile substances, e.g. by physiologically based pharmacokinetic (PBPK) modelling. Highly volatile chemicals, including many hydrofluorocarbons (HFC) have low solubility in liquid media. These characteristics pose challenges for determining lambda values. A modified head-space vial equilibrium method was used to determine lambda values for five widely used HFCs. The method is based on automated head-space gas chromatography and injection of equal amount of chemical in two head-space vials with identical air phase volumes but different volumes of the liquid phase. The liquids used were water (physiological saline), fresh human blood, and olive oil. The average lambda values (n = 8) were as follows: 1,1-difluoroethane (HFC152a) - 1.08 (blood-air), 1.11 (water-air) and 5.6 (oil-air); 1,1,1-trifluoroethane (HFC143a) - 0.15, 0.15 and 1.90; 1,1,1,2-tetrafluoroethane (HFC134a) - 0.36, 0.35 and 3.5; 1,1,1,2,2-pentafluoroethane (HFC125) - 0.083, 0.074 and 1.71; and 1,1,1,3,3-pentafluoropropane (HFC245fa) - 0.62, 0.58 and 12.1. The lambda values appeared to be concentration-independent in the investigated range (2-200 ppm). In spite of the low lambda values, the method errors were modest, with coefficients of variation of 9, 11 and 10% for water, blood and oil, respectively.

  13. Performance analysis of an organic Rankine cycle with internal heat exchanger having zeotropic working fluid

    Directory of Open Access Journals (Sweden)

    Thoranis Deethayat

    2015-09-01

    Full Text Available In this study, performance of a 50 kW organic Rankine cycle (ORC with internal heat exchanger (IHE having R245fa/R152a zeotropic refrigerant with various compositions was investigated. The IHE could reduce heat rate at the ORC evaporator and better cycle efficiency could be obtained. The zeotropic mixture could reduce the irreversibilities during the heat exchanges at the ORC evaporator and the ORC condenser due to its gliding temperature; thus the cycle working temperatures came closer to the temperatures of the heat source and the heat sink. In this paper, effects of evaporating temperature, mass fraction of R152a and effectiveness of internal heat exchanger on the ORC performances for the first law and the second law of thermodynamics were considered. The simulated results showed that reduction of R245fa composition could reduce the irreversibilities at the evaporator and the condenser. The suitable composition of R245fa was around 80% mass fraction and below this the irreversibilities were nearly steady. Higher evaporating temperature and higher internal heat exchanger effectiveness also increased the first law and second law efficiencies. A set of correlations to estimate the first and the second law efficiencies with the mass fraction of R245fa, the internal heat exchanger effectiveness and the evaporating temperature were also developed.

  14. Ozone Sensitivity in Hybrid Poplar Correlates with Insensitivity to Both Salicylic Acid and Jasmonic Acid. The Role of Programmed Cell Death in Lesion Formation1

    Science.gov (United States)

    Koch, Jennifer Riehl; Creelman, Robert A.; Eshita, Steven M.; Seskar, Mirjana; Mullet, John E.; Davis, Keith R.

    2000-01-01

    Our earlier studies demonstrated that the ozone-sensitive hybrid poplar clone NE-388 displays an attenuated level of ozone-, wound-, and phytopathogen-induced defense gene expression. To determine if this reduced gene activation involves signal transduction pathways dependent on salicylic acid (SA) and/or jasmonic acid (JA), we compared the responses of NE-388 and an ozone-tolerant clone, NE-245, to these signal molecules. JA levels increased in both clones in response to ozone, but only minimal increases in SA levels were measured for either clone. Treatment with SA and methyl jasmonate induced defense gene expression only in NE-245, indicating that NE-388 is insensitive to these signal molecules. DNA fragmentation, an indicator of programmed cell death (PCD), was detected in NE-245 treated with either ozone or an avirulent phytopathogen, but was not detected in NE-388. We conclude that these clones undergo two distinct mechanisms of ozone-induced lesion formation. In NE-388, lesions appear to be due to toxic cell death resulting from a limited ability to perceive and subsequently activate SA- and/or JA-mediated antioxidant defense responses. In NE-245, SA-dependent PCD precedes lesion formation via a process related to the PCD pathway activated by phytopathogenic bacteria. These results support the hypothesis that ozone triggers a hypersensitive response. PMID:10859179

  15. Ozone sensitivity in hybrid poplar correlates with insensitivity to both salicylic acid and jasmonic acid. The role of programmed cell death in lesion formation.

    Science.gov (United States)

    Koch, J R; Creelman, R A; Eshita, S M; Seskar, M; Mullet, J E; Davis, K R

    2000-06-01

    Our earlier studies demonstrated that the ozone-sensitive hybrid poplar clone NE-388 displays an attenuated level of ozone-, wound-, and phytopathogen-induced defense gene expression. To determine if this reduced gene activation involves signal transduction pathways dependent on salicylic acid (SA) and/or jasmonic acid (JA), we compared the responses of NE-388 and an ozone-tolerant clone, NE-245, to these signal molecules. JA levels increased in both clones in response to ozone, but only minimal increases in SA levels were measured for either clone. Treatment with SA and methyl jasmonate induced defense gene expression only in NE-245, indicating that NE-388 is insensitive to these signal molecules. DNA fragmentation, an indicator of programmed cell death (PCD), was detected in NE-245 treated with either ozone or an avirulent phytopathogen, but was not detected in NE-388. We conclude that these clones undergo two distinct mechanisms of ozone-induced lesion formation. In NE-388, lesions appear to be due to toxic cell death resulting from a limited ability to perceive and subsequently activate SA- and/or JA-mediated antioxidant defense responses. In NE-245, SA-dependent PCD precedes lesion formation via a process related to the PCD pathway activated by phytopathogenic bacteria. These results support the hypothesis that ozone triggers a hypersensitive response.

  16. 40_245 - 250_Hussaini, A. Ahmad and S. Sani

    African Journals Online (AJOL)

    user pc

    Bajopas Volume 10 Number 2 December, 2017. Table 4: Conductivity measurement of the complex compounds. Complexes. Concentration moldm-3. Electrical conductivity ohm-1 cm-1. Molar conductivity ohm-1cm2 mol-1. [NiL2]. 2H2O. 1 x 10-3. 9.40x10-6. 94.0. [CuL2]. 2H2O. 1 x 10-3. 6.85x10-6. 68.5. Table 5: Infrared ...

  17. 48 CFR 1852.245-71 - Installation-accountable Government property.

    Science.gov (United States)

    2010-10-01

    ..., physical inventory, financial control, and reporting of the property subject to this clause shall be... assume accountability and financial reporting responsibility for such property. The contractor shall... property, and the contractor assumes the following user responsibilities: [Insert contractor user...

  18. All projects related to | Page 245 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Development of a New Tobacco Tax Policy in Peru ... Region: Far East Asia, Philippines, Central Asia, South Asia ... taxes in Latin America presents a unique opportunity to improve public health and create net gains for national economies.

  19. 40 CFR 421.245 - Pretreatment standards for existing sources.

    Science.gov (United States)

    2010-07-01

    ...) EFFLUENT GUIDELINES AND STANDARDS NONFERROUS METALS MANUFACTURING POINT SOURCE CATEGORY Secondary Nickel... Nickel 9.590 6.344 (c) Acid reclaim leaching belt filter backwash PSES for the Secondary Nickel...

  20. 8 CFR 245a.13 - During pendency of application.

    Science.gov (United States)

    2010-01-01

    ... States submits a prima facie application for adjustment of status under LIFE Legalization during the... inadmissibility, an application for adjustment of status shall be treated as a prima facie application during the... eligible alien who submits a prima facie application for adjustment of status under this Subpart B shall be...

  1. 7 CFR 245.10 - Action by local educational agencies.

    Science.gov (United States)

    2010-01-01

    ... submit for approval to the State agency a free and reduced price policy statement. Once approved, the... shall amend its permanent free and reduced price policy statement to reflect substantive changes. Any... local educational agency's free and reduced price policy statement has been approved by the State agency...

  2. 8 CFR 245a.2 - Application for temporary residence.

    Science.gov (United States)

    2010-01-01

    ... person. The applicant must appear for a personal interview at the legalization office as scheduled. If...-258 (Applicant Card). (2) At the time of the interview, wherever possible, original documents must be... title of persons authorized to act in their behalf. If at the time of the interview the return of...

  3. 50 CFR 216.245 - Requirements for monitoring and reporting.

    Science.gov (United States)

    2010-10-01

    ... to categorize in any way, the observed behavior of the animals (such as animal closing to bow ride... explosive detonations. The Navy shall provide NMFS with species or description of the animal(s), the condition of the animal(s) (including carcass condition if the animal is dead), location, time of first...

  4. 24 CFR 245.430 - Decision on request for approval.

    Science.gov (United States)

    2010-04-01

    ... (3) In the case of HUD's approval of a conversion of residential units in a multifamily housing... corporation or association, which residential rental units are to be converted and whether the conversion is... a conversion from project-paid utilities to tenant-paid utilities or a reduction in tenant utility...

  5. Use of Compound-Specific Stable Isotope Analysis to Distinguish Between Vapor Intrusion and Indoor Sources of VOCs

    Science.gov (United States)

    2013-11-01

    Chlorinated Hydrocarbons, Volatile Organics, TPH (HEM/SGT), CT- Extractable Petroleum Hydrocarbons (ETPH), MA-EPH, MA- VPH . Microbiology Parameters: Total...Toxaphene, CT-Extractable Petroleum Hydrocarbons (ETPH), MA-EPH, MA- VPH , Dicamba, 2,4-D, 2,4,5-T, 2,4,5-TP(Silvex), Dalapon, Volatile Organics (SW 8260...3510C, 3630C, 5030B, ME- DRO, ME-GRO, MA-EPH, MA- VPH .) Solid Waste/Soil (Inorganic Parameters: 9010B, 9012A, 9014A, 9030B, 9040B, 9045C, 6010B

  6. Differentiation of shoot elements from the rachis of Secale cereale L.

    Directory of Open Access Journals (Sweden)

    Jan J. Rybczyński

    2014-01-01

    Full Text Available In vitro culture of young Secale cereale spikes is described with special attention given to changes in development of the rachis. 7 mm explants were cultivated on a modified M u r a s h i g e and S k o o g (1962 medium (MS supplemented with 2,4-D (dichlorophenoxyacetic acid, NAA (α-naph-thaleneacetic acid, IAA (β-indoleacetic acid, 2,4,5-T (trichlorophenoxyacetic acid, and ZEA (zeatin, KIN (kinetin, BAP (6-benzylaminopurine, IPA (izopentenyladenine or 2 iP in numerous combinations and concentrations. Rachises differentiated branches with node construction in the presence of synthetic auxin. Rhizogenesis of explants was stimulated by 2,4-D and 2,4,5-T. 2,4,5-T + IPA appeared to be the best combination for callus regeneration. Many meristematic centres were found previously and combinations of NAA + KIN stimulated direct, whereas 2,4-D + ZEA indirect, differentiation of shoot elements. Development was observed from plantlets to flowering plants.

  7. Radiochemical studies of neutron deficient actinide isotopes

    Energy Technology Data Exchange (ETDEWEB)

    Williams, K.E.

    1978-04-01

    The production of neutron deficient actinide isotopes in heavy ion reactions was studied using alpha, gamma, x-ray, and spontaneous fission detection systems. A new isotope of berkelium, /sup 242/Bk, was produced with a cross-section of approximately 10 ..mu..b in reactions of boron on uranium and nitrogen on thorium. It decays by electron capture with a half-life of 7.0 +- 1.3 minutes. The alpha-branching ratio for this isotope is less than 1% and the spontaneous fission ratio is less than 0.03%. Studies of (Heavy Ion, pxn) and (Heavy Ion, ..cap alpha..xn) transfer reactions in comparison with (Heavy ion, xn) compound nucleus reactions revealed transfer reaction cross-sections equal to or greater than the compound nucleus yields. The data show that in some cases the yield of an isotope produced via a (H.I.,pxn) or (H.I.,..cap alpha..xn) reaction may be higher than its production via an xn compound nucleus reaction. These results have dire consequences for proponents of the ''Z/sub 1/ + Z/sub 2/ = Z/sub 1+2/'' philosophy. It is no longer acceptable to assume that (H.I.,pxn) and (H.I.,..cap alpha..xn) product yields are of no consequence when studying compound nucleus reactions. No evidence for spontaneous fission decay of /sup 228/Pu, /sup 230/Pu, /sup 232/Cm, or /sup 238/Cf was observed indicating that strictly empirical extrapolations of spontaneous fission half-life data is inadequate for predictions of half-lives for unknown neutron deficient actinide isotopes.

  8. Paul Scherrer Institute Scientific Report 1999. Volume I: Particles and Matter

    International Nuclear Information System (INIS)

    Gobrecht, J.; Gaeggeler, H.; Herlach, D.; Junker, K.; Kettle, P.-R.; Kubik, P.; Zehnder, A.

    2000-01-01

    Although originally planned for fundamental research in nuclear physics, the particle beams of pions, muons, protons and neutrons are now used in a large variety of disciplines in both natural science and medicine. The beams at PSI have the world's highest intensities and therefore allow certain experiments to be performed, which would not be possible elsewhere. The highlight of research this year was the first-ever determination of the chemical properties of the superheavy element 107 Bohrium. This was undertaken, by an international team led by H. Gaeggeler of PSI's Laboratory for Radiochemistry. Bohrium was produced by bombarding a Berkelium target with Neon ions from the Injector I cyclotron and six atoms were detected after having passed through an online gas chromatography device. At the Laboratory for Particle Physics the focus has shifted from nuclear physics to elementary particle physics with about a fifty-fifty split between investigations of rare processes or particle decays using the high intensity muon, pion and recently also polarized neutron beams of PSI, and research at the highest energy frontier at CERN (Geneva) and DESY (Hamburg). Important space instrumentation has been contributed by the Laboratory for Astrophysics to the European Space Agency and NASA satellite programmes. The Laboratory for Micro and Nanotechnology continued to focus on research into molecular nanotechnology and SiGeC nanostructures, the latter with the aim of producing silicon based optoelectronics. Progress in 1999 in these topical areas is described in this report. A list of scientific publications in 1999 is also provided

  9. Paul Scherrer Institute Scientific Report 1999. Volume I: Particles and Matter

    Energy Technology Data Exchange (ETDEWEB)

    Gobrecht, J.; Gaeggeler, H.; Herlach, D.; Junker, K.; Kettle, P.-R.; Kubik, P.; Zehnder, A. [eds.

    2000-07-01

    lthough originally planned for fundamental research in nuclear physics, the particle beams of pions, muons, protons and neutrons are now used in a large variety of disciplines in both natural science and medicine. The beams at PSI have the world's highest intensities and therefore allow certain experiments to be performed, which would not be possible elsewhere. The highlight of research this year was the first-ever determination of the chemical properties of the superheavy element {sup 107} Bohrium. This was undertaken, by an international team led by H. Gaeggeler of PSI's Laboratory for Radiochemistry. Bohrium was produced by bombarding a Berkelium target with Neon ions from the Injector I cyclotron and six atoms were detected after having passed through an online gas chromatography device. At the Laboratory for Particle Physics the focus has shifted from nuclear physics to elementary particle physics with about a fifty-fifty split between investigations of rare processes or particle decays using the high intensity muon, pion and recently also polarized neutron beams of PSI, and research at the highest energy frontier at CERN (Geneva) and DESY (Hamburg). Important space instrumentation has been contributed by the Laboratory for Astrophysics to the European Space Agency and NASA satellite programmes. The Laboratory for Micro and Nanotechnology continued to focus on research into molecular nanotechnology and SiGeC nanostructures, the latter with the aim of producing silicon based optoelectronics. Progress in 1999 in these topical areas is described in this report. A list of scientific publications in 1999 is also provided.

  10. Paul Scherrer Institute Scientific Report 1999. Volume I: Particles and Matter

    Energy Technology Data Exchange (ETDEWEB)

    Gobrecht, J; Gaeggeler, H; Herlach, D; Junker, K; Kettle, P -R; Kubik, P; Zehnder, A [eds.

    2000-07-01

    lthough originally planned for fundamental research in nuclear physics, the particle beams of pions, muons, protons and neutrons are now used in a large variety of disciplines in both natural science and medicine. The beams at PSI have the world's highest intensities and therefore allow certain experiments to be performed, which would not be possible elsewhere. The highlight of research this year was the first-ever determination of the chemical properties of the superheavy element {sup 107} Bohrium. This was undertaken, by an international team led by H. Gaeggeler of PSI's Laboratory for Radiochemistry. Bohrium was produced by bombarding a Berkelium target with Neon ions from the Injector I cyclotron and six atoms were detected after having passed through an online gas chromatography device. At the Laboratory for Particle Physics the focus has shifted from nuclear physics to elementary particle physics with about a fifty-fifty split between investigations of rare processes or particle decays using the high intensity muon, pion and recently also polarized neutron beams of PSI, and research at the highest energy frontier at CERN (Geneva) and DESY (Hamburg). Important space instrumentation has been contributed by the Laboratory for Astrophysics to the European Space Agency and NASA satellite programmes. The Laboratory for Micro and Nanotechnology continued to focus on research into molecular nanotechnology and SiGeC nanostructures, the latter with the aim of producing silicon based optoelectronics. Progress in 1999 in these topical areas is described in this report. A list of scientific publications in 1999 is also provided.

  11. ORF Alignment: Ca19AnnotatedDec2004aaSeq [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available y: 186 KGGINITNTVPLTHLDNDEIRAVMSEYKINSANIAFRCDATVDDLIDAIEAKARKYIPAI 245 ... KGGINITNTVPLTHLDNDEIRAVMSEYKINSANIA...FRCDATVDDLIDAIEAKARKYIPAI Sbjct: 121 KGGINITNTVPLTHLDNDEIRAVMSEYKINSANIA

  12. Beam Switching of an Nd:YAG Laser Using Domain-Engineered Prisms in Magnesium-Oxide-Doped Congruent Lithium Niobate

    Science.gov (United States)

    2010-08-01

    explicitly: (2.45) The equalities shown in (2.45) are known as the “ Manley -Rowe relations” for the nonlinear process. These equalities...this discussion, O ve ra ll Tr an sl at io n 36 but it can be seen from Snell’s Law that these structures are equivalent as beam deflectors...an EOBS channel. Figure 3.15 shows that for nearly all values of , the most optimal beam diameter for which to design is 160  . O ve ra ll Tr an

  13. Organic Rankine Cycle recovering stage heat from MSF desalination distillate water

    International Nuclear Information System (INIS)

    Al-Weshahi, Mohammed A.; Anderson, Alexander; Tian, Guohong

    2014-01-01

    Highlights: • The ORC model is validated against measured performance of an existing ORC unit. • This ORC model highlights the importance of refrigerant choice (R245fa performs better than R134a for this specific application). • For heat recovery from desalination plant, ORC evaporator and cooling water temperatures significantly influence the performance. - Abstract: This investigation addresses the potential for heat recovery from Multi Stage Flash (MSF) desalination plant hot distillate water to power an Organic Rankine Cycle (ORC), comparing R134a and R245fa refrigerants as the working fluid. Using design characteristics of an existing ORC unit, the model was first validated against its measured output. The distillate hot water from MSF stages is utilised to provide heat to the ORC and performance is investigated for both working fluids and for the number of MSF stages for heat recovery. For the specific MSF plant investigated, the net produced ORC power is found the highest with extraction up to MSF powering stage 8, generating 359 kW when R245fa is used and 307 kW when R134a is used. Both refrigerants exhibit an increase of power output and decrease of energy efficiency as heat is recovered from more MSF stages. The influence of variation of the evaporator and cooling temperature on ORC performance is demonstrated to be significant for both refrigerants, with R245fa performing better in this specific application

  14. Disposable skin staplers for closure of linear gastrointestinal incisions in dogs.

    Science.gov (United States)

    Schwartz, Zeev; Coolman, Bradley R

    2018-02-01

    To report the clinical features and outcomes of linear gastrointestinal incisions closed with skin staples in dogs. Historical cohort study. 333 client-owned dogs. Medical records from 1 private referral hospital were searched for dogs that underwent gastrointestinal surgery between November 1999 and October 2015. Cases were included if skin staplers were used to close linear gastrointestinal incisions. Information regarding preoperative, surgical, and postoperative factors was collected. Complications were diagnosed in 8 of 245 (3.27%) dogs, including 3 of 245 (1.22%) dogs that died or were euthanized, 3 of 245 (1.22%) dogs with incisional dehiscence, and 2 of 245 (0.81%) dogs with attachment of a linear foreign body to the staples at the intestinal lumen. Dehiscence was noted at the enterotomy sites in 3 dogs at a mean time of 44 hours after surgery (SD ± 6.93). Two dogs presented with another linear foreign body that was attached to the staples in the intestinal lumen at postoperative days 24 and 42. The risk factors associated with incisional dehiscence included multiple gastrointestinal incisions performed in 1 surgery (χ 2 , P indication for surgical intervention, surgery location in the gastrointestinal tract, or surgeon experience and incisional dehiscence. Skin staplers provide safe and effective closure of gastrotomies, enterotomies, and colonotomies in dogs. This method is reliable, efficient, and affordable in the hands of veterinary surgeons with varying skill levels. © 2017 The American College of Veterinary Surgeons.

  15. ORF Alignment: NC_004193 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NEIVKLAQSITDAQQEEMHSLQNIEPYEVVNAS 180 ... Query: 245 TYSEWFPTSDYEVIEAPSFSFTKMNEYKENYAYSEIWIPVRKK 287 ... ... TYSEWFPTSDYEVIEAPSFSFTKMNEYKENYAYSEIWIPVRKK Sbjct: 241 TYSEWFPTSDYEVIEAPSFSFTKMNEYKENYAYSEIWIPVRKK 283

  16. Body-Worn Spiral Monopole Antenna for On-Body Communications (Invited Paper)

    DEFF Research Database (Denmark)

    Kammersgaard, Nikolaj Peter Iversen; Kvist, Søren Helstrup; Thaysen, Jesper

    2015-01-01

    A novel body-worn spiral monopole antenna is presented. The antenna consists of a ground plane and a spiral monopole. The antenna was designed for Ear-to-Ear (E2E) communication between In-the-Ear (ITE) hearing instruments at 2.45 GHz and has been simulated, prototyped, and measured. The antenna ...... yielded a measured and simulated E2E path gain at 2.45 GHz of –82.1 dB and –85.9 dB, respectively. The radiation pattern of the antenna when mounted in the ear is presented and discussed....

  17. Fusion neutron detector calibration using a table-top laser generated plasma neutron source

    International Nuclear Information System (INIS)

    Hartke, R.; Symes, D.R.; Buersgens, F.; Ruggles, L.E.; Porter, J.L.; Ditmire, T.

    2005-01-01

    Using a high intensity, femtosecond laser driven neutron source, a high-sensitivity neutron detector was calibrated. This detector is designed for observing fusion neutrons at the Z accelerator in Sandia National Laboratories. Nuclear fusion from laser driven deuterium cluster explosions was used to generate a clean source of nearly monoenergetic 2.45 MeV neutrons at a well-defined time. This source can run at 10 Hz and was used to build up a clean pulse-height spectrum on scintillating neutron detectors giving a very accurate calibration for neutron yields at 2.45 MeV

  18. ORF Alignment: NC_002678 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available GKPALVIAANILSRRINPAERASSVLFADAAGALVIGPCEDPYQGILGASVDS 180 ... Query: 245 PQDIDRFVPHQANARIFDAVGRNLGIADEAIVKTIAEY...GNSSAATIPLSLSLAHRAAPFR 304 ... PQDIDRFVPHQANARIFDAVGRNLGIADEAIVKTIAEYGNSSAATIPLSLSLAHRAAPFR Sbjct: 241 PQDIDRFVPHQANARIFDAVGRNLGIADEAIVKTIAEYGNSSAATIPLSLSLAHRAAPFR 300 ...

  19. ORF Alignment: NC_004369 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available APELGEAWTPLKLYYSHGFIRQR 180 ... Query: 245 PAGAFFGTPVEVQRRLWPTEEFELAQTRVRTAIPEDDLFAGI 286 ... PAGAFFGTPVEVQRRLWPTEEFELAQTRVRTAIPE...DDLFAGI Sbjct: 241 PAGAFFGTPVEVQRRLWPTEEFELAQTRVRTAIPEDDLFAGI 282

  20. ORF Alignment: NC_003280 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available elegans ... Length = 115 ... Query: 245 KEWNTTESGSKYRLFEERKSWDNAERHCQGFGAHLAIIDNEAKNGFVTNLINSSETSDFA 304... ... KEWNTTESGSKYRLFEERKSWDNAERHCQGFGAHLAIIDNEAKNGFVTNLINSSETSDFA Sbjct: 1 ... KEWNTTESGSKYRLFEERKSWDNAERHCQGFGAHLAIIDNEAKNGFVTNLINSSETSDFA 60 ...

  1. Dual-objective optimization of organic Rankine cycle (ORC) systems using genetic algorithm: a comparison between basic and recuperative cycles

    Science.gov (United States)

    Hayat, Nasir; Ameen, Muhammad Tahir; Tariq, Muhammad Kashif; Shah, Syed Nadeem Abbas; Naveed, Ahmad

    2017-08-01

    Exploitation of low potential waste thermal energy for useful net power output can be done by manipulating organic Rankine cycle systems. In the current article dual-objectives (η_{th} and SIC) optimization of ORC systems [basic organic Rankine cycle (BORC) and recuperative organic Rankine cycle (RORC)] has been done using non-dominated sorting genetic algorithm (II). Seven organic compounds (R-123, R-1234ze, R-152a, R-21, R-236ea, R-245ca and R-601) have been employed in basic cycle and four dry compounds (R-123, R-236ea, R-245ca and R-601) have been employed in recuperative cycle to investigate the behaviour of two systems and compare their performance. Sensitivity analyses show that recuperation boosts the thermodynamic behaviour of systems but it also raises specific investment cost significantly. R-21, R-245ca and R-601 show attractive performance in BORC whereas R-601 and R-236ea in RORC. RORC, due to higher total investment cost and operation & maintenance costs, has longer payback periods as compared to BORC.

  2. Data storage on Russian pesticide producers exposed to dioxin. Sex ratios of third generation of Russian cohort

    Energy Technology Data Exchange (ETDEWEB)

    Amirova, Z.; Kruglov, E. [Environmental Research and Protection Center, Ufa (Russian Federation); Dardynskaia, I. [Univ. of Illinois, School of Public Health, Chicago (United States)

    2004-09-15

    A cohort of Russian workers who produced 2,4,5-T and 2,4,5-TrCP at a chemical factory in Ufa was brought to light in the papers of A. Schecter, J. Ryan and O. Papke. Dioxin exposure was experimentally confirmed by PCDD/Fs determination in blood samples first for a small group of workers and their children. This study permitted to connect the information of medical institutions about chloracne from which a group of young 2,4,5-T workers suffered in 1965-67 with exposure to dioxin. This report presents the results of the detailed study of the third generation of the Russian cohort (247 workers, 314 children and 260 grandchildren). We also present the data on the sex ratio of the second generation for the initial group enlarged by 25% as compared with the group of workers analyzed by J. Ryan et al. (198 workers and 227 children). Besides, as skewed sex ratio had earlier been stated only for paternal descendants, genealogical branches of the cohort representatives were studied.

  3. Design of a Dual-Band Bidirectional Antenna Using Superellipse-Monopole-Fed Rectangular Ring for IEEE 802.11 a/b/g/n Applications

    Directory of Open Access Journals (Sweden)

    Ekajit Khoomwong

    2016-01-01

    Full Text Available This paper presents the design of a dual-band bidirectional ring antenna fed by a superellipse surface probe for 2.4/5 GHz WLAN applications. The Method of Moments (MoM with RWG basis function was utilized in the study and design processes. A prototype antenna was fabricated successfully with the advantages of simple and low-cost structure. The measured impedance bandwidth of 810 MHz (2.10–2.91 GHz and 2.39 GHz (3.57–5.96 GHz is achieved for the first and second band, respectively. The peak gains are also feasible, 4.67 dBi at 2.45 GHz and 7.83 dBi at 5.5 GHz, with bidirectional radiation patterns for both bands. From the experimental field tests, the proposed antenna was suitable for most applications in long and narrow communication sites in 2.4/5 GHz bands as desired. Also, the measured and calculated results were in good agreement.

  4. Radiation and risk for thyroid cancer: atypical findings of a community thyroid recall program

    International Nuclear Information System (INIS)

    Straub, W.; Miller, M.; Sanislow, C.; Fishbeck, W.

    1982-01-01

    Screening of 553 persons for thyroid disease by scan and physical exam was performed. Group I (245) had documented irradiation, with most (85%) receiving 300 R for lymphoid hyperplasia. Group II (308) had only a history of prior irradiation. Abnormal glands were found in 17 of 245 (7%) of Group I with 7 of 245 (3%) having nodular disease. No cancers were found in six of eight (75%) persons with nodular disease having surgery. Abnormal glands were found in 45/308 (14.6%) of Group II with 16/308 (5.2%) having nodular disease. Twelve of 16 (75%) with nodular disease from Group II had surgery and three thyroid cancers were found; in addition, one person from this group had a history of prior surgery for thyroid cancer. The incidence of thyroid cancer in Group I was 0%, Group II was 1.3%, and the combined incidence was 0.7%. The relatively low incidence of thyroid cancer observed is attributed to the relatively late average age at time of irradiation; 22 years for Group 1, 13 years for Group II

  5. Dioxins and related compounds in Vietnamese, Vietnamese food and the environment. Potential relevance of hot spots from recent findings

    Energy Technology Data Exchange (ETDEWEB)

    Paepke, O. [ERGO Research, Hamburg (Germany); Quynh, Hoang Trong [Institute for Oncology, Ha Noi (Viet Nam); Schecter, A. [Univ. of Texas School of Public Health, Dallas Regional Campus, Dallas, TX (United States)

    2004-09-15

    Agent Orange, a phenoxyherbicide mixture of 2,4,5-trichlorophenoxyaceticacid (2,4,5-T) and 2,4- dichlorophenoxyacetic acid (2,4-D) was sprayed for reasons of defoliation in large amounts on about 10 % of southern Vietnam during the Vietnam war between 1962-1971. 2,4,5-T was contaminated with the highly toxic and persistent 2,3,7,8-tetrachlorodibenzo-p-dioxin (TCDD) in the low ppm-range (mg/kg). In samples collected between 1970 and 1973 Baughman et al., 1973 documented elevated levels of TCDD from Agent Orange in milk samples from southern Vietnamese woman as well as in fish and shrimp samples from sprayed areas in this region. Studies have documented the intake of 2,3,7,8-TCDD from Agent Orange in Vietnamese and in among US war veterans. This paper gives an overview on recent findings for PCDDs/Fs and dioxin-like PCBs and in various environmental compartments, in humans and in food. Due to the fact that 2,3,7,8-TCDD is the major dioxin congener in 2,4,5-T, many investigators focused mainly on TCDD. We found from our own investigations, that TCDD in case of dioxin contamination is still the predominant dioxin congener, but in certain instances we also found other elevated congeners as well. In some cases mixed chemical contamination of food or humans was found - originating from Agent Orange and other sources. The paper will explain the potential origin of some of the other contaminations found.

  6. Electrochemical destruction of chlorophenoxy herbicides by anodic oxidation and electro-Fenton using a boron-doped diamond electrode

    International Nuclear Information System (INIS)

    Brillas, Enric; Boye, Birame; Sires, Ignasi; Garrido, Jose Antonio; Rodriguez, Rosa Maria; Arias, Conchita; Cabot, Pere-Lluis; Comninellis, Christos

    2004-01-01

    The degradation of herbicides 4-chlorophenoxyacetic acid (4-CPA), 4-chloro-2-methylphenoxyacetic acid (MCPA), 2,4-dichlorophenoxyacetic acid (2,4-D) and 2,4,5-trichlorophenoxyacetic acid (2,4,5-T) in aqueous medium of pH 3.0 has been comparatively studied by anodic oxidation and electro-Fenton using a boron-doped diamond (BDD) anode. All solutions are totally mineralized by electro-Fenton, even at low current, being the process more efficient with 1 mM Fe 2+ as catalyst. This is due to the production of large amounts of oxidant hydroxyl radical (OH·) on the BDD surface by water oxidation and from Fenton's reaction between added Fe 2+ and H 2 O 2 electrogenerated at the O 2 -diffusion cathode. The herbicide solutions are also completely depolluted by anodic oxidation. Although a quicker degradation is found at the first stages of electro-Fenton, similar times are required for achieving overall mineralization in both methods. The decay kinetics of all herbicides always follows a pseudo first-order reaction. Reversed-phase chromatography allows detecting 4-chlorophenol, 4-chloro-o-cresol, 2,4-dichlorophenol and 2,4,5-trichlorophenol as primary aromatic intermediates of 4-CPA, MCPA, 2,4-D and 2,4,5-T, respectively. Dechlorination of these products gives Cl - , which is slowly oxidized on BDD. Ion-exclusion chromatography reveals the presence of persistent oxalic acid in electro-Fenton by formation of Fe 3+ -oxalato complexes, which are slowly destroyed by OH· adsorbed on BDD. In anodic oxidation, oxalic acid is mineralized practically at the same rate as generated

  7. Tunnel disintegration and neutron emission probability

    International Nuclear Information System (INIS)

    Tani, Toyu; Kobayashi, Yukio.

    1993-01-01

    It is shown that the main features of the so-called cold fusion, that is, poor reproducibility, high t/n ratio and the energy spectrum of neutrons, can be explained by the 'tunnel disintegration' of a deuterium and the subsequent 'dipole disintegration' of a deuteron. Especially, the 2.45-MeV peak found in the energy spectrum, which has been considered to be owing to the d-d nuclear fusion, is explained by this mechanism, and therefore the observation of 2.45-MeV neutrons may not be a direct verification of the d-d nuclear fusion. (author)

  8. Committed effective doses at various times after intakes of radionuclides

    CERN Document Server

    Phipps, A W; Kendall, G M; Silk, T J; Stather, J W

    1991-01-01

    This report contains details of committed effective doses at nine times after intake from intakes by ingestion and inhalation of 1 mu 1 AMAD particles by adults. Data are given for various chemical forms of 359 nuclides. It complements NRPB-R245 which describes the changes which have taken place since the last NRPB compendium of dose per unit intake factors (dose coefficients) and gives summary tables. Information on committed equivalent doses to organs is given in NRPB-M288. The information given in these memoranda is also available as a microcomputer package - NRPB-SR245.

  9. Different patterns of neuronal activities in the infralimbic and prelimbic cortices and behavioral expression in response to two affective odors, 2,5-dihydro-2,4,5-trimethylthiazoline and a mixture of cis-3-hexenol and trans-2-hexenal, in the freely moving rat.

    Science.gov (United States)

    Nikaido, Y; Nakashima, T

    2011-03-17

    The medial prefrontal cortex (mPFC) is involved in stimulus perception, attentional control, emotional behavior, and the stress response. These functions are thought to be mediated by the infralimbic (IL) and prelimbic (PL) subregions of mPFC; however, few studies have examined the roles of IL and PL cortices in olfactory cognition. In the present study, we investigated the acute effects of two odors, 2,5-dihydro-2,4,5-trimethylthiazoline (TMT) and a mixture of cis-3-hexenol and trans-2-hexenal (green odor: GO), on behavioral responses and IL and PL neuronal activities using extracellular single-unit recordings in a freely moving rat. We found that the total number of spike firings in IL and PL neurons did not change with 10s presentation of odors. TMT presentation induced significant changes in burst firing activity in IL and PL neurons, while GO presentation induced changes in burst firing only in IL neurons. In the temporal profile of the firing activity of IL neurons, TMT exposure induced transient activation and GO exposure induced sustained activation. Those of PL neurons showed sustained activation during TMT exposure and transient activations during GO exposure. GO exposure induced a stretch-attend posture, whereas TMT exposure induced immobility. Furthermore, multiple regression analysis indicated that the property of the odor and neuronal activities of IL and PL regions were correlated with behavioral responses. These findings reveal that olfaction-related neurons exist in IL and PL regions, and that the neurons in these regions might temporarily encode odor information in order to modulate motor outputs by tuning firing properties in the early stage of cognition according to the odor property. Copyright © 2010 Elsevier B.V. All rights reserved.

  10. ORF Alignment: NC_006582 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available ENGAHRVQ Sbjct: 121 LFAADLYKMYHRYAEMQGWKTEVIEAHATELGGYKEIIFMVNGSGAYSKLKYENGAHRVQ 180 ... Query: 245 THLPTNTVVSCQDEKSQIKNKEKAMKVLRARIFD...KVQQEAQAEYAESRKLAVGTGDRSER 304 ... THLPTNTVVSCQDEKSQIKNKEKAMKVLRARIFDKVQQEAQAE...YAESRKLAVGTGDRSER Sbjct: 241 THLPTNTVVSCQDEKSQIKNKEKAMKVLRARIFDKVQQEAQAEYAESRKLAVGTGDRSER 300 ...

  11. People and things. CERN Courier, Jun 1984, v. 24(5)

    Energy Technology Data Exchange (ETDEWEB)

    Anon.

    1984-06-15

    The article reports on achievements of various people, staff changes and position opportunities within the CERN organization and contains news updates on upcoming or past events: In our report of physics from the Mark III detector at Stanford's SPEAR electron-positron ring, a few unfortunate errors crept in. The detector has been looking at the radiative decays of J/psi particles, mesons composed of a charmed quark and antiquark.

  12. Antibacterial activity of synthesized 2,4,5-trisubstituted imidazole derivatives

    Digital Repository Service at National Institute of Oceanography (India)

    Khan, M.S.; Siddiqui, S.A.; Siddiqui, M.S.R.A.; Goswami, U.; Srinivasan, K.V.; Khan, M.I.

    release or inhibiting the p38 MAP kinase (1), anti-allergic activity (2) and analgesic activity (3). They are also sensitizers of multidrug-resistant cancer cells (4), pesticides (5), antibiotics (6) or sodium-channel mod- ulators (7). Some imidazole... (ATCC 25922), Klebsiella pneumoniae (ATCC 13883), Pseudomonas aeruginosa (ATCC 27853) and Serratia morganii (ATCC 31665), obtained from Goa Medical college, Goa, India, grown to mid-logarithmic phase were harvested by centrifu- gation, washed with 10 m...

  13. 18 CFR 367.2450 - Account 245, Derivative instrument liabilities-Hedges

    Science.gov (United States)

    2010-04-01

    ..., Derivative instrument liabilities—Hedges (a) This account must include the change in the fair value of... service company must record the change in the fair value of a derivative instrument liability related to a... change in the fair value of a derivative instrument liability related to a fair value hedge in this...

  14. 48 CFR 245.7309-2 - Condition and location of property.

    Science.gov (United States)

    2010-10-01

    ..., express or implied, as to quantity, kind, character, quality, weight, size, or description of the property... REGULATIONS SYSTEM, DEPARTMENT OF DEFENSE CONTRACT MANAGEMENT GOVERNMENT PROPERTY Sale of Surplus Contractor...

  15. short communication one-pot synthesis of 2,4,5-trisubstituted

    African Journals Online (AJOL)

    trisubstituted ... supported 10-molybdo-2-vanadophosphoric acid [28]. ... 86. 208-. 210. 207-208 23. 3. 2-MeOC6H4-. N. H. N. Ph. Ph. MeO. 9. 11. 88 .... NMR spectra were ... Montero, D.; Escarion, J.A. Novel antiprotozoal products: Imidazole and ...

  16. 48 CFR 245.610-4 - Contractor inventory in foreign countries.

    Science.gov (United States)

    2010-10-01

    ..., DRMS disposal activities shall be used to dispose of surplus contractor inventory located outside the... property covered by this contract will be used in (name of country). In the event of resale or export by... equivalent in other currency at the official exchange rate, the Purchaser agrees to obtain the approval of...

  17. 7 CFR 245.11 - Action by State agencies and FNSROs.

    Science.gov (United States)

    2010-01-01

    ... FNSRO, as applicable, shall issue a prototype free and reduced price policy statement and any other... lunches that is less than 40 cents, the State shall establish such price in its prototype policy. Such... price policy statements necessary to bring the family-sized income criteria into conformance with the...

  18. 40 CFR 1065.245 - Sample flow meter for batch sampling.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 32 2010-07-01 2010-07-01 false Sample flow meter for batch sampling... Sample flow meter for batch sampling. (a) Application. Use a sample flow meter to determine sample flow... difference between a diluted exhaust sample flow meter and a dilution air meter to calculate raw exhaust flow...

  19. 27 CFR 19.245 - Bonds and penal sums of bonds.

    Science.gov (United States)

    2010-04-01

    ...) Distiller The amount of tax on spirits produced during a period of 15 days $5,000 $100,000 (ii) Warehouseman... gallons ......do 5,000 50,000 (iii) Distiller and warehouseman The amount of tax on spirits produced... transit to bonded premises 10,000 200,000 (iv) Distiller and processor The amount of tax on spirits...

  20. Transuranium Processing Plant semiannual report of production, status, and plans for period ending December 31, 1975

    International Nuclear Information System (INIS)

    King, L.J.; Bigelow, J.E.; Collins, E.D.

    1976-10-01

    Between July 1, 1975, and December 31, 1975, maintenance was conducted at TRU for a period of three months, 295 g of curium oxide (enough for approximately 26 HFIR targets) were prepared, 100 mg of high-purity 248 Cm, were separated from 252 Cf that had been purified during earlier periods, 11 HFIR targets were fabricated, and 28 product shipments were made. No changes were made in the chemical processing flowsheets normally used at TRU during this report period. However, three equipment racks were replaced (with two new racks) during this time. In Cubicle 6, the equipment replaced was that used to decontaminate the transplutonium elements from rare earth fission products and to separate curium from the heavier elements by means of the LiCl-based anion-exchange process. In Cubicle 5, the equipment used to separate the transcurium elements by high-pressure ion exchange and to purify berkelium by batch solvent extraction was replaced. Two neutron sources were fabricated, bringing the total fabricated to 79. One source that had been used in a completed project was returned to the TRU inventory and is available for reissue. Three sources, for which no further use was foreseen, were processed to isolate and recover the ingrown 248 Cm and the residual 252 Cf. Eight pellets, each containing 100 μg of high-purity 248 Cm were prepared for irradiation in HFIR to study the production of 250 Cm. The values currently being used for transuranium element decay data and for cross-section data in planning irradiation-processing cycles, calculating production forecasts, and assaying products are tabulated

  1. Comparison of Multidetector CT and Gadobutrol-Enhanced MR Imaging for Evaluation of Small, Solid Pancreatic Lesions

    Energy Technology Data Exchange (ETDEWEB)

    Choi, Tae Won [Department of Radiology, Seoul National University Hospital, Seoul 03080 (Korea, Republic of); Lee, Jeong Min; Kim, Jung Hoon [Department of Radiology, Seoul National University Hospital, Seoul 03080 (Korea, Republic of); Institute of Radiation Medicine, Seoul National University Hospital, Seoul 03080 (Korea, Republic of); Yu, Mi Hye [Department of Radiology, Konkuk University Medical Center, Seoul 05030 (Korea, Republic of); Han, Joon Koo; Choi, Byung Ihn [Department of Radiology, Seoul National University Hospital, Seoul 03080 (Korea, Republic of); Institute of Radiation Medicine, Seoul National University Hospital, Seoul 03080 (Korea, Republic of)

    2016-11-01

    To compare multidetector computed tomography (MDCT) and MRI for lesion conspicuity, as well as the detection and characterization of small solid pancreatic lesions (SPLs). 193 patients with small SPLs (< 3 cm) and 52 patients with normal pancreas who underwent both multiphasic MDCT and gadobutrol-enhanced MRI were included in our study. Two radiologists blinded to the pathologic diagnoses independently reviewed those images, and determined the detection of 'SPL per se' and 'SPL in consideration of secondary features', the lesion conspicuity, the probability of pancreatic ductal adenocarcinoma (PDAC), and the most likely specific diagnosis. The sensitivity of MRI for 'detection of SPL per se' was significantly higher than that of CT in both reviewers: 92.7% (179/193) and 97.9% (189/193), respectively, for reviewer 1 (p = 0.031) and 90.7% (175/193) and 99.5% (192/193), respectively, for reviewer 2 (p < 0.001). In addition, MRI provided better lesion conspicuity than MDCT for both reviewers (p < 0.001). However, CT and MRI did not show significant difference in sensitivity for 'detection of SPL in consideration of secondary features', specificity for SPL detection, and differentiation of PDAC vs. non-PDAC (p > 0.05). The accuracies of CT and MRI for making a specific diagnosis were as follows: 85.7% (210/245) vs. 86.9% (213/245), respectively, for reviewer 1 (p = 0.736), and 91.8% (225/245) vs. 93.5% (229/245), respectively, for reviewer 2 (p = 0.454). MRI showed better lesion conspicuity than MDCT, but did not show significantly different diagnostic performance compared with MDCT for detecting and characterizing small SPLs.

  2. Clinical Pharmacokinetics of IPX066: Evaluation of Dose Proportionality and Effect of Food in Healthy Volunteers.

    Science.gov (United States)

    Yao, Hsuan-Ming; Hsu, Ann; Gupta, Suneel; Modi, Nishit B

    2016-01-01

    IPX066 is an oral, extended-release capsule formulation of carbidopa-levodopa (CD-LD) available in 4 strengths. The goals of this investigation were to assess the dose proportionality of IPX066 and to study the effects of a high-fat, high-calorie meal and of sprinkling the capsule contents on applesauce on the pharmacokinetics of IPX066 in healthy volunteers. Three open-label studies were conducted. In the first study, subjects received 1 capsule of each IPX066 strength (23.75-95, 36.25-145, 48.75-195, and 61.25-245 mg of CD-LD). In the second study, subjects received 1 and 2 capsules of IPX066 245-mg LD under fasting conditions. In the third study, subjects received 2 capsules of IPX066 245-mg LD under 3 conditions: fasting; following a high-fat, high-calorie breakfast; and with the capsule contents sprinkled on applesauce under fasting conditions. Peak plasma concentrations (Cmax) and systemic exposure (AUCt, AUCinf) for LD and CD increased dose-proportionally over the range of the IPX066 capsule strengths. Comparison of 1 and 2 IPX066 245-mg LD capsules showed dose-proportional pharmacokinetics for Cmax and AUCt. Sprinkling the capsule contents on applesauce did not affect the pharmacokinetics. A high-fat, high-calorie meal delayed the initial increase in LD concentration by approximately 1 to 2 hours, reduced Cmax by 21%, and increased AUCinf by 13% compared with the fasted state. IPX066 shows dose-proportional pharmacokinetics. Sprinkling the capsule contents on applesauce does not affect the pharmacokinetics; a high-fat, high-calorie meal delayed absorption by 1 to 2 hours, slightly reduced Cmax, and slightly increased extent of absorption.

  3. Structural and biochemical analyses reveal insights into covalent flavinylation of the Escherichia coli Complex II homolog quinol:fumarate reductase

    Energy Technology Data Exchange (ETDEWEB)

    Starbird, C.A.; Maklashina, Elena; Sharma, Pankaj; Qualls-Histed, Susan; Cecchini, Gary; Iverson, T.M. (VA); (UCSF); (Vanderbilt)

    2017-06-14

    The Escherichia coli Complex II homolog quinol:fumarate reductase (QFR, FrdABCD) catalyzes the interconversion of fumarate and succinate at a covalently attached FAD within the FrdA subunit. The SdhE assembly factor enhances covalent flavinylation of Complex II homologs, but the mechanisms underlying the covalent attachment of FAD remain to be fully elucidated. Here, we explored the mechanisms of covalent flavinylation of the E. coli QFR FrdA subunit. Using a ΔsdhE E. coli strain, we show that the requirement for the assembly factor depends on the cellular redox environment. We next identified residues important for the covalent attachment and selected the FrdAE245 residue, which contributes to proton shuttling during fumarate reduction, for detailed biophysical and structural characterization. We found that QFR complexes containing FrdAE245Q have a structure similar to that of the WT flavoprotein, but lack detectable substrate binding and turnover. In the context of the isolated FrdA subunit, the anticipated assembly intermediate during covalent flavinylation, FrdAE245 variants had stability similar to that of WT FrdA, contained noncovalent FAD, and displayed a reduced capacity to interact with SdhE. However, small-angle X-ray scattering (SAXS) analysis of WT FrdA cross-linked to SdhE suggested that the FrdAE245 residue is unlikely to contribute directly to the FrdA-SdhE protein-protein interface. We also found that no auxiliary factor is absolutely required for flavinylation, indicating that the covalent flavinylation is autocatalytic. We propose that multiple factors, including the SdhE assembly factor and bound dicarboxylates, stimulate covalent flavinylation by preorganizing the active site to stabilize the quinone-methide intermediate.

  4. Combining molecular and immunohistochemical analyses of key drivers in primary melanomas: interplay between germline and somatic variations.

    Science.gov (United States)

    Bruno, William; Martinuzzi, Claudia; Dalmasso, Bruna; Andreotti, Virginia; Pastorino, Lorenza; Cabiddu, Francesco; Gualco, Marina; Spagnolo, Francesco; Ballestrero, Alberto; Queirolo, Paola; Grillo, Federica; Mastracci, Luca; Ghiorzo, Paola

    2018-01-19

    Due to the high mutational somatic burden of Cutaneous Malignant Melanoma (CMM) a thorough profiling of the driver mutations and their interplay is necessary to explain the timing of tumorigenesis or for the identification of actionable genetic events. The aim of this study was to establish the mutation rate of some of the key drivers in melanoma tumorigenesis combining molecular analyses and/or immunohistochemistry in 93 primary CMMs from an Italian cohort also characterized for germline status, and to investigate an interplay between germline and somatic variants. BRAF mutations were present in 68% of cases, while CDKN2A germline mutations were found in 16 % and p16 loss in tissue was found in 63%. TERT promoter somatic mutations were detected in 38% of cases while the TERT -245T>C polymorphism was found in 51% of cases. NRAS mutations were found in 39% of BRAF negative or undetermined cases. NF1 was expressed in all cases analysed. MC1R variations were both considered as a dichotomous variable or scored. While a positive, although not significant association between CDKN2A germline mutations, but not MC1R variants, and BRAF somatic mutation was found, we did not observe other associations between germline and somatic events. A yet undescribed inverse correlation between TERT -245T>C polymorphism and the presence of BRAF mutation was found. It is possible to hypothesize that -245T>C polymorphism could be included in those genotypes which may influence the occurrence of BRAF mutations. Further studies are needed to investigate the role of -245T>C polymorphism as a germline predictor of BRAF somatic mutation status.

  5. Thermodynamic and economic optimizations of a waste heat to power plant driven by a subcritical ORC (Organic Rankine Cycle) using pure or zeotropic working fluid

    International Nuclear Information System (INIS)

    Le, Van Long; Kheiri, Abdelhamid; Feidt, Michel; Pelloux-Prayer, Sandrine

    2014-01-01

    This paper carried out the thermodynamic and economic optimizations of a subcritical ORC (Organic Rankine Cycle) using a pure or a zeotropic mixture working fluid. Two pure organic compounds, i.e. n-pentane and R245fa, and their mixtures with various concentrations were used as ORC working fluid for this study. Two optimizations, i.e. exergy efficiency maximization and LCOE (Levelized Cost of Electricity) minimization, were performed to find out the optimum operating conditions of the system and to determine the best working fluid from the studied media. Hot water at temperature of 150 °C and pressure of 5 bars was used to simulate the heat source medium. Whereas, cooling water at temperature of 20 °C was considered to be the heat sink medium. The mass flow rate of heat source is fixed at 50 kg/s for the optimizations. According to the results, the n-pentane-based ORC showed the highest maximized exergy efficiency (53.2%) and the lowest minimized LCOE (0.0863 $/kWh). Regarding ORCs using zeotropic working fluids, 0.05 and 0.1 R245fa mass fraction mixtures present the comparable economic features and thermodynamic performances to the system using n-pentane at minimum LCOE. The ORC using R245fa represents the least profitable system. - Highlights: • Thermoeconomic optimization is carried out for a subcritical ORC. • Exergy efficiency and Levelized Cost of Electricity are optimized. • R245fa, n-Pentane and their mixtures are used as ORC working fluid. • CO 2 emissions can be substantially reduced by waste heat recovery using an ORC

  6. Study of working fluid selection of organic Rankine cycle (ORC) for engine waste heat recovery

    International Nuclear Information System (INIS)

    Wang, E.H.; Zhang, H.G.; Fan, B.Y.; Ouyang, M.G.; Zhao, Y.; Mu, Q.H.

    2011-01-01

    Organic Rankine Cycle (ORC) could be used to recover low-grade waste heat. When a vehicle is running, the engine exhaust gas states have a wide range of variance. Defining the operational conditions of the ORC that achieve the maximum utilization of waste heat is important. In this paper the performance of different working fluids operating in specific regions was analyzed using a thermodynamic model built in Matlab together with REFPROP. Nine different pure organic working fluids were selected according to their physical and chemical properties. The results were compared in the regions when net power outputs were fixed at 10 kW. Safety levels and environmental impacts were also evaluated. The outcomes indicate that R11, R141b, R113 and R123 manifest slightly higher thermodynamic performances than the others; however, R245fa and R245ca are the most environment-friendly working fluids for engine waste heat-recovery applications. The optimal control principle of ORC under the transient process is discussed based on the analytical results. -- Highlights: → R11, R141b, R113 and R123 manifest the best thermodynamic performances. → R245fa and R245ca are the most environment-friendly working fluids for the engine waste heat-recovery application. → The condensing temperature has more important effect than the evaporating pressure to the performance of ORC. → The optimal control principle of ORC under the transient process was defined according to the calculation results for the vehicle engine waste heat-recovery application. → ORC thermodynamic model was built in Matlab together with REFPROP.

  7. Committed equivalent organ doses and committed effective doses from intakes of radionuclides

    CERN Document Server

    Phipps, A W; Kendall, G M; Silk, T J; Stather, J W

    1991-01-01

    This report contains details of committed equivalent doses to individual organs for intakes by ingestion and inhalation of 1 mu m AMAD particles of 359 nuclides by infants aged 3 months, by children aged 1, 5, 10 and 15 years, and by adults. It complements NRPB-R245 which describes the changes which have taken place since the last NRPB compendium of dose per unit intake factors (dose coefficients) and gives summary tables. Information on the way committed doses increase with the integration period is given in NRPB-M289. The information given in these memoranda is also available as a microcomputer package - NRPB-SR245.

  8. ORF Alignment: NC_002927 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available la ... bronchiseptica RB50] ... Length = 245 ... Query: 548 KPVLHAMIVGINEFGEASLNLQYAVNDANAIARELRERTR...GLYRDVRIELLTTPQQTSRA 607 ... KPVLHAMIVGINEFGEASLNLQYAVNDANAIARELRERTRGL...YRDVRIELLTTPQQTSRA Sbjct: 1 ... KPVLHAMIVGINEFGEASLNLQYAVNDANAIARELRERTRGLYRDVRIELLTTPQQTSRA 60 ... Query: 668 KR

  9. Evaluation of sol-gel based magnetic 45S5 bioglass and bioglass-ceramics containing iron oxide.

    Science.gov (United States)

    Shankhwar, Nisha; Srinivasan, A

    2016-05-01

    Multicomponent oxide powders with nominal compositions of (45-x)·SiO2·24.5CaO·24.5Na2O·6P2O5xFe2O3 (in wt.%) were prepared by a modified sol-gel procedure. X-ray diffraction (XRD) patterns and high resolution transmission electron microscope images of the sol-gel products show fully amorphous structure for Fe2O3 substitutions up to 2 wt.%. Sol-gel derived 43SiO2·24.5CaO·24.5Na2O·6P2O5·2Fe2O3 glass (or bioglass 45S5 with SiO2 substituted with 2 wt.% Fe2O3), exhibited magnetic behavior with a coercive field of 21 Oe, hysteresis loop area of 33.25 erg/g and saturation magnetization of 0.66 emu/g at an applied field of 15 kOe at room temperature. XRD pattern of this glass annealed at 850 °C for 1h revealed the formation of a glass-ceramic containing sodium calcium silicate and magnetite phases in nanocrystalline form. Temperature dependent magnetization and room temperature electron spin resonance data have been used to obtain information on the magnetic phase and distribution of iron ions in the sol-gel glass and glass-ceramic samples. Sol-gel derived glass and glass-ceramic exhibit in-vitro bioactivity by forming a hydroxyapatite surface layer under simulated physiological conditions and their bio-response is superior to their melt quenched bulk counterparts. This new form of magnetic bioglass and bioglass ceramics opens up new and more effective biomedical applications. Copyright © 2016 Elsevier B.V. All rights reserved.

  10. Tissue localization of some teratogens at early and late gestation related to fetal effects

    Energy Technology Data Exchange (ETDEWEB)

    Dencker, L [Uppsala Univ. (Sweden)

    1976-01-01

    A number of teratogens have been studied with regard to their distribution and tissue localization in pregnant rodents. The period from the presomite or early somite stages and up to the last days of gestation has been studied by means of whole body autoradiography. The fetal concentrations have been quantitatively measured from day 12 to day 18 of gestation for some of the teratogens by impulse counting. Cadmium (/sup 109/CdCl/sub 2/), mercury (/sup 203/HgCl/sub 2/), and trypan blue (detected by its colour) accumulated in the visceral yolk sac endoderm and in the embryonic endoderm. After duct closure time none of the substances were detected in the embryo except mercury in late gestation. The herbicide 2,4,5-T (/sup 14/C-2,4,5-T) did not pass to the embryonic tissues up to day 10-11 of gestation. The results obtained with 2,4,5-T show that the visceral yolk sac and chorioallantoic placenta have different characteristics concerning the transport of comparatively small organic molecules. /sup 14/C-salicylic acid reached relatively high concentrations during the entire embryonic-fetal period, proving salicylates fetotoxicity throughout gestation. Mercury, 2,4,5-T and salicylic acid showed an increasing fetal concentration with advancing stage of gestation. Extraembryonic mechanisms must too be considered of importance in inducing fetal damage. Cadmium mercury and trypan blue all accumulated in the placental structures throughout gestation. Zinc (/sup 65/ZnCl/sub 2/), which has been shown to be essential for fetal development probably because of its involvment in DNA synthesis, accumulated in the most rapidly growing embryonic structures. Zinc injected prior to gestation was transported to the embryos and placental structures while only a minor amount of the cadmium injected before gestation was mobilized from the maternal organs.

  11. Thermodynamic and economic performances optimization of an organic Rankine cycle system utilizing exhaust gas of a large marine diesel engine

    International Nuclear Information System (INIS)

    Yang, Min-Hsiung; Yeh, Rong-Hua

    2015-01-01

    Highlights: • A new parameter is proposed for optimizing economic performance of the ORC system. • Maximal thermodynamic and economic performances of an ORC system are presented. • The corresponding operating pressures in turbine of optimum thermodynamic and economic performances are investigated. • An optimal effectiveness of pre-heater is obtained for the ORC system. - Abstract: The aim of this study is to investigate the thermodynamic and economic performances optimization for an ORC system recovering the waste heat of exhaust gas from a large marine diesel engine of the merchant ship. Parameters of net power output index and thermal efficiency are used to represent the economic and thermodynamic performances, respectively. The maximum net power output index and thermal efficiency are obtained and the corresponding turbine inlet pressure, turbine outlet pressure, and effectiveness of pre-heater of the ORC system are also evaluated using R1234ze, R245fa, R600, and R600a. Furthermore, the analyses of the effects of turbine inlet temperature and cooling water temperature on the optimal economic and thermodynamic performances of the ORC system are carried out. The results show that R245fa performs the most satisfactorily followed by R600, R600a, and R1234ze under optimal economic performance. However, in the optimal thermodynamic performance evaluations, R1234ze has the largest thermal efficiency followed by R600a, R245fa, and R600. The payback periods will decrease from 0.5 year for R245fa to 0.65 year for R1234ze respectively as the system is equipped with a pre-heater. In addition, compared with conventional diesel oil feeding, the proposed ORC system can reduce 76% CO 2 emission per kilowatt-hour

  12. Sensitivity of Vibrio cholerae cells to lethal and mutagenic effect of UV-irradiation mediated by plasmids

    International Nuclear Information System (INIS)

    Tiganova, I.G.; Evdokimova, N.M.; Aleshkin, G.I.

    1988-01-01

    The effect of UV-irradiation on Vibrio cholerae cells and its changes mediated by the plasmid R245 have been studied. Vibrio cholerae strains 569B and RV31 have been shown to be considerably more sensitive to lethal effect of UV-irradiation as compared with Escherichia coli and Salmonella typhimurium cells. Highly toxigenic strain 569B and practically atoxigenic strain RV31 have the same UV-sensitivity. Lethla effect of UV-irradiation on Vibrio cholerae cells is incresed when the irradiated cells are plated on enriched media. UV-induction of mutations was not registered in plasmidless strains of Vibrio cholerae. Plasmid R245 increase UV-resistance of vibrio cells and makes them UV-mutable

  13. Cryoinsulation Material Development to Mitigate Obsolescence Risk for Global Warming Potential Foams

    Science.gov (United States)

    Protz, Alison; Bruyns, Roland; Nettles, Mindy

    2015-01-01

    Cryoinsulation foams currently being qualified for the Space Launch System (SLS) core stage are nonozone- depleting substances (ODP) and are compliant with current environmental regulations. However, these materials contain the blowing agent HFC-245fa, a hydrofluorocarbon (HFC), which is a Global Warming Potential (GWP) substance. In August 2014, the Environmental Protection Agency (EPA) proposed a policy change to reduce or eliminate certain HFCs, including HFC-245fa, in end-use categories including foam blowing agents beginning in 2017. The policy proposes a limited exception to allow continued use of HFC and HFC-blend foam blowing agents for military or space- and aeronautics-related applications, including rigid polyurethane spray foams, but only until 2022.

  14. Use of Powder PEG-3350 as a Sole Bowel Preparation

    Science.gov (United States)

    Arora, Manish

    2008-01-01

    Objective: To assess the efficacy of low-volume powder polyethylene glycol (PEG)-3350 as a sole bowel preparation for colonoscopy. Methods: This case series examined 245 consecutive patients (a mixture of inpatients and outpatients undergoing screening colonoscopy) at a hospital endoscopy center over a 2-year period. The patients received powder PEG-3350 in the amount of 204 g dissolved in 32 oz of water and taken in 3 divided doses 1 hour apart with 8 oz of water in between each dose. Colon preparation scores (CPS) were used to assess the quality of colon cleansing. The results obtained from the 245 patients were collated and compared to those of patients receiving sodium phosphate, the historical control. Results: The mean CPS was calculated to be 3.43, with a standard deviation of 1.12. Of the 245 patients, 92 were scored with a grade of 4, and 5 patients had incomplete colonoscopies secondary to failure of bowel preparation (CPS=0). Among the remaining patients, 22 and 26 were graded as poor (CPS=1) or fair (CPS=2) bowel preparations, respectively. Conclusion: The low-volume powder PEG-3350 formula used in our case series showed effective colon cleansing and may be considered for use as a sole bowel preparation. PMID:21960925

  15. Removal of contaminated concrete surfaces by microwave heating: Phase 1 results

    International Nuclear Information System (INIS)

    White, T.L.; Grubb, R.G.; Pugh, L.P.; Foster, D. Jr.; Box, W.D.

    1992-01-01

    Oak Ridge National Laboratory (ORNL) is developing a microwave heating process to remove radiologically contaminated surface layers from concrete. The microwave energy is directed at the concrete surface and heats the concrete and free water present in the concrete matrix. Continued heating produces steam-pressure-induced mechanical stresses that cause the concrete surface to burst. The concrete particles from this steam explosion are small enough to be removed by a vacuum system, yet less than 1% of the debris is small enough to pose an airborne contamination hazard. The first phase of this program has demonstrated reliable removal of noncontaminated concrete surfaces at frequencies of 2.45 GHz and 10.6 GHz. Continuous concrete removal rates of 1.07 cm 3 /s with 5.2 kW of 2.45.-GHz power and 2.11 cm 3 /s with 3.6 kW of 10.6-GHz power have been demonstrated. Figures-of-merit for microwave removal of concrete have been calculated to be 0.21 cm 3 /s/kW at 2.45 GHz and 0.59 cm 3 /s/kW at 10.6 GHz. The amount of concrete removed in a single pass can be controlled by choosing the frequency and power of the microwave system

  16. Design and optimization of organic rankine cycle for low temperature geothermal power plant

    Science.gov (United States)

    Barse, Kirtipal A.

    Rising oil prices and environmental concerns have increased attention to renewable energy. Geothermal energy is a very attractive source of renewable energy. Although low temperature resources (90°C to 150°C) are the most common and most abundant source of geothermal energy, they were not considered economical and technologically feasible for commercial power generation. Organic Rankine Cycle (ORC) technology makes it feasible to use low temperature resources to generate power by using low boiling temperature organic liquids. The first hypothesis for this research is that using ORC is technologically and economically feasible to generate electricity from low temperature geothermal resources. The second hypothesis for this research is redesigning the ORC system for the given resource condition will improve efficiency along with improving economics. ORC model was developed using process simulator and validated with the data obtained from Chena Hot Springs, Alaska. A correlation was observed between the critical temperature of the working fluid and the efficiency for the cycle. Exergy analysis of the cycle revealed that the highest exergy destruction occurs in evaporator followed by condenser, turbine and working fluid pump for the base case scenarios. Performance of ORC was studied using twelve working fluids in base, Internal Heat Exchanger and turbine bleeding constrained and non-constrained configurations. R601a, R245ca, R600 showed highest first and second law efficiency in the non-constrained IHX configuration. The highest net power was observed for R245ca, R601a and R601 working fluids in the non-constrained base configuration. Combined heat exchanger area and size parameter of the turbine showed an increasing trend as the critical temperature of the working fluid decreased. The lowest levelized cost of electricity was observed for R245ca followed by R601a, R236ea in non-constrained base configuration. The next best candidates in terms of LCOE were R601a, R

  17. Metabolism of UV-filter benzophenone-3 by rat and human liver microsomes and its effect on endocrine-disrupting activity

    Energy Technology Data Exchange (ETDEWEB)

    Watanabe, Yoko, E-mail: y-watanabe@nichiyaku.ac.jp [Graduate School of Biomedical and Health Sciences, Hiroshima University, Kasumi 1-2-3, Minami-ku, Hiroshima 734-8553 (Japan); Nihon Pharmaceutical University, Komuro 10281, Ina-machi, Saitama 362-0806 (Japan); Kojima, Hiroyuki; Takeuchi, Shinji [Hokkaido Institute of Public Health, Kita-19, Nishi-12, Kita-ku, Sapporo 060-0819 (Japan); Uramaru, Naoto [Nihon Pharmaceutical University, Komuro 10281, Ina-machi, Saitama 362-0806 (Japan); Sanoh, Seigo [Graduate School of Biomedical and Health Sciences, Hiroshima University, Kasumi 1-2-3, Minami-ku, Hiroshima 734-8553 (Japan); Sugihara, Kazumi [Faculty of Pharmaceutical Science, Hiroshima International University, Koshingai 5-1-1, Kure, Hiroshima 737-0112 (Japan); Kitamura, Shigeyuki [Nihon Pharmaceutical University, Komuro 10281, Ina-machi, Saitama 362-0806 (Japan); Ohta, Shigeru [Graduate School of Biomedical and Health Sciences, Hiroshima University, Kasumi 1-2-3, Minami-ku, Hiroshima 734-8553 (Japan)

    2015-01-15

    Benzophenone-3 (2-hydroxy-4-methoxybenzophenone; BP-3) is widely used as sunscreen for protection of human skin and hair from damage by ultraviolet (UV) radiation. In this study, we examined the metabolism of BP-3 by rat and human liver microsomes, and the estrogenic and anti-androgenic activities of the metabolites. When BP-3 was incubated with rat liver microsomes in the presence of NADPH, 2,4,5-trihydroxybenzophenone (2,4,5-triOH BP) and 3-hydroxylated BP-3 (3-OH BP-3) were newly identified as metabolites, together with previously detected metabolites 5-hydroxylated BP-3 (5-OH BP-3), a 4-desmethylated metabolite (2,4-diOH BP) and 2,3,4-trihydroxybenzophenone (2,3,4-triOH BP). In studies with recombinant rat cytochrome P450, 3-OH BP-3 and 2,4,5-triOH BP were mainly formed by CYP1A1. BP-3 was also metabolized by human liver microsomes and CYP isoforms. In estrogen reporter (ER) assays using estrogen-responsive CHO cells, 2,4-diOH BP exhibited stronger estrogenic activity, 2,3,4-triOH BP exhibited similar activity, and 5-OH BP-3, 2,4,5-triOH BP and 3-OH BP-3 showed lower activity as compared to BP-3. Structural requirements for activity were investigated in a series of 14 BP-3 derivatives. When BP-3 was incubated with liver microsomes from untreated rats or phenobarbital-, 3-methylcholanthrene-, or acetone-treated rats in the presence of NADPH, estrogenic activity was increased. However, liver microsomes from dexamethasone-treated rats showed decreased estrogenic activity due to formation of inactive 5-OH BP-3 and reduced formation of active 2,4-diOH BP. Anti-androgenic activity of BP-3 was decreased after incubation with liver microsomes. - Highlights: • Metabolic modification of the endocrine-disrupting activity of BP-3 was examined. • 2,4,5-TriOH BP and 3-OH BP-3 were identified as new BP-3 metabolites. • 2,4-DiOH BP and 2,3,4-triOH BP exhibited high or similar estrogenic activities. • Estrogenic activity of BP-3 was enhanced by incubation with rat liver

  18. Microwave Plasma System: PVA Tepla 300

    Data.gov (United States)

    Federal Laboratory Consortium — Description:CORAL Name: Microwave AsherA tool using microwave oxygen plasma to remove organics on the surfacesSpecifications / Capabilities:Frequency: 2.45 GHzPower:...

  19. An implantable bioimpedance monitor using 2.45 GHz band for telemetry

    International Nuclear Information System (INIS)

    Bogónez-Franco, Paco; Nescolarde, Lexa; Bragós, Ramon; Rosell-Ferrer, Javier; Gálvez-Montón, Carolina

    2013-01-01

    This paper describes a multi-frequency single-channel electrical implantable bioimpedance monitor (35 mm × 35 mm × 10 mm, weight 52 g) powered by a NiMH battery. By using the tetrapolar method and injecting 10 µA peak , the monitor is capable of measuring at 14 different frequencies, from 100 Hz to 200 kHz. It contains a ZigBee transceiver to monitor the measurements performed, and has an embedded memory for backing up the data. RC networks and in-situ heart excised tissues were used to test the system. When measuring a full spectrum every 5 min, 35 days of autonomy are possible due to the low power consumption of the monitor. Temperature drift was estimated by short-term and long-term measurements. Temperature cycling was used to measure modulus and phase angle stability. The result was a very low effect on a modulus decrease of 2.34 Ω, with respect to an impedance of 322 Ω, at 100 Hz and a phase angle increase of 1.1°, at 200 kHz. In addition, measurement errors were bigger at low frequencies because of the high impedance of the electrodes used, which was higher than 10 kΩ at frequencies below 1 kHz. (paper)

  20. Sanitary Norms of the Design of Industrial Enterprises. SN 245-71.

    Science.gov (United States)

    1979-07-09

    Plants of feed 4ntibiotics. 3. Fish trades. 4. Cattle bases to 1000 heads of given cattle. 5. Shops for production of ferments with surface method of...sirloin with scrap processing shops, fisheries. 9. Shops for production of ferments with deep method of cultivation. 10. Beet sugar plants without pulp...zone by size/dimension 50 a. 1. Confectionery factories. 2. Production of table vinegar . 3. Enterprises tobacco-lov-grade tobacco (tobacco

  1. Electrostatic Vibration Energy Harvester Pre-charged Wirelessly at 2.45 GHz

    Science.gov (United States)

    Saddi, Z.; Takhedmit, H.; Karami, A.; Basset, P.; Cirio, L.

    2016-11-01

    This paper reports the design, fabrication and experiments of an electrostatic vibration harvester (e-VEH), pre-charged wirelessly for the first time by using an electromagnetic waves harvester at 2.4 GHz. The rectenna uses the Cockcroft-Walton voltage doubler rectifier. It is designed and optimized to operate at low power densities and provides high voltage levels: 0.5 V at 0.5 μW/cm2 and 0.8 V at 1 μW/cm2 The e-VEH uses the Bennet doubler as conditioning circuit. Experiments show 23 V voltage across the transducer terminal when the harvester is excited at 25 Hz by 1.5 g of external acceleration. An accumulated energy of 275 μJ and a maximum power of 0.4 μW are available for the load.

  2. Electrostatic Vibration Energy Harvester Pre-charged Wirelessly at 2.45 GHz

    International Nuclear Information System (INIS)

    Saddi, Z.; Takhedmit, H.; Basset, P.; Cirio, L.; Karami, A.

    2016-01-01

    This paper reports the design, fabrication and experiments of an electrostatic vibration harvester (e-VEH), pre-charged wirelessly for the first time by using an electromagnetic waves harvester at 2.4 GHz. The rectenna uses the Cockcroft-Walton voltage doubler rectifier. It is designed and optimized to operate at low power densities and provides high voltage levels: 0.5 V at 0.5 μW/cm 2 and 0.8 V at 1 μW/cm 2 The e-VEH uses the Bennet doubler as conditioning circuit. Experiments show 23 V voltage across the transducer terminal when the harvester is excited at 25 Hz by 1.5 g of external acceleration. An accumulated energy of 275 μJ and a maximum power of 0.4 μW are available for the load. (paper)

  3. Standardized UXO Technology Demonstration Site Open Field Scoring Record Number 245

    National Research Council Canada - National Science Library

    Overbay, Larry

    2005-01-01

    ... (UXO) utilizing the YPG Standardized UXO Technology Demonstration Site Open Field. The scoring record was coordinated by Larry Overbay and by the Standardized UXO Technology Demonstration Site Scoring Committee...

  4. Actinide production in the reaction of heavy ions with curium-248

    International Nuclear Information System (INIS)

    Moody, K.J.

    1983-07-01

    Chemical experiments were performed to examine the usefulness of heavy ion transfer reactions in producing new, neutron-rich actinide nuclides. A general quasi-elastic to deep-inelastic mechanism is proposed, and the utility of this method as opposed to other methods (e.g. complete fusion) is discussed. The relative merits of various techniques of actinide target synthesis are discussed. A description is given of a target system designed to remove the large amounts of heat generated by the passage of a heavy ion beam through matter, thereby maximizing the beam intensity which can be safely used in an experiment. Also described is a general separation scheme for the actinide elements from protactinium (Z=91) to mendelevium (Z=101), and fast specific procedures for plutonium, americium and berkelium. The cross sections for the production of several nuclides from the bombardment of 248 Cm with 18 O, 86 Kr and 136 Xe projectiles at several energies near and below the Coulomb barrier were determined. The results are compared with yields from 48 Ca and 238 U bombardments of 248 Cm. Simple extrapolation of the product yields into unknown regions of charge and mass indicates that the use of heavy ion transfer reactions to produce new, neutron-rich above-target species is limited. The substantial production of neutron-rich below-target species, however, indicates that with very heavy ions like 136 Xe and 238 U the new species 248 Am, 249 Am and 247 Pu should be produced with large cross sections from a 248 Cm target. A preliminary, unsuccessful attempt to isolate 247 Pu is outlined. The failure is probably due to the half life of the decay, which is calculated to be less than 3 minutes. The absolute gamma ray intensities from 251 Bk decay, necessary for calculating the 251 Bk cross section, are also determined

  5. Minor Actinides Recycling in PWRs

    International Nuclear Information System (INIS)

    Delpech, M.; Golfier, H.; Vasile, A.; Varaine, F.; Boucher, L.; Greneche, D.

    2006-01-01

    Recycling of minor actinides in current and near future PWR is considered as one of the options of the general waste management strategy. This paper presents the analysis of this option both from the core physics and fuel cycle point of view. A first indicator of the efficiency of different neutron spectra for transmutation purposes is the capture to fission cross sections ratio which is less favourable by a factor between 5 to 10 in PWRs compared to fast reactors. Another indicator presented is the production of high ranking isotopes like Curium, Berkelium or Californium in the thermal or epithermal spectrum conditions of PWR cores by successive neutron captures. The impact of the accumulation of this elements on the fabrication process of such PWR fuels strongly penalizes this option. The main constraint on minor actinides loadings in PWR (or fast reactors) fuels are related to their direct impact (or the impact of their transmutation products) on the reactivity coefficients, the reactivity control means and the core kinetics parameters. The main fuel cycle physical parameters like the neutron source, the alpha decay power, the gamma and neutrons dose rate and the criticality aspects are also affected. Recent neutronic calculations based on a reference core of the Evolutionary Pressurized Reactor (EPR), indicates typical maximum values of 1 % loadings. Different fuel design options for minor actinides transmutation purposes in PWRs are presented: UOX and MOX, homogeneous and heterogeneous assemblies. In this later case, Americium loading is concentrated in specific pins of a standard UOX assembly. Recycling of Neptunium in UOX and MOX fuels was also studied to improve the proliferation resistance of the fuel. The impact on the core physics and penalties on Uranium enrichment were underlined in this case. (authors)

  6. 7 CFR 275.4 - Record retention.

    Science.gov (United States)

    2010-01-01

    ... materials supporting the review decision; sample lists; sampling frames; tabulation sheets; and reports of... Stamps and Medicaid Quality Control Reviews, FNS-380-1, Integrated Review Schedule, FNS-245, Negative...

  7. Purification and characterisation of a novel enantioselective epoxide hydrolase from Aspergillus niger M200

    Czech Academy of Sciences Publication Activity Database

    Kotík, Michael; Kyslík, Pavel

    2006-01-01

    Roč. 1760, - (2006), s. 245-252 ISSN 0006-3002 Institutional research plan: CEZ:AV0Z50200510 Keywords : epoxide hydrolase * enantioselectivity * aspergillus niger Subject RIV: EE - Microbiology, Virology

  8. 48 CFR 1845.505-14 - Reports of Government property. (NASA supplements paragraphs (b))

    Science.gov (United States)

    2010-10-01

    .... (NASA supplements paragraphs (b)) (b) When the clause at 1852.245-73, Financial Reporting of NASA... contractor acquired property for purposes of reporting the acquisition cost in the property classifications...

  9. Ogunsile et al (18)

    African Journals Online (AJOL)

    USER

    nanoparticles have activity against all the tested bacteria but are less active against some isolated fungi. ABSTRACT. 245 ... process or electrochemical precipitation, vapour deposition ... protective property against ethanol induced ulceration.

  10. 76 FR 50808 - Certification Related to the Khmer Rouge Tribunal

    Science.gov (United States)

    2011-08-16

    ...), and Delegation of Authority 245-1, I hereby certify that the United Nations and Government of Cambodia are taking credible steps to address allegations of corruption and mismanagement within the...

  11. A Balanced-Fed Dual Inverted-F Antenna with Reduced Human Body Effects

    Directory of Open Access Journals (Sweden)

    Wang-Sang Lee

    2013-01-01

    Full Text Available A balanced-fed dual inverted-F antenna with reduced human body effects for WLAN applications at 2.45 GHz is presented. In order to reduce the influence by a close proximity or a touch of a human body, the proposed antenna employs an impedance matching using a lumped LC-balun which has the simple and compact structure applying for mobile handsets. The resonant frequency of the proposed antenna is fixed at 2.45 GHz regardless of the close proximity of a human body. By applying for the L-shape ground plane, the proposed antenna has the wide impedance bandwidth of about 150 MHz and the peak realized gain of about 4 dBi.

  12. [Factors inducing transition from growth to dormancy in rhizobacteria Azospirillum brasilense].

    Science.gov (United States)

    Kushneruk, M A; Tugarova, A V; Il'chukova, A V; Slavkina, E A; Starichkova, N I; Bogatyrev, V A; Antoniuk, L P

    2013-01-01

    The factors suppressing division of the cells of the rhizobacterium Azospirillum brasilense and inducing their transition to a dormant state were analyzed. These included the presence of hexylresorcinol or heavy metals (Cu and Co) in the medium, oxygen stress, and transfer of the cells into the physiological saline or phosphate buffer solution. The results were used to develop a protocol for obtaining of uncultured cells of A. brasilense Sp245, a natural symbiont of wheat. The cells lost their ability to grow on synthetic agar medium, but could revert to growth when incubated in freshly prepared liquid medium. Needle-shaped crystals differing from struvite, which has been previously reported for this strain, were found in the dormant culture of A. brasilense Sp245.

  13. Journal of Chemical Sciences | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    ) andMn(II) complexes of poly(methyl vinyl ether-alt-maleic anhydride). Synthesis, characterization and thermodynamic parameters. Hidayet Mazi Ali Gulpinar. Volume 126 Issue 1 January 2014 pp 239-245 ...

  14. 76 FR 6003 - Defense Federal Acquisition Regulation Supplement; Marking of Government-Furnished Property

    Science.gov (United States)

    2011-02-02

    ...-7000, Government-Furnished Mapping, Charting, and Geodesy Property, in solicitations and contracts when mapping, charting, and geodesy property is to be furnished. (b) Use the clause at 252.245-7001, Tagging...

  15. 75 FR 16450 - Kern River Gas Transmission Company; Notice of Availability of the Draft Environmental Impact...

    Science.gov (United States)

    2010-04-01

    ... American tribes; local newspapers and libraries in the project area; intervenors to the FERC's proceeding...., and are scheduled as follows: Date Location Tuesday, April 27, 2010 Millcreek Junior High School, 245...

  16. 78 FR 17595 - New Animal Drugs; Changes of Sponsor

    Science.gov (United States)

    2013-03-22

    ... RAPINOVET (propofol) Injectable Emulsion. 141-245 TRIBUTAME (embutramide, chloroquine, and lidocaine... DRUGS FOR USE IN ANIMAL FEEDS 0 53. The authority citation for 21 CFR part 558 continues to read as...

  17. 76 FR 35070 - Canexus Chemicals Canada L.P. v. BNSF Railway Company

    Science.gov (United States)

    2011-06-15

    ... FURTHER INFORMATION, CONTACT: Joseph Dettmar, (202) 245-0395. Assistance for the hearing impaired is... conservation of energy resources. Decided: June 10, 2011. By the Board. Rachel D. Campbell, Director, Office of...

  18. About Military Sexual Trauma

    Medline Plus

    Full Text Available ... Veterans Health Administration 58,393 views 2:45 World War II Veterans Honored at Bay Pines Community Living Center - Duration: 2:55. ... Loading... Loading... About Press Copyright Creators ...

  19. 76 FR 32968 - Proposed Extensions and Waivers: National Center To Enhance the Professional Development of...

    Science.gov (United States)

    2011-06-07

    ... of this notice. Telephone: (202) 245- 7506. If you use a telecommunications device for the deaf (TDD... site that meets accessibility standards under section 508 of the Rehabilitation Act (See http://www...

  20. Dvě ontologie české demokracie: T. G. Masaryk a J. L. Fischer

    Czech Academy of Sciences Publication Activity Database

    Pauza, Miroslav

    2015-01-01

    Roč. 63, č. 2 (2015), s. 233-245 ISSN 0015-1831 Institutional support: RVO:67985955 Keywords : Masaryk * Fischer * democracy * providence * order * structure * function * individuality * sociality * crisis Subject RIV: AA - Philosophy ; Religion

  1. Download this PDF file

    African Journals Online (AJOL)

    construction of personal identity and this may influence psychological adjustment and ... perception with general appearance, color, arrangement and shape of anterior teeth, ... one impact; the most impacted performance was eating (24.5%).

  2. 78 FR 50075 - Statewide Communication Interoperability Plan Template and Annual Progress Report

    Science.gov (United States)

    2013-08-16

    ... Collection Request should be forwarded to DHS/NPPD/CS&C/OEC, 245 Murray Lane SW., Mail Stop 0640, Arlington... will assist states in their strategic planning for interoperable and emergency communications while...

  3. Download this PDF file

    African Journals Online (AJOL)

    pc

    [2,4,5-trichlorophenoxy] propionic .... other agronomical practices. Treatments ... shorter night in a year (Dugje et al., 2012). ... environmental responsive methodology to improve ... higher plants in response to feeding with ... Annual Review.

  4. dispersion characteristics of settleable and dissolvable pollutants in ...

    African Journals Online (AJOL)

    The implication of this in waste stabilization pond design was also discussed. KEYWORDS: Dispersion, settleable pollutants, waste stabilization ponds. INTRODUCTION. A waste ...... and Soil Pollution 52, 237-245. Agunwamba, J. C., 1991.

  5. Influenza vaccination in Dutch nursing homes: is tacit consent morally justified?

    Science.gov (United States)

    Verweij, M F; van den Hoven, M A

    2005-01-01

    Efficient procedures for obtaining informed (proxy) consent may contribute to high influenza vaccination rates in nursing homes. Yet are such procedures justified? This study's objective was to gain insight in informed consent policies in Dutch nursing homes; to assess how these may affect influenza vaccination rates and to answer the question whether deviating from standard informed consent procedures could be morally justified. A survey among nursing home physicians. We sent a questionnaire to all (356) nursing homes in the Netherlands, to be completed by one of the physicians. We received 245 completed questionnaires. As 21 institutions appeared to be closed or merged into other institutions, the response was 73.1% (245/335). Of all respondents 81.9% reported a vaccination rate above 80%. Almost 50% reported a vaccination rate above 90%. Most respondents considered herd immunity to be an important consideration for institutional policy. Freedom of choice for residents was considered important by almost all. Nevertheless, 106 out of 245 respondents follow a tacit consent procedure, according to which vaccination will be administered unless the resident or her proxy refuses. These institutions show significantly higher vaccination rates (p tacit consent procedures can be morally justifiable. Such procedures assume that vaccination is good for residents either as individuals or as a group. Even though this assumption may be true for most residents, there are good reasons for preferring express consent procedures.

  6. The role of the antimicrobial compound 2,4-diacetylphloroglucinol in the impact of biocontrol Pseudomonas fluorescens F113 on Azospirillum brasilense phytostimulators.

    Science.gov (United States)

    Couillerot, Olivier; Combes-Meynet, Emeline; Pothier, Joël F; Bellvert, Floriant; Challita, Elita; Poirier, Marie-Andrée; Rohr, René; Comte, Gilles; Moënne-Loccoz, Yvan; Prigent-Combaret, Claire

    2011-06-01

    Pseudomonads producing the antimicrobial metabolite 2,4-diacetylphloroglucinol (Phl) can control soil-borne phytopathogens, but their impact on other plant-beneficial bacteria remains poorly documented. Here, the effects of synthetic Phl and Phl(+) Pseudomonas fluorescens F113 on Azospirillum brasilense phytostimulators were investigated. Most A. brasilense strains were moderately sensitive to Phl. In vitro, Phl induced accumulation of carotenoids and poly-β-hydroxybutyrate-like granules, cytoplasmic membrane damage and growth inhibition in A. brasilense Cd. Experiments with P. fluorescens F113 and a Phl(-) mutant indicated that Phl production ability contributed to in vitro growth inhibition of A. brasilense Cd and Sp245. Under gnotobiotic conditions, each of the three strains, P. fluorescens F113 and A. brasilense Cd and Sp245, stimulated wheat growth. Co-inoculation of A. brasilense Sp245 and Pseudomonas resulted in the same level of phytostimulation as in single inoculations, whereas it abolished phytostimulation when A. brasilense Cd was used. Pseudomonas Phl production ability resulted in lower Azospirillum cell numbers per root system (based on colony counts) and restricted microscale root colonization of neighbouring Azospirillum cells (based on confocal microscopy), regardless of the A. brasilense strain used. Therefore, this work establishes that Phl(+) pseudomonads have the potential to interfere with A. brasilense phytostimulators on roots and with their plant growth promotion capacity.

  7. Denitrification-derived nitric oxide modulates biofilm formation in Azospirillum brasilense.

    Science.gov (United States)

    Arruebarrena Di Palma, Andrés; Pereyra, Cintia M; Moreno Ramirez, Lizbeth; Xiqui Vázquez, María L; Baca, Beatriz E; Pereyra, María A; Lamattina, Lorenzo; Creus, Cecilia M

    2013-01-01

    Azospirillum brasilense is a rhizobacterium that provides beneficial effects on plants when they colonize roots. The formation of complex bacterial communities known as biofilms begins with the interaction of planktonic cells with surfaces in response to appropriate signals. Nitric oxide (NO) is a signaling molecule implicated in numerous processes in bacteria, including biofilm formation or dispersion, depending on genera and lifestyle. Azospirillum brasilense Sp245 produces NO by denitrification having a role in root growth promotion. We analyzed the role of endogenously produced NO on biofilm formation in A. brasilense Sp245 and in a periplasmic nitrate reductase mutant (napA::Tn5; Faj164) affected in NO production. Cells were statically grown in media with nitrate or ammonium as nitrogen sources and examined for biofilm formation using crystal violet and by confocal laser microscopy. Both strains formed biofilms, but the mutant produced less than half compared with the wild type in nitrate medium showing impaired nitrite production in this condition. NO measurements in biofilm confirmed lower values in the mutant strain. The addition of a NO donor showed that NO influences biofilm formation in a dose-dependent manner and reverses the mutant phenotype, indicating that Nap positively regulates the formation of biofilm in A. brasilense Sp245. © 2012 Federation of European Microbiological Societies. Published by Blackwell Publishing Ltd. All rights reserved.

  8. Phylogenetic placement of Dapisostemon gen. nov. and Streptostemon, two tropical heterocytous genera (Cyanobacteria)

    Czech Academy of Sciences Publication Activity Database

    Hentschke, G. S.; Johansen, J. R.; Pietrasiak, N.; Fiore, M.F.; Rigonato, J.; Sant’Anna, C. L.; Komárek, Jiří

    2016-01-01

    Roč. 245, č. 2 (2016), s. 129-143 ISSN 1179-3155 Institutional support: RVO:67985939 Keywords : new cyanobacterial genera * phylogeny * tropical habitats Subject RIV: EF - Botanics Impact factor: 1.240, year: 2016

  9. Gender differences in seasonal movement of dice snakes in Histria, southeastern Romania

    Czech Academy of Sciences Publication Activity Database

    Kärvemo, S.; Carlsson, M.; Tudor, M.; Sloboda, M.; Mihalca, A. D.; Ghira, I.; Bel, L.; Modrý, David

    2011-01-01

    Roč. 18, 20 September 2011 (2011), s. 245-254 ISSN 0934-6643 Institutional support: RVO:60077344 Keywords : Squamata * Natrix tessellata * dice snake * seasonal movements * activity patterns * sex ratio Subject RIV: EG - Zoology

  10. christ as once for all sacrifice: a cultural reading of hebrews

    African Journals Online (AJOL)

    UV/UFS. . Rev. K.J. Pali, Department of Practical ..... of suffering from spiritual trauma which led to various psychological, .... lamps (Ex. 27:21), weekly placements of the breads (Lv. 24:5), and daily.

  11. 76 FR 50199 - National Center To Enhance the Professional Development of School Personnel Who Share...

    Science.gov (United States)

    2011-08-12

    ... 20202-2550. Telephone: (202) 245-7506. If you use a telecommunications device for the deaf (TDD), call... products to instructors and their students through a cost-free, dedicated Web site that meets accessibility...

  12. 76 FR 80448 - VASRD Forum-Improving VA's Disability Evaluation Criteria for Neurological Conditions and...

    Science.gov (United States)

    2011-12-23

    ... Office located at 245 West Houston Street, New York, NY 10014. Public Comment: Contingent upon available capacity and time, individuals wishing to make oral statements or ask questions will be accommodated on a...

  13. Experimental Evaluation of Tachistoscopic Measurement: A Step Beyond Wundt’s Criticism

    Czech Academy of Sciences Publication Activity Database

    Vobořil, Dalibor; Jelínek, Martin; Květon, Petr

    2014-01-01

    Roč. 127, č. 2 (2014), 245–252 ISSN 0002-9556 Institutional support: RVO:68081740 Keywords : history of psychology * tachistoscop * experimental instruments Subject RIV: AN - Psychology Impact factor: 0.619, year: 2014

  14. 40 CFR Table 2 to Subpart Ggg of... - Partially Soluble HAP

    Science.gov (United States)

    2010-07-01

    ... Standards for Pharmaceuticals Production Pt. 63, Subpt. GGG, Table 2 Table 2 to Subpart GGG of Part 63... Epichlorohydrin 1,3-Dichloropropene Ethyl acrylate 2,4,5-Trichlorophenol Ethylbenzene 2-Butanone (mek) Ethylene...

  15. TJOG Vol 25 No 1.cdr

    African Journals Online (AJOL)

    places of delivery were government facilities (54.8%), private hospital (24.5%), traditional birth attendants ... public health institutions will encourage women to use the available maternity services. ... At the Safe Motherhood Initiative (SMI).

  16. Domestic Violence and Sexual Health among Young Women in ...

    African Journals Online (AJOL)

    Nneka Umera-Okeke

    coercion, physical threats, psychological abuse and controlling actions such as ... sexual risk behavior (Lang, Sales & Salazar, 2011: Exner-Cortens, Eckenrode & .... 25.0. 20.3. 657. 2288. Educational level. Primary. Secondary. Higher. 24.5***.

  17. South African Medical Journal - Vol 83, No 4 (1993)

    African Journals Online (AJOL)

    Indications for colonoscopy An analysis based on indications and diagnostic yield · EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. I. Berkowitz, M. Kaplan, 245-248 ...

  18. How fat works

    National Research Council Canada - National Science Library

    Wood, Philip A. (Philip Allen)

    2006-01-01

    ... for Making Good Decisions 192 IV. The Environment 17. Nutrient Labeling 203 18. 209 Alternative Medicine and Fad Diets 19. 214 Media Coverage of Health Research 225 Glossary 231 References Index 245 Ackn...

  19. Evaluation of sol–gel based magnetic 45S5 bioglass and bioglass–ceramics containing iron oxide

    International Nuclear Information System (INIS)

    Shankhwar, Nisha; Srinivasan, A.

    2016-01-01

    Multicomponent oxide powders with nominal compositions of (45 − x)·SiO_2·24.5CaO·24.5Na_2O·6P_2O_5xFe_2O_3 (in wt.%) were prepared by a modified sol–gel procedure. X-ray diffraction (XRD) patterns and high resolution transmission electron microscope images of the sol–gel products show fully amorphous structure for Fe_2O_3 substitutions up to 2 wt.%. Sol–gel derived 43SiO_2·24.5CaO·24.5Na_2O·6P_2O_5·2Fe_2O_3 glass (or bioglass 45S5 with SiO_2 substituted with 2 wt.% Fe_2O_3), exhibited magnetic behavior with a coercive field of 21 Oe, hysteresis loop area of 33.25 erg/g and saturation magnetization of 0.66 emu/g at an applied field of 15 kOe at room temperature. XRD pattern of this glass annealed at 850 °C for 1 h revealed the formation of a glass–ceramic containing sodium calcium silicate and magnetite phases in nanocrystalline form. Temperature dependent magnetization and room temperature electron spin resonance data have been used to obtain information on the magnetic phase and distribution of iron ions in the sol–gel glass and glass–ceramic samples. Sol–gel derived glass and glass–ceramic exhibit in-vitro bioactivity by forming a hydroxyapatite surface layer under simulated physiological conditions and their bio-response is superior to their melt quenched bulk counterparts. This new form of magnetic bioglass and bioglass ceramics opens up new and more effective biomedical applications. - Highlights: • Bioglass 45S5 containing 2 wt.% Fe_2O_3 is prepared by sol–gel route. • Fully amorphous bioglass exhibits spontaneous magnetization. • Gel powders with more than 2 wt.% Fe_2O_3 formed glass–ceramics. • γ-Fe_2O_3 in bioglass transformed irreversibly to magnetite upon heat treatment. • In vitro bioactivity of sol–gel samples is superior to their bulk counterparts.

  20. Polymorphism of Candidate Genes for Hypertension and their Relation to Blood Pressure and Intermediate Phenotypes in Normotensive Offspring of Hypertensives

    Czech Academy of Sciences Publication Activity Database

    Peleška, Jan; Jindra, A.; Jáchymová, M.; Horký, K.; Kolář, J.; Heller, S.; Marečková, Z.; Tomečková, Marie; Umnerová, V.; Reissigová, Jindra; Zvárová, Jana

    19 Suppl. 2, - (2001), s. 245-246 ISSN 0263-6352. [European Meeting on Hypertension /11./. 15.06.2001-19.06.2001, Milano] Institutional research plan: AV0Z1030915 Subject RIV: BA - General Mathematics

  1. Robust assessment of moderate heavy metal contamination levels in floodplain sediments: A case study on the Jizera River, Czech Republic

    Czech Academy of Sciences Publication Activity Database

    Matys Grygar, Tomáš; Nováková, Tereza; Bábek, O.; Elznicová, J.; Vadinová, N.

    2013-01-01

    Roč. 452, May (2013), s. 233-245 ISSN 0048-9697 Institutional support: RVO:61388980 Keywords : Background * Enrichment factor * Fluvial sediments * Heavy metals * Pollution Subject RIV: DD - Geochemistry Impact factor: 3.163, year: 2013

  2. Disease: H01646 [KEGG MEDICUS

    Lifescience Database Archive (English)

    Full Text Available e the first-line antidepressant drug treatment of depression and replaced tricyclic antidepressants (TCA) an... randomized clinical trials of SSRI treatment of depression. ... JOURNAL ... BMC Psychiatry 14:245 (2014) DOI:10

  3. The Office of the Secretary of the Air Force 1947-1965

    Science.gov (United States)

    1993-01-01

    245 xvi A ppendices ....................................................................................................... 255 1. Air...timed and did not endear the Air Force to McNamara and the President, both of whom had been acutely embarrassed. 69 Project Forecast One idea of

  4. Preparation of graphite derivatives by selective reduction of graphite oxide and isocyanate functionalization

    Czech Academy of Sciences Publication Activity Database

    Kumar, A. R. S. S.; Piana, Francesco; Mičušík, M.; Pionteck, J.; Banerjee, S.; Voit, B.

    2016-01-01

    Roč. 182, 1 October (2016), s. 237-245 ISSN 0254-0584 Institutional support: RVO:61389013 Keywords : graphite oxide * surface modification * conductive nanoparticles Subject RIV: CD - Macromolecular Chemistry Impact factor: 2.084, year: 2016

  5. Why Do Simple Molecules with "Isolated" Phenyl Rings Emit Visible Light?

    Science.gov (United States)

    Zhang, Haoke; Zheng, Xiaoyan; Xie, Ni; He, Zikai; Liu, Junkai; Leung, Nelson L C; Niu, Yingli; Huang, Xuhui; Wong, Kam Sing; Kwok, Ryan T K; Sung, Herman H Y; Williams, Ian D; Qin, Anjun; Lam, Jacky W Y; Tang, Ben Zhong

    2017-11-15

    π-Bonds connected with aromatic rings were generally believed as the standard structures for constructing highly efficient fluorophores. Materials without these typical structures, however, exhibited only low fluorescence quantum yields and emitted in the ultraviolet spectral region. In this work, three molecules, namely bis(2,4,5-trimethylphenyl)methane, 1,1,2,2-tetrakis(2,4,5-trimethylphenyl)ethane, and 1,1,2,2-tetraphenylethane, with nonconjugated structures and isolated phenyl rings were synthesized and their photophysical properties were systematically investigated. Interestingly, the emission spectra of these three molecules could be well extended to 600 nm with high solid-state quantum yields of up to 70%. Experimental and theoretical analyses proved that intramolecular through-space conjugation between the "isolated" phenyl rings played an important role for this abnormal phenomenon.

  6. Design and Development of Compact Microstrip Patch Antenna for Wireless Applications

    Directory of Open Access Journals (Sweden)

    R. Nagendra

    2017-09-01

    Full Text Available In this paper, a novel dual band microstrip patch antenna based on composite patch antenna and radiating part. By selecting a suitable offset feed position, it is feasible to provide 50Ω characteristic impedance and thus making better impedance matching. The proposed antenna has been improved broader bandwidth by using RT Duroid substrate. The radiating part is plays a important role in creating a lower operating band (2.45 GHz in addition to achieve miniaturization. The proposed antenna has to be fabricated with RT / Duroid substrate and dimensions of 19 × 22 × 0.8 mm. The measured -10 dB bandwidth of 200 MHz at 2.45 GHz and 990 MHz at 5.45 GHz, which is quite useful for Industrial, Scientific and Medical (ISM and WLAN applications.

  7. Retraction: Evaluation of Carcinogenic Effects of Electromagnetic Fields (Emf

    Directory of Open Access Journals (Sweden)

    Bakir Mehic

    2010-08-01

    Full Text Available This retracts the article "EVALUATION OF CARCINOGENIC EFFECTS OF ELECTROMAGNETIC FIELDS (EMF" on page 245. The Editor-in-chief of the Bosnian Journal ofBasic Medical Sciences has decided to retract the article from Bayazit V et al. [1] entitled as: “Evaluation of carcinogenic effects of electromagnetic fields (EMF” published in Bosn J Basic Med Sci. 2010 Aug;10(3:245-50.After the editorial office was alerted of possible plagiarism in the article, it conducted thorough investigation and concluded that the article apparently represents plagiarized material from two World Health Organization reports, one European Commission report and other sources. Since this is considered scientific plagiarism and scientific misconduct, Editor-in-chief has decided to withdraw the article. The authors have agreed with the editorial office decision.

  8. Theoretical and experimental investigation of a rectenna element for microwave power transmission

    Science.gov (United States)

    Mcspadden, James O.; Yoo, Taewhan; Chang, Kai

    1992-01-01

    A microstrip measurement system has been designed to analyze packaged GaAs Schottky barrier diodes under small and large signal conditions. The nonlinear equivalent circuit parameters of the diode are determined using a small signal test method that analyzes the diode's scattering parameters at various bias levels. The experimental results of a 2.45 GHz diode are verified using a nonlinear circuit simulation program based on a multireflection algorithm. A 35 GHz rectenna has been built using a microstrip patch antenna and Ka-band mixer diode. The measured efficiency was 29 percent at 120 mW input power. A frequency selective surface is designed using an equivalent circuit model to reduce the second harmonic radiations for a 2.45 GHz rectenna. Theoretical results are found to be in fairly good agreement with experiments.

  9. Plasma focus system: Design, construction and experiments

    International Nuclear Information System (INIS)

    Alacakir, A.; Akguen, Y.; Boeluekdemir, A. S.

    2007-01-01

    The aim of this work is to construct a compact experimental system for fusion research. The design, construction and experiments of the 3 kJ Mather type plasma focus machine is described. This machine is established for neutron yield and fast neutron radiography by D-D reaction which is given by D + D→ 3 He (0.82 MeV) + n (2.45 MeV) . Investigation of the geometry of plasma focus machine in the presence of high voltage drive and vacuum system setup is shown. 108 neutron per pulse and 200 kA peak current is obtained for many shots. Scintillator screen for fast neutron imaging, sensitive to 2.45 MeV neutrons, is also manufactured in our labs. Structural neutron shielding computations for safety is also completed

  10. Herbicide effect on 14C cellulose and 14C straw decomposition in soils. Influence of phenylcarbamates on biological activity

    International Nuclear Information System (INIS)

    Ramanujam, T.; Bellinck, Celine; Mayaudon, J.

    1979-01-01

    Aniline, 2,4-D, 2,4,5-T, simazine and paraquat have no effect on cellulose decomposition in soils. The monophenylcarbamates SN 38210, IPC and CIPC, applied at 500 ppm exert per contra an important inhibitory effect. The decomposition of straw is little influenced by the phenylcarbamates, 100 ppm of 2,4-D, 2,4,5-T or simazine significantly increase the decomposition of straw in a sandy soil. The diphenylcarbamate SN 38584 has little effect on biological activity of soils; this is strongly inhibited by application of 500 ppm of SN 38210. This inhibition may be reduced by amending the soil with lignin but addition of straw or cellulose doesn't enhance biological activity of soil. Addition of 5000 ppm of soil extract or humic acids reduces somewhat the toxicity of SN 38210 [fr

  11. About Military Sexual Trauma

    Medline Plus

    Full Text Available ... the types of incidents that constitute MST, the effects of MST on survivors and the services available to Veterans who have experienced ... Prolonged Exposure for PTSD - Duration: 2:45. Veterans Health Administration ...

  12. The Chlamydomonas genome reveals the evolution of key animal and plant functions

    Czech Academy of Sciences Publication Activity Database

    Merchant, S.S.; Prochnik, S. E.; Bišová, Kateřina

    2007-01-01

    Roč. 318, - (2007), s. 245-251 ISSN 0036-8075 Institutional research plan: CEZ:AV0Z50200510 Keywords : chlamydomonas reinhardtii * alga * eukaryotic cell Subject RIV: EE - Microbiology, Virology Impact factor: 26.372, year: 2007

  13. Sulfonamiden en Dapson in vleeswaren

    NARCIS (Netherlands)

    Vaessen HAMG; Kamp CG van de

    1987-01-01

    Onderzocht op sulfanilamide, sulfadiazine, sulfadimidine, sulfadoxine en sulfaquinoxaline alsmede Dapson zijn 245 monsters vleeswaar waaronder: leverworst, kookworst, bloedworst, boterhamworst, rookworst en tongeworst. Bij HPTLC-screening was in geen van de monsters DAPSON aantoonbaar, wel waren

  14. Změny Římského statutu Mezinárodního trestního soudu

    Czech Academy of Sciences Publication Activity Database

    Šturma, Pavel

    2010-01-01

    Roč. 9, č. 8 (2010), s. 245-251 ISSN 1213-5313 Institutional research plan: CEZ:AV0Z70680506 Keywords : public international law * International Criminal Court * crime of agression Subject RIV: AG - Legal Sciences

  15. Pharmaceuticals, benzene, toluene and chlorobenzene removal from contaminated groundwater by combined UV/H2O2 photo-oxidation and aeration

    Czech Academy of Sciences Publication Activity Database

    Lhotský, O.; Krákorová, Eva; Mašín, P.; Žebrák, R.; Linhartová, Lucie; Křesinová, Zdena; Kašlík, J.; Steinová, J.; Rodsand, T.; Filipová, Alena; Petrů, K.; Kroupová, K.; Cajthaml, Tomáš

    2017-01-01

    Roč. 120, SEP 1 2017 (2017), s. 245-255 ISSN 0043-1354 Institutional support: RVO:61388971 Keywords : Pharmaceuticals * BTEX * Chlorobenzene Subject RIV: EE - Microbiology, Virology OBOR OECD: Microbiology Impact factor: 6.942, year: 2016

  16. 2005 Puget Sound LiDAR Consortium (PSLC) Topographic LiDAR: Olympic Peninsula

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Terrapoint collected Light Detection and Ranging (LiDAR) data for the Olympic Peninsula project of 2005, totaling approximately 114.59 sq mi: 24.5 for Clallam...

  17. Paldisklased said USA mereväelt tasuta arstiabi / Eda Post

    Index Scriptorium Estoniae

    Post, Eda, 1983-

    2002-01-01

    Kriisimeditsiiniõppuseks Tallinna sõitnud USA mereväe hospidalilaevas Comfort saavad erialast väljaõpet 245 meedikut ning tasuta hambaravi ja nägemise kontrolli üle poolesaja vähekindlustatud Paldiski elaniku

  18. Der Umgang mit den beschlagnahmten Kunstwerken aus Schlössern des ehemaligen Herrscherhauses Habsburg-Lothringen. Ein Dilemma für die junge Tschechoslowakische Republik nach 1918

    Czech Academy of Sciences Publication Activity Database

    Uhlíková, Kristina

    2016-01-01

    Roč. 70, 1/2 (2016), s. 232-245 ISSN 0029-9626 Institutional support: RVO:68378033 Keywords : Archduke Franz Ferdinand d´Este * history of monument preservation * castles Subject RIV: AL - Art, Architecture, Cultural Heritage

  19. 76 FR 79485 - Interstate Land Sales Registration Program (Regulations J, K, and L)

    Science.gov (United States)

    2011-12-21

    ... Secretary's consumer protection functions relating to ILSA.\\2\\ Accordingly, effective July 21, 2011, the... Vol. 76 Wednesday, No. 245 December 21, 2011 Part VII Bureau of Consumer Financial Protection 12... Regulations#0;#0; [[Page 79486

  20. Small molecule inhibitors of protein interaction with glycosaminoglycans (SMIGs), a novel class of bioactive agents with anti-inflammatory properties

    Czech Academy of Sciences Publication Activity Database

    Harris, N.; Kogan, F. Y.; Ilková, G.; Juhás, Štefan; Lahmy, O.; Gregor, Y. I.; Koppel, J.; Zhuk, R.; Gregor, P.

    2014-01-01

    Roč. 1840, č. 1 (2014), s. 245-254 ISSN 0304-4165 Institutional support: RVO:67985904 Keywords : heparan sulfate * heparin binding protein * glycosaminoglycan Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 4.381, year: 2014

  1. PCR

    African Journals Online (AJOL)

    Elham

    2013-07-03

    Jul 3, 2013 ... was constructed with competitive strategy by PCR-cloning technique and the limitation range was determined. The PCR products of MTB and IAC were 245 and 660 bp, respectively on .... products' differentiation was easy.

  2. Genetic diversity and population structure in Meconopsis ...

    African Journals Online (AJOL)

    STORAGESEVER

    2010-05-24

    May 24, 2010 ... The location and main ecological characteristics of sample sites are shown in ..... suggest that this is wind-pollinated and allogamous plant species ... (Teleostei, Characidae) from an urban stream, Hydrobiology, 553: 245-254 ...

  3. Data of evolutionary structure change: 1LA6A-2ZLWD [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1LA6A-2ZLWD 1LA6 2ZLW A D -SLSDKDKAAVRALWSKIGKSSDAIGNDALSRMIVVYPQ...R VQLSGEEKAAVLALWDKV--NEEEVGGEALGRLLVVYPWTQRFFDSFGDLSNPGAVMGNPKVKAHGKKVLHSFGEGVHHLDNLKGTFAALSEL...line>ASN CA 245 2ZLW D 2ZLWD... 1 2ZLW D 2ZLWD LWD

  4. Potent Antidiuretic Agonists, Deamino-Vasopressin and Desmopressin, and Their Inverso Analogs: NMR Structure and Interactions With Micellar and Liposomic Models of Cell Membrane

    Czech Academy of Sciences Publication Activity Database

    Lubecka, E. A.; Sikorska, E.; Sobolewski, D.; Prahl, A.; Slaninová, Jiřina; Ciarkowski, J.

    2016-01-01

    Roč. 106, č. 3 (2016), s. 245-259 ISSN 0006-3525 Institutional support: RVO:61388963 Keywords : desmopressin * deamino-vasopressin * anionic-zwitterionic micelles * liposomes * inverso analogs Subject RIV: CE - Biochemistry Impact factor: 1.908, year: 2016

  5. Supramolecular interactions between chiral ions: Synthesis and characterization of [M-II(bpy)(3)][VO(O-2)(ox)(bpy)].7H(2)O (M = Fe and Ni)

    Czech Academy of Sciences Publication Activity Database

    Antal, P.; Tatiersky, J.; Schwendt, P.; Žák, Z.; Gyepes, Robert

    2013-01-01

    Roč. 1032, JAN 2013 (2013), s. 240-245 ISSN 0022-2860 Institutional support: RVO:61388955 Keywords : vanadium(V) * iron(II) * nickel(II) complexes Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 1.599, year: 2013

  6. 76 FR 7231 - Wild Horse and Burro Advisory Board; Meeting

    Science.gov (United States)

    2011-02-09

    ... Sheraton Phoenix Downtown Hotel, 340 N. 3rd Street, Phoenix, Arizona, 85004. The hotel phone number for... June 15, 2010 Minutes Program Updates Gathers Adoptions Budget Facilities Break (2:20 p.m.--2:45 p.m...

  7. Sperm antibodies, intra-acrosomal sperm proteins, and cytokines in semen in men from infertile couples

    Czech Academy of Sciences Publication Activity Database

    Ulčová-Gallová, Z.; Gruberová, J.; Vrzalová, J.; Bibková, K.; Pěknicová, Jana; Mičanová, Z.; Topolčan, O.

    2009-01-01

    Roč. 61, č. 3 (2009), s. 236-245 ISSN 1046-7408 Institutional research plan: CEZ:AV0Z50520701 Keywords : intra-acrosomal protein * cytokines * infertility Subject RIV: EC - Immunology Impact factor: 2.172, year: 2009

  8. Assessing the Current State of Amber Force Field Modifications for DNA

    Czech Academy of Sciences Publication Activity Database

    Galindo-Murillo, R.; Robertson, J.; Zgarbová, M.; Šponer, Jiří; Otyepka, M.; Jurečka, P.; Cheatham III, T. E.

    2016-01-01

    Roč. 12, č. 8 (2016), s. 4114-4127 ISSN 1549-9618 Institutional support: RVO:68081707 Keywords : molecular-dynamics simulations * particle mesh ewald * pair opening kinetics Subject RIV: BO - Biophysics Impact factor: 5.245, year: 2016

  9. NIHSeniorHealth

    Medline Plus

    Full Text Available ... 03 Play next Play now Eating for Your Health - Duration: 5 minutes, 3 seconds. 7,016 views ... 30+ more This item has been hidden Complementary Health Approaches Play all 2:45 Play next Play ...

  10. Assessment of the efficacy of desmopressin in treatment of Primary ...

    African Journals Online (AJOL)

    Farida ElBaz

    2015-03-31

    Mar 31, 2015 ... Monosymptomatic Nocturnal Enuresis (PMNE) in Egyptian children. Method: The study .... short term memory and a composite score is derived from the area .... to 91%, but only 24.5% of subjects achieved long-term dryness.

  11. Využití akustické emise při vrypové zkoušce

    Czech Academy of Sciences Publication Activity Database

    Tomáštík, J.; Čtvrtlík, Radim; Dráb, M.; Boháč, P.; Koula, V.; Cvrk, K.; Hrabovský, M.; Jastrabík, L.; Veselský, M.

    2016-01-01

    Roč. 61, č. 10 (2016), s. 242-245 ISSN 0447-6441 R&D Projects: GA TA ČR TA03010743 Institutional support: RVO:68378271 Keywords : acoustic emission analysis * scratch test * thin films Subject RIV: BI - Acoustics

  12. HLA-G levels in serum and plasma

    Czech Academy of Sciences Publication Activity Database

    Rudstein-Svetlicky, N.; Loewenthal, R.; Hořejší, Václav; Gazit, E.

    2007-01-01

    Roč. 69, č. 1 (2007), s. 140-142 ISSN 0001-2815 Institutional research plan: CEZ:AV0Z50520514 Keywords : HLA-G * serum * plasma Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 2.245, year: 2007

  13. Fatty acids composition of diploid and triploid populations of Tench (Tinca tinca L.)

    Czech Academy of Sciences Publication Activity Database

    Buchtová, H.; Smutná, M.; Vorlová, L.; Svobodová, Z.; Flajšhans, Martin

    2004-01-01

    Roč. 73, - (2004), s. 235-245 ISSN 0001-7213 R&D Projects: GA MŠk ME 638 Keywords : fatty acids * diploid and triploid tench * genome polyploidy Subject RIV: ED - Physiology Impact factor: 0.449, year: 2004

  14. NIHSeniorHealth

    Medline Plus

    Full Text Available ... 03 Play next Play now Eating for Your Health - Duration: 5 minutes, 3 seconds. 7,000 views ... 30+ more This item has been hidden Complementary Health Approaches Play all 2:45 Play next Play ...

  15. Mysids (Crustacea) from the salt pans of Mumbai, India, with a description of a new species

    Digital Repository Service at National Institute of Oceanography (India)

    Biju, A.; Panampunnayil, S.U.

    on Marine Science, University of Tokyo 256–273. Quintero C, de Roa EZ. 1973. Notas bioecologicas sobre Metamysidopsis insularis Brattegard (Crusatacea-Mysidacea) en una laguna litoral de Venezuela. Acta Biologica Venezuelica 8: 245-278. Ramamoorthy K...

  16. 77 FR 76936 - Defense Federal Acquisition Regulation Supplement; Technical Amendments

    Science.gov (United States)

    2012-12-31

    ...; List of Subjects in 48 CFR Parts 201, 203, 204, 215, 219, 245, and 252 Government procurement. Manuel... clause 52.203-13, Contractor Code of Business Ethics and Conduct, is the DoD Office of Inspector General...

  17. 45 CFR 3.2 - Applicability.

    Science.gov (United States)

    2010-10-01

    ... following provisions: § 3.24 Parking permits; § 3.25 Servicing of vehicles; § 3.42 Hobbies and sports; and... and/or $500 fine. 9. Gambling Article 27, Secs. 240, 245 Prohibits betting, wagering and gambling, and...

  18. Administrative Management Competencies for Safety Professionals.

    Science.gov (United States)

    Blair, Earl H.; Logan, Joyce P.

    1999-01-01

    In a 1997 study, 245 safety professionals and educators identified and prioritized management competencies that are important for safety professionals. Results show that the most important competencies are communication, listening, motivating others, creative thinking, and flexibility. (JOW)

  19. NIHSeniorHealth

    Medline Plus

    Full Text Available ... 03 Play next Play now Eating for Your Health - Duration: 5 minutes, 3 seconds. 6,981 views ... 30+ more This item has been hidden Complementary Health Approaches Play all 2:45 Play next Play ...

  20. Development of 2.45GHz compact ECR ion sources with permanent magnets

    International Nuclear Information System (INIS)

    Tojyo, E.; Ohshiro, Y.; Oyaizu, M.; Shirakabe, Y.

    1993-05-01

    Two kinds of new compact ECR ion sources have been developed by use of permanent magnets only, for the purpose of acceleration tests of the 25.5MHz INS split coaxial RFQ linac and the 50MHz one. Confined magnetic fields of sources are constructed by permanent magnets only. In this paper design parameters, structures, magnetic field distributions and extracted beam properties of these sources are described briefly. (author)

  1. Table of Radionuclides (Vol. 7 - A = 14 to 245) - Monograph BIPM-5

    International Nuclear Information System (INIS)

    Arinc, Arzu; Be, Marie-Martine; Chiste, Vanessa; Mougeot, Xavier; Chechev, Valery P.; Galan, Monica; Huang, Xialong; Kondev, Filip G.; Luca, Aurelian; Nichols, Alan L.

    2013-02-01

    This monograph is one of several published in a series by the Bureau International des Poids et Mesures (BIPM) on behalf of the Consultative Committee for Ionizing Radiation (Comite Consultatif des Rayonnements Ionisants, CCRI). The aim of this series of publications is to review topics that are of importance for the measurement of ionizing radiation and especially of radioactivity, in particular those techniques normally used by participants in international comparisons. The purpose of this monograph, number 5 in the series, is to present the recommended values of nuclear and decay data for a wide range of radionuclides. Activity measurements for more than sixty-three of these radionuclides have already been the subject of comparisons under the auspices of Section II (dedicated to the Measurement of radionuclides) of the CCRI. The material for this monograph is now covered in seven volumes. The first two volumes contain the primary recommended data relating to half-lives, decay modes, x-rays, gamma-rays, electron emissions; alpha- and beta-particle transitions and emissions, and their uncertainties for a set of sixty-eight radionuclides, Volume 1 for those radionuclides with mass number up to and including 150 and Volume 2 for those radionuclides with mass number over 150. Volume 3 contains the equivalent data for twenty-six additional radionuclides as listed and re-evaluations for 125 Sb and 153 Sm. Volume 4 contains the data for a further thirty-one radionuclides with a re-evaluation for 226 Ra and Volume 5 includes seventeen new radionuclide evaluations and eight re-evaluations of previous data as identified in the contents page. Volume 6 contains twenty-one new radionuclide evaluations and four re-evaluations, for 64 Cu, 236 Np, 37 Np and 239 U. The present Volume 7 contains twenty-four new radionuclide evaluations and five re-evaluations, for 67 Ga, 208 Tl, 228 Th, 242 Cm and 244 Cm. The data have been collated and evaluated by an international working group (Decay Data Evaluation Project, DDEP) led by the Laboratoire National de Metrologie et d'Essais - Laboratoire National Henri Becquerel (LNE-LNHB). The evaluators have agreed on the methodologies to be used and the CD-ROM included with this monograph contains the evaluators' comments for each radionuclide in addition to the data tables included in the monograph itself. The work involved in evaluating nuclear data is ongoing and the recommended values are kept up to date on the LNE-LNHB web site at http://www.nucleide.org/DDEP_WG/DDEPdata.htm

  2. 8 CFR 245a.18 - Ineligibility and applicability of grounds of inadmissibility.

    Science.gov (United States)

    2010-01-01

    ... history that shows the ability to support himself or herself even though his or her income may be below the poverty level is not excludable under paragraph (c)(2)(vi) of this section. The alien's employment history need not be continuous in that it is uninterrupted. In applying the Special Rule, the Service will...

  3. Purex canyon exhaust fan bearing temperature monitoring system doric 245 datalogger programming

    International Nuclear Information System (INIS)

    Blackaby, W.B.

    1994-01-01

    A micro-processor based datalogger is used to monitor, display, and log seventeen RTD temperature channels. Five bearings are monitored for each of the three electric motor-fan assemblies and two bearings are monitored on the steam turbine unit. Several alarms per data channel (a High alarm at 236 degrees and a High High alarm at 246 degrees F) will alert the operation's staff to increasing abnormal bearing temperatures. This procedure is cross-referenced to the manufacturers manual. All programming steps will have the following footnote: Mpg x-xx. The Mpg refers to the Manual page, with x as the section number and xx as the page number in that section. When more information is needed, such as pictures or details, then the manual section and page number is provided

  4. COMBINED BIOLOGICAL-PHOTOCATALYTIC TREATMENT FOR THE MINERALIZATION OF A MIXTURE OF CHLOROPHENOLS IN AN ELECTROLYTE-CONTAINING MODEL WATER AND SPONTANEOUS SEDIMENTATION OF TITANIUM DIOXIDE

    Directory of Open Access Journals (Sweden)

    Dhanus Suryaman

    2010-06-01

    Full Text Available To shorten the biological treating time and to examine the effect of electrolytes in a model water on the photocatalytic treatment, the combined biological-photocatalytic treatment was evaluated for removal of a mixture (total: 100 mg L-1, each: 25 mg L-1 of 2-chlorophenol (2-CP, 2,4-dichlorophenol (2,4-DCP, 2,4,5-trichlorophenol (2,4,5-TCP, and pentachlorophenol (PCP in tap water. The mineralization of the four phenols was performed by a flow (biological treatment-circulative flow (photocatalytic treatment operation under black light and sunlight irradiations. After a large portion of biodegradable 2-CP and 2,4-DCP, and around half amount of slightly biodegradable 2,4,5-TCP were removed by the biological treatment, the remained three chlorophenols, biorecalcitrant PCP, and  biodegradation products were completely removed by the subsequent photocatalytic treatment. The combined treatment significantly shortened the degradation time only the biotreatment. High circulative flow rate (600 mL min-1 enabled for TiO2 particles to completely suspend in a tubular photoreactor and resulted in high removals of chlorophenols and TOC. Sunlight irradiation was successfully used and the saving of the electric energy of black light was possible. Since TiO2 particles in the tap water spontaneously sedimented on standing after the photocatalytic treatment, the combined system can be operated by integrating it with the TiO2 separation.   Keywords: photocatalysis, titanium dioxide, biodegradation, pollutant, wastewater

  5. Role of Free Radicals and Biotransformation in Trichloronitrobenzene-Induced Nephrotoxicity In Vitro.

    Science.gov (United States)

    Rankin, Gary O; Tyree, Connor; Pope, Deborah; Tate, Jordan; Racine, Christopher; Anestis, Dianne K; Brown, Kathleen C; Dial, Mason; Valentovic, Monica A

    2017-05-31

    This study determined the comparative nephrotoxic potential of four trichloronitrobenzenes (TCNBs) (2,3,4-; 2,4,5-; 2,4,6-; and 3,4,5-TCNB) and explored the effects of antioxidants and biotransformation inhibitors on TCNB-induced cytotoxicity in isolated renal cortical cells (IRCC) from male Fischer 344 rats. IRCC were incubated with a TCNB up to 1.0 mM for 15-120 min. Pretreatment with an antioxidant or cytochrome P450 (CYP), flavin monooxygenase (FMO), or peroxidase inhibitor was used in some experiments. Among the four TCNBs, the order of decreasing nephrotoxic potential was approximately 3,4,5- > 2,4,6- > 2,3,4- > 2,4,5-TCNB. The four TCNBs exhibited a similar profile of attenuation of cytotoxicity in response to antioxidant pretreatments. 2,3,4- and 3,4,5-TCNB cytotoxicity was attenuated by most of the biotransformation inhibitors tested, 2,4,5-TCNB cytotoxicity was only inhibited by isoniazid (CYP 2E1 inhibitor), and 2,4,6-TCNB-induced cytotoxicity was inhibited by one CYP inhibitor, one FMO inhibitor, and one peroxidase inhibitor. All of the CYP specific inhibitors tested offered some attenuation of 3,4,5-TCNB cytotoxicity. These results indicate that 3,4,5-TCNB is the most potent nephrotoxicant, free radicals play a role in the TCNB cytotoxicity, and the role of biotransformation in TCNB nephrotoxicity in vitro is variable and dependent on the position of the chloro groups.

  6. Subcritical limits for special fissile actinides

    International Nuclear Information System (INIS)

    Clark, H.K.

    1980-01-01

    Critical masses and subcritical mass limits in oxide-water mixtures were calculated for actinide nuclides other than 233 U, 235 U, and 239 Pu that have an odd number of neutrons in the nucleus: S/sub n/ transport theory was used together with cross sections, drawn from the GLASS multigroup library, developed to provide accurate forecasts of actinide production at Savannah River. The subcritical limits are 201 g for 241 Pu, 13 g for 242 /sup m/Am, 90 g for 243 Cm, 30 g for 245 Cm, 900 g for 247 Cm, 10 g for 249 Cf, and 5 g for 251 Cf. Association of 241 Pu with an equal mass of 240 Pu increases the 241 Pu limit to a value greater than that for pure 239 Pu. Association of 242 /sup m/Am with 241 Am increases the limit for the mixture to that for dry, theoretical density AmO 2 at isotopic concentrations of 242 /sup m/Am less than approx. 6%. Association of 245 Cm with 244 Cm increases the limit according to the formula 30 + 0.3 244 Cm/ 245 Cm up to the limit for dry CmO 2 . A limiting mass of 8.15 kg for plutonium containing at least 67% 238 Pu as oxide was calculated that applies (provided 240 Pu exceeds 241 Pu) with no limit on moderation. 1 figure, 5 tables

  7. A static analytical apparatus for vapour pressures and (vapour + liquid) phase equilibrium measurements with an internal stirrer and view windows

    International Nuclear Information System (INIS)

    Guo, Hao; Gong, Maoqiong; Dong, Xueqiang; Wu, Jianfeng

    2014-01-01

    Highlights: • A new static analytical apparatus for vapour pressures and VLE data was designed. • The {R600a + R245fa} system was selected as a verification system. • Correlation of VLE data was made using PRvdWs and PRHVNRTL model. • Good agreement can be found with the literature data. - Abstract: A new static analytical apparatus for reliable vapour pressures and (vapour + liquid) equilibrium data of small-scale cell (≈150 mL) with internal stirrer and view windows was designed. In this work, the compositions of the phases were analyzed by a gas chromatograph connected on-line with TCD detectors. The operating pressure ranges from (0 to 3000) kPa, and the operating temperature range from (293 to 400) K. Phase equilibrium data for previously reported systems were first measured to test the credibility of the newly developed apparatus. The test included vapour pressure of 1,1,1,3,3-pentafluoropropane (R245fa) and isobutane (R600a), VLE of the (R600a + R245fa) system from T = (293.150 to 343.880) K. The measured VLE data are regressed with thermodynamic models using Peng–Robinson EoS with two different models, viz. the van der Waals mixing rule, and the Huron–Vidal mixing rule utilising the non-random two-liquid activity coefficient model. Thermodynamic consistency testing is also performed for the newly measured experimental data

  8. [Detection of putative polysaccharide biosynthesis genes in Azospirillum brasilense strains from serogroups I and II].

    Science.gov (United States)

    Petrova, L P; Prilipov, A G; Katsy, E I

    2017-01-01

    It is known that in Azospirillum brasilense strains Sp245 and SR75 included in serogroup I, the repeat units of their O-polysaccharides consist of five residues of D-rhamnose, and in strain SR15, of four; and the heteropolymeric O-polysaccharide of A. brasilense type strain Sp7 from serogroup II contains not less than five types of repeat units. In the present work, a complex of nondegenerate primers to the genes of A. brasilense Sp245 plasmids AZOBR_p6, AZOBR_p3, and AZOBR_p2, which encode putative enzymes for the biosynthesis of core oligosaccharide and O-polysaccharide of lipopolysaccharide, capsular polysaccharides, and exopolysaccharides, was proposed. By using the designed primers, products of the expected sizes were synthesized in polymerase chain reactions on genomic DNA of A. brasilense Sp245, SR75, SR15, and Sp7 in 36, 29, 23, and 12 cases, respectively. As a result of sequencing of a number of amplicons, a high (86–99%) level of identity of the corresponding putative polysaccharide biosynthesis genes in three A. brasilense strains from serogroup I was detected. In a blotting-hybridization reaction with the biotin-labeled DNA of the A. brasilense gene AZOBR_p60122 coding for putative permease of the ABC transporter of polysaccharides, localization of the homologous gene in ~120-MDa plasmids of the bacteria A. brasilense SR15 and SR75 was revealed.

  9. SAMJ

    African Journals Online (AJOL)

    Rotman. Pp. xxiv + 481. NLG480/US$245. Amsterdam: Elsevier. Science. 1998. ISBN 0-444-82608-4. New Trends ... Advances in Neutron Capture. Vol. I: Medicine and Physics. Vol. JI : Chemistry and Biology. * Edited by Borje Larsson, John.

  10. Taxonomic revision of the genus Asellia (Chiroptera: Hipposideridae) with description of a new species from southern Arabia

    Czech Academy of Sciences Publication Activity Database

    Benda, P.; Vallo, Peter; Reiter, A.

    2011-01-01

    Roč. 13, č. 2 (2011), s. 245-270 ISSN 1508-1109 Institutional research plan: CEZ:AV0Z60930519 Keywords : Asellia * morphology * morphometry * mtDNA * taxonomy * phylogeny Subject RIV: EG - Zoology Impact factor: 1.116, year: 2011

  11. The toughness of split graphs

    NARCIS (Netherlands)

    Woeginger, G.J.

    1998-01-01

    In this short note we argue that the toughness of split graphs can be computed in polynomial time. This solves an open problem from a recent paper by Kratsch et al. (Discrete Math. 150 (1996) 231–245).

  12. Dicty_cDB: Contig-U13442-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available e: 915,245,386 Effective search space: 26542116194 Effective search space used: 2...6542116194 Neighboring words threshold: 12 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits

  13. Zero-ODP Refrigerants for Low Tonnage Centrifugal Chiller Systems

    National Research Council Canada - National Science Library

    Gui, Fulin

    1996-01-01

    ..., HFC-236cb, HFC-236fa, HFC-245cb, and HFC-254cb, for centrifugal chiller applications. We took into account the thermodynamic properties of the refrigerant and aerodynamic properties of the impeller compression process to this evaluation...

  14. Design of a seismic energy dissipator for an interruptor type 3AS2-45; Diseno de un disipador de energia sismica para un interruptor tipo 3AS2-45

    Energy Technology Data Exchange (ETDEWEB)

    Castro Felix, Jaime

    2004-02-15

    With the aid of the theory behind seismically isolated structures and the bi-linear behavior of an isolated system of Multiple Degrees of Freedom (MDOF), the information obtained on the spectral analysis is complemented with the purpose of simulating one itself for the design of a dissipator of seismic energy. The seismicity in the world is briefly explained, (in Mexico in special for the Geothermal Field of Cerro Prieto), the types of earthquakes, etc., to give way to a documentation of the state-of-the-art in advanced seismic resistant systems and to a procedure to establish the level of seismic qualification of electrical equipment from the level of seismic performance for the Mexican Republic. [Spanish] Con la ayuda de la teoria detras de estructuras aisladas sismicamente y el comportamiento bilineal de un sistema de aislamiento de Multiples Grados de Libertad (MDOF), se complementa la informacion recabada sobre el analisis espectral con el fin de simular uno propio para el diseno de un disipador de energia sismica. Se explica brevemente la sismicidad en el mundo, en Mexico, en especial el Campo Geotermico de Cerro Prieto, los tipos de sismos, etc., para dar paso a una documentacion del estado del arte en sistemas sismorresistentes avanzados y a un procedimiento para establecer el nivel de calificacion sismica de equipos electricos a partir del Nivel de desempeno sismico para la Republica Mexicana.

  15. Ellipticine induces apoptosis in T-cell lymphoma via oxidative DNA damage

    DEFF Research Database (Denmark)

    Savorani, Cecilia; Manfé, Valentina; Biskup, Edyta

    2015-01-01

    (CTCL), a disease that is progressive, chemoresistant and refractory to treatment. We tested the effect of ellipticine in three cell lines with different p53 status: MyLa2000 (p53(wt/wt)), SeAx ((G245S)p53) and Hut-78 ((R196Stop)p53). Ellipticine caused apoptosis in MyLa2000 and SeAx and restored...... the transcriptional activity of (G245S)p53 in SeAx. However, p53 siRNA knockdown experiments revealed that p53 was not required for ellipticine-induced apoptosis in CTCL. The lipophilic antioxidant α-tocopherol inhibited ellipticine-dependent apoptosis and we linked the apoptotic response to the oxidative DNA damage....... Our results provide evidence that ellipticine-induced apoptosis is exerted through DNA damage and does not require p53 activation in T-cell lymphoma....

  16. Bacterial mutagenicity and mammalian cell DNA damage by several substituted anilines.

    Science.gov (United States)

    Zimmer, D; Mazurek, J; Petzold, G; Bhuyan, B K

    1980-04-01

    Several substituted alkyl- and haloanilines were tested for their ability to mutate Salmonella typhimurium and to damage the DNA of mammalian (V79) cells. These results were correlated with their reported carcinogenicity. Of 9 suspected carcinogens, 4 were bacterial mutagens and 4 (out of 7 tested) damaged DNA of V79 cells. The following compounds were weakly mutagenic (less than 150 revertants/mumole): 4-fluoroaniline, 2,3-, 2,4-, 2,5- and 3,4-dimethylaniline, and 2-methyl-4-fluoroaniline. The following compounds were strong mutagens: 2,4,5-trimethylaniline, 2-methyl-4-chloro-, and 2-methyl-4-bromo-, 4-methyl-2-chloro-, 4-methyl-2-bromo- and 2-ethyl-4-chloroaniline. The compounds which damaged DNA in V79 cells were: 2 methyl-4-chloroaniline, 2-methyl-4-bromoaniline, 2,4,5- and 2,4,6-trimethylaniline.

  17. Methods of Phase and Power Control in Magnetron Transmitters for Superconducting Accelerators

    Energy Technology Data Exchange (ETDEWEB)

    Kazadevich, G. [MUONS Inc., Batavia; Johnson, R. [MUONS Inc., Batavia; Neubauer, M. [MUONS Inc., Batavia; Lebedev, V. [Fermilab; Schappert, W. [Fermilab; Yakovlev, V. [Fermilab

    2017-05-01

    Various methods of phase and power control in magnetron RF sources of superconducting accelerators intended for ADS-class projects were recently developed and studied with conventional 2.45 GHz, 1 kW, CW magnetrons operating in pulsed and CW regimes. Magnetron transmitters excited by a resonant (injection-locking) phasemodulated signal can provide phase and power control with the rates required for precise stabilization of phase and amplitude of the accelerating field in Superconducting RF (SRF) cavities of the intensity-frontier accelerators. An innovative technique that can significantly increase the magnetron transmitter efficiency at the widerange power control required for superconducting accelerators was developed and verified with the 2.45 GHz magnetrons operating in CW and pulsed regimes. High efficiency magnetron transmitters of this type can significantly reduce the capital and operation costs of the ADSclass accelerator projects.

  18. Synthesis and antimicrobial evaluation of new 3-alkyl/aryl-2-[((alpha,alpha-diphenyl-alpha-hydroxy)acetyl)hydrazono]-5-methyl-4-thiazolidinones.

    Science.gov (United States)

    Güzeldemirci, Nuray Ulusoy; Ilhan, Eser; Küçükbasmaci, Omer; Satana, Dilek

    2010-01-01

    New 4-thiazolidinone derivatives of benzilic acid (alpha,alpha-diphenyl-alpha-hydroxyacetic acid) have been synthesized and evaluated for antibacterial and antifungal activities. The reaction of 1- (alpha,alpha-diphenyl-alpha-hydroxy)acetyl-4-alkyl/arylthiosemicarbazides with ethyl 2-bromopropionate gave 3-alkyl/aryl-2-[((alpha,alpha-diphenyl-alpha-hydroxy)acetyl)hydrazono]-5-methyl-4-thiazolidinone derivatives. Their antibacterial and antifungal activities were evaluated against S. aureus ATCC 29213, P. aeruginosa ATCC 27853, E. coli ATCC 25922, C. albicans ATCC 10231, C. parapsilosis ATCC 22019, C. krusei ATCC 6258, T. mentagrophytes var. erinacei NCPF 375, M. gypseum NCPF 580 and T. tonsurans NCPF 245. 3e, 3f, 3g and 3h showed the highest antibacterial activity. Particularly 3a and 3e showed the highest antifungal activities against C. parapsilosis ATCC 22019, T. tonsurans NCPF 245 and M. gypseum NCPF 580.

  19. Use of plant cell cultures to study the metabolism of environmental chemicals

    International Nuclear Information System (INIS)

    Sandermann, H. Jr.; Scheel, D.; von der Trenck, T.

    1984-01-01

    The metabolism of the following environmental chemicals has been studied in cell suspension cultures of wheat (Triticum aestivum L.) and soybean (Glycine max L.):2, 4-dichlorophenoxyacetic acid (2,4-D), 2,4,5-trichlorophenoxyacetic acid (2,4,5-T), hexachlorobenzene, pentachlorophenol, diethylhexylphthalate , benzo [alpha] pyrene, and DDT. All chemicals tested, including the persistent ones, were partially metabolized. Polar conjugates predominated in all cases. A covalent incorporation into lignin could be demonstrated for 2,4-D and pentachlorophenol. A specific deposition in the cellular vacuole could be demonstrated for the beta-D-glucopyranoside conjugates derived from 2,4-D. A rapid assay procedure to evaluate the metabolism of a given 14 C-labeled chemical in plant cell suspension cultures is described. This procedure requires about 1 week, and the reproducibility of the results obtained has been assessed

  20. Přesídlování Čechů, Slováků, Poláků a Němců z bývalého Sovětského svazu do vlasti jejich předků

    Czech Academy of Sciences Publication Activity Database

    Valášková, Naďa; Pojarová, Tereza

    2009-01-01

    Roč. 96, č. 3 (2009), s. 225-245 ISSN 0009-0794 R&D Projects: GA AV ČR IAA700580801 Institutional research plan: CEZ:AV0Z90580513 Keywords : migration * resettlement * countrymen Subject RIV: AC - Archeology, Anthropology, Ethnology

  1. Comprehensive analysis for major, minor and trace element contents and Sr-Nd-Pb-Hf isotope ratios in sediment reference materials, JSd-1 and MAG-1

    Digital Repository Service at National Institute of Oceanography (India)

    Nath, B.N.; Makishima, A.; Noordmann, J.; Tanaka, R.; Nakamura, E.

    (TFE) bomb at 245 degrees C for 96 hrs with Mg addition. The elemental concentration was measured by quadrupole type inductively coupled plasma source mass spectrometry (ICP-QMS) and sector field type ICP-MS (ICP-SFMS) using isotope dilution...

  2. Spirits of the Air: Birds and American Indians in the South

    Directory of Open Access Journals (Sweden)

    E. N. Anderson

    2010-08-01

    Full Text Available Review of Spirits of the Air: Birds and American Indians in the South. Shepard Krech III. 2009. University of Georgia Press, Athens. Pp. 245, copiously illustrated. $44.95 (hardbound. ISBN-13 978-0-8203-2815-7.

  3. Wetland plant decomposition under different nutrient conditions: what is more important, litter quality or site quality?

    Czech Academy of Sciences Publication Activity Database

    Rejmánková, E.; Houdková, Kateřina

    2006-01-01

    Roč. 80, - (2006), s. 245-262 ISSN 0168-2563 Grant - others:National Science Foundation, USA 0089211 Keywords : Eleocharis cellulosa * Northern Belize * Litter bags * Cellulose * Nitrogen * Phosphorus * PLFA Subject RIV: EH - Ecology, Behaviour Impact factor: 2.536, year: 2006

  4. Chemistry, Technology and Aplications of Oxidized Celluloses

    Czech Academy of Sciences Publication Activity Database

    Havelka, P.; Sopuch, T.; Hnatowicz, Vladimír; Suchý, P.; Masteikova, R.; Bajerová, M.; Gajdziok, J.; Milichovský, M.; Švorčík, V.

    2010-01-01

    Roč. 2010, C (2010), s. 205-245. ISBN 978-1-608-76-388-7 Institutional support: RVO:61389005 Keywords : oxidation * cellulose * in-vitro Subject RIV: BO - Biophysics https://www.novapublishers.com/catalog/product_info.php? products _id=14049

  5. The rhetorical function of references to angels in the Main Letters of ...

    African Journals Online (AJOL)

    Test

    2011-06-07

    Jun 7, 2011 ... (1984:245–247), Morland (1995:148–149), Kremendahl (2000:83) and ..... gender-related roles that he links to creation (cf. dia; tou`to ..... Carr, W., 1981, Angels and principalities: The background, meaning and development.

  6. Tai Chi and Qi Gong

    Science.gov (United States)

    ... of Grants and Contracts General Award Mechanisms Small Business Research Grant Program (SBIR) Funding for: Natural Product Research ... tai chi and qigong in older adults. Western Journal of Nursing Research. 2009;31(2):245–279. Saeed SA, Antonacci ...

  7. Inelastic scattering of 9Be of 27 MeV/A to giant resonances

    International Nuclear Information System (INIS)

    Lebrun, D.; Buenerd, M.; Bini, M.; Harvey, B.G.; Legrain, R.; Mahoney, J.; Symons, T.J.M.; Van Bibber, K.

    1980-07-01

    Inelastic scattering spectra have been measured with 245 MeV incident energy 9 Be ions, on 208 Pb target. They show large excitation of the 208 Pb giant quadrupole resonance. DWBA calculations are reported and compared with the data

  8. Significance of uniaxial and hydrostatic pressure studies on ancient oceanic rocks in tectonics

    Digital Repository Service at National Institute of Oceanography (India)

    Sarma, K.V.L.N.S.; Ramana, Y.V.

    showed the lowest value of compressive strength (45 MPa) and pyroxenite gave the highest value (269 MPa), while meta volcanics exhibited narrow limits of 58 to 245 MPa. Standard correlations were obtained for compressive strength to G/P ratio...

  9. Coping Strategies of Young Mothers at Risk of HIV/AIDS in the ...

    African Journals Online (AJOL)

    Erah

    2009-03-01

    Mar 1, 2009 ... realities as childbearing obligations make protective sex less optional. However ... million people living with HIV globally,. 64% (24.5 ... Socio-cultural factors influence people's ..... “If a man has girl friends besides his wife, he ...

  10. Seroprevalence of Neospora caninum in aborting dairy cattle in the Czech Republic

    Czech Academy of Sciences Publication Activity Database

    Václavek, P.; Koudela, Břetislav; Modrý, David; Sedlák, K.

    2003-01-01

    Roč. 115, č. 3 (2003), s. 239-245 ISSN 0304-4017 Institutional research plan: CEZ:AV0Z6022909 Keywords : Neospora caninum * abortion * cattle Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 1.583, year: 2003

  11. Bulletin of the Chemical Society of Ethiopia - Vol 18, No 2 (2004)

    African Journals Online (AJOL)

    aops): case of the mineralization of 2,4,5-t on bdd electrode · EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT · DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. Birame Boye, Enric Brillas, Beatrice Marselli, Pierre-Alain Michaud, Christos ...

  12. Microwave Production of Steady State Large Volume Air Plasmas

    National Research Council Canada - National Science Library

    Brandenburg, John

    1999-01-01

    ...) and these plasmas persist for hundreds of milliseconds after power is turned off. These plasmas can be made in an inexpensive and easy to build apparatus based around a microwave oven operating at approximately 1kW and 2.45GHz...

  13. A PROSPECTIVE ANALYSIS OF RISK-FACTORS FOR THE DISCONTINUATION OF 2ND-LINE ANTIRHEUMATIC DRUGS

    NARCIS (Netherlands)

    WIJNANDS, MJ; VANTHOF, MA; VANLEEUWEN, MA; VANRIJSWIJK, MH; VANDEPUTTE, LBA; VANRIEL, PLCM

    1993-01-01

    Clinical and laboratory factors influencing the discontinuation of second-line antirheumatic drugs were prospectively studied using survival analysis in a consecutive series of 245 patients with recently diagnosed rheumatoid arthritis. A statistically significant influence of age, sex, serum IgA and

  14. A new species of Besleria (Gesneriaceae) from the western Amazon rainforest

    OpenAIRE

    Gabriel Emiliano Ferreira; Andréa Onofre De Araújo; Michael John Gilbert Hopkins; Alain Chautems

    2017-01-01

    Gabriel Emiliano Ferreira, Andréa Onofre De Araújo, Michael John Gilbert Hopkins, Alain Chautems (2017): A new species of Besleria (Gesneriaceae) from the western Amazon rainforest. Brittonia 69 (2): 241-245, DOI: 10.1007/s12228-017-9464-6

  15. Nature Watch

    Indian Academy of Sciences (India)

    Home; Journals; Resonance – Journal of Science Education; Volume 20; Issue 3. Nature Watch: Symbiosis in Coastal Marine Communities. Neelam Pereira. Feature Article Volume 20 Issue 3 March 2015 pp 245-253. Fulltext. Click here to view fulltext PDF. Permanent link:

  16. Identification and functionality of proteomes secreted by rat cardiac stem cells and neonatal cardiomyocytes

    Czech Academy of Sciences Publication Activity Database

    Šťastná, Miroslava; Chimenti, I.; Marban, E.; Van Eyk, J.E.

    2010-01-01

    Roč. 10, č. 2 (2010), s. 245-253 ISSN 1615-9853 Institutional research plan: CEZ:AV0Z40310501 Keywords : animal proteomics * cardiac stem cells * neonatal cardiomyocytes Subject RIV: CB - Analytical Chemistry, Separation Impact factor: 4.815, year: 2010

  17. Amyloid beta Fibril Elongation by Monomers Involves Disorder at the Tip

    Czech Academy of Sciences Publication Activity Database

    Bacci, M.; Vymětal, Jiří; Mihajlovic, M.; Caflisch, A.; Vitalis, A.

    2017-01-01

    Roč. 13, č. 10 (2017), s. 5117-5130 ISSN 1549-9618 Institutional support: RVO:61388963 Keywords : molecular dynamics simulations * atomic resolution structure * A beta Subject RIV: CF - Physical ; Theoretical Chemistry OBOR OECD: Physical chemistry Impact factor: 5.245, year: 2016

  18. Maslov. Evaluated neutron reaction data for Am and Cm isotopes. Summary documentation

    International Nuclear Information System (INIS)

    Lemmel, H.D.

    1996-01-01

    The nuclear data file by V.M. Maslov et al includes evaluated neutron reaction data for Am-241,243 Cm-243-245,246 in EDNF-6 format. The data are available from the IAEA Nuclear Data Section, costfree upon request. (author)

  19. The extent of unwanted infrared photoacoustic signals from polymer sampling tubings exposed to ultraviolet radiation

    NARCIS (Netherlands)

    Bicanic, D.; Solyom, A.; Angeli, G.; Wegh, H.; Postumus, M.; Jalink, H.

    1995-01-01

    The extent of unwanted photoacoustic (PA) signals due to volatiles released from various polymer tubing materials [transparent, red and black polyethylene (PE), polymer of tetrafluorethylene (PTFE) and copolymer of tetrafluorethylene and hexafluorethylene (FEP)] when exposed to 245 nm radiation was

  20. Measuring the complex permittivity tensor of uniaxial biological materials with coplanar waveguide transmission line

    Science.gov (United States)

    A simple and accurate technique is described for measuring the uniaxial permittivity tensor of biological materials with a coplanar waveguide transmission-line configuration. Permittivity tensor results are presented for several chicken and beef fresh meat samples at 2.45 GHz....