WorldWideScience

Sample records for berkelium 244

  1. New berkelium isotope: 242Bk

    International Nuclear Information System (INIS)

    A new isotope of berkelium, 242Bk, was produced with a cross section of approx. 10 μb in reactions of boron on uranium and nitrogen on thorium. It decays by electron capture with a half-life of 7 +- 1.3 minutes. The branching ratio for this isotope for alpha decay is less than 1% and that for spontaneous fission is less than 0.03%. 2 figures, 2 tables

  2. EC decay of 244Bk

    Science.gov (United States)

    Sodaye, Suparna; Tripathi, R.; Sudarshan, K.; Sharma, S. K.; Pujari, P. K.; Palit, R.; Mukhopadhyay, S.

    2014-12-01

    Berkelium isotopes have been produced in 11B-induced reaction on 238U. The EC decay of 244Bk → 244Cm has been studied by carrying out the single and coincidence measurements of the γ-rays emitted during the de-excitation of the 244Cm levels. Radiochemical separations have been carried out to minimize the contribution from the fission products and target. The new half-life of 244Bk is obtained as 5.02 ± 0.03 h, which is close to the theoretically calculated value. The relative intensities of the decay γ-rays have been re-evaluated. Based on the coincidence measurements, a tentative partial level scheme for 244Bk → 244Cm decay has been proposed.

  3. EC decay of 244Bk

    International Nuclear Information System (INIS)

    Berkelium isotopes have been produced in 11B-induced reaction on 238U. The EC decay of 244Bk → 244Cm has been studied by carrying out the single and coincidence measurements of the γ-rays emitted during the de-excitation of the 244Cm levels. Radiochemical separations have been carried out to minimize the contribution from the fission products and target. The new half-life of 244Bk is obtained as 5.02 ± 0.03 h, which is close to the theoretically calculated value. The relative intensities of the decay γ-rays have been re-evaluated. Based on the coincidence measurements, a tentative partial level scheme for 244Bk → 244Cm decay has been proposed. (paper)

  4. Characterization of berkelium(III) dipicolinate and borate compounds in solution and the solid state.

    Science.gov (United States)

    Silver, Mark A; Cary, Samantha K; Johnson, Jason A; Baumbach, Ryan E; Arico, Alexandra A; Luckey, Morgan; Urban, Matthew; Wang, Jamie C; Polinski, Matthew J; Chemey, Alexander; Liu, Guokui; Chen, Kuan-Wen; Van Cleve, Shelley M; Marsh, Matthew L; Eaton, Teresa M; van de Burgt, Lambertus J; Gray, Ashley L; Hobart, David E; Hanson, Kenneth; Maron, Laurent; Gendron, Frédéric; Autschbach, Jochen; Speldrich, Manfred; Kögerler, Paul; Yang, Ping; Braley, Jenifer; Albrecht-Schmitt, Thomas E

    2016-08-26

    Berkelium is positioned at a crucial location in the actinide series between the inherently stable half-filled 5f(7) configuration of curium and the abrupt transition in chemical behavior created by the onset of a metastable divalent state that starts at californium. However, the mere 320-day half-life of berkelium's only available isotope, (249)Bk, has hindered in-depth studies of the element's coordination chemistry. Herein, we report the synthesis and detailed solid-state and solution-phase characterization of a berkelium coordination complex, Bk(III)tris(dipicolinate), as well as a chemically distinct Bk(III) borate material for comparison. We demonstrate that berkelium's complexation is analogous to that of californium. However, from a range of spectroscopic techniques and quantum mechanical calculations, it is clear that spin-orbit coupling contributes significantly to berkelium's multiconfigurational ground state. PMID:27563098

  5. Extraction of tetravalent berkelium and cerium by aliquate-336-S-NO3 quaternary ammonium salt

    International Nuclear Information System (INIS)

    Extraction of tetravalent berkelium and cerium by aliquate-336-S-NO3 quaternary ammonium salt from nitric acid solutions is investigated. The effect of concentrations of nitric acid and extracting agent, nature of an oxidant (potassium bromate, potassium bichromate, mixture of AgNO3 and (NH4)2S2O8) and solvent on the distribution coefficient of berkelium(4) and cerium(4) is studied. It is established that solutions of aliquate-336-S-NO3 in carbon tetrachloride and dichloroethane extract quantitatively tetravalent berkelium from 10-12 M nitric acid solutions and cerium - from 1-10 M nitric acid solutions containing potassium bichromate as an oxidant. It is shown that the value of distribution coefficient for berkelium and cerium depends on the nature of an oxidant and extracting agent concentration. It is established that in the case of extraction by quaternary ammonium salt with one berkelium(4) mole four aliquate-336-SNO3 moles are associated and 1.5-1.6 mole of extracting agent are associated with one cerium(4) mole. It permits to make a conclusion that stoichiometry of extraction reactions by quaternary ammonium salt is not the same for tetravalent berkelium and cerium. It is shown that trivalent transplutonium and rare earth elements are not practically extracted by aliquate-336-S-NO3 from nitric acid solutions

  6. IT 244 UOP Tutorial Courses/ Uoptutorial

    OpenAIRE

    salman

    2015-01-01

    For more course tutorials visit www.uoptutorial.com   IT 244 Week 1 Assignment Principles of Security Paper   IT 244 Week 1 Checkpoint SmartScenario Information Security Security Policies   IT 244 Week 1 Assignment Introduction to the Information Security Policy Paper   IT 244 Week 2 Checkpoint Smart Scenario Trusted Computing Base   IT 244 Week 3 Smart Scenario: Business Continuity Disaster Recovery   IT 244 W...

  7. Infrared spectrum of curium-244

    International Nuclear Information System (INIS)

    The spectrum of curium-244 has been observed on the high resolution Fourier-transform spectrometer at Laboratoire Aime Cotton. An electrodeless lamp containing 50 μg of CmI3 was run for 12 hours and 800,000 points were taken. A total of 1743 lines have been ascribed to curium and 87 percent of the lines have been assigned to transitions between known energy levels

  8. 8 CFR 244.2 - Eligibility.

    Science.gov (United States)

    2010-01-01

    ... immigrant except as provided under § 244.3; (e) Is not ineligible under § 244.4; and (f)(1) Registers for... relief from removal; (ii) The applicant has an application for change of status, adjustment of...

  9. 12 CFR 24.4 - Investment limits.

    Science.gov (United States)

    2010-01-01

    ... ENTITIES, COMMUNITY DEVELOPMENT PROJECTS, AND OTHER PUBLIC WELFARE INVESTMENTS § 24.4 Investment limits. (a... 12 Banks and Banking 1 2010-01-01 2010-01-01 false Investment limits. 24.4 Section 24.4 Banks and...) Limited liability. A national bank may not make an investment under this part that would expose the...

  10. 8 CFR 244.4 - Ineligible aliens.

    Science.gov (United States)

    2010-01-01

    ... 8 Aliens and Nationality 1 2010-01-01 2010-01-01 false Ineligible aliens. 244.4 Section 244.4 Aliens and Nationality DEPARTMENT OF HOMELAND SECURITY IMMIGRATION REGULATIONS TEMPORARY PROTECTED STATUS FOR NATIONALS OF DESIGNATED STATES § 244.4 Ineligible aliens. An alien is ineligible for...

  11. 8 CFR 244.6 - Application.

    Science.gov (United States)

    2010-01-01

    ... 8 Aliens and Nationality 1 2010-01-01 2010-01-01 false Application. 244.6 Section 244.6 Aliens and Nationality DEPARTMENT OF HOMELAND SECURITY IMMIGRATION REGULATIONS TEMPORARY PROTECTED STATUS FOR NATIONALS OF DESIGNATED STATES § 244.6 Application. An application for Temporary Protected Status must be...

  12. 8 CFR 244.15 - Travel abroad.

    Science.gov (United States)

    2010-01-01

    ... 8 Aliens and Nationality 1 2010-01-01 2010-01-01 false Travel abroad. 244.15 Section 244.15 Aliens... NATIONALS OF DESIGNATED STATES § 244.15 Travel abroad. (a) After the grant of Temporary Protected Status... to travel abroad. Permission to travel may be granted by the director pursuant to the...

  13. Dicty_cDB: SLA244 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SL (Link to library) SLA244 (Link to dictyBase) - - - Contig-U16368-1 SLA244Z (Link... to Original site) - - SLA244Z 605 - - - - Show SLA244 Library SL (Link to library) Clone ID SLA244 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/SL/SLA2-B/SLA244Q.Seq.d/ Representative seq. ID SLA24...4Z (Link to Original site) Representative DNA sequence >SLA244 (SLA244Q) /CSM/SL/SLA2-B/SLA244Q.Seq.d/ XXXXX...CCACTTCATA AATAAAACTTTGATC sequence update 1997. 5. 7 Translated Amino Acid sequence ---QLCKVTQCPTDFSCKMIRGN

  14. 42 CFR 24.4 - Eligibility.

    Science.gov (United States)

    2010-10-01

    ... implications for clinical research or resulted in a widespread economic effect in the health-care delivery system. In addition, the individual should have been involved in the development of scientific or... 42 Public Health 1 2010-10-01 2010-10-01 false Eligibility. 24.4 Section 24.4 Public Health...

  15. 14 CFR 135.244 - Operating experience.

    Science.gov (United States)

    2010-01-01

    ... 14 Aeronautics and Space 3 2010-01-01 2010-01-01 false Operating experience. 135.244 Section 135.244 Aeronautics and Space FEDERAL AVIATION ADMINISTRATION, DEPARTMENT OF TRANSPORTATION (CONTINUED) AIR CARRIERS AND OPERATORS FOR COMPENSATION OR HIRE: CERTIFICATION AND OPERATIONS OPERATING REQUIREMENTS: COMMUTER AND ON DEMAND OPERATIONS AND...

  16. 27 CFR 70.244 - Payroll period.

    Science.gov (United States)

    2010-04-01

    ... 27 Alcohol, Tobacco Products and Firearms 2 2010-04-01 2010-04-01 false Payroll period. 70.244... Excise and Special (Occupational) Tax Limitations § 70.244 Payroll period. For purpose of determining the... established calendar period regularly used by the employer or other person levied upon for payroll or...

  17. Hazard evaluation for 244-AR vault facility

    International Nuclear Information System (INIS)

    This document presents the results of a hazard identification and evaluation performed on the 244-AR Vault Facility to close a USQ (USQ No. TF-98-0785, Potential Inadequacy in Authorization Basis (PIAB): To Evaluate Miscellaneous Facilities Listed in HNF-2503 And Not Addressed In The TWRS Authorization Basis) that was generated as part of an evaluation of inactive TWRS facilities

  18. Hazard Evaluation for 244-CR Vault

    International Nuclear Information System (INIS)

    This document presents the results of a hazards identification and evaluation performed on the 244-CR Vault to close a USQ (USQ No.TF-98-0785, Potential Inadequacy in Authorization Basis (PIAB): To Evaluate Miscellaneous Facilities Listed In HNF-2503 And Not Addressed In The TWRS Authorization Basis) that was generated as part of an evaluation of inactive TWRS facilities

  19. 244-AR Vault Interim Stabilization Project Plan

    International Nuclear Information System (INIS)

    The 244-AR Vault Facility, constructed between 1966 and 1968, was designed to provide lag storage and treatment for the Plutonium-Uranium Extraction Facility (PUREX) tank farm sludges. Tank farm personnel transferred the waste from the 244-AR Vault Facility to B Plant for recovery of cesium and strontium. B Plant personnel then transferred the treatment residuals back to the tank farms for storage of the sludge and liquids. The last process operations, which transferred waste supporting the cesium/strontium recovery mission, occurred in April 1978. After the final transfer in 1978, the 244-AR facility underwent a cleanout. However, 2,271 L (600 gal) of sludge were left in Tank 004AR from an earlier transfer from Tank 241-AX-104. When the cleanout was completed, the facility was placed in a standby status. The sludge had been transferred to Tank 004AR to support Pacific Northwest National Laboratory [PNNL] vitrification work. Documentation of waste transfers suggests that a portion of the sludge may have been moved from Tank 004AR to Tank 002AR in preparation for transfer back to the AX Tank Farm; however, quantities of the sludge that were moved to Tank 002AR from that transfer must be estimated

  20. Tank 244A tank characterization plan

    International Nuclear Information System (INIS)

    The Double-Shell Tank (DST) System currently receives waste from the Single-Shell Tank (SST) System in support of SST stabilization efforts or from other on-site facilities which generate or store waste. Waste is also transferred between individual DSTs. The mixing or commingling of potentially incompatible waste types at the Hanford Site must be addressed prior to any waste transfers into the DSTs. The primary goal of the Waste Compatibility Program is to prevent the formation of an Unreviewed Safety Question (USQ) as a result of improper waste management. Tank 244A is a Double Contained Receiver Tank (DCRT) which serves as any overflow tank for the East Area Farms. Waste material is able to flow freely between the underground storage tanks and tank 244A. Therefore, it is necessary to test the waste in tank 244A for compatibility purposes. Two issues related to the overall problem of waste compatibility must be evaluated: Assurance of continued operability during waste transfer and waste concentration and Assurance that safety problems are not created as a result of commingling wastes under interim storage. The results of the grab sampling activity prescribed by this Tank Characterization Plan shall help determine the potential for four kinds of safety problems: criticality, flammable gas accumulation, energetics, and corrosion and leakage

  1. 27 CFR 28.244 - Shipment to manufacturing bonded warehouse.

    Science.gov (United States)

    2010-04-01

    ... bonded warehouse. 28.244 Section 28.244 Alcohol, Tobacco Products and Firearms ALCOHOL AND TOBACCO TAX... Export Consignment § 28.244 Shipment to manufacturing bonded warehouse. Distilled spirits and wines withdrawn for shipment to a manufacturing bonded warehouse shall be consigned to the proprietor of...

  2. Dicty_cDB: VHQ244 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available kfqyldektkiskisrgaiagivvgcvvavsligsiafyyhhknkkv nlff*klk*nltirf Frame C: knfnlkkikekthqn*isknkneifisifthitil...ces producing significant alignments: (bits) Value N ( BJ446630 ) Dictyostelium discoideum cDNA...ive seq. ID VHQ244P (Link to Original site) Representative DNA sequence >VHQ244 (VHQ244Q) /CSM/VH/VHQ2-B/VHQ...nsgictcdnehigngceikfieckhkcstkhgicdndsgnckcdtqtkgltceesrll iesldsinskggtiniigyfgnttslltikig...esqcknikvfnettlkcdigegkgihni tiidddlsftainkfqyldektkiskisrgaiagivvgcvvavsligsi

  3. Oxidation-reduction properties of americium, curium, berkelium, californium, einsteinium and fermium, and thermodynamic consequences for the 5f series

    International Nuclear Information System (INIS)

    The amalgamation of 5f elements from Am to Fm has been studied by using 241Am, 244Cm, 249Bk, 249Cf, 252Cf, 253Es, 254Es, 252Fm and 255Fm with two electrochemical methods, radiocoulometry and radiopolarography, perfectly adapted to investigate extremely diluted solutions when the concentration of electroactive species is as low as 10-16M. The theory of radiocoulometry has been developed in the general cases of reversible and irreversible electrode process. It has been used to interpret the experimental data on the kinetic curves of amalgamation, and to estimate the standard rate constant of the electrode process in complexing medium (citric). On the other hand the radiopolarographic method has been applied to study the mechanism of reduction at the dropping mercury electrode of cations M3+ in aqueous medium to the metal M with formation of amalgam. The results are exploited into two directions: 1- Acquisition of some data concerning the oxidation-reduction properties of elements from Am to Fm. Therefore the standard electrode E0 [M(III-0)] potentials for Bk, Cf and Es, and the standard electrode E0 [M(II-0)] potential for Fm are estimated and the relative stability of each oxidation state (from II to VII) of 5f elements is discussed; 2- Acquisition of unknown thermodynamic data on transcalifornium elements. Correlations between 4f and 5f elements are precised and some divergences appear for the second half of 4f and 5f series (i.e. for 65<=Z<=71 and 97<=Z<=103)

  4. Dicty_cDB: VSJ244 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VS (Link to library) VSJ244 (Link to dictyBase) - - - Contig-U13740-1 VSJ244P (Link to Original ... 01 2 U36450 |U36450.1 E. coli/yeast shuttle vector pAD -GAL4, complete sequence. 40 0.002 2 AC124819 |AC12 ...

  5. 40 CFR 52.244 - Motor vehicle emissions budgets.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 3 2010-07-01 2010-07-01 false Motor vehicle emissions budgets. 52.244... (CONTINUED) APPROVAL AND PROMULGATION OF IMPLEMENTATION PLANS California § 52.244 Motor vehicle emissions budgets. (a) Approval of the motor vehicle emissions budgets for the following ozone rate-of-progress...

  6. 48 CFR 52.244-6 - Subcontracts for Commercial Items.

    Science.gov (United States)

    2010-10-01

    ... clauses in subcontracts for commercial items: (i) 52.203-13, Contractor Code of Business Ethics and... component level. Editorial Note: For Federal Register citations affecting 52.244-6, see the List of...

  7. Dicty_cDB: SHK244 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SH (Link to library) SHK244 (Link to dictyBase) - - - Contig-U16526-1 SHK244P (Link to Original ... .1 Influenza A virus (swine/Cotes d'Armor/1515/99 (H1N1 )) partial N1NA gene for Neuraminidase, genomic RNA ... .1 Influenza A virus (swine/Cotes d'Armor/1482/99 (H1N1 )) partial N1NA gene for Neuraminidase, genomic RNA ...

  8. Dicty_cDB: SHD244 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SH (Link to library) SHD244 (Link to dictyBase) - - - Contig-U16526-1 SHD244P (Link to Original ... .1 Influenza A virus (swine/Cotes d'Armor/1515/99 (H1N1 )) partial N1NA gene for Neuraminidase, genomic RNA ... .1 Influenza A virus (swine/Cotes d'Armor/1482/99 (H1N1 )) partial N1NA gene for Neuraminidase, genomic RNA ...

  9. Double-contained receiver tank 244-TX, grab samples, 244TX-97-1 through 244TX-97-3 analytical results for the final report

    International Nuclear Information System (INIS)

    This document is the final report for the double-contained receiver tank (DCRT) 244-TX grab samples. Three grabs samples were collected from riser 8 on May 29, 1997. Analyses were performed in accordance with the Compatibility Grab Sampling and Analysis Plan (TSAP) and the Data Quality Objectives for Tank Farms Waste Compatibility Program (DQO). The analytical results are presented in a table

  10. Dicty_cDB: CHO244 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CH (Link to library) CHO244 (Link to dictyBase) - - - Contig-U16708-1 - (Link to Original site) ... AV065281 |AV065281.1 Mus musculus adult male small intestine ... cDNA, partial sequence, clone 2010015E09. 40 7.2 1 ... AV062105 |AV062105.1 Mus musculus adult male small intestine ... cDNA, partial sequence, clone 2010002D17. 40 7.2 1 ...

  11. 27 CFR 24.244 - Use of acid to stabilize standard wine.

    Science.gov (United States)

    2010-04-01

    ... 27 Alcohol, Tobacco Products and Firearms 1 2010-04-01 2010-04-01 false Use of acid to stabilize standard wine. 24.244 Section 24.244 Alcohol, Tobacco Products and Firearms ALCOHOL AND TOBACCO TAX AND TRADE BUREAU, DEPARTMENT OF THE TREASURY LIQUORS WINE Storage, Treatment and Finishing of Wine § 24.244 Use of acid to stabilize standard...

  12. 8 CFR 244.11 - Renewal of application; appeal to the Board of Immigration Appeals.

    Science.gov (United States)

    2010-01-01

    ... of Immigration Appeals. 244.11 Section 244.11 Aliens and Nationality DEPARTMENT OF HOMELAND SECURITY IMMIGRATION REGULATIONS TEMPORARY PROTECTED STATUS FOR NATIONALS OF DESIGNATED STATES § 244.11 Renewal of application; appeal to the Board of Immigration Appeals. If a charging document is served on the alien with...

  13. Motivation for the determination of the 244Cm effective neutron capture cross-section

    International Nuclear Information System (INIS)

    Measurement of the effective neutron capture cross-section of 244Cm was tried, and the irradiation test of the 244Cm sample was performed for 1 cycle. Gamma- and alpha-rays measurements were performed to analyze the productions from the 244Cm(n,γ) and fission reactions. (author)

  14. Operability test procedure for 244-U DCRT. Revision 1

    Energy Technology Data Exchange (ETDEWEB)

    Erhart, M.F.

    1995-03-13

    This OPT will insure the operability of various systems and their general equipment, used in the operation of the 244-U DCRT. Systems that will be tested include the following: Leak Detection Systems; Heat Trace System; Vessel Temperature Measurement System; Dip Tube Water System; Weight Factor and Specific Gravity System; Instrument Air System; Vessel Liquid Level System; Vessel Liquid Transfer System; and Exhauster Differential Pressure Indicating Controller System. The tests will cover checks on equipment operation and electrical interlocks, but will not cover checks on associated annunciator alarms which are covered in a separate OTP.

  15. Operability test procedure for 244-U DCRT. Revision 1

    International Nuclear Information System (INIS)

    This OPT will insure the operability of various systems and their general equipment, used in the operation of the 244-U DCRT. Systems that will be tested include the following: Leak Detection Systems; Heat Trace System; Vessel Temperature Measurement System; Dip Tube Water System; Weight Factor and Specific Gravity System; Instrument Air System; Vessel Liquid Level System; Vessel Liquid Transfer System; and Exhauster Differential Pressure Indicating Controller System. The tests will cover checks on equipment operation and electrical interlocks, but will not cover checks on associated annunciator alarms which are covered in a separate OTP

  16. Plutonium-244 in the early solar system and xenology

    Energy Technology Data Exchange (ETDEWEB)

    Kuroda, P.K. [Arkansas Univ., Fayetteville (United States). Dept. of Chem. Eng.; Myers, W.A. [Arkansas Univ., Fayetteville (United States). Dept. of Chem. Eng.

    1995-06-01

    Isotopic compositions of the anomalous xenon components, such as the so-called xenon-H L and the s-type xenon, can be explained in terms of a two-component model in which they are regarded as representing the isotopic composition of a mixture of the {sup 244}Pu fission xenon component and a trapped xenon component, whose isotopic composition resembles that of the atmospheric xenon, but is often markedly altered by a combined effect of (a) mass-fractionation, (b) spallation and (c) neutron-capture reactions caused primarily by the 10 keV (stellar temperature) neutrons. (orig.)

  17. Plutonium-244 in the early solar system and xenology

    International Nuclear Information System (INIS)

    Isotopic compositions of the anomalous xenon components, such as the so-called xenon-H L and the s-type xenon, can be explained in terms of a two-component model in which they are regarded as representing the isotopic composition of a mixture of the 244Pu fission xenon component and a trapped xenon component, whose isotopic composition resembles that of the atmospheric xenon, but is often markedly altered by a combined effect of a) mass-fractionation, b) spallation and c) neutron-capture reactions caused primarily by the 10 keV (stellar temperature) neutrons. (orig.)

  18. Preparation of powdered CR244 adhesive type chloroprene rubber%CR244粘接型粉末氯丁橡胶的制备

    Institute of Scientific and Technical Information of China (English)

    朱家顺; 王炼石; 梁启浩

    2003-01-01

    用凝聚法制备出粉末粘接型氯丁橡胶(PCR244).研究了包覆剂性质对PCR244粒径分布的影响,并用SEM对所得PCR244的形貌及断面进行了观察分析.研究表明,在CR244粉末化体系中,包覆剂必须具有一定的交联程度才能起粉末化作用.在研究范围内,包覆剂的θg对粒径小于0.9mm产物的成粉率几乎无影响,均达到98.6%以上.SEM分析表明,PCR244宏观粒子表面粗糙,粒子内外均分布着大量空隙,其形成过程可分为三个主要阶段,即在包覆剂作用下,首先由胶乳初级粒子聚结成次级粒子,再由次级粒子凝聚成团粒,最后团粒相互结合成宏观粒子PCR244.

  19. 49 CFR 244.11 - Contents of a Safety Integration Plan.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 4 2010-10-01 2010-10-01 false Contents of a Safety Integration Plan. 244.11... ADMINISTRATION, DEPARTMENT OF TRANSPORTATION REGULATIONS ON SAFETY INTEGRATION PLANS GOVERNING RAILROAD CONSOLIDATIONS, MERGERS, AND ACQUISITIONS OF CONTROL Safety Integration Plans § 244.11 Contents of a...

  20. 8 CFR 244.5 - Temporary treatment benefits for eligible aliens.

    Science.gov (United States)

    2010-01-01

    ... 8 Aliens and Nationality 1 2010-01-01 2010-01-01 false Temporary treatment benefits for eligible aliens. 244.5 Section 244.5 Aliens and Nationality DEPARTMENT OF HOMELAND SECURITY IMMIGRATION... for eligible aliens. (a) Prior to the registration period. Prior to the registration...

  1. 17 CFR 244.100 - General rules regarding disclosure of non-GAAP financial measures.

    Science.gov (United States)

    2010-04-01

    ... disclosure of non-GAAP financial measures. 244.100 Section 244.100 Commodity and Securities Exchanges... discloses material information that includes a non-GAAP financial measure, the registrant must accompany... unreasonable efforts, for forward-looking information, of the differences between the non-GAAP...

  2. 10 CFR 72.244 - Application for amendment of a certificate of compliance.

    Science.gov (United States)

    2010-01-01

    ... INDEPENDENT STORAGE OF SPENT NUCLEAR FUEL, HIGH-LEVEL RADIOACTIVE WASTE, AND REACTOR-RELATED GREATER THAN CLASS C WASTE Approval of Spent Fuel Storage Casks § 72.244 Application for amendment of a...

  3. Above-threshold structure in {sup 244}Cm neutron-induced fission cross section

    Energy Technology Data Exchange (ETDEWEB)

    Maslov, V.M. [Radiation Physics and Chemistry Problems Inst., Minsk-Sosny (Belarus)

    1997-03-01

    The quasi-resonance structure appearing above the fission threshold in neutron-induced fission cross section of {sup 244}Cm(n,f) is interpreted. It is shown to be due to excitation of few-quasiparticle states in fissioning {sup 245}Cm and residual {sup 244}Cm nuclides. The estimate of quasiparticle excitation thresholds in fissioning nuclide {sup 245}Cm is consistent with pairing gap and fission barrier parameters. (author)

  4. Measurements and modeling of LLE and HE for (methanol + 2,4,4-trimethyl-1-pentene), and LLE for (water + methanol + 2,4,4-trimethyl-1-pentene)

    International Nuclear Information System (INIS)

    Highlights: • Simultaneous description of VLE, LLE and HE using NRTL model is investigated. • Measurement and modeling for LLE and HE of (methanol + 2,4,4-trimethyl-1-pentene). • Measurement and modeling for LLE of (water + methanol + 2,4,4-trimethyl-1-pentene). - Abstract: Excess enthalpy (HE) for the binary system of (methanol + 2,4,4-trimethyl-1-pentene) (TMP-1) is reported at T = 298.15 K and 101 kPa. (Liquid + liquid) equilibrium (LLE) for the same system is measured at atmospheric pressure (101 kPa). LLE for ternary system of (water + methanol + 2,4,4-trimethyl-1-pentene) is measured at T = (283 and 298) K. The parameters of Non-Random Two-Liquid (NRTL) model were regressed for the system of (methanol + TMP-1) using HE and LLE from this work combined with isobaric (101 kPa) and isothermal (T = 331 K) VLE data from literature. The NRTL parameters for the binary system of (water + TMP-1) were fitted to a binary LLE data set from literature. NRTL parameters for the binary system of (water + methanol) were taken from ASPEN PLUS. The LLE for the ternary system was modeled by the three binary NRTL interaction parameters systems. The binary and ternary models were compared against the measured data

  5. 胶态二氧化硅SYLOID244FP固化肉桂挥发油的研究%Study on solidifying volatile oil of cinnamon with colloidal silicon dioxide SYLOID244FP

    Institute of Scientific and Technical Information of China (English)

    蒋艳荣; 张振海; 胡绍英; 贾晓斌

    2013-01-01

    目的:评价胶态二氧化硅SYLOID244FP固化肉桂挥发油的特性.方法:采用SYLOID244FP固化肉桂挥发油,以桂皮醛收率为指标,优选SYLOID244FP用量;采用差示扫描量热法和扫描电镜法对固化粉末进行物相表征;考察SY-LOID244FP对肉桂挥发油中桂皮醛体外溶出和受热稳定性的影响.结果:SYLOID244FP与肉桂挥发油最佳固化比例1∶1,肉桂挥发油被固化之后,体外溶出速率加快,受热稳定性提高.结论:SYLOID244FP吸附固化中药挥发油值得进一步研究.%Objective:To evaluate the properties of solidifying volatile oil of cinnamon with colloidal silicon dioxide SYLOID244FP.Method:Volatile oil of cinnamon was solidified by SYLOID244FP.The amount of SYLOID244FP was optimized with the cinnamaldehyde yield as criteria.Curing powder was characterized by scanning electron microscopy (SEM) and differential scanning calorimetry (DSC).The effects of SYLOID244FP on dissolution in vitro and thermal stability of cinnamaldehyde were studied.Result:The optimum solidification ratio of SYLOID244FP to volatile oil of cinnamon was 1 ∶ 1.Dissolution rate of cinnamaldehyde increasesd and its thermal stability improved after volatile oil of cinnamon was solidified.Conclusion:Solidifying herbal volatile oil with SY-LOID244FP deserves studying further.

  6. Measurements of neutron cross section of the {sup 243}Am(n,{gamma}){sup 244}Am reaction

    Energy Technology Data Exchange (ETDEWEB)

    Hatsukawa, Yuichi; Shinohara, Nobuo; Hata, Kentaro [Japan Atomic Energy Research Inst., Tokai, Ibaraki (Japan). Tokai Research Establishment

    1998-03-01

    The effective thermal neutron cross section of {sup 243}Am(n,{gamma}){sup 244}Am reaction was measured by the activation method. Highly-purified {sup 243}Am target was irradiated in an aluminum capsule by using a research reactor JRR-3M. The tentative effective thermal neutron cross sections are 3.92 b, and 84.44 b for the production of {sup 244g}Am and {sup 244m}Am, respectively. (author)

  7. HAYNES 244 alloy – a new 760 ∘C capable low thermal expansion alloy

    Directory of Open Access Journals (Sweden)

    Fahrmann Michael G.

    2014-01-01

    Full Text Available HAYNES® 244TM alloy is a new 760∘C capable, high strength low thermal expansion (CTE alloy. Its nominal chemical composition in weight percent is Ni – 8 Cr – 22.5 Mo – 6 W. Recently, a first mill-scale heat of 244 alloy was melted by Haynes International, and processed to various product forms such as re-forge billet, plate, and sheet. This paper presents key attributes of this new alloy (CTE, strength, low-cycle fatigue performance, oxidation resistance, thermal stability as they pertain to the intended use in rings and seals of advanced gas turbines.

  8. The measurement of prompt neutron spectrum in spontaneous fission of {sup 244}Cm

    Energy Technology Data Exchange (ETDEWEB)

    Batenkov, O.I.; Boykov, G.S.; Drapchinsky, L.V.; Majorov, M.Ju.; Trenkin, V.A. [V.G. Khlopin Radium Inst., Saint Petersburg (Russian Federation)

    1997-03-01

    Under the Program of Measurements of Prompt Fission Neutron Spectra of Minor Actinides for Transmutation Purposes the integral neutron spectrum in spontaneous fission of {sup 244}Cm has been measured by the time-of-flight method in the energy range of 0.1-15 MeV relative to the standard neutron spectrum in {sup 252}Cf spontaneous fission. Essential attention was paid to revealing of possible systematic errors. It is shown, that the {sup 244}Cm spectrum shape may be well described by using Mannhart evaluation with appropriate parameter of Maxwell temperature T{sub M} = 1.37 MeV. (author)

  9. HAYNES 244 alloy – a new 760 ∘C capable low thermal expansion alloy

    OpenAIRE

    Fahrmann Michael G.; Srivastava S. Krishna; Pike Lee M.

    2014-01-01

    HAYNES® 244TM alloy is a new 760∘C capable, high strength low thermal expansion (CTE) alloy. Its nominal chemical composition in weight percent is Ni – 8 Cr – 22.5 Mo – 6 W. Recently, a first mill-scale heat of 244 alloy was melted by Haynes International, and processed to various product forms such as re-forge billet, plate, and sheet. This paper presents key attributes of this new alloy (CTE, strength, low-cycle fatigue performance, oxidation resistance, thermal stability) as they pertain t...

  10. Inhalation toxicology of repeated exposures to 244CmO2

    International Nuclear Information System (INIS)

    Rats have been exposed to inhaled 244CmO2 at 70 and 280 days of age (IAD, approx. 350 nCi) and at ten 3-week intervals (IAD, approx. 35 nCi per exposure). Autoradiographs are being examined for lung, liver and bone microdosimetry

  11. 48 CFR 1852.244-70 - Geographic participation in the aerospace program.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 6 2010-10-01 2010-10-01 true Geographic participation in... AERONAUTICS AND SPACE ADMINISTRATION CLAUSES AND FORMS SOLICITATION PROVISIONS AND CONTRACT CLAUSES Texts of Provisions and Clauses 1852.244-70 Geographic participation in the aerospace program. As prescribed in...

  12. 27 CFR 28.244a - Shipment to a customs bonded warehouse.

    Science.gov (United States)

    2010-04-01

    ... 27 Alcohol, Tobacco Products and Firearms 1 2010-04-01 2010-04-01 false Shipment to a customs... Export Consignment § 28.244a Shipment to a customs bonded warehouse. Distilled spirits and wine withdrawn for shipment to a customs bonded warehouse shall be consigned in care of the customs officer in...

  13. Plutonium-244 fission xenon and primordial xenon in lunar samples and meteorites

    International Nuclear Information System (INIS)

    Xenon found in lunar samples is a binary mixture of 244Pu fission xenon and a trapped xenon, whose isotopic composition often shows a striking resemblance to that of TAKAOKA's primitive xenon. The decay product of 129I is conspicuously absent in lunar samples and this may be attributed to the facts that (a) the half-life of 129I is much shorter than that of 244Pu, and (b) the separation of xenon from plutonium may take place easily, since the former is a gaseous element, while the latter is a refractory element. The separation of xenon from iodine may not take place easily, however, since the former is a gaseous element, while the latter is a volatile element. The isotopic compositions of the trapped xenon released from ordinary chondrites and achondrites resemble that of TAKAOKA's primitive xenon, which has been mass-fractionated in such a manner that the heavier isotopes are systematically enriched relative to the lighter isotopes. (author)

  14. Alpha particle radiography of ants using a 244Cm alpha source

    International Nuclear Information System (INIS)

    Alpha particles emitted from a radioisotope 244Cm were used for the radiography of ants. Cellulose nitrate films, LR-115 from Kodak Pathe, were used as solid state nuclear track detectors to make the radiographs. Alpha particles of energies from 3.5 to 5.5 MeV were obtained by varying the air spacing between the 244Cm and the sample with stainless steel spacers of thickness from 2.4 to 0.5 cm to slow the 5.81 MeV alpha particles from the 244Cm by air. The resulting radiographs of the ants put on the LR-115 films and irradiated by alpha particles of different energies show that only the profiles of the ants were obtained when the ants were exposed to alpha particles of energies lower than 3.5 MeV, and almost all parts of the ant except a portion in the head were penetrated by alpha particles of energies higher than 5.0 MeV to register high density alpha tracks on the LR-115. The details of the internal organs of the ant can be shown clearly by radiography with alpha particles of energies between 4.0 and 5.0 MeV. (author)

  15. Effect of DTPA on concentration ratios of 237Np and 244Cm in vegetative parts of bush bean and barley

    International Nuclear Information System (INIS)

    Bush beans (Phaseolus vulgaris L.) and barley (Hordeum vulgare L.) were grown in two different soils (noncalcareous and calcareous) in containers in a glasshouse with 530 pCi/g 237Np or 15040 pCi/g 244Cm mixed into separate containers of the soil. The chelating agent DTPA at 100 μg/g soil was added to one half of the containers. The concentration ratio (C.R.) without DTPA was two orders of magnitude higher for 237Np than for 244Cm by two and three orders of magnitude but had little influence on 237Np. For the calcareous soil with DTPA, 244Cm C.R.'s were greater than those for 237Np. In bush beans both 237Np and 244Cm C.R.'s were higher in primary leaves than in trifoliate leaves which were higher than for stems

  16. Development of technology for high-purity 244Pu production by method of electromagnetic separation

    International Nuclear Information System (INIS)

    The IAEA needs plutonium isotopic reference materials and spikes certified to an accuracy of 0.05% or better for the verification of large throughputs and inventories of plutonium under IAEA safeguards and for the isotopic analysis of traces of plutonium in environmental samples taken to confirm state declarations. At the request of the IAEA the Russian Federal Nuclear Center (RFNC) has defined a plan to produce highly enriched plutonium isotopes necessary for the preparation of the required reference materials and spikes. The objective is to produce about 260 mg of 99.74% enriched 242Pu and up to 100 mg of 99.56% enriched 244Pu by electromagnetic separation starting from 5 g of a feed material of US origin containing about 16% of 244Pu. A second enrichment cycle is foreseen to produce about 1 mg of 99.99% enriched 244Pu. In view of the limited amount of feed material, RFNC will upgrade its technologies and procedures for the preparation of high-purity plutonium chloride, the processes of ionisation, the radiochemical recovery of the material deposited on the collectors of the mass separator or scattered in the machine and the regeneration of the latter, before proceeding with the production of the isotopes requested by the IAEA. To cover the cost of this development RFNC has applied to the International Science and Technology Center for a grant which is presently under evaluation. The project described in this paper is undertaken with the close support and collaboration of the IAEA, Los Alamos National Laboratory (LANL), New Brunswick Laboratory (NBL) and the Institute for Reference Materials and Measurements (IRMM)

  17. Software Verification and Validation Report for the 244-AR Vault Interim Stabilization Ventilation System

    International Nuclear Information System (INIS)

    This document reports on the analysis, testing and conclusions of the software verification and validation for the 244-AR Vault Interim Stabilization ventilation system. Automation control system will use the Allen-Bradley software tools for programming and programmable logic controller (PLC) configuration. The 244-AR Interim Stabilization Ventilation System will be used to control the release of radioactive particles to the environment in the containment tent, located inside the canyon of the 244-AR facility, and to assist the waste stabilization efforts. The HVAC equipment, ducts, instruments, PLC hardware, the ladder logic executable software (documented code), and message display terminal are considered part of the temporary ventilation system. The system consists of a supply air skid, temporary ductwork (to distribute airflow), and two skid-mounted, 500-cfm exhausters connected to the east filter building and the vessel vent system. The Interim Stabilization Ventilation System is a temporary, portable ventilation system consisting of supply side and exhaust side. Air is supplied to the containment tent from an air supply skid. This skid contains a constant speed fan, a pre-filter, an electric heating coil, a cooling coil, and a constant flow device (CFD). The CFD uses a passive component that allows a constant flow of air to pass through the device. Air is drawn out of the containment tent, cells, and tanks by two 500-cfm exhauster skids running in parallel. These skids are equipped with fans, filters, stack, stack monitoring instrumentation, and a PLC for control. The 500CFM exhaust skids were fabricated and tested previously for saltwell pumping activities. The objective of the temporary ventilation system is to maintain a higher pressure to the containment tent, relative to the canyon and cell areas, to prevent contaminants from reaching the containment tent

  18. Type B investigation report of curium-244 exposure at the ORNL TRU Facility, January 15, 1986

    Energy Technology Data Exchange (ETDEWEB)

    Love, G.L.; Butler, H.M.; Duncan, D.T.; Oakes, T.W.

    1986-04-01

    This Type B Investigative Report provides an evaluation of relevant events and activities that led to, were a part of, or resulted from the release of curium-244 in the Building 7920 facility at ORNL in January 1986. Impacts have been evaluated with respect to employee exposures and the costs and loss of productivity resulting from increased bioassay analyses and activities of investigative committees. Management systems evaluated include (1) training of employees performing lab analyses, (2) adherence to procedures, and (3) response to unusual circumstances.

  19. Type B investigation report of curium-244 exposure at the ORNL TRU Facility, January 15, 1986

    International Nuclear Information System (INIS)

    This Type B Investigative Report provides an evaluation of relevant events and activities that led to, were a part of, or resulted from the release of curium-244 in the Building 7920 facility at ORNL in January 1986. Impacts have been evaluated with respect to employee exposures and the costs and loss of productivity resulting from increased bioassay analyses and activities of investigative committees. Management systems evaluated include (1) training of employees performing lab analyses, (2) adherence to procedures, and (3) response to unusual circumstances

  20. Infrared Line Emission in the Interacting Region of Arp 244 (the Antennae) Colliding Molecular Cloud Complexes ?

    CERN Document Server

    Liang, M C; Lo, K Y; Kim, D C

    2001-01-01

    We report velocity-resolved spectroscopy of infrared hydrogen recombination lines in the interacting region of the Antennae galaxies (NGC 4038/4039). It generally has been assumed that the active star formation found there is due to the interaction of the disks of the two galaxies and \\citet{lee01} have observed two molecular cloud complexes, separated in velocity by $\\sim$100 km s$^{-1}$, in the southern part of this region. Our measurements imply that the two cloud complexes are moving away from each other. This result poses interesting questions about the physical mechanisms leading to starbursts in Arp 244 and other interacting galaxies.

  1. Kuluttajakäyttäytymisen hyödyntäminen verkkokaupan markkinoinnissa : Case: 244

    OpenAIRE

    Kylä-Kaila, Tero; Kylä-Kaila, Kaisa

    2013-01-01

    Opinnäytetyön toimeksiantajana oli kirjoittajien vuonna 2011 perustama yritys, 244. Yritys on vaatteita ja asusteita myyvä verkkokauppa. Opinnäytetyö tehtiin vauhdittamaan verkkokaupan myyntiä luomalla markkinointistrategia. Opinnäytetyöllä oli kaksi tavoitetta: ensimmäinen tavoite oli tutkia ja todistaa erityisesti sosiaalisten tekijöiden vaikutusta ihmisten verkkokauppakäyttäytymiseen muodin ostamisessa. Toinen tavoite oli löytää ja luoda keinoja markkinoida yritystä tutkimuksista saatujen ...

  2. New limit of $^{244}$Pu on Earth points to rarity of actinide nucleosynthesis

    CERN Document Server

    Wallner, A; Feige, J; Feldstein, C; Knie, K; Korschinek, G; Kutschera, W; Ofan, A; Paul, M; Quinto, F; Rugel, G; Steier, P

    2015-01-01

    Half of the heavy elements including all actinides are produced in r-process nucleosynthesis whose sites and history still remain a mystery. If continuously produced, the Interstellar Medium (ISM) is expected to build up a quasi-steady state of abundances of short-lived nuclides (with half-lives <100My), including actinides produced in r-process nucleosynthesis. Their existence in today's ISM would serve as a radioactive clock and would establish that their production was recent. In particular $^{244}$Pu, a radioactive actinide nuclide (81 My half-life), can place strong constraints on recent r-process frequency and production yield. Here we report on the detection of live interstellar $^{244}$Pu, archived in Earth's deep-sea floor during the last 25 My, at abundances lower by about two orders of magnitude than expected from continuous production in the Galaxy. This large discrepancy may signal a rarity of actinide r-process nucleosynthesis sites, compatible with neutron-star mergers or with a small subset...

  3. Isotopic yield in cold binary fission of even-even $^{244-258}$Cf isotopes

    CERN Document Server

    Santhosh, K P; Krishnan, Sreejith

    2016-01-01

    The cold binary fission of even-even 244-258Cf isotopes has been studied by taking the interacting barrier as the sum of Coulomb and proximity potential. The favorable fragment combinations are obtained from the cold valley plot (plot of driving potential vs. mass number of fragments) and by calculating the yield for charge minimized fragments. It is found that highest yield for 244,246,248Cf isotopes are for the fragments with isotope of Pb (Z=82) as one fragment, whereas for 250Cf and 252Cf isotopes the highest yield is for the fragments with isotope of Hg (Z=80) as one fragment. In the case of 254,256,258Cf isotopes the highest yield is for the fragments with Sn (Z=50) as one fragment. Thus, the fragment combinations with maximum yield reveal the role of doubly magic and near doubly magic nuclei in binary fission. It is found that asymmetric splitting is favoured for Cf isotopes with mass number A 252. In the case of Cf isotope with A=252, there is an equal probability for asymmetric and symmetric splitti...

  4. 244CmO2/nat.-UO2 hybrid blanket with flat fission power production

    International Nuclear Information System (INIS)

    In the present study, 244CmO2 is mixed with nat.-UO2 for the purpose of power flattening in a hybrid blanket with a reasonably high energy multiplication factor. Also, the temporal variations of the fission power density (FPD) are observed during an 18-month plant operation period. The main conclusion drawn from this work is that it became possible to keep a flat fission power profile (FPP) over a very long plant operation period of 18 months by simply omitting the beryllium multiplier in the blanket and keeping the neutron spectrum fairly unchanged throughout the fission zone. This reduced the efforts for fuel management to a minimum. A further observation focused on only minor variations of the integral neutronic data over longer plant operation periods. Among others, the fission power generation increase is also very modest. This results in an optimum investment for the nonnuclear island. The blanket burns up high-level nuclear waste 244Cm effectively, with efficient electricity production and breeding of a new type of nuclear fuel 245Cm with very superior nuclear properties. Finally, a warning should be issued for the careful international safeguarding of such a hybrid plant due to the extremely high quality of the bred plutonium fuel

  5. Isotopic yield in cold binary fission of even-even 244-258Cf isotopes

    Science.gov (United States)

    Santhosh, K. P.; Cyriac, Annu; Krishnan, Sreejith

    2016-05-01

    The cold binary fission of even-even 244-258Cf isotopes has been studied by taking the interacting barrier as the sum of Coulomb and proximity potential. The favorable fragment combinations are obtained from the cold valley plot (plot of driving potential vs. mass number of fragments) and by calculating the yield for charge minimized fragments. It is found that for 244,246,248Cf isotopes highest yield is for the fragments with isotope of Pb (Z = 82) as one fragment, whereas for 250Cf and 252Cf isotopes the highest yield is for the fragments with isotope of Hg (Z = 80) as one fragment. In the case of 254,256,258Cf isotopes the highest yield is for the fragments with Sn (Z = 50) as one fragment. Thus, the fragment combinations with maximum yield reveal the role of doubly magic and near doubly magic nuclei in binary fission. It is found that asymmetric splitting is favored for Cf isotopes with mass number A ≤ 250 and symmetric splitting is favored for Cf isotopes with A > 252. In the case of Cf isotope with A = 252, there is an equal probability for asymmetric and symmetric splitting. The individual yields obtained for the cold fission of 252Cf isotope are compared with the experimental data taken from the γ- γ- γ coincidences technique using Gammasphere.

  6. Stability of 244-260Fm isotopes against alpha and cluster radioactivity

    Indian Academy of Sciences (India)

    K P Santhosh; R K Biju; Sabina Sahadevan

    2009-12-01

    Taking Coulomb and proximity potentials as the interacting barrier we have studied the cold valley in the radioactive decay of 244-260Fm isotopes. It is found that in addition to alpha particle minima, other minima occur at S, Ar and Ca clusters. We have computed the half-lives and other characteristics of different clusters emitted from these parents treating parent, daughter and emitted cluster as spheres. Our study reveals that most of these parents are unstable against alpha and heavy cluster (46Ar, 48,50Ca) emissions and stable against light cluster emission, except 8Be from 244-248Fm isotopes. The most probable clusters from these parents are predicted to be 46Ar, 48,50Ca which indicate the role of doubly or near doubly magic clusters ( = 20, = 28) and also stress the role of doubly magic 208Pb daughter. The computed half-lives for alpha decay are in good agreement with the experimental data. It is found that the presence of neutron excess in the parent nuclei slows down the cluster decay process. The effect of quadrupole (2) and hexadecapole (4) deformations of parent and fragments on half-lives are also studied. It is found that inclusion of 2 and 4 reduces the height and shape of the barrier (increases barrier penetrability) and hence the half-life decreases.

  7. Filaments and Ionized Gas in the Vicinity of 3C 244.1

    CERN Document Server

    Feinstein, C; Martel, A R; Sparks, W B; Feinstein, Carlos; Martel, Andre R.; Sparks, William B.

    2001-01-01

    We present results of Hubble Space Telescope observations of the radio galaxy 3C 244.1. The broadband F702W (R) and F555W (V) images (WFPC2/PC) show an elliptical galaxy and gaseous filaments and blobs surrounding it. In the narrow-band ramp filter, dominated by [OIII]lambda5007, these filaments are bright and have the same morphology as the broad band images. To the south, the filaments have a cone-shaped structure and the radio jet is located at the center of this cone. To the north of the galaxy, the structure is found near the nucleus of the galaxy within its elliptical profile. From the photometry, the two brighter structures seem to be extended narrow line emission regions (ENLRs). The comparison with diagnostic line ratios shows that the observed emission is consistent with interactions between the expanding radio-jet and the local denser medium.

  8. Deformation effects in the alpha accompanied cold ternary fission of even-even $^{244-260}$Cf isotopes

    OpenAIRE

    Santhosh, K P; Krishnan, Sreejith

    2016-01-01

    Within the Unified ternary fission model (UTFM), the alpha accompanied ternary fission of even-even $^{244-260}$Cf isotopes has been studied by taking the interacting barrier as the sum of Coulomb and proximity potential. For the alpha accompanied ternary fission of 244^Cf isotope, the highest yield is obtained for the fragment combination 108^Ru+4^He+132^Te, which contain near doubly magic nuclei 132^Te (N=80, Z=52). In the case of 246^Cf and 248^Cf isotopes, the highest yield is obtained fo...

  9. The emission probabilities of long range alpha particles from even-even 244-252Cm isotopes

    OpenAIRE

    Santhosh, K P; Krishnan, Sreejith; Priyanka, B.

    2014-01-01

    The alpha accompanied cold ternary fission of even-even 244Cm, 246Cm, 248Cm, 250Cm and 252Cm isotopes have been studied by taking the interacting barrier as the sum of Coulomb and proximity potential with the fragments in equatorial configuration. The favorable fragment combinations are obtained from the cold reaction valley plot and by calculating the relative yield for the charge minimized fragments. In the alpha accompanied ternary fission of 244Cm isotope, the highest yield is found for t...

  10. 5 CFR 531.244 - Adjusting a GM employee's rate at the time of an annual pay adjustment.

    Science.gov (United States)

    2010-01-01

    ... 5 Administrative Personnel 1 2010-01-01 2010-01-01 false Adjusting a GM employee's rate at the... Rules for Gm Employees § 531.244 Adjusting a GM employee's rate at the time of an annual pay adjustment... agency must set the new GS rate for a GM employee as follows: (1) For a GM employee whose GS rate...

  11. 30 CFR 250.244 - What geological and geophysical (G&G) information must accompany the DPP or DOCD?

    Science.gov (United States)

    2010-07-01

    ... 30 Mineral Resources 2 2010-07-01 2010-07-01 false What geological and geophysical (G&G... Operations Coordination Documents (docd) § 250.244 What geological and geophysical (G&G) information must accompany the DPP or DOCD? The following G&G information must accompany your DPP or DOCD: (a)...

  12. 19 CFR 24.4 - Optional method for payment of estimated import taxes on alcoholic beverages upon entry, or...

    Science.gov (United States)

    2010-04-01

    ... 19 Customs Duties 1 2010-04-01 2010-04-01 false Optional method for payment of estimated import... THE TREASURY CUSTOMS FINANCIAL AND ACCOUNTING PROCEDURE § 24.4 Optional method for payment of... been given to me to use such procedure. (d) Use of deferred payment method. (1) The port director...

  13. Representation of perfectly reconstructed octave decomposition filter banks with set of decimators {2,4,4} via tree structure

    OpenAIRE

    Ling, Wing-Kuen; Tam, P K

    2003-01-01

    In this letter, we prove that a filter bank with set of decimators {2,4,4} achieves perfect reconstruction if and only if it can be represented via a tree structure and each branch of the tree structure achieves perfect reconstruction.

  14. The synthesis of superheavy nuclei in the 48Ca + 244Pu reaction

    International Nuclear Information System (INIS)

    In the bombardment of a 244Pu target with 48Ca ions, we observed a decay sequence consisting of an implanted heavy atom, three subsequent α-decays, and a spontaneous fission, all correlated in time and position. The measured α-energies and corresponding time intervals were: Eα = 9.71 MeV (Δt = 30.4 s), 8.67 MeV (Δt = 15.4 min) and 8.83 MeV (Δt = 1.6 min); for the spontaneous fission (Δt = 16.5 min) the total deposited energy was approximately 190 MeV. The large alpha-particle energies together with the long decay times and spontaneous fission terminating the chain offer evidence of the decay of nuclei with high atomic numbers. This decay chain is a good candidate for originating from the α-decay of the parent nucleus 289114, produced in the 3n-evaporation channel with a cross section of about 1 pb. The significant increase in the lifetimes of the new Z = 112 and 110 daughters of the Z = 114 nuclide (by a factor of ∼ 106) with respect to the known heaviest isotopes of elements 112 and 110 can be considered as a direct proof of the existence of the 'island of stability' of superheavy elements

  15. 243 244Cm studies in C57BL/Do mice

    International Nuclear Information System (INIS)

    Three groups of C57BL/Do mice were injected with different activities of 243244Cm so that the long-term biological effects could be evaluated. Effective skeletal retention equations were used to calculate the cumulative mean skeletal dose in rad at 140 days before death in each group of mice. The primary objective of this study was to determine the relative biological effectiveness (RBE) of 243244Cm compared to 226Ra, using bone sarcoma induction at the end point. Combined data for male and female mice permitted the RBE value +/- SD for 243244Cm to be calculated as 4.4 +/- 1.8 compared to 1.0 for 226Ra. A comparison of RBE values from a previous study in this mouse strain and the value for 243244Cm from this study suggest that the trivalent actinides 241Am, /sup 243,244/Cm, and 249Cf are about three times less effective for bone sarcoma induction than 239Pu

  16. Direct nuclear magnetic resonance observation of odorant binding to mouse odorant receptor MOR244-3.

    Science.gov (United States)

    Burger, Jessica L; Jeerage, Kavita M; Bruno, Thomas J

    2016-06-01

    Mammals are able to perceive and differentiate a great number of structurally diverse odorants through the odorant's interaction with odorant receptors (ORs), proteins found within the cell membrane of olfactory sensory neurons. The natural gas industry has used human olfactory sensitivity to sulfur compounds (thiols, sulfides, etc.) to increase the safety of fuel gas transport, storage, and use through the odorization of this product. In the United States, mixtures of sulfur compounds are used, but the major constituent of odorant packages is 2-methylpropane-2-thiol, also known as tert-butyl mercaptan. It has been fundamentally challenging to understand olfaction and odorization due to the low affinity of odorous ligands to the ORs and the difficulty in expressing a sufficient number of OR proteins. Here, we directly observed the binding of tert-butyl mercaptan and another odiferous compound, cis-cyclooctene, to mouse OR MOR244-3 on living cells by saturation transfer difference (STD) nuclear magnetic resonance (NMR) spectroscopy. This effort lays the groundwork for resolving molecular mechanisms responsible for ligand binding and resulting signaling, which in turn will lead to a clearer understanding of odorant recognition and competition. PMID:27019154

  17. The statistical model calculation of prompt neutron spectra from spontaneous fission of {sup 244}Cm and {sup 246}Cm

    Energy Technology Data Exchange (ETDEWEB)

    Gerasimenko, B.F. [V.G. Khlopin Radium Inst., Saint Peterburg (Russian Federation)

    1997-03-01

    The calculations of integral spectra of prompt neutrons of spontaneous fission of {sup 244}Cm and {sup 246}Cm were carried out. The calculations were done by the Statistical Computer Code Complex SCOFIN applying the Hauser-Feschbach method as applied to the description of the de-excitation of excited fission fragments by means of neutron emission. The emission of dipole gamma-quanta from these fragments was considered as a competing process. The average excitation energy of a fragment was calculated by two-spheroidal model of tangent fragments. The density of levels in an excited fragment was calculated by the Fermi-gas model. The quite satisfactory agreement was reached between theoretical and experimental results obtained in frames of Project measurements. The calculated values of average multiplicities of neutron number were 2,746 for {sup 244}Cm and 2,927 for {sup 246}Cm that was in a good accordance with published experimental figures. (author)

  18. {\\alpha}-accompanied cold ternary fission of $^{238-244}$Pu isotopes in equatorial and collinear configuration

    OpenAIRE

    Santhosh, K P; Krishnan, Sreejith; Priyanka, B.

    2015-01-01

    The cold ternary fission of $^{238}$Pu, $^{240}$Pu, $^{242}$Pu and $^{244}$Pu isotopes, with $^{4}$He as light charged particle, in equatorial and collinear configuration has been studied within the Unified ternary fission model (UTFM). The fragment combination $^{100}$Zr+$^{4}$He+$^{134}$Te possessing the near doubly magic nuclei $^{134}$Te (N=82, Z=52) gives the highest yield in the alpha accompanied ternary fission of $^{238}$Pu. For the alpha accompanied ternary fission of $^{240}$Pu, $^{...

  19. Utilisation of micro-plant and reactive distillation for the production of 2-methoxy-2,4,4-trimethylpentane

    OpenAIRE

    Mustapha, Kehinde

    2014-01-01

    The micro-plant and reactive distillation concepts have been researched in this thesis. The aim of the project is to invent a technique for the production of pure 2-methoxy-2,4,4-trimethylpentane (TOME). After the production, physical property of interest of the chemical compound would be determined. The first phase of this project relates to the production of TOME with the micro-plant constructed by Aalto University chemical engineering research group. In the second section, TOME was man...

  20. Short-lived $^{244}$Pu Points to Compact Binary Mergers as Sites for Heavy r-process Nucleosynthesis

    CERN Document Server

    Hotokezaka, Kenta; Paul, Michael

    2015-01-01

    Measurements of the radioactive $^{244}$Pu abundances can break the degeneracy between high-rate/low-yield and low-rate/high-yield scenarios for the production of heavy $r$-process elements. The first corresponds to production by core collapse supernovae (cc-SNe) while the latter corresponds to production by e.g. compact binary mergers. The estimated $^{244}$Pu abundance in the current interstellar medium inferred from deep-sea measurements (Wallner et al. 2015) is significantly lower than that corresponding Early Solar System abundances (Turner et al 2007). We estimate the expected median value of the $^{244}$Pu abundances and fluctuations around this value in both models. We show that while the current and Early Solar System abundances are naturally explained within the low-rate/high-yield (e.g. merger) scenario, they are incompatible with the high-rate/low-yield (cc-SNe) model. The inferred event rate remarkably agrees with compact binary merger rates estimated from Galactic neutron star binaries and from ...

  1. {\\alpha}-accompanied cold ternary fission of $^{238-244}$Pu isotopes in equatorial and collinear configuration

    CERN Document Server

    Santhosh, K P; Priyanka, B

    2015-01-01

    The cold ternary fission of $^{238}$Pu, $^{240}$Pu, $^{242}$Pu and $^{244}$Pu isotopes, with $^{4}$He as light charged particle, in equatorial and collinear configuration has been studied within the Unified ternary fission model (UTFM). The fragment combination $^{100}$Zr+$^{4}$He+$^{134}$Te possessing the near doubly magic nuclei $^{134}$Te (N=82, Z=52) gives the highest yield in the alpha accompanied ternary fission of $^{238}$Pu. For the alpha accompanied ternary fission of $^{240}$Pu, $^{242}$Pu and $^{244}$Pu isotopes, the highest yield was found for the fragment combination with doubly magic nuclei $^{132}$Sn (N=82, Z=50) as the heavier fragment. The deformation and orientation of fragments have also been taken into account for the alpha accompanied ternary fission of $^{238-244}$Pu isotopes, and it has been found that in addition to closed shell effect, ground state deformation also plays an important role in determining the isotopic yield in the ternary fission process. The emission probability and ki...

  2. The emission probabilities of long range alpha particles from even-even 244-252Cm isotopes

    CERN Document Server

    Santhosh, K P; Priyanka, B

    2014-01-01

    The alpha accompanied cold ternary fission of even-even 244Cm, 246Cm, 248Cm, 250Cm and 252Cm isotopes have been studied by taking the interacting barrier as the sum of Coulomb and proximity potential with the fragments in equatorial configuration. The favorable fragment combinations are obtained from the cold reaction valley plot and by calculating the relative yield for the charge minimized fragments. In the alpha accompanied ternary fission of 244Cm isotope, the highest yield is found for the fragment combination 110Ru+4He+130Sn, which possess near doubly magic nuclei 130Sn. For the ternary fission of 246Cm, 248Cm, 250Cm and 252Cm isotopes with 4He as light charged particle, the highest yield is obtained for the fragment combination with doubly magic nuclei 132Sn as the heavier fragment. The emission probabilities and kinetic energies of long range alpha particle have been computed for the 242,244,246,248Cm isotopes and are found to be in good agreement with the experimental data. The relative yields for th...

  3. [Italian national register of low etiological fraction occupational cancer pursuant to art. 244 of legislative decree n. 81/2008].

    Science.gov (United States)

    Massari, S; Ippoliti, M; Menegozzo, S; Forastiere, F; Crosignani, P

    2011-01-01

    Legislative decree No. 81/2008 in the article n. 244 states that ISPESL, now INAIL, realizes a register of occupational cancers with low etiological fraction by means of a data collection method based exclusively on voluntary reports by GPs, healthcare and social security agencies (ReNaLOC) and a surveillance cancer monitoring system (OCCAM) based on linkage of routinely available data (cancer registries, hospital discharge records, Italian Social Security archives). ReNaLOC has produced a partial picture of the situation, it includes 1.584 cases as of June 2011. With OCCAM many situations of known risks were identified and others are worthy to be deepen. PMID:23393807

  4. Absolute L X-ray intensities in the decays of 230Th, 234U, 238Pu and 244Cm

    International Nuclear Information System (INIS)

    The absolute L X-ray emission rates of 230Th, 234U, 238Pu and 244Cm have been measured. The rates were obtained by an alpha-particle gated photon spectrometry technique involving the use of a highly calibrated Ge(HP) detector in coincidence with a SiSB detector. The directional correlation between L X-rays and alpha-particles has been accounted for. The present results are compared with previous experimental values and theoretical estimates. Agreement with theoretical estimates is good, however few of the previous experimental values agree with the present work. Differences with previous work partly seem to lie with the detector calibration. (orig.)

  5. A multi-channel 24.4 ps bin size Time-to-Digital Converter for HEP applications

    CERN Document Server

    Mester, C; Morira, P

    2008-01-01

    A multi-channel time-tagging Time-to-Digital Converter (TDC) ASIC with a resolution of 24.4 ps (bin size) has been implemented and fabricated in a 130 nm CMOS technology. An on-chip PLL is used to generate an internal timing reference from an external 40 MHz clock source. The circuit is based on a 32 element Delay Locked Loop (DLL) which performs the time interpolation. The 32 channel architecture of the TDC is suitable for both triggered and non-triggered applications. The prototype contains test structures such as a substrate noise generator. The paper describes the circuit architecture and its principles of operation.

  6. When the non-contrast-enhanced phase is unnecessary in abdominal computed tomography scans? A retrospective analysis of 244 cases

    Energy Technology Data Exchange (ETDEWEB)

    Costa, Danilo Manuel Cerqueira; Salvadori, Priscila Silveira; Monjardim, Rodrigo da Fonseca; Bretas, Elisa Almeida Sathler; Torres, Lucas Rios; Caldana, Rogerio Pedreschi; Shigueoka, David Carlos; Medeiros, Regina Bitelli; D' ippolito, Giuseppe, E-mail: giuseppe_dr@uol.com.br [Universidade Federal de Sao Paulo (EPM/UNIFESP), Sao Paulo, SP (Brazil). Escola Paulista de Medicina. Departamento de Diagnostico por Imagem

    2013-06-15

    Objective: to evaluate the necessity of the non contrast-enhanced phase in abdominal computed tomography scans. Materials and Methods: A retrospective, cross-sectional, observational study was developed, evaluating 244 consecutive abdominal computed tomography scans both with and without contrast injection. Initially, the contrast-enhanced images were analyzed (first analysis). Subsequently, the observers had access to the non-contrast-enhanced images for a second analysis. The primary and secondary diagnoses were established as a function of the clinical indications for each study (such as tumor staging, acute abdomen, investigation for abdominal collection and hepatocellular carcinoma, among others). Finally, the changes in the diagnoses resulting from the addition of the non-contrast-enhanced phase were evaluated. Results: Only one (0.4%; p > 0.999; non-statistically significant) out of the 244 reviewed cases had the diagnosis changed after the reading of non-contrast-enhanced images. As the secondary diagnoses are considered, 35 (14%) cases presented changes after the second analysis, as follows: nephrolithiasis (10%), steatosis (3%), adrenal nodule (0.7%) and cholelithiasis (0.3%). Conclusion: For the clinical indications of tumor staging, acute abdomen, investigation of abdominal collections and hepatocellular carcinoma, the non-contrast-enhanced phase can be excluded from abdominal computed tomography studies with no significant impact on the diagnosis. (author)

  7. When the non-contrast-enhanced phase is unnecessary in abdominal computed tomography scans? A retrospective analysis of 244 cases

    International Nuclear Information System (INIS)

    Objective: to evaluate the necessity of the non contrast-enhanced phase in abdominal computed tomography scans. Materials and Methods: A retrospective, cross-sectional, observational study was developed, evaluating 244 consecutive abdominal computed tomography scans both with and without contrast injection. Initially, the contrast-enhanced images were analyzed (first analysis). Subsequently, the observers had access to the non-contrast-enhanced images for a second analysis. The primary and secondary diagnoses were established as a function of the clinical indications for each study (such as tumor staging, acute abdomen, investigation for abdominal collection and hepatocellular carcinoma, among others). Finally, the changes in the diagnoses resulting from the addition of the non-contrast-enhanced phase were evaluated. Results: Only one (0.4%; p > 0.999; non-statistically significant) out of the 244 reviewed cases had the diagnosis changed after the reading of non-contrast-enhanced images. As the secondary diagnoses are considered, 35 (14%) cases presented changes after the second analysis, as follows: nephrolithiasis (10%), steatosis (3%), adrenal nodule (0.7%) and cholelithiasis (0.3%). Conclusion: For the clinical indications of tumor staging, acute abdomen, investigation of abdominal collections and hepatocellular carcinoma, the non-contrast-enhanced phase can be excluded from abdominal computed tomography studies with no significant impact on the diagnosis. (author)

  8. Deformation effects in the alpha accompanied cold ternary fission of even-even 244-260Cf isotopes

    Science.gov (United States)

    Santhosh, K. P.; Krishnan, Sreejith

    2016-04-01

    Within the unified ternary fission model (UTFM), the alpha accompanied ternary fission of even-even 244-260Cf isotopes has been studied by taking the interacting barrier as the sum of Coulomb and proximity potential. For the alpha accompanied ternary fission of the 244Cf isotope, the highest yield is obtained for the fragment combination 108Ru + 4He + 132Te, which contains the near doubly magic nucleus 132Te ( N = 80, Z = 52). In the case of 246Cf and 248Cf isotopes, the highest yield is obtained for the fragment combinations with the near doubly magic nucleus 134Te ( N = 82, Z = 52) as the heaviest fragment. The highest yield obtained for 250Cf, 252Cf, 254Cf, 256Cf, 258Cf and 260Cf isotopes is for the fragment combination with the doubly magic nucleus 132Sn ( N = 82), Z = 50 as the heaviest fragment. We have included the effect of deformation and orientation of fragments and this has revealed that in addition to the closed shell effect, ground-state deformation also plays an important role in the calculation of the relative yield of favorable fragment combinations. The computed isotopic yields for the alpha accompanied ternary fission of the 252Cf isotope are found to be in agreement with the experimental data. The emission probability and kinetic energy of the long-range alpha particle is calculated for the various isotopes of Cf and are found to be in good agreement with the experimental data.

  9. Deformation effects in the alpha accompanied cold ternary fission of even-even $^{244-260}$Cf isotopes

    CERN Document Server

    Santhosh, K P

    2016-01-01

    Within the Unified ternary fission model (UTFM), the alpha accompanied ternary fission of even-even $^{244-260}$Cf isotopes has been studied by taking the interacting barrier as the sum of Coulomb and proximity potential. For the alpha accompanied ternary fission of 244^Cf isotope, the highest yield is obtained for the fragment combination 108^Ru+4^He+132^Te, which contain near doubly magic nuclei 132^Te (N=80, Z=52). In the case of 246^Cf and 248^Cf isotopes, the highest yield is obtained for the fragment combinations with near doubly magic nuclei 134^Te (N=82, Z=52) as the heavier fragment. The highest yield obtained for 250^Cf, 252^Cf, 254^Cf, 256^Cf, 258^Cf and 260^Cf isotopes is for the fragment combination with doubly magic nuclei 132^Sn (N=82, Z=50) as the heavier fragment. We have included the effect of deformation and orientation of fragments and this has revealed that in addition to closed shell effect, ground state deformation also plays an important role in the calculation of relative yield of fav...

  10. When the non-contrast-enhanced phase is unnecessary in abdominal computed tomography scans? A retrospective analysis of 244 cases

    Directory of Open Access Journals (Sweden)

    Danilo Manuel Cerqueira Costa

    2013-07-01

    Full Text Available Objective: To evaluate the necessity of the non contrast-enhanced phase in abdominal computed tomography scans. Materials and Methods: A retrospective, cross-sectional, observational study was developed, evaluating 244 consecutive abdominal computed tomography scans both with and without contrast injection. Initially, the contrast-enhanced images were analyzed (first analysis. Subsequently, the observers had access to the non-contrast-enhanced images for a second analysis. The primary and secondary diagnoses were established as a function of the clinical indications for each study (such as tumor staging, acute abdomen, investigation for abdominal collection and hepatocellular carcinoma, among others. Finally, the changes in the diagnoses resulting from the addition of the non-contrast-enhanced phase were evaluated. Results: Only one (0.4%; p > 0.999; non-statistically significant out of the 244 reviewed cases had the diagnosis changed after the reading of non-contrast-enhanced images. As the secondary diagnoses are considered, 35 (14% cases presented changes after the second analysis, as follows: nephrolithiasis (10%, steatosis (3%, adrenal nodule (0.7% and cholelithiasis (0.3%. Conclusion: For the clinical indications of tumor staging, acute abdomen, investigation of abdominal collections and hepatocellular carcinoma, the non-contrast-enhanced phase can be excluded from abdominal computed tomography studies with no significant impact on the diagnosis.

  11. Radioactive air emissions notice of construction use of a portable exhauster at 244-AR vault. Revision 2

    International Nuclear Information System (INIS)

    This document serves as a notice of construction (NOC), pursuant to the requirements of Washington Administrative Code (WAC) 246-247-060, and as a request for approval to construct, pursuant to 40 Code of Federal Regulations (CFR) 61.96, a portable exhauster at the 244-AR Vault. The exhauster would be used during air jetting of accumulated liquids from the cell sumps into the tanks and to make transfers among the tanks within the vault when needed. The 244-AR Vault is considered to be a double-contained receiver tank (OCRT) based on its functional characteristics, although it is not listed as one of the five designated DCRTs in the 200 Area Tank Farm systems. Process operations at the vault have been inactive since 1978 and the vault's two stacks have not operated since 1993. Since cessation of vault operations an extremely large amount of rain water and snow melt have accumulated in the cell sumps. The water level in the sumps is substantially above their respective operating levels and there is concern for leakage to the environment through containment failure due to corrosion from backed-up sump liquid. Active ventilation is required to provide contamination control during air jetting operations within the vault. It has been determined that it would not be cost effective to repair the existing exhaust systems to an operational condition; thus, a portable exhauster will be used to support the intermittent operations

  12. Petrogenesis of silicic magmatism related to the ˜ 2.44 Ga rifting of Archean crust in Koillismaa, eastern Finland

    Science.gov (United States)

    Lauri, L. S.; Rämö, O. T.; Huhma, H.; Mänttäri, I.; Räsänen, J.

    2006-01-01

    Early Paleoproterozoic extension in the Archean craton of the Fennoscandian shield led to the emplacement of several 2.44 Ga layered gabbroic intrusive complexes in northern Finland and adjacent Russia. Closely associated with them are felsic rocks of similar age: (1) the Sirniö Group volcanic rocks on top of the Koillismaa layered complex; (2) a quartz alkali feldspar syenite at Kynsijärvi near the Koillismaa complex; and (3) an aluminous A-type granite at Nuorunen near the Oulanka layered complex. In the Koillismaa area, the ruptured Archean crust consists of ortho- and paragneisses that were intruded and migmatized by somewhat younger granites. U-Pb zircon data indicate that the gneisses are at least ˜2.8 Ga old and that the granites were crystallized at ˜2.7 Ga. Both rock types show a common monazite age of 2695 Ma that registers the peak of granulite facies metamorphism and, possibly, the intrusion of the granites. The local Neoarchean crust has ɛNd(at 2440 Ma) values between - 5 and - 8.5. The mafic rocks of the Koillismaa complex show initial ɛNd(at 2440 Ma) values around - 1.5 and those of the Oulanka complex range from - 2.1 to 0. The ɛNd value (- 4.8) and TDM model age (2.9-3.0 Ga) of the Kynsijärvi quartz alkali feldspar syenite are within the limits of the evolution path of the local Archean crust. The corresponding values for the Nuorunen granite are - 2.0 and 2.76 Ga and are thus closer to those of the mafic rocks. The volcanic rocks of the Sirniö Group show more scatter with initial ɛNd(at 2440 Ma) values of - 1.1 to - 5.3; the lowest ɛNd values probably reflect later disturbance-magmatic values cluster around - 2. Major and trace element modeling shows that fractional crystallization of the Koillismaa complex parental magma or partial melting of the Archean crust cannot account for the ˜ 2.44 Ga silicic rocks of Koillismaa. The geochemical and Nd isotope characteristics of the volcanic rocks and the Kynsijärvi quartz alkali feldspar

  13. Shu-mei Shih, Visuality and Identity. Sinophone Articulation across the Pacific, Berkeley, University Press of California, 2007, 244 p.

    OpenAIRE

    Lincot, Emmanuel

    2008-01-01

    Professeur de littérature comparée à l’université de Californie de Los Angeles (UCLA), spécialiste des « gender studies », Shu-mei Shih aborde d’une manière originale, dans ce nouvel ouvrage, la question de l’identité dans le monde sinophone actuel. Long de 244 pages, Visuality and Identity. Sinophone Articulations across the Pacific, est composé d’une introduction et de six parties : la première porte sur la globalisation et ses effets sur les minorités, la deuxième sur le cas, plus précis, ...

  14. Hazards assessment document for receiving basin for offsite fuel (244-H) and resin regeneration facility (245-H) (RBOF/RRF)

    International Nuclear Information System (INIS)

    The Hazard Assessment Document (HAD) for the Receiving Basin for Offsite Fuels (RBOF), Building 244-H, and the Resin Regeneration Facility (RRF), Building 245-H, was prepared in accordance with Department of Energy (DOE) Order 5480.23, DOE-STD-1 027-92, and WSRC-MS-92-206. The HAD provides hazards categorizations based on the radiological and chemical hazards associated with the facility. The hazard category is used to provide the input data for a graded approach to the development of the facility Safety Analysis Report (SAR) in accordance with DOE Order 5480.23. The RBOF/RRF was assumed to be a one segment facility. The accident consequences are calculated without consideration for any mitigative systems or administrative controls This facility is categorized as Hazard Category 2 as a result of the analysis of the radiological inventory conducted in accordance with Reference 2 and the chemical inventory in accordance with Reference 3

  15. Production of new superheavy Z=108-114 nuclei with $^{238}$U, $^{244}$Pu and $^{248,250}$Cm targets

    CERN Document Server

    Feng, Zhao-Qing; Li, Jun-Qing

    2009-01-01

    Within the framework of the dinuclear system (DNS) model, production cross sections of new superheavy nuclei with charged numbers Z=108-114 are analyzed systematically. Possible combinations based on the actinide nuclides $^{238}$U, $^{244}$Pu and $^{248,250}$Cm with the optimal excitation energies and evaporation channels are pointed out to synthesize new isotopes which lie between the nuclides produced in the cold fusion and the $^{48}$Ca induced fusion reactions experimentally, which are feasible to be constructed experimentally. It is found that the production cross sections of superheavy nuclei decrease drastically with the charged numbers of compound nuclei. Larger mass asymmetries of the entrance channels enhance the cross sections in 2n-5n channels.

  16. Statistical evaluation of lung, bone, and liver tumors in rats exposed to aerosols of 238PuO2, 239PuO2, and 244CmO2

    International Nuclear Information System (INIS)

    The Mantel--Haenszel procedure was applied to the evaluation of tumor data from exposures to aerosols of 238PuO2, 239PuO2, and 244CmO2. Significance was evident for lung tumors for all three transuranics, for osteosarcomas in animals exposed to 244CmO2, and was suggested for liver tumors in animals exposed to 244CmO2

  17. Drospirenone/ethinylestradiol 3mg/20microg (24/4 day regimen): a review of its use in contraception, premenstrual dysphoric disorder and moderate acne vulgaris.

    Science.gov (United States)

    Fenton, Caroline; Wellington, Keri; Moen, Marit D; Robinson, Dean M

    2007-01-01

    Drospirenone 3mg with ethinylestradiol 20microg (Yaz) is a low-dose combined oral contraceptive (COC) administered in a regimen of 24 days of active tablets followed by a short hormone-free interval (4 days; 24/4 regimen). Drospirenone, unlike other synthetic progestogens used in COCs, is a 17alpha-spirolactone derivative and a 17alpha-spironolactone analogue with antimineralocorticoid and antiandrogenic properties. Drospirenone/ethinylestradiol 3mg/20microg (24/4) is approved in the US for the prevention of pregnancy in women, for the treatment of the symptoms of premenstrual dysphoric disorder (PMDD) and for the treatment of moderate acne vulgaris in women who wish to use an oral contraceptive for contraception.Drospirenone/ethinylestradiol 3mg/20microg (24/4) provided 99% contraceptive protection over 1 year of treatment in two large studies. The same treatment regimen over three treatment cycles also significantly improved the emotional and physical symptoms associated with PMDD, and improved moderate acne vulgaris over six treatment cycles in double-blind trials. It was generally well tolerated, with adverse events generally typical of those experienced with other COCs and which were most likely to occur in the first few cycles. Clinical trials indicate that drospirenone/ethinylestradiol 3mg/20microg (24/4) is a good long-term contraceptive option, and additionally offers relief of symptoms that characterise PMDD and has a favourable effect on moderate acne vulgaris. PMID:17683173

  18. Primary hyperoxaluria type 1 in the Canary Islands: a conformational disease due to I244T mutation in the P11L-containing alanine:glyoxylate aminotransferase.

    Science.gov (United States)

    Santana, A; Salido, E; Torres, A; Shapiro, L J

    2003-06-10

    Primary hyperoxaluria type 1 (PH1) is an inborn error of metabolism resulting from a deficiency of alanine:glyoxylate aminotransferase (AGXT; EC 2.6.1.44). Most of the PH1 alleles detected in the Canary Islands carry the Ile-244 --> Thr (I244T) mutation in the AGXT gene, with 14 of 16 patients homozygous for this mutation. Four polymorphisms within AGXT and regional microsatellites also were shared in their haplotypes (AGXT*LTM), consistent with a founder effect. The consequences of these amino acid changes were investigated. Although I244T alone did not affect AGXT activity or subcellular localization, when present in the same protein molecule as Leu-11 --> Pro (L11P), it resulted in loss of enzymatic activity in soluble cell extracts. Like its normal counterpart, the AGXT*LTM protein was present in the peroxisomes but it was insoluble in detergent-free buffers. The polymorphism L11P behaved as an intragenic modifier of the I244T mutation, with the resulting protein undergoing stable interaction with molecular chaperones and aggregation. This aggregation was temperature-sensitive. AGXT*LTM expressed in Escherichia coli, as a GST-fusion protein, and in insect cells could be purified and retained enzymatic activity. Among various chemical chaperones tested in cell culture, betaine substantially improved the solubility of the mutant protein and the enzymatic activity in cell lysates. In summary, I244T, the second most common mutation responsible for PH1, is a protein conformational disease that may benefit from new therapies with pharmacological chaperones or small molecules to minimize protein aggregation. PMID:12777626

  19. Fragmentation of 200 and 244 MeV/u carbon beams in thick tissue-like absorbers

    International Nuclear Information System (INIS)

    Stacks consisting of thin CR-39 sheets sandwiched between thick lucite and water absorbers were perpendicularly bombarded by 12C ions at 200 and 244 MeV/u. Track radius distributions representing the charge composition of the fragmented beams were automatically measured by a particle track analysis system. After analysis of the nuclear charge distributions, the total charge removal cross-sections and elemental production cross-sections of fragments with atomic numbers from 5 to 3, were obtained down to the lower energies (∼50 and 100 MeV/u, respectively). It has been found that the measured total charge removal cross-section agrees with theoretical predictions within ∼10% and very well with previous experiments in corresponding energy regions. Two model calculations for production of B fragment are in good agreement with our measured data while a third model overestimates it by ∼12%. Theoretical cross-sections for Be and Li fragments differ strongly among the different models and from measured values

  20. In vivo characterization of radioiodinated (+)-2-[4-(4-iodophenyl) piperidino] cyclohexanol as a potential {sigma}-1 receptor imaging agent

    Energy Technology Data Exchange (ETDEWEB)

    Akhter, Nasima [Department of Biotracer Medicine, Kanazawa University, Kanazawa 920-8640 (Japan); Shiba, Kazuhiro [Division of Tracer Kinetics, Advanced Science Research Center, Kanazawa University, Kanazawa 920-8640 (Japan)], E-mail: shiba@med.kanazawa-u.ac.jp; Ogawa, Kazuma [Division of Tracer Kinetics, Advanced Science Research Center, Kanazawa University, Kanazawa 920-8640 (Japan); Kinuya, Seigo; Nakajima, Kenichi [Department of Biotracer Medicine, Kanazawa University, Kanazawa 920-8640 (Japan); Mori, Hirofumi [Division of Tracer Kinetics, Advanced Science Research Center, Kanazawa University, Kanazawa 920-8640 (Japan)

    2007-08-15

    In this study, the (+)-enantiomer of radioiodinated 2-[4-(4-iodophenyl)piperidino]cyclohexanol [(+)-[{sup 125}I]-p-iodovesamicol] [(+)-[{sup 125}I]pIV], which is reported to bind with high affinity to {sigma}-1 receptors in vitro, was tested for its usefulness in imaging {sigma}-1 receptors in the central nervous system (CNS) in vivo. In biodistribution studies, significant amounts (approximately 3% of the injected dose) of (+)-[{sup 125}I]pIV accumulated in rat brain, and its retention was prolonged. In blocking studies, the accumulation of (+)-[{sup 125}I]pIV in the rat brain was significantly reduced by the coadministration of {sigma}-ligands such as pentazocine (5.0 {mu}mol), haloperidol (0.5 {mu}mol) or SA4503 (0.5 {mu}mol). The blocking effect of pentazocine (selective {sigma}-1 ligand) was similar to the blocking effects of SA4503 and haloperidol [nonselective {sigma} ({sigma}-1 and {sigma}-2) ligands]. Ex vivo autoradiography of the rat brain at 45 min following intravenous injection of (+)-[{sup 125}I]pIV showed high localization in brain areas rich in {sigma}-1 receptors. Thus, the distribution of (+)-[{sup 125}I]pIV was thought to bind to {sigma}-1 receptors in the CNS in vivo. These results indicate that radioiodinated (+)-pIV may have the potential to image {sigma}-1 receptors in vivo.

  1. In vivo characterization of radioiodinated (+)-2-[4-(4-iodophenyl) piperidino] cyclohexanol as a potential σ-1 receptor imaging agent

    International Nuclear Information System (INIS)

    In this study, the (+)-enantiomer of radioiodinated 2-[4-(4-iodophenyl)piperidino]cyclohexanol [(+)-[125I]-p-iodovesamicol] [(+)-[125I]pIV], which is reported to bind with high affinity to σ-1 receptors in vitro, was tested for its usefulness in imaging σ-1 receptors in the central nervous system (CNS) in vivo. In biodistribution studies, significant amounts (approximately 3% of the injected dose) of (+)-[125I]pIV accumulated in rat brain, and its retention was prolonged. In blocking studies, the accumulation of (+)-[125I]pIV in the rat brain was significantly reduced by the coadministration of σ-ligands such as pentazocine (5.0 μmol), haloperidol (0.5 μmol) or SA4503 (0.5 μmol). The blocking effect of pentazocine (selective σ-1 ligand) was similar to the blocking effects of SA4503 and haloperidol [nonselective σ (σ-1 and σ-2) ligands]. Ex vivo autoradiography of the rat brain at 45 min following intravenous injection of (+)-[125I]pIV showed high localization in brain areas rich in σ-1 receptors. Thus, the distribution of (+)-[125I]pIV was thought to bind to σ-1 receptors in the CNS in vivo. These results indicate that radioiodinated (+)-pIV may have the potential to image σ-1 receptors in vivo

  2. Resíduos de glifosato e ácido aminometilfosfônico e teores de isoflavonas em soja BRS 244 RR e BRS 154 Residues of glyphosate and aminomethylphosphonic acid and levels of isoflavones in BRS 244 RR and BRS 154 soybean

    Directory of Open Access Journals (Sweden)

    Giani Mariza Bärwald Bohm

    2008-12-01

    Full Text Available A principal forma de controle das plantas daninhas durante o cultivo de soja geneticamente modificada (GM RR BRS 244 RR é o uso de glifosato. Porém, existem dúvidas quanto à segurança desse herbicida, à qualidade dos grãos e do solo da soja GM RR cultivada em Planossolo. Resíduos da molécula do glifosato e do metabólito ácido aminometilfosfônico (AMPA podem estar presentes nos grãos, bem como, podem afetar a concentração de isoflavonas. Por isso, avaliaram-se as sojas BRS 244 RR e BRS 154 cultivadas nos seguintes tratamentos: T1 - soja BRS 244 RR, sem aplicação de herbicida, com capina manual aos 28 dias após o plantio (dap; T2 - soja BRS 154 sem aplicação de herbicida, com capina manual também aos 28 dap; T3 - soja BRS 244 RR com uma aplicação de glifosato a 960 g ia ha-1 aos 28 dap; T4 - soja BRS 244 RR com duas aplicações de glifosato a 960 g ia ha-1 aos 28 e 56 dap; T5 - soja BRS 244 RR com uma aplicação de herbicida imazetapir a 100 g ia ha-1 aos 28 dap; T6 - soja BRS 154 com uma aplicação de herbicida imazetapir a 100 g ia ha-1 aos 28 dap. Verificou-se que a aplicação de glifosato no controle de plantas daninhas resultou em teores elevados de glifosato e ácido aminometilfosfônico no solo. Nos grãos, o teor de isoflavonas não parece ser significativamente afetado pela aplicação de glifosato, mas os resíduos desse herbicida foram superiores ao permitido pela legislação vigente, que é de 10 mg.kg-1.The use of Glyphosate is the best way to control weed growing when cultivating genetically modified soybean (GMRR BRS 244 RR. However, there have been doubts about the safety of this herbicide use concerning its effects on the quality of grains and on the soil of Albaqualf cultivated GMRR soybean. Glyphosate and the metabolite aminomethylphosphonic acid (AMPA residues can be present in the grains and affect the isoflavones concentration. Therefore, BRS 244 RR and BRS 154 soybeans with the following

  3. Studying of distribution of 137Cs, 90Sr, 239+240Pu, 241Am and 244Cm according to the organic acids fractions of the alienation zone soils

    International Nuclear Information System (INIS)

    The paper deals with data of research on the distribution of the radionuclides 137Cs, 90Sr, 239+240Pu, 241Am and 244Cm of ''the Chornobyl rains'' by the fractions of the organic matters of derno-podzolic sandy, derno-meadow and peat soils sampled in the alienation zone of the Chornobyl NPP. Functioning of organic matters was carried according to Tyurin's method. It is stressed that, independently on soil type, 137Cs is connected with the mineral contituent by 80-95%. It is found out that, independently on the soil type, 50-70% 137Sr and 15-45% 241Am are associated with fulvic acid fractions. The 241Am and 244Cm distribution according to organic acids taking into account deviations while carrying out determinations is unambiguous. It is found out that in all the soils tested the main quality of 239+24Pu is connected with humic acids

  4. A Study of Personality and Family- and School Environment and Possible Interactional Effects in 244 Swedish Children—A Multiple Regression Analysis

    OpenAIRE

    Persson, Bertil

    2014-01-01

    The aim of the study was to examine relationships between psychosocial family- and school environment and personality as assessed by the Junior Eysenck Personality Questionnaire (EPQ-J) and possible personality interactional effects. The study was based on 244 Swedish girls and boys, 10-19 years old, who filled in the Family- and School Psychosocial Environment (FSPE) questionnaire and the EPQ-J. A multiple regression analysis showed that the FSPE-factor Family conflicts and school discipline...

  5. Comparison of theoretical and experimental anisotropy between α-particles and L X-rays in the decays of 238Pu and 244Cm

    International Nuclear Information System (INIS)

    Recent measurements of the anisotropic directional correlation between α-particles and L X-rays in the decays of 238Pu and 244Cm are compared with theoretical estimates. The comparison shows reasonable agreement for the major L X-ray groups Lα and Lβ, however the experimental value for Ll is considerably lower than the theoretical prediction. A greater M2 admixture in the Ll transition than predicted by Scofield could explain the difference. (orig.)

  6. The effect of occupational stress on depression symptoms among 244 policemen in a city%某市244名警察职业紧张对抑郁症状发生的影响

    Institute of Scientific and Technical Information of China (English)

    谷桂珍; 余善法; 吴辉; 周文慧

    2015-01-01

    目的 探讨职业紧张相关因素对警察抑郁症状发生的影响.方法 采取整群抽样方法,于2011年5月抽取某市公安局287名警察进行职业问卷调查,剔除人口学特征调查表变量缺失者以及职业紧张相关因素调查表3个条目以上应答缺失者问卷后,最终244名警察的资料纳入本研究.采用抑郁自评问卷中文译本、工作内容问卷、付出-回报失衡问卷中文译本、工作危险量表、职业紧张量表测试调查对象的抑郁症状及职业紧张相关因素.应用Spearman相关分析和多元回归分析探讨抑郁症状评分与职业紧张相关变量之间的关系.结果 全部调查对象抑郁症状评分中位数(P25~P75)为16.50(11.00~25.00)分.无抑郁症状警察144名,有抑郁症状警察100名.警龄<10、10~19、20~29、≥30年的抑郁症状评分中位数(P25~P75)分别为17.00(8.00~26.00)、16.00(11.00~24.50)、19.00(12.00~27.00)、12.00(6.25~15.00)分(χ2=9.52,P=0.023),差异有统计学意义.有抑郁症状组的心理需求、睡眠障碍、每日紧张感和负性情感评分中位数(P25~P75)分别为25.00(23.00~28.00)、12.50(9.00~18.00)、9.50(8.00~12.00)、3.00(2.00~4.00)分,均高于无抑郁症状组[24.00(22.00~25.00)、8.00(5.00~13.00)、8.00(6.00~10.00)、1.00(0~2.75)分](Z值分别为3.82、5.39、5.15、6.41,P值均<0.001),差异有统计学意义.Spearman相关分析显示,抑郁症状评分与睡眠障碍、内在投入、付出、心理需求、每日紧张感、负性情感和工作危险性呈正相关,相关系数分别为0.44、0.28、0.28、0.33、0.38、0.44、0.38(P均<0.001).多元线性回归分析结果表明,自尊感、每日紧张感和负性情感状态对抑郁症状评分的贡献较大,标准回归系数分别是-0.46、0.19和0.13(P值分别为<0.001、0.001、0.030).结论 睡眠障碍、内在投入、付出、心理需求、每日紧张感、负性情感和工作危险性是警察抑郁症状的诱因,减少负性情感、

  7. Biological, chemical and other data collected aboard the THOMAS G. THOMPSON during cruise TN244 in the Coastal Waters of SE Alaska from 2009-12-05 to 2009-12-08 (NODC Accession 0117395)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — NODC accession 0117395 includes biological, chemical, optical and physical data collected aboard the THOMAS G. THOMPSON during cruise TN244 in the Coastal Waters of...

  8. Liquid-Liquid Extraction and Separation of Co (II) and Ni(II) from Chloride Medium by bis (2,4,4-trimethylpentyl) dithio phosphinic acid in Kerosene

    International Nuclear Information System (INIS)

    The extraction of Co(II) and Ni(II) from chloride solutions using bis (2,4,4-trimethylpentyl) dithio phosphinic acid (CYANEX 301) in kerosene has been investigated. The various factors affecting the extraction process of Co(II) and Ni(II) by the investigated extractant such as contact time, ph, extractant and metal ion concentration as well as temperature, are separately investigated. The stripping of the extracted metal ions from loaded organic solutions is also carried out using different stripping reagents. The results were used to assess the conditions for maximum Co(II)/Ni(II) separation from chloride medium using CYANEX 301

  9. Magnetic thermal hysteresis due to paramagnetic-antiferromagnetic transition in Fe-24.4Mn-5.9Si-5.1Cr alloy

    Directory of Open Access Journals (Sweden)

    L. Wang

    2013-08-01

    Full Text Available Magnetic thermal hysteresis (MTH associated with a paramagnetic (PM-antiferromagnetic (AFM phase transition was found in an Fe-24.4Mn-5.9Si-5.1Cr shape-memory alloy. Aside from the magnetic field (H, the driving rate (v can also tune the critical temperature of the magnetic transition and cause an increase in MTH. The magnetic phase diagram obtained is discussed. The equation for MTH was deduced based on the Landau model for a PM-AFM transition that includes H and v dependence, which gives a reasonable account of the experimental results.

  10. Uptake of curium (244Cm) by five benthic marine species (Arenicola marina, Cerastoderma edule, Corophium volutator, Nereis diversicolor and Scrobicularia plana): comparison with americium and plutonium

    International Nuclear Information System (INIS)

    Curium (244Cm) uptake from contaminated sea water was studied in five benthic marine species: two bivalve molluscs (Scrobicularia plana and Cerastoderma edule), two polychaete annelids (Arenicola marina and Nereis diversicolor) and one amphidpod crustacean (Corophium volutator). The concentrations in the whole organisms relative to the concentration in the sea water (concentration factors) were: 700 for the amphipods (after 11 d of accumulation), 140 for the cockles (after 28 d), 80 for the scrobicularia (after 23d) and approx. 30 for the two annelids (after > 20 d). All species except S. plana accumulated americium and curium similarly; S. plana accumulated similar amounts of curium and plutonium. (author)

  11. Uptake of curium (/sup 244/Cm) by five benthic marine species (Arenicola marina, Cerastoderma edule, Corophium volutator, Nereis diversicolor and Scrobicularia plana): comparison with americium and plutonium

    Energy Technology Data Exchange (ETDEWEB)

    Miramand, P.; Germain, P.; Arzur, J.C.

    1987-01-01

    Curium (/sup 244/Cm) uptake from contaminated sea water was studied in five benthic marine species: two bivalve molluscs (Scrobicularia plana and Cerastoderma edule), two polychaete annelids (Arenicola marina and Nereis diversicolor) and one amphidpod crustacean (Corophium volutator). The concentrations in the whole organisms relative to the concentration in the sea water (concentration factors) were: 700 for the amphipods (after 11 d of accumulation), 140 for the cockles (after 28 d), 80 for the scrobicularia (after 23d) and approx. 30 for the two annelids (after > 20 d). All species except S. plana accumulated americium and curium similarly; S. plana accumulated similar amounts of curium and plutonium.

  12. 60-day waste compatibility safety issue and final results for 244-TX DCRT, grab samples TX-95-1, TX-95-2, and TX-95-3

    International Nuclear Information System (INIS)

    Three grab samples (TX-95-1, TX-95-2, and TX-95-3) were taken from tank 241- TX-244 riser 8 on November 7, 1995 and received by the 222-S Laboratory on that same day. Samples TX-95-1 and TX-95-2 were designated as supernate liquids, and sample TX-95-3 was designated as a supernate/sludge. These samples were analyzed to support the waste compatibility safety program. Accuracy and precision criteria were met for all analyses. No notifications were required based on sample results. This document provides the analysis to support the waste compatibility safety program

  13. A 233U/236U/242Pu/244Pu spike for isotopic and isotope dilution analysis by mass spectrometry with internal calibration

    International Nuclear Information System (INIS)

    The Khlopin Radium Institute prepared on behalf of the IAEA a synthetic mixture of 233U, 236U, 242Pu and 244Pu isotopes. The isotopic composition and elemental concentration of uranium and plutonium were certified on the basis of analyses done by four laboratories of the IAEA Network, using mass spectrometry with internal standardization. The certified values for 233U/236U ratio and the 236U chemical concentration have a coefficient of variation of 0.05%. The latter is fixed by the uncertainty in the 235U/238U ratio of NBS500 used as internal standard. The coefficients of variation of the 244Pu/242Pu ratio and the 242Pu chemical concentration are respectively 0.10% and 0.16% and limited by the uncertainty in the 240Pu/239Pu ratio of NBS947. This four isotope mixture was used as an internal standard as well as a spike, to analyze 30 batches of LWR spent fuel solutions. The repeatability of the mass spectrometric measurements have a coefficient of variation of 0.025% for the uranium concentration, and of 0.039% for the plutonium concentration. The spiking and treatment errors had a coefficient of variation of 0.048%. (author). Refs, figs and tabs

  14. Analysis of linear energy transfers and quality factors of charged particles produced by spontaneous fission neutrons from 252Cf and 244Pu in the human body

    International Nuclear Information System (INIS)

    Absorbed doses, linear energy transfers (LETs) and quality factors of secondary charged particles in organs and tissues, generated via the interactions of the spontaneous fission neutrons from. 252Cf and. 244Pu within the human body, were studied using the Particle and Heavy Ion Transport Code System (PHITS) coupled with the ICRP Reference Phantom. Both the absorbed doses and the quality factors in target organs generally decrease with increasing distance from the source organ. The analysis of LET distributions of secondary charged particles led to the identification of the relationship between LET spectra and target-source organ locations. A comparison between human body-averaged mean quality factors and fluence-averaged radiation weighting factors showed that the current numerical conventions for the radiation weighting factors of neutrons, updated in ICRP103, and the quality factors for internal exposure are valid. (authors)

  15. Separation and activity determination of 239+240Pu, 241Am and Curium (242and244Cm) in evaporator concentrate by Alpha Spectrometry

    International Nuclear Information System (INIS)

    Alpha spectrometry analysis was used for activity determinations of Pu, Am and Cm isotopes in evaporator concentrate samples from nuclear power plants. Using a sequential procedure the first step was Pu isolation by an anion exchange column followed by an Am and Cm separation of U and Fe by a co-precipitation with oxalic acid. The precipitate was used for americium and curium separation of strontium by using a TRU resin extraction chromatography column. Due to their chemical similarities and energy difference it was seen that the simultaneous determination of 241Am, 242Cm and 243,244Cm isotopes is possible using the 243Am as tracer, once they have peaks in different region of interest (ROI) in the alpha spectrum. In this work it was used tracers, 238Pu, 243Am, 244Cm and 232U, for determination and quantification of theirs isotopes, respectively. The standard deviations for replicate analysis were calculated and for 241Am it was (1,040 ± 160 mBqKg-1), relative standard deviation 15.38%, and for 239+240Pu it was (551 +- 44 mBqKg-1), relative standard deviation 7.98%. In addition, for the 242Cm isotope the standard deviation for determinations was(75 ± 23 mBqKg-1), with the relative standard deviation 30.67% higher than for 241Am and 239+240Pu. The radiometric yields ranged from 90% to 105% and the lower limit of detection was estimated as being 2.05 mBqKg-1. (author)

  16. Role of static deformation and compact orientation of target nucleus in measured fusion, fusion-fission and capture cross-sections of 244Pu+48Ca reaction

    International Nuclear Information System (INIS)

    The dynamical cluster-decay model (DCM), with deformations and orientation degrees of freedom of the incoming nuclei and of outgoing fragments included, is used to study the excitation functions of the "equatorial" compact hot fusion reaction 244Pu+48Ca→292114* (compact orientation angle θc=90° for 244Pu). Considering the higher multipole deformations up to hexadecapole deformation β4 and configurations with "compact" orientation θc, the model is shown to give a good description of the measured individual light-particle decay channels σxn, here x=3, 4 and 5, and other decay channels, the fusion-fission σff and quasi-fission σqf (equivalently, capture σcap) with in one parameter fitting, the neck length ΔR. The quasi-fission is also considered as a cold process with an elongated "polar" configuration. The xn-channel cross-sections for collisions between nuclei with static deformations at their respective compact orientations are shown to be much more than for the case of the nuclei taken to be spherical, signifying the increase in fusion threshold for an intermediate hot fusion reaction to be associated with the static deformation of the target nucleus and its orientation at the point of collision in its path toward the (spherical) compound nucleus. The shell effects in both the potential and kinetic energy (the mass parameters) terms of the Hamiltonian are shown to be important. The free parameter ΔR of the model is shown to depend strongly on limiting angular momentum, which in turn depends on the use of sticking or non-sticking moment of inertia for angular momentum effects. For the sticking moment of inertia, the evaporation residue (neutron emission) is shown to occur almost promptly (largest ΔR), followed by the competing (hot/cold) quasi-fission and ending finally with fusion-fission of hot compound nucleus. Different ΔR's (equivalently, relative separations) for the three processes means to predict that the processes ER, ff and qf happen

  17. Synthesis and Crystal Structure of Cobalt(II) Complex [Co(H2O)2(bpe)(OAc)2](4,4'-dpdo

    Institute of Scientific and Technical Information of China (English)

    赵琦华; 李惠琼; 方瑞斌

    2004-01-01

    The reaction of Co(OAc)2 with bpe and 4,4'-dpdo in an aqueous-alcohol solution affords the formation of red crystals of [Co(H2O)2(bpe)(OAc)2](4,4'-dpdo (bpe = trans-1,2-bis(4- pyridyl)ethylene, 4,4'-dpdo = 4,4'-dipyridyl N,N'-oxide). The molecular and crystal structures were determined by single-crystal X-ray diffraction. The crystal is of triclinic, space group P with a = 7.6146(9), b = 8.6691(11), c = 10.344011 A, α = 88.311(3), β = 76.992(3), γ = 75.809(3)°, V = 644.7613 A3, Z = 1, C26H28CoN4O8, Mr = 583.45, Dc = 1.503 g/cm3, μ = 0.724 mm-1, F(000) = 303, T = 223(2) K, the final R = 0.0477 and wR = 0.1177 for 3199 observed reflections with I > 2σ(I). In the crystal the cobalt atom is six-coordinated by oxygen atoms from two carboxylic molecules, two nitrogen atoms from the bpe ligands and two water molecules, completing an octahedral geometry. The structure of the title complex consists of neutral chains containing cobalt(II) ions bridged by mutually trans bpe molecules. The adjacent chains are connected through weak hydrogen bonds to form a two-dimensional structure.

  18. Measurements of prompt neutron multiplicity distributions in correlation with mass-energy distribution of fission fragments in spontaneous fission of 252Cf, 244Cm and 248Cm

    International Nuclear Information System (INIS)

    The number of prompt neutrons emitted in the fission event have been measured separately for each complementary fragment in coincidence with fragment mass and kinetic energies in spontaneous fission of 252Cf, 244Cm and 248Cm. Two high efficient Gd-loaded liquid scintillator tanks were used for the neutron registration. Approximately 3x106 fission events coincident with prompt neutron emission have been accumulated for each isotope. The mean neutron multiplicity, the dispersion and the covariance of the multiplicity distributions have been obtained as a function of fission fragment mass and kinetic energy. The neutron multiplicity data have been corrected for neutron registration efficiency, background and pile-up. Dependencies of the moments of the multiplicity distributions on the fragment mass and total kinetic energy for different mass bins, as well as mass and total kinetic energy distributions of the fission fragments are presented, discussed and compared for the different isotopes investigated. The results showed a different behavior of the moments of the multiplicity distribution depending on the fragment mass asymmetry that reflects changes in the dynamical effects for different fission modes. (author)

  19. Routine radiochemical method for the determination of 90Sr, 238Pu, 239+240Pu, 241Am and 244Cm in environmental samples

    International Nuclear Information System (INIS)

    Routine analytical procedures have been developed for the reliable simultaneous determination of 90Sr, 238Pu, 239+240Pu, 241Am and 242-244Cm, Chernobyl derived radioisotopes and fallout after nuclear weapon tests in a wide range of environmental samples: soil (100-200 g), sediments, aerosols, water and vegetation. This procedure has been applied to thousands of soil and sediment samples and hundreds of biological and water samples taken in the exclusive zone of Chernobyl NPP and different regions of Ukraine from 1989 to the present. After the sample has been properly prepared and isotopic tracers added, plutonium, americium and curium are precipitated with calcium oxalate and then lanthanum fluoride. Plutonium is separated from americium and curium by anion-exchange. Americium and curium are separated from rare earths by cation-exchange with gradient elute α-hydroxy-iso-butyric acid. During projects by AQCS IAEA 'Evaluation of Methods for 90Sr in a Mineral Matrix' and 'Proficiency Test for 239Pu, 241Pu and 241Am Measurement in a Mineral Matrix' accuracy and precision for 90Sr, 239Pu and 241Am by present procedure was evaluated. Advantages, difficulties and limitations of the method are discussed. (author)

  20. Synthesis and Crystal Structure of {Cu2(pdc)2(4,4′-bipy)(H2O)·(3H2O}2

    Institute of Scientific and Technical Information of China (English)

    温一航; 张健; 覃业燕; 李兆基; 康遥; 陈玉标; 程建开; 姚元根

    2004-01-01

    The title compound {Cu2(pdc)2(4,4′-bipy)(H2O)(3H2O}2 1 (H2pdc = pyridine-2,6- dicarboxylic acid, also known as dipicolinic acid; 4,4′-bipy = 4,4′-bipyridine) has been synthesized by the hydrothermal reaction and its structure was determined by single-crystal X-ray diffraction. The crystal is of triclinic, space group Pī with a = 7.2278(3), b = 10.6259(4), c = 17.7614(6)A, α= 79.5990(10), β = 83.6300(10), γ = 71.8280(10)o, V = 1272.60(8)A3, C48H44Cu4N8O24, Mr = 1371.07, Z = 1, Dc = 1.789 g/cm3, μ = 1.747 mm-1, F(000) = 696, R = 0.0397 and wR = 0.1137 for 3938 observed reflections (I > 2σ(I)). There are two kinds of Cu coordination environments, and each central copper(II) atom is five-coordinated in a distorted square-based pyramidal coordination geo- metry. Four copper(II) atoms are linked by four pdc and two 4,4′-bipy ligands to form an annular rectangle structure. Extensive hydrogen-bonding interactions involving carboxylate O atoms as well as coordinated and free water molecules lead to the formation of a three-dimensional network struc- ture.

  1. Synergistic extraction of gadolinium from nitrate media by mixtures of bis (2,4,4-trimethylpentyl) dithiophosphinic acid and di-(2-ethylhexyl) phosphoric acid

    International Nuclear Information System (INIS)

    Highlights: • The effect of operating parameters on the gadolinium extraction was investigated. • The mixture of extractants had the synergistic effects on the gadolinium extraction. • Mixture system obtained better stripping in comparison with D2EHPA system. - Abstract: The extraction of gadolinium (III) from aqueous nitrate solution with bis (2,4,4-trimethylpentyl) dithiophosphinic acid (Cyanex301), di-(2-ethylhexyl) phosphoric acid (D2EHPA) and the mixtures of extractants was investigated. Various parameters affecting the extraction process including the pH of aqueous phase, nitrate ion, extractant concentration, temperature, and stripping agents were studied. The stoichiometric coefficients of reactive extraction, thermodynamic and equilibrium parameters were obtained for two extractants and their mixtures. The results showed that the extraction ability of Cyanex301 was lower than that of D2EHPA extractant. As a result, the extraction of Gd3+ at low concentration of Cyanex301 was investigated by the addition of D2EHPA to the extraction system. The reactive extraction in the mixture system was spontaneous in nature as referred to the negative sign of ΔG while it was not favorable in case of single Cyanex301 system as indicated by the positive sign of ΔG. The experimental results showed that the mixture of extractants provided better extraction efficiency and effective stripping performance in comparison with single D2EHPA or Cyanex301 system

  2. 2B4 (CD244) signaling via chimeric receptors costimulates tumor-antigen specific proliferation and in vitro expansion of human T cells.

    Science.gov (United States)

    Altvater, Bianca; Landmeier, Silke; Pscherer, Sibylle; Temme, Jaane; Juergens, Heribert; Pule, Martin; Rossig, Claudia

    2009-12-01

    Regulatory NK cell receptors can contribute to antigen-specific adaptive immune responses by modulating T cell receptor (TCR)-induced T cell activation. We investigated the potential of the NK cell receptor 2B4 (CD244) to enhance tumor antigen-induced activation of human T cells. 2B4 is a member of the CD2 receptor subfamily with both activating and inhibitory functions in NK cells. In T cells, its expression is positively associated with the acquisition of a cytolytic effector memory phenotype. Recombinant chimeric receptors that link extracellular single-chain Fv fragments specific for the tumor-associated surface antigens CD19 and G(D2) to the signaling domains of human 2B4 and/or TCRzeta were expressed in non-specifically activated peripheral blood T cells by retroviral gene transfer. While 2B4 signaling alone failed to induce T cell effector functions or proliferation, it significantly augmented the antigen-specific activation responses induced by TCRzeta. 2B4 costimulation did not affect the predominant effector memory phenotype of expanding T cells, nor did it increase the proportion of T cells with regulatory phenotype (CD4+CD25(hi)FoxP3+). These data support a costimulatory role for 2B4 in human T cell subpopulations. As an amplifier of TCR-mediated signals, 2B4 may provide a powerful new tool for immunotherapy of cancer, promoting sustained activation and proliferation of gene-modified antitumor T cells. PMID:19360406

  3. Experimental study of the formation of super-heavy compound nuclei in the reaction 58Fe + 244Pu → 302 120

    International Nuclear Information System (INIS)

    This work deals with the nuclear mechanisms that take place in the collision of an incident Fe58 nucleus with a Pu244 nucleus for an energy that nears that of the Coulomb barrier. The compound nucleus is Z = 120, A 302. We have studied the specificities of the main reaction products and we have taken into account the information conveyed away by the neutrons released in the collision. Measurements have been performed at the U-400 accelerator in Dubna (Russia). 2 detecting systems have been necessary to detect fission fragments and neutrons: the Corset system is made up of 2 telescopes measuring the time of flight of the nuclear fragments and the Demon multi-detector able to draw the energy spectrum of the neutrons detected in coincidence with the fragments. We know that mass asymmetry is no longer a point of difference between fusion-fission and quasi-fission. It seems that fusion-fission fragments have more kinetic energy than quasi-fission fragments. We have made various analysis concerning the neutron emission in order to find the values of temperatures and multiplicities at pre- and post-scission stages with a view to tell fusion-fission events from quasi-fission events. We have deduced that the contribution of fusion-fission events to symmetric partitioning is about 10%. (A.C.)

  4. 社区卫生服务中心门诊腹痛患者244例诊治情况分析%Analysis of diagnosis and treatment of 244 cases of patients with abdominal pain in outpatient services of community health service center

    Institute of Scientific and Technical Information of China (English)

    胡勇军

    2014-01-01

    目的:分析某社区卫生服务中心门诊腹痛患者伴随症状及病因,探索门诊腹痛诊治过程中的注意事项及腹痛诊断思维。方法:2013年1-12月收治腹痛患者244例,回顾性分析其临床资料。结果:244例腹痛患者中,102例伴恶心呕吐,86例伴腹泻,28例伴反跳痛,5例伴牵涉痛,19例有发热。腹痛病因最后确诊为急性胃肠炎等18种疾病,病例数及百分比排在前5位的疾病有急性胃肠炎92例(38.70%)、胆囊炎及胆结石34例(13.92%)、急性阑尾炎17例(6.97%)、泌尿系结石及感染12例(4.92%)、急性盆腔炎11例(4.51%)。另有腹痛患者诊断为心肌梗死、心肌炎和癫痫等。结论:腹痛病因较为复杂,社区门诊医师应完善自己的知识结构,打破固有的思维定势,进一步扩大腹痛病因诊断方面的知识面,以减少误诊和漏诊。%Objective:To analyze the associated symptoms and etiology of patients with abdominal pain in outpatient services of community health service center,to explore the matters needing attention in the course of diagnosis and treatment of abdominal pain and abdominal pain diagnosis thinking.Methods:244 patients with abdominal pain were selected from January to December 2013.The clinical data were retrospectively analyzed.Results:In 244 cases of patients with abdominal pain,102 cases accompanied with nausea and vomiting;86 cases had diarrhea;28 cases had rebound pain;5 cases had referred pain;19 cases had fever.The cause of abdominal pain finally diagnosed as acute gastroenteritis and other 18 kinds of diseases.The case number and percentage of the top five diseases were acute gastroenteritis in 92 cases(38.70% ),cholecystitis and gallstones in 34 cases(13.92% ),17 cases(6.97%) of acute appendicitis,urinary calculi and infection in 12 cases(4.92%),11 cases(4.51%) of acute pelvic inflammatory disease.In addition,some abdominal pain were diagnosed with myocardial infarction

  5. Safe handling of kilogram amounts of fuel-grade plutonium and of gram amounts of plutonium-238, americium-241 and curium-244

    International Nuclear Information System (INIS)

    During the past 10 years about 600 glove-boxes have been installed at the Institute for Transuranium Elements at Karlsruhe. About 80% of these glove-boxes have been designed and equipped for handling 100-g to 1-kg amounts of 239Pu containing 8-12% 240Pu (low-exposure plutonium). A small proportion of the glove-boxes is equipped with additional shielding in the form of lead sheet or lead glass for work with recycled plutonium. In these glove-boxes gram-amounts of 241Am have also been handled for preparation of Al-Am targets using tongs and additional shielding inside the glove-boxes themselves. Water- and lead-shielded glove-boxes equipped with telemanipulators have been installed for routine work with gram-amounts of 241Am, 243Am and 244Cm. A prediction of the expected radiation dose for the personnel is difficult and only valid for a preparation procedure with well-defined preparation steps, owing to the fact that gamma dose-rates depend strongly upon proximity and source seize. Gamma radiation dose measurements during non-routine work for 241Am target preparation showed that handling of gram amounts leads to a rather high irradiation dose for the personnel, despite lead or steel glove-box shielding and shielding within the glove-boxes. A direct glove-hand to americium contact must be avoided. For all glove-handling of materials with gamma radiation an irradiation control of the forearms of the personnel by, for example, thermoluminescence dosimeters is necessary. Routine handling of americium and curium should be executed with master-slave equipment behind neutron and gamma shielding. (author)

  6. Soil washing in combination with homogeneous Fenton-like oxidation for the removal of 2,4,4'-trichlorodiphenyl from soil contaminated with capacitor oil.

    Science.gov (United States)

    Ma, Xiao-Hong; Zhao, Ling; Lin, Zhi-Rong; Dong, Yuan-Hua

    2016-04-01

    Detoxification by chemical oxidation of polychlorinated biphenyls (PCBs) in contaminated soils is very difficult and inefficient because PCBs typically associate with the solid phase or exist as non-aqueous-phase liquids due to their low solubility and slow desorption rates, and thus, they are difficult to remove from soils by using traditional, water-based elution techniques. Surfactant can enhance washing efficiency of PCBs from contaminated soils. This study used Brij 58, Brij 30, Tween 80, and 2-hydroxypropyl-β-cyclodextrin (HPCD) to solubilize 2,4,4'-trichlorodiphenyl (PCB28) from soil contaminated with capacitor oil into solution. The feasibility of PCB28 oxidation in soil washing wastewater through a Fe(3+)-catalyzed Fenton-like reaction was subsequently examined. Washing with 10 g L(-1) Brij 58 solution showed the highest extraction efficiency (up to 61.5 %) compared with that of the three other surfactants. The total concentration of PCB28 in contaminated soil at 25 °C after 48-h extraction was 286 mg L(-1). In contrast to conditions in which no washing agent was added, addition of the four washing agents decreased the efficiency of PCB28 degradation by the Fenton-like reaction, with the decrease due to addition of 10 g L(-1) Brij 58 solution being the smallest. The optimal concentration of H2O2 for preventing its useless decomposition was found to be 50 mM. The efficiency of PCB28 removal was lower when the initial concentration of PCB28 treated in the Fenton-like reaction was higher. The degradation efficiencies of PCB28 at initial concentrations of 0.1, 10, and 176 mg L(-1) in 10 g L(-1) Brij 58 solution at 25 °C and pH 3.0 and 9 h of reaction using 50 mM H2O2 were 64.1, 42.0, and 34.6 %, respectively. This result indicates that soil washing combined with Fenton-like oxidation may be a practical approach for the remediation of PCB-contaminated soil. PMID:26762933

  7. CHLOROPHYLL A, growth rate and graze rate (or grazing rate) site samples data collected in the Gulf of Alaska on the ALPHA HELIX cruises HX242, HX244 and others as part of the NEP project from 2001-04-18 to 2003-08-10 (NODC Accession 0114241)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — NODC Accession 0114241 includes site samples and biological data collected aboard the ALPHA HELIX during cruises HX242, HX244, HX247, HX271 and HX275 in the Gulf of...

  8. SILICATE, WATER TEMPERATURE, FLUORESCENCE, PHOTOSYNTHETIC ACTIVE RADIATION (PAR) and other profile and discrete sample data collected in the Gulf of Alaska on the ALPHA HELIX cruises HX242, HX244 and others as part of the NEP project from 2001-04-18 to 2003-08-11 (NODC Accession 0113348)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — NODC Accession 0113348 includes profile, discrete sample, biological, chemical and physical data collected aboard the ALPHA HELIX during cruises HX242, HX244,...

  9. SALINITY, WATER TEMPERATURE, FLUORESCENCE, PHOTOSYNTHETIC ACTIVE RADIATION (PAR) and other profile data collected in the Gulf of Alaska on the ALPHA HELIX cruises HX242, HX244 and others as part of the NEP project from 2001-04-18 to 2003-08-11 (NODC Accession 0115255)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — NODC Accession 0115255 includes profile, biological and physical data collected aboard the ALPHA HELIX during cruises HX242, HX244, HX247, HX271 and HX275 in the...

  10. AG Turbo, Turbotech II, project 1.244. Experimental investigations of rotary instabilities in axial compressors and their effects in terms of compressor stability. Final report; AG Turbo, Turbotech II, Vorhaben 1.244. Experimentelle Untersuchungen rotierender Instabilitaeten in Axialverdichtern und ihr Einfluss auf die Verdichterstabilitaet. Abschlussbericht

    Energy Technology Data Exchange (ETDEWEB)

    Holste, F.; Haukap, C.; Kameier, F.

    2000-07-10

    The physical phenomena of rotary instabilities in industrial compressors and high-pressure aircraft compressors were investigated, which may be a cause of compressor blade fracture. The investigations were carried out by Duesseldorf Technical University on behalf of Rolls-Royce Deutschland GmbH at the new four-stage low-pressure compressor test stand of TU Dresden University. Extensive measurements were made both in the rotary and stationary system in the third compressor stage. Rotary instabilities could be detected by increasing the clearance between the blade tip and compressor wall. Modal analyses yielded a rate of about 30 for 63 blades, i.e. a characteristic wavelength of about twice the length of a blade. So far, an accurate description of the physical mechanism was impossible. Investigations using a Snubber model showed no significant influence on the rotary instabilities. [German] Im Turbotech II Forschungsvorhaben 1.244 wurden die physikalischen Vorgaenge der rotierenden Instabilitaet untersucht, die sowohl in industriellen Verdichtern als auch in Hochdruckverdichtern von Flugtriebwerken auftreten koennen. Diese Instabilitaeten stellen eine zusaetzliche Belastung fuer die Verdichterblaetter dar und koennen damit die Ursache fuer Blattbrueche sein. Im Auftrag von Rolls-Royce Deutschland wurden die Untersuchungen von der Faachhochschule Duesseldorf durchgefuehrt. Testobjekt war der neu aufgebaute vier stufige Niedergeschwindigkeitsverdichter der TU Dresden. In enger Kooperation mit den Vorhaben 1.243 und 1.246 wurden umfangreiche Messungen sowohl im rotierenden als auch im festen System an der dritten Stufe des Verdichters durchgefuehrt. Durch Vergroesserung des Spaltes zwischen Schaufelspitze und Verdichterwandung konnten rotierenden Instabilitaeten nachgewiesen werden. Modenanalysen ergaben Umfangsordnungen von ungefaehr 30 bei einer Blattzahl von 63, wodurch die charakteristische Wellenlaenge etwa zwei Schaufelwellenlaengen entspricht. Eine exakte

  11. Facile synthesis of new nano sorbent for magnetic solid-phase extraction by self assembling of bis-(2,4,4-trimethyl pentyl)-dithiophosphinic acid on Fe3O4-Ag core-shell nanoparticles: Characterization and application

    International Nuclear Information System (INIS)

    Graphical abstract: Self assembling of bis-(2,4,4-trimethylpentyl)-dithiophosphinic acid on Fe3O4-Ag core-shell nanoparticles and application of it for solid phase extraction of PAHs. Highlights: ► A novel sorbent for magnetic solid-phase extraction of PAHs was introduced. ► Silver was coated on Fe3O4 nanoparticles (MNPs) by reduction of AgNO3 with NaBH4. ► Bis-(2,4,4-trimethylpentyl)-dithiophosphinic acid self-assembled on silver coated MNPs. ► Size, morphology, composition and properties of the nanoparticles were characterized. ► Extraction efficiency of the sorbent was investigated by extraction of five PAHs. - Abstract: A novel sorbent for magnetic solid-phase extraction by self-assembling of organosulfur compound, (bis-(2,4,4-trimethylpentyl)-dithiophosphinic acid), onto the silver-coated Fe3O4 nanoparticles was introduced. Due to the formation of covalent bond of S-Ag, the new coating on the silver surface was very stable and showed high thermal stability (up to 320 °C). The size, morphology, composition, and properties of the prepared nanoparticles have also been characterized and determined using scanning electron microscopy (SEM), energy-dispersive X-ray analyzer (EDX), dynamic light scattering (DLS), Fourier transform-infrared (FT-IR) spectroscopy, and thermal gravimetric analysis (TGA). Extraction efficiency of the new sorbent was investigated by extraction of five polycyclic aromatic hydrocarbons (PAHs) as model compounds. The optimum extraction conditions for PAHs were obtained as of extraction time, 20 min; 50 mg sorbent from 100 mL of the sample solution, and elution with 100 μL of 1-propanol under fierce vortex for 2 min. Under the optimal conditions, the calibration curves were obtained in the range of 0.05–100 μg L−1 (R2 > 0.9980) and the LODs (S/N = 3) were obtained in the range of 0.02–0.10 μg L−1. Relative standard deviations (RSDs) for intra- and inter-day precision were 2.6–4.2% and 3.6–8.3%, respectively. In

  12. Evaluation of thermal neutron cross-sections and resonance integrals of protactinium, americium, curium, and berkelium isotopes

    International Nuclear Information System (INIS)

    Data on the thermal neutron fission and capture cross-sections as well as their corresponding resonance integrals are reviewed and analysed. The data are classified according to the form of neutron spectra under investigation. The weighted mean values of the cross-sections and resonance integrals for every type of neutron spectra were adopted as evaluated data. (author). 87 refs, 2 tabs

  13. Extraction mechanism of Sc(III) and separation from Th(IV), Fe(III) and Lu(III) with bis(2,4,4-trimethylpentyl)phosphinic acid in n-hexane from sulphuric acid solutions

    International Nuclear Information System (INIS)

    The extraction equilibrium data of sulphuric acid and scandium(III) with bis(2,4,4-trimethylpentyl)phosphinic acid (H[BTMPP]) from sulphuric acid solutions have been obtained. There are two extraction mechanisms of scandium(III) with H[BTMPP] at different ranges of aqueous acidity. The extraction of Sc(III) proceeds according to a cation exchange reaction at lower aqueous acidity and to a solvating reaction at higher acidity. The practicability of separating Sc(III) from Th(IV),Fe(III) and Lu(III) by controlling the aqueous acidity was discussed. The effect of temperature on extraction of Sc(III) was observed and thermodynamic functions were calculated. IR and NMR spectra were made for organic extracts. The extraction characteristics of H[BTMPP] and di(2-ethylhexyl)phosphinic acid (H[DEHP]) were contrasted to obtain more information about extraction with H[BTMPP]. 12 refs., 6 figs., 1 tab

  14. Adsorption of gases and vapors on nanoporous Ni2(4,4'-Bipyridine)3(NO3)4 metal-organic framework materials templated with methanol and ethanol: structural effects in adsorption kinetics.

    Science.gov (United States)

    Fletcher, Ashleigh J; Cussen, Edmund J; Bradshaw, Darren; Rosseinsky, Matthew J; Thomas, K Mark

    2004-08-11

    Desolvation of Ni(2)(4,4'-bipyridine)(3)(NO(3))(4).2CH(3)OH and Ni(2)(4,4'-bipyridine)(3)(NO(3))(4).2C(2)H(5)OH give flexible metal-organic porous structures M and E, respectively, which have the same stoichiometry, but subtly different structures. This study combines measurements of the thermodynamics and kinetics of carbon dioxide, methanol, and ethanol sorption on adsorbents M and E over a range of temperatures with adsorbent structural characterization at different adsorbate (guest) loadings. The adsorption kinetics for methanol and ethanol adsorption on porous structure E obey a linear driving force (LDF) mass transfer model for adsorption at low surface coverage. The corresponding adsorption kinetics for porous structure M follow a double exponential (DE) model, which is consistent with two different barriers for diffusion through the windows and along the pores in the structure. The former is a high-energy barrier due to the opening of the windows in the structure, required to allow adsorption to occur, while the latter is a lower-energy barrier for diffusion in the pore cavities. X-ray diffraction studies at various methanol and ethanol loadings showed that the host porous structures E and M underwent different scissoring motions, leading to an increase in unit cell volume with the space group remaining unchanged during adsorption. The results are discussed in terms of reversible adsorbate/adsorbent (host/guest) structural changes and the adsorption mechanism involving hydrogen-bonding interactions with specific surface sites for methanol and ethanol adsorption in relation to pore size and extent of filling. This paper contains the first evidence for individual kinetic barriers to diffusion through windows and pore cavities in flexible porous coordination polymer frameworks. PMID:15291578

  15. Adsorption dynamics of gases and vapors on the nanoporous metal organic framework material Ni2(4,4'-bipyridine)3(NO3)4: guest modification of host sorption behavior.

    Science.gov (United States)

    Fletcher, A J; Cussen, E J; Prior, T J; Rosseinsky, M J; Kepert, C J; Thomas, K M

    2001-10-17

    This study combines measurements of the thermodynamics and kinetics of guest sorption with powder X-ray diffraction measurements of the nanoporous metal organic framework adsorbent (host) at different adsorptive (guest) loadings. The adsorption characteristics of nitrogen, argon, carbon dioxide, nitrous oxide and ethanol and methanol vapors on Ni2(4,4'-bipyridine)3(NO3)4 were studied over a range of temperatures as a function of pressure. Isotherm steps were observed for both carbon dioxide and nitrous oxide adsorption at approximately 10-20% of the total pore volume and at approximately 70% of total pore volume for methanol adsorption. The adsorption kinetics obey a linear driving force (LDF) mass transfer model for adsorption at low surface coverage. At high surface coverage, both methanol and ethanol adsorption follow a combined barrier resistance/diffusion model. The rates of adsorption in the region of both the carbon dioxide and methanol isotherm steps were significantly slower than those observed either before or after the step. X-ray diffraction studies at various methanol loadings showed that the host structure disordered initially but underwent a structural change in the region of the isotherm step. These isotherm steps are ascribed to discrete structural changes in the host adsorbent that are induced by adsorption on different sites. Isotherm steps were not observed for ethanol adsorption, which followed a Langmuir isotherm. Previous X-ray crystallography studies have shown that all the sites are equivalent for ethanol adsorption on Ni2(4,4'-bipyridine)3(NO3)4, with the host structure undergoing a scissoring motion and the space group remaining unchanged during adsorption. The activation energies and preexponential factors for methanol and ethanol adsorption were calculated for each pressure increment at which the linear driving force model was obeyed. There was a good correlation between activation energy and ln(preexponential factor), indicating a

  16. Psychological Empowerment of Contract Nurses and Its Influencing Factors%244名合同制护士心理授权及其影响因素分析

    Institute of Scientific and Technical Information of China (English)

    郭青; 覃巍; 何红燕; 程嘉莉; 胡华琼; 张小虹

    2012-01-01

    Objective To understand the status quo and the potential influencing factors of psychological empowerment of contract nurses and to provide reference for nursing managers to take psychological empowerment and improve contract nurses ' psychological empowerment. Methods Psychological Empowerment Scale (PES) was used to survey 244 contract nurses. Results The score of PES of contract nurses was (40.70±4.96), and there was no statistically significant difference in terms of different ages, marriages, work length, educational background, professional titles and departments. However, statistically significant difference was found in the factor of different working purposes (P<0.01). Conclusion Psychological empowerment of contract nurses needs to be improved. The recognition of importance of psychological empowerment, and the devotion to nursing will contribute to the improvement of psychological empowerment of contract nurses.%目的 了解合同制护士心理授权状况,探讨潜在的影响因素,为护理管理者实施心理授权提供依据,以有效提高合同制护士心理授权水平.方法 采用中文版心理授权量表对湖北省襄阳市3 所三级甲等综合性医院的244 名合同制护士进行调查.结果 合同制护士心理授权问卷总分(40.70±4.96)分,不同年龄、婚姻状态、护龄、学历、职称、科室的合同制护士心理授权总分差异无统计学意义,而工作目的 不同的合同制护士心理授权总分差异有统计学意义(P<0.01).结论 合同制护士的心理授权水平有待提高,认识合同制护士心理授权的重要性,培养合同制护士热爱护理专业有助于提高合同制护士心理授权水平.

  17. Formation of W/O microemulsions in the extraction of Nd(iii) by bis(2,4,4-trimethylpentyl)dithiophosphinic acid and its effects on Nd(iii) coordination.

    Science.gov (United States)

    Sun, Taoxiang; Xu, Chao; Chen, Jing

    2016-01-21

    The formation of water-in-oil (W/O) microemulsions during the extraction of Nd(iii) by bis(2,4,4-trimethylpentyl)dithiophosphinic acid (also known as purified Cyanex 301, denoted as HC301) was studied. Results from the measurement of the concentration of Nd(iii), Na(+) and NO3(-) in the organic phase, IR spectroscopy, and dynamic light scattering (DLS) all indicated that W/O microemulsions could form as the ratio of the neutralized ligand to Nd(iii) in the aqueous phase is over 3 : 1. The coordination environment of Nd(iii) in the extracted complexes was monitored by absorption spectroscopy and extended X-ray absorption fine structure (EXAFS) and was found to vary significantly with the formation of W/O microemulsions. When only 10% of HC301 was neutralized, with no formation of W/O microemulsions, the inner coordination shell of Nd(iii) in the organic phase was occupied dominantly by sulfur atoms from HC301. As HC301 was further neutralized, the coordinated sulfur atoms around Nd(iii) were replaced gradually by the oxygen atoms from water. This work provides further insights into the extraction mechanism in the extraction system using purified Cyanex 301 as an extractant. PMID:26660060

  18. 15 CFR 24.4 - Applicability.

    Science.gov (United States)

    2010-01-01

    ... Commerce and Foreign Trade Office of the Secretary of Commerce UNIFORM ADMINISTRATIVE REQUIREMENTS FOR... National School Lunch Act: (i) School Lunch (section 4 of the Act), (ii) Commodity Assistance (section 6 of...), and (ii) School Breakfast (section 4 of the Act). (6) Entitlement grants for State...

  19. 48 CFR 1652.244-70 - Subcontracts.

    Science.gov (United States)

    2010-10-01

    ... under FAR 52.215-2 “Audit and Records—Negotiations” if based on cost analysis or 48 CFR 1646.301 and... all FEHB Program contracts based on cost analysis (experience-rated): Subcontracts (JUL 2005) (a) The... price analysis; (5) The subcontractor's current, complete, and accurate cost or pricing data and...

  20. 8 CFR 244.9 - Evidence.

    Science.gov (United States)

    2010-01-01

    ... consist of: (i) Passport; (ii) Birth certificate accompanied by photo identification; and/or (iii) Any national identity document from the alien's country of origin bearing photo and/or fingerprint. (2) Proof... with whom he or she has done business. In all of the above, the name of the alien and the name of...

  1. 49 CFR 244.9 - Definitions.

    Science.gov (United States)

    2010-10-01

    ... rules at 49 CFR part 1105. Merger means the acquisition of one Class I railroad or Class II railroad... regulations of the Surface Transportation Board (49 CFR part 1201; General Instructions 1-1), as those... environmental documentation and analyses. Transaction means a consolidation, merger, or acquisition of...

  2. 50 CFR 216.244 - Mitigation.

    Science.gov (United States)

    2010-10-01

    ... habitat (as designated in 50 CFR Part 226) shall implement the following measures. (A) All torpedo-firing... right whale critical habitat (as designated in 50 CFR part 226) from November 15-April 15. (E) Object... accomplishment of primary operational duties. (xviii) Aircraft with deployed sonobuoys shall use only the...

  3. 17 CFR 244.101 - Definitions.

    Science.gov (United States)

    2010-04-01

    ... applicable to the registrant. (b) GAAP. GAAP refers to generally accepted accounting principles in the United... prepared in accordance with non-U.S. generally accepted accounting principles, GAAP refers to the... with U.S. generally accepted accounting principles, GAAP refers to U.S. generally accepted...

  4. Efficacy and safety of an oral contraceptive containing ethinylestradiol 20 µg/drospirenone 3 mg (24/4 regimen in three indications in the People's Republic of China: a comparison with international studies

    Directory of Open Access Journals (Sweden)

    Marr J

    2015-07-01

    Full Text Available Joachim Marr,1 Zirong Huang,2 Baoxi Wang,3 Hongyan Zhang,4 Katrin Roth1 1Bayer Pharma AG, Berlin, Germany; 2Obstetrics and Gynecology Hospital of Fudan University, Shanghai, 3Institute of Dermatology, Chinese Academy of Medical Sciences, Nanjing, Jiangsu, 4Peking University Sixth Hospital, Peking University Institute of Mental Health, Ministry of Health (Peking University, Beijing, People's Republic of China Abstract: While combined oral contraceptives are a popular choice in developed Western countries, they are used by only 1% of women who are married or in a relationship in the People's Republic of China. The purpose of this review is to describe the efficacy and safety of the combined oral contraceptive containing ethinylestradiol (EE 20 µg/drospirenone 3 mg taken in a 24/4 regimen (YAZ®; Bayer HealthCare Pharmaceuticals, Berlin, Germany by Chinese women and to compare these results with those in women assessed in the international studies. Studies of EE 20 µg/drospirenone 3 mg in three different indications (contraception, acne, and premenstrual dysphoric disorder [PMDD] have been conducted in Chinese women. The results of these three studies indicate that the EE 20 µg/drospirenone 3 mg combined oral contraceptive is a good long-term contraceptive option in Chinese women, providing 99% contraceptive protection over the observed 1-year treatment period, and additionally had a favorable effect on moderate acne vulgaris and relieved the symptoms of PMDD. The contraceptive efficacy, improvement in acne, and relief from PMDD symptoms observed in these studies did not differ from the effects observed in other international studies of EE 20 µg/drospirenone 3 mg, indicating that EE 20 µg/drospirenone 3 mg is as effective in Chinese women as in other ethnicities. Further, EE 20 µg/drospirenone 3 mg demonstrated a similar safety and tolerability profile in women enrolled in the Chinese and international trials, with no unexpected adverse

  5. Facile synthesis of new nano sorbent for magnetic solid-phase extraction by self assembling of bis-(2,4,4-trimethyl pentyl)-dithiophosphinic acid on Fe{sub 3}O{sub 4}-Ag core-shell nanoparticles: Characterization and application

    Energy Technology Data Exchange (ETDEWEB)

    Tahmasebi, Elham [Department of Chemistry, Tarbiat Modares University, P.O. Box 14115-175, Tehran (Iran, Islamic Republic of); Yamini, Yadollah, E-mail: yyamini@modares.ac.ir [Department of Chemistry, Tarbiat Modares University, P.O. Box 14115-175, Tehran (Iran, Islamic Republic of)

    2012-12-05

    Graphical abstract: Self assembling of bis-(2,4,4-trimethylpentyl)-dithiophosphinic acid on Fe{sub 3}O{sub 4}-Ag core-shell nanoparticles and application of it for solid phase extraction of PAHs. Highlights: Black-Right-Pointing-Pointer A novel sorbent for magnetic solid-phase extraction of PAHs was introduced. Black-Right-Pointing-Pointer Silver was coated on Fe{sub 3}O{sub 4} nanoparticles (MNPs) by reduction of AgNO{sub 3} with NaBH{sub 4}. Black-Right-Pointing-Pointer Bis-(2,4,4-trimethylpentyl)-dithiophosphinic acid self-assembled on silver coated MNPs. Black-Right-Pointing-Pointer Size, morphology, composition and properties of the nanoparticles were characterized. Black-Right-Pointing-Pointer Extraction efficiency of the sorbent was investigated by extraction of five PAHs. - Abstract: A novel sorbent for magnetic solid-phase extraction by self-assembling of organosulfur compound, (bis-(2,4,4-trimethylpentyl)-dithiophosphinic acid), onto the silver-coated Fe{sub 3}O{sub 4} nanoparticles was introduced. Due to the formation of covalent bond of S-Ag, the new coating on the silver surface was very stable and showed high thermal stability (up to 320 Degree-Sign C). The size, morphology, composition, and properties of the prepared nanoparticles have also been characterized and determined using scanning electron microscopy (SEM), energy-dispersive X-ray analyzer (EDX), dynamic light scattering (DLS), Fourier transform-infrared (FT-IR) spectroscopy, and thermal gravimetric analysis (TGA). Extraction efficiency of the new sorbent was investigated by extraction of five polycyclic aromatic hydrocarbons (PAHs) as model compounds. The optimum extraction conditions for PAHs were obtained as of extraction time, 20 min; 50 mg sorbent from 100 mL of the sample solution, and elution with 100 {mu}L of 1-propanol under fierce vortex for 2 min. Under the optimal conditions, the calibration curves were obtained in the range of 0.05-100 {mu}g L{sup -1} (R{sup 2} > 0.9980) and the

  6. 19 CFR 10.244 - Certificate of Origin.

    Science.gov (United States)

    2010-04-01

    ... Group: Group Each Description Below Is Only a Summary of the Cited CFR Provision. 19 CFR A Apparel... preference group which applies to the article according to the description contained in the CFR provision... llama, alpaca or vicuña fabrics, fabric components, or knit-to-shape components, from Andean yarns...

  7. Dicty_cDB: CHS244 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available d:none) Homo sapiens mRNA for mannosidase,... 121 4e-26 AY099704_1( AY099704 |pid:none) Arabidopsis thaliana alpha-man... sequence. 74 9e-13 2 BW354577 |BW354577.1 Ciona intestinalis cDNA, clone:cima804e24, 5'end, single read. 66...dqicqlhlqvfnilwiqplpvywqiqkeslfmlklhfskdggmnkvqqckill rvwlkvvnwn--- ---hhgi*pwfnqpvvim...M82822.1 Dictyostelium discoideum alpha-mannosidase (manA) gene, complete cds. 1302 0.0 1 CK149800 |CK149800...( P34098 ) RecName: Full=Lysosomal alpha-mannosidase; Sho... 387 e-106 M82822_1(

  8. 1935 15' Quad #244 Aerial Photo Mosaic Index

    Data.gov (United States)

    Earth Data Analysis Center, University of New Mexico — Aerial Photo Reference Mosaics contain aerial photographs that are retrievable on a frame by frame basis. The inventory contains imagery from various sources that...

  9. Fuzzy Itand#244; Integral Driven by a Fuzzy Brownian Motion

    OpenAIRE

    Didier Kumwimba Seya; Rostin Mabela Makengo; Marcel Rémon; Walo Omana Rebecca

    2015-01-01

    In this paper we take into account the fuzzy stochastic integral driven by fuzzy Brownian motion. To define the metric between two fuzzy numbers and to take into account the limit of a sequence of fuzzy numbers, we invoke the Hausdorff metric. First this fuzzy stochastic integral is constructed for fuzzy simple stochastic functions, then the construction is done for fuzzy stochastic integrable functions.

  10. Determination of 241Am and 244Cm in environmental samples

    International Nuclear Information System (INIS)

    The present technique describes a method to separate, purify and measure low levels of americium and curium in different environmental samples such as sediments, soils, water, vegetables, and air filters. The determination of radionuclides in theses environmental matrices have analytical problems, since a simple method doesn't exist for the purification, which is indispensable for its later measuring alpha spectrometry. The developed technique consist on taking an aliquot of the sample to analyze, to add tracer as americium 243 and curium 242, and to dissolve the matrix in a such way to have a clear solution. For the isolation of the americium and curium of the other actinides ar used as separation techniques: precipitation with Fe3+, anionic and cationic exchange, and extraction with a appropriate organic solvent. The purification of the americium and curium is followed by the electrodeposition habitually used. The measurement is carried out by alpha spectrometry with a detector of implanted ion. The detection limit for this techniques is of 0,002 Bq/l or 0,2 mBq in the case of filters. (author)

  11. Dicty_cDB: AHA244 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CP000094 |pid:none) Pseudomonas fluorescens Pf0-1, ... 35 8.3 AY338732_1( AY338732 |pid:none) Avian infec...tious bronchitis virus ... 35 8.3 DQ278233_1( DQ278233 |pid:none) Uncultured microo

  12. Dicty_cDB: VFH244 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available resident chaperone calreticulin mRNA, complete cds. 56 6e-04 1 CB937139 |CB937139.1 IpCGJ...x13_12_E07_23 IpCGJx13 Ictalurus punctatus cDNA clone IpCGJx13_12_E07 5', mRNA sequence. 56 6e-04 1

  13. Dicty_cDB: CHE244 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ing in prelim test: 0 Number of HSP's gapped (non-prelim): 0 length of query: 176 length of database: 80,480,566 effective... HSP length: 17 effective length of query: 159 effective length of database: 78,821,179 effe...ctive search space: 12532567461 effective search space used: 12532567461 T: 0 A: 0 ... of query: 176 length of database: Z,811,932,929 effective HSP length: 22 effective length of query: 154 effective... length of database: Y,960,467,611 effective search space: 6461912012094 effective

  14. Poweo 2006 consolidated revenue at euro 244 million, up 121%

    International Nuclear Information System (INIS)

    POWEO, the leading independent energy operator in France, presents in this document its key business indicators for the 4. quarter of 2006 and the full year: POWEO records again a strong rise of its annual revenue, exceeding its euro 220 million target. This progression relates to all the business components. The particularly soft climatic conditions recorded in France at the end of the year did not result in a significant fall of revenue compared to initial forecasts. The number of customer sites amounts to 80.300 at December 31, 2006, in progression of 23% compared to the end of 2005. The customer base remained overall stable during the second half of 2006, POWEO limiting voluntarily the acquisition of customers in electricity during the preparation of the opening to competition of the residential market due to take place on July 1, 2007. The gas customer base for its part more than doubled compared to end June 2006, with more than 5.000 customer sites transferred as at December 31, 2006. The Energy Management net margin, realised or un-realised, amounted to euro 49.7 million in 2006, recognised as revenue under IFRS standards. This includes the euro 22 million exceptional capital gain mentioned in previous financial releases in 2006, as well as a euro 7.9 million un-realised capital gain resulting from the transfer of some contracts into the Energy Management portfolio further to the capacity swap agreement with EDF announced publicly on January 3, 2007. The services provided by POWEO to its customers enjoy a high level of acceptance and represented revenue of euro 2.9 million in 2006. As from 2007, the revenue realised through these services will be presented separately from other components of revenue in order to better reflect its expected growth. The services offering will be indeed a key element of the marketing strategy of POWEO in the years to come, with a potentially significant impact on the results taking into account their level of gross margin which is structurally high. POWEO announced on January 3, 2007 to have concluded with EDF a long-term industrial agreement relating to a power generation capacity exchange, which will allow POWEO to have access from 2007 to 2021 to base-load electricity generated by EDF nuclear power plants. POWEO actively prepares the launch of its offering to residential customers, with in particular a communication campaign planned from next March to June in order to increase its notoriety and to create the conditions necessary to its commercial success on this segment. In parallel POWEO will dedicate specific sales resources to the acquisition of large accounts in industry and services. The public opinion poll carried out in the 4. quarter 2006 by BVA at the request of the Commission of Regulation of the Energy (CRE), and whose results have been just published, indicates that POWEO is already enjoying a global notoriety of 24% near companies only consuming electricity and 37% near companies consuming both electricity and gas. In addition, according to a TNS Sofres study ordered by POWEO, the assisted notoriety of the company near the specific segment of residential customers targeted by POWEO amounts to 13%. These results make POWEO feel confident in its ability to grow significantly its customer base in 2007

  15. Reasons for Exclusion from School. Research Brief No. 244.

    Science.gov (United States)

    Osler, Audrey; Watling, Rob; Busher, Hugh; Cole, Ted; White, Andy

    This study examined the reasons behind exclusion from school, emphasizing the exclusion of students with special needs, ethnic minority children, and children looked after by local authorities. Data collection included interviews with local education authority (LEA) officers; interviews with teachers and administrators; and documents from the…

  16. Use of trioctylphosphine oxide for transplutonium element extraction and purification

    International Nuclear Information System (INIS)

    Investigated was extraction of tri-valent curium, berkelium, californium, einsteinium as well as cerium and europium with trioctylphosphin oxide from lactic acid solutions, containing DTPA and aluminium nitrate depending on the aluminium nitrate and TOPO concentrations and nitric acid solutions of variable concentration as well. Under optimum conditions of extraction chromatography of berkelium studied was the distribution of cobalt, nickel, chromium, iron, aluminium, titanium, zirconium and niobium ions, and the coefficients of berkelium purification from cations investigated were determined. The effect of weight quantities of cation impurities on extraction chromatographic yield of berkelium has been investigated. Examples of practice application of the extraction chromatography with the use of TOPO are given

  17. Poweo 2006 consolidated revenue at euro 244 million, up 121%; Poweo chiffre d'affaires 2006 de 244 millions euro, en hausse de 121%

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    2007-01-15

    POWEO, the leading independent energy operator in France, presents in this document its key business indicators for the 4. quarter of 2006 and the full year: POWEO records again a strong rise of its annual revenue, exceeding its euro 220 million target. This progression relates to all the business components. The particularly soft climatic conditions recorded in France at the end of the year did not result in a significant fall of revenue compared to initial forecasts. The number of customer sites amounts to 80.300 at December 31, 2006, in progression of 23% compared to the end of 2005. The customer base remained overall stable during the second half of 2006, POWEO limiting voluntarily the acquisition of customers in electricity during the preparation of the opening to competition of the residential market due to take place on July 1, 2007. The gas customer base for its part more than doubled compared to end June 2006, with more than 5.000 customer sites transferred as at December 31, 2006. The Energy Management net margin, realised or un-realised, amounted to euro 49.7 million in 2006, recognised as revenue under IFRS standards. This includes the euro 22 million exceptional capital gain mentioned in previous financial releases in 2006, as well as a euro 7.9 million un-realised capital gain resulting from the transfer of some contracts into the Energy Management portfolio further to the capacity swap agreement with EDF announced publicly on January 3, 2007. The services provided by POWEO to its customers enjoy a high level of acceptance and represented revenue of euro 2.9 million in 2006. As from 2007, the revenue realised through these services will be presented separately from other components of revenue in order to better reflect its expected growth. The services offering will be indeed a key element of the marketing strategy of POWEO in the years to come, with a potentially significant impact on the results taking into account their level of gross margin which is structurally high. POWEO announced on January 3, 2007 to have concluded with EDF a long-term industrial agreement relating to a power generation capacity exchange, which will allow POWEO to have access from 2007 to 2021 to base-load electricity generated by EDF nuclear power plants. POWEO actively prepares the launch of its offering to residential customers, with in particular a communication campaign planned from next March to June in order to increase its notoriety and to create the conditions necessary to its commercial success on this segment. In parallel POWEO will dedicate specific sales resources to the acquisition of large accounts in industry and services. The public opinion poll carried out in the 4. quarter 2006 by BVA at the request of the Commission of Regulation of the Energy (CRE), and whose results have been just published, indicates that POWEO is already enjoying a global notoriety of 24% near companies only consuming electricity and 37% near companies consuming both electricity and gas. In addition, according to a TNS Sofres study ordered by POWEO, the assisted notoriety of the company near the specific segment of residential customers targeted by POWEO amounts to 13%. These results make POWEO feel confident in its ability to grow significantly its customer base in 2007.

  18. Prompt Neutron Emission from Fragments in Spontaneous Fission of 244, 248Cm and 252Cf

    Science.gov (United States)

    Vorobyev, A. S.; Dushin, V. N.; Hambsch, F.-J.; Jakovlev, V. A.; Kalinin, V. A.; Laptev, A. B.; Petrov, B. F.; Shcherbakov, O. A.

    2005-11-01

    Neutrons emitted in fission were measured separately for each complementary fragment in correlation with fission fragment energies. Two high efficient Gd-loaded liquid scintillator tanks were used for neutron registration. Fission fragment energies were measured using a twin Frisch gridded ionization chamber with a pin-hole collimator. The neutron multiplicity distributions were obtained for each value of the fission fragment mass and energy and corrected for neutron registration efficiency, background and pile-up. The dependencies of these distributions on fragment mass and energy for different energy and mass bins, as well as the mass and energy distribution of the fission fragments are presented and discussed.

  19. Poly[bis(μ2-4,4′-bipyridinebis(3-nitrobenzoatocobalt(II

    Directory of Open Access Journals (Sweden)

    Pei-Hsuan Chiang

    2009-11-01

    Full Text Available The hydrothermal reaction of cobalt nitrate with 4,4′-bipyridine and 3-nitrobenzoic acid lead to the formation of the title complex, [Co(C7H4NO42(C10H8N22]n. In the crystal structure, the CoII atoms are coordinated by two terminal carboxylate anions and four 4,4′-bipyridine ligands within slightly distorted octahedra. The CoII atom and one of the two independent 4,4′-bipyridine ligands are located on a twofold rotation axis, while the second independent 4,4′-bipyridine molecule is located on a centre of inversion. One of the two rings of one 4,4′-bipyridine ligand is disordered over two orientations and was refined using a split model [occupancy ratio 0.68 (2:0.32 (2]. The CoII atoms are connected by the 4,4′-bipyridine ligands into layers, which are located parallel to the ab plane.

  20. Options in Education. Technology in College, Parts One and Two, Program Nos. 244-245.

    Science.gov (United States)

    George Washington Univ., Washington, DC. Inst. for Educational Leadership.

    Scripts of public radio programs on the subject of technology in college are presented. The scripts are as follows: "Dental Videotape;""A Geography Student Talks About Learning by Computers;""Linda Harris Talks About Fear of Computers;""Charles Van Loan, Who Teaches Computer Science at Cornell University;""Students Who Learn Through…

  1. 7 CFR 2.44 - Administrator, Risk Management Agency and Manager, Federal Crop Insurance Corporation.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 1 2010-01-01 2010-01-01 false Administrator, Risk Management Agency and Manager... Secretary for Farm and Foreign Agricultural Services to the Administrator, Risk Management Agency, and... for the transaction of the business of the Federal Crop Insurance Corporation and the Risk...

  2. PETROCHINA PLACED US$2.44 B IN NEW H SHARES

    Institute of Scientific and Technical Information of China (English)

    Qu Lan

    2005-01-01

    @@ Following a request made by PetroChina, China's largest oil and gas producer, Hong Kong-listed, to the Stock Exchange of Hong Kong Limited, trading in the Company's H shares had been suspended with effect from 9:30 a.m. on 31 August 2005. The Company issued a formal announcement concerning about a placing of H shares under the general mandate granted to the Board of Directors at the annual general meeting of the Company on 26 May 2005 to issue up to 20% of the aggregate nominal amount of the Company's H shares in issue on that date, being not exceeding 3,516,483,600 H shares.

  3. Effect of benthic invertebrates on the desorption of Am-241 and Cm-244 from freshwater sediments

    International Nuclear Information System (INIS)

    Americium and curium are transuranic elements that bind strongly to particulate matter in freshwater environments. This research was conducted to determine if benthic amphipods (Hyalella sp.) or oligochaete worms (Tubifex spp.) alter sediment/water partitioning. Laboratory experiments were conducted in buffered water from Lake Washington (Seattle, WA) with radionuclide tracers added either to the water or to a selected particulate phase - quartz sand, organic detritus, or NBS (National Bureau of Standards) standard river sediment. Samples were collected during a five day exposure period and radioactivity was measured in the water, particulates and organisms. The presence of organisms increased soluble concentrations of Am and Cm. Desorption from particulate phases occurred more readily for Am than for Cm and each isotope was bound most tightly by NBS sediment and least strongly by quartz sand. (author)

  4. 40 CFR 98.244 - Monitoring and QA/QC requirements.

    Science.gov (United States)

    2010-07-01

    ... Measurement of Fluid Flow by Means of Coriolis Mass Flowmeters (incorporated by reference, see § 98.7). (viii... the minimum frequency specified by the manufacturer. (2) Operate and maintain all flow meters for gas... procedures specified by the flow meter manufacturer or § 98.3(i). Recalibrate each flow meter...

  5. Investigation of equilibria in solutions of metal(2) ion complexes with heptane-2,4,4-trione

    International Nuclear Information System (INIS)

    Using the method of pH potentiometric titration in water - ethanol solutions, the interaction of bivalent metal ions with heptane-2, 4, 6-trione is investigated. It is shown that in case of Mg, Ca, Sr, Ba protonated and normal mononuclear complexes are formed. At 22 deg C and ionic strength μ = 0.1 equilibrium constants of the complex mononuclear forms are determined

  6. Distribution of Prompt Neutron Emission Probability for Fission Fragments in Spontaneous Fission of 252Cf and 244,248Cm

    Science.gov (United States)

    Vorobyev, A. S.; Dushin, V. N.; Hambsch, F.-J.; Jakovlev, V. A.; Kalinin, V. A.; Laptev, A. B.; Petrov, B. F.; Shcherbakov, O. A.

    2005-05-01

    Neutrons emitted in fission events were measured separately for each complementary fragment in correlation with fission fragment energies. Two high-efficiency Gd-loaded liquid scintillator tanks were used for neutron registration. Fission fragment energies were measured using a twin Frisch gridded ionization chamber with a pinhole collimator. The neutron multiplicity distributions were obtained for each value of the fission fragment mass and energy and corrected for neutron registration efficiency, background, and pile-up. The dependency of these distributions on fragment mass and energy for different energy and mass bins as well as mass and energy distribution of fission fragments are presented and discussed.

  7. Changing convention in combination oral contraceptives: estradiol and nomegestrol acetate in a monophasic 24/4 regimen.

    Science.gov (United States)

    Shulman, Lee P

    2013-07-01

    Initial oral contraceptive regimens were characterised by high doses of ethinylestradiol (EE) and a progestogen in a 21-day regimen that either included seven additional hormone-free tablets or simply the 21 days of combination hormonal tablets. These regimens were developed to ensure high contraceptive effectiveness, regular and predictable withdrawal bleeding episodes to mimic a menstrual cycle, and minimal unscheduled vaginal bleeding. However, these regimens were associated with adverse tolerability and safety issues resulting from the dose and characteristics of their hormonal components. Attempts to ameliorate these adverse issues included the development of lower-dose EE regimens, the incorporation of new progestogens, multiphasic regimens, and reduced hormone-free interval regimens. However, the EE component has remained a constant until the recent approval of combination oral contraceptives with an estrogen component other than EE. The development and introduction of an estradiol-based oral contraceptive regimen is presented in this review. PMID:23709606

  8. NA22 Model Cities Project - LL244T An Intelligent Transportation System-Based Radiation Alert and Detection System

    Energy Technology Data Exchange (ETDEWEB)

    Peglow, S

    2004-02-24

    The purpose of this project was twofold: first, provide an understanding of the technical foundation and planning required for deployment of Intelligent Transportation System (ITS)-based system architectures for the protection of New York City from a terrorist attack using a vehicle-deployed nuclear device; second, work with stakeholders to develop mutual understanding of the technologies and tactics required for threat detection/identification and establish guidelines for designing operational systems and procedures. During the course of this project we interviewed and coordinated analysis with people from the New Jersey State Attorney General's office, the New Jersey State Police, the Port Authority of New York/New Jersey, the Counterterrorism Division of the New York City Police Department, the New Jersey Transit Authority, the State of New Jersey Department of Transportation, TRANSCOM and a number of contractors involved with state and federal intelligent transportation development and implementation. The basic system architecture is shown in the figure below. In an actual system deployment, radiation sensors would be co-located with existing ITS elements and the data will be sent to the Traffic Operations Center. A key element of successful system operation is the integration of vehicle data, such as license plate, EZ pass ID, vehicle type/color and radiation signature. A threat data base can also be implemented and utilized in cases where there is a suspect vehicle identified from other intelligence sources or a mobile detector system. Another key aspect of an operational architecture is the procedures used to verify the threat and plan interdiction. This was a major focus of our work and discussed later in detail. In support of the operational analysis, we developed a detailed traffic simulation model that is described extensively in the body of the report.

  9. Plutonium-244 dating: Initial ratios of plutonium to uranium in the Apollo 11 and 14 lunar fines and breccias

    International Nuclear Information System (INIS)

    More than 550 mass-spectrometric analyses of xenon released from bulk samples and temperature fractions of the lunar fines, breccias and rocks have been carried out in various laboratories in the world including the Soviet Union, since Apollo 11 astronauts made the first successful landing on the moon on 20 July 1969. Re-examination of all the known xenon isotope data for the lunar samples reveals that the moon started to retain her xenon at about the same time as the carbonaceous chondrites, when the initial ratio of Pu to U within the solar system was about 1 to 10 (atom/atom) more than 4,800 million years ago

  10. Notice of construction work in tank farm waste transfer pit 244-TX double contained receiver-tank

    International Nuclear Information System (INIS)

    The following description and any attachments and references are provided to the Washington State Department of Health (WDOH), Division of Radiation Protection, Air Emissions and Defense Waste Section as a notice of construction (NOC) in accordance with Washington Administrative Code (WAC) 246-247, Radiation Protection - Air Emissions. WAC 246-247-060, ''Applications, registration, and licensing'', states ''This section describes the information requirements for approval to construct, modify, and operate an emission unit. Any NOC requires the submittal of information listed in Appendix A,'' Appendix A (WAC 246-247-1 10) lists the requirements that must be addressed. Additionally, the following description, attachments, and references are provided to the U.S. Environmental Protection Agency (EPA) as an NOC, in accordance with Title 40 Code of Federal Regulations (CFR), Part 61, ''National Emission Standards for Hazardous Air Pollutants.'' The information required for submittal to the EPA is specified in 40 CFR 61.07. The potential emissions from this activity are estimated to provide less than 0.1 millired year total effective dose equivalent to the hypothetical offsite maximally exposed individual, and commencement is needed within a short time. Therefore, this application also is intended to provide notification of the anticipated date of initial startup in accordance with the requirement listed in 40 CFR 61.09(a)(1), and it is requested that approval of this application also will constitute EPA acceptance of this initial startup notification. Written notification of the actual date of initial startup, in accordance with the requirement listed in 40 CFR 61.09(a)(2), will be provided later. The activities described in this NOC are estimated to provide a potential offsite (unabated) total effective dose equivalent (TEDE) to the hypothetical maximally exposed individual (MEI) of 2.36 E-02 millirem per year

  11. Investigation of the soil-to-plant transfer of Np-237, Pu-238, Am-241 and Cm-244

    International Nuclear Information System (INIS)

    Inside a greenhouse for radioecological studies the root uptake of Np, Pu, Am, and Cm from 5 different soils into 19 crop plants have been measured. The soils have been artificially contaminated with the 4 nuclides in range from 1-20 Bq/g dry soil. Within 7 vegetation periods about 380 transfer measurements have been performed. The obtained results show that the soil-to-plant transfer is mainly influenced by the following parameters: physical and chemical properties of the different radionuclides, plant species and variety, soil type, time of soil utilization and soil management. The transfer factors measured are compared with those data which are proposed for the calculation of the long term radiation burden of the population by ingestion of contaminated food inside the Federal Republic of Germany. The experiments have been performed from the beginning of 1983 to the end of 1986. The results summarized within this report have already been published in annual reports or as contributions to scientific meetings. (orig.)

  12. Metabolites of 2,4,4'-tribrominated diphenyl ether (BDE-28) in pumpkin after in vivo and in vitro exposure.

    Science.gov (United States)

    Yu, Miao; Liu, Jiyan; Wang, Thanh; Sun, Jianteng; Liu, Runzeng; Jiang, Guibin

    2013-01-01

    There is currently limited knowledge on PBDE metabolism in plants although they could play an important role in the environmental transformation of these persistent organic pollutants. In this study, pumpkin (Cucurbita maxima × C. moschata) was chosen as the model to understand the fate of BDE-28 in plants. MeO-tri-BDEs, OH-tri-BDEs, and OH-tri-BDEs were found as metabolites in plant samples of both in vivo hydroponic and in vitro tissue culture exposure. Three MeO-tri-BDEs were further identified as para-substituted metabolites. MeO-BDEs and OH-BDEs, respectively, accounted for about 1.6% and 1.5% (recovery corrected) of initial amount of BDE-28 according to the semiquantitative results. Other PBDEs, especially less brominated PBDEs as impurities in the standard of BDE-28, were also detected. The impurities and evaporation of the standard must be considered when trace metabolites are studied in exposure experiments. PMID:24191731

  13. Accumulation of Am-241 and Cm-244 from water and sediments by Hyalella sp. and Tubifex spp

    International Nuclear Information System (INIS)

    This paper reports on the bioaccumulation of americium and curium by freshwater invertebrates in laboratory experiments. Uptake by benthic invertebrates will affect both the biogeochemical cycling of these elements and the potential exposure of man through accumulation in aquatic food chains. Am and Cm isotopes are produced by nuclear reactions in commercial reactors and are major components of high level wastes. Both elements bind strongly to sediments which may be the principal source for uptake by benthic organisms in freshwater and marine environments. The principal objectives of this research were: (1) to determine the extent of bioaccumulation of Am and Cm for freshwater species; (2) to compare bioaccumulation from water with bioaccumulation from various types of sediment particles; and (3) to evaluate the similarities and differences in the behavior of Am and Cm

  14. Accumulation of Am-241 and Cm-244 from water and sediments by Hyalella sp. and Tubifex spp

    Energy Technology Data Exchange (ETDEWEB)

    Sibley, T.H.; Stohr, J.S. (Univ. of Washington, Seattle (USA))

    1990-01-01

    This paper reports on the bioaccumulation of americium and curium by freshwater invertebrates in laboratory experiments. Uptake by benthic invertebrates will affect both the biogeochemical cycling of these elements and the potential exposure of man through accumulation in aquatic food chains. Am and Cm isotopes are produced by nuclear reactions in commercial reactors and are major components of high level wastes. Both elements bind strongly to sediments which may be the principal source for uptake by benthic organisms in freshwater and marine environments. The principal objectives of this research were: (1) to determine the extent of bioaccumulation of Am and Cm for freshwater species; (2) to compare bioaccumulation from water with bioaccumulation from various types of sediment particles; and (3) to evaluate the similarities and differences in the behavior of Am and Cm.

  15. Oscar H. Aelo, El peronismo en la provincia de Buenos Aires (1946-1955), Caseros, Eduntref, 2012, 244 p.

    OpenAIRE

    Hémeury, Lucie

    2013-01-01

    Fenómeno fundamental en la historia de la Argentina del siglo XX, el peronismo sigue siendo un tema central de la historiografía argentina. Como suele ocurrir en el caso de movimientos de tal amplitud, caracterizados tanto por su longevidad como por la importancia de ciertas transformaciones en el campo político, social, cultural y económico, la bibliografía enfoca algunos de estos aspectos en perjuicio de otros. En su libro El peronismo en la provincia de Buenos Aires, fruto de una tesis de ...

  16. Comparison of photosensitivity in germanium doped silica fibers using 244 nm and 266 nm continuous wave lasers

    DEFF Research Database (Denmark)

    Jensen, Jesper Bo; Varming, Poul; Liu, B.;

    2001-01-01

    Diode pumped continuous-wave UV lasers offer an interesting alternative to frequency doubled argon-ion lasers. We report the first photosensitivity comparison using these lasers on deuterium loaded standard telecommunication fibers and unloaded experimental fibers.......Diode pumped continuous-wave UV lasers offer an interesting alternative to frequency doubled argon-ion lasers. We report the first photosensitivity comparison using these lasers on deuterium loaded standard telecommunication fibers and unloaded experimental fibers....

  17. 8 CFR 1240.21 - Suspension of deportation and adjustment of status under section 244(a) of the Act (as in effect...

    Science.gov (United States)

    2010-01-01

    ... cancellation of removal as provided in 8 CFR 240.21 (as in effect prior to September 30, 1998). (b) Conditional... of removal is pending on appeal before the Board as of September 30, 1998 or, if the right to appeal... unfavorable exercise of discretion, a finding of no good moral character on a ground not specifically noted...

  18. 8 CFR 240.21 - Suspension of deportation and adjustment of status under section 244(a) of the Act (as in effect...

    Science.gov (United States)

    2010-01-01

    ... provided in 8 CFR 240.21 (as in effect prior to September 30, 1998). (b) Conditional grants of suspension... before the Board as of September 30, 1998 or, if the right to appeal to the Board has not been waived... moral character on a ground not specifically noted in section 101(f) of the Act, a failure to...

  19. Integrated plant safety assessment systematic evaluation program. R.E. Ginna Nuclear Power Plant, Rochester Gas and Electric Corporation, Docket No. 50-244

    International Nuclear Information System (INIS)

    The Systematic Evaluation Program was initiated in February 1978 by the US Nuclear Regulatory Commission to review the designs of older operating nuclear reactor plants to reconfirm and document their safety. The review provides (1) an assessment of how these plants compare with current licensing safety requirements relating to selected issues, (2) a basis for deciding on how these differences should be resolved in an integrated plant review, and (3) a documented evaluation of plant safety. This report documents the review of the R.E. Ginna Nuclear Power Plant (located in Wayne County near Rochester, NY), one of ten plants reviewed under Phase II of this program, and indicates how 137 topics selected for review under Phase I of the program were addressed. Equipment and procedural changes have been identified as a result of the review. It is expected that this report will be one of the bases in considering the issuance of a full-term operating license in place of the existing provisional operating license

  20. 77 FR 27082 - StarTek USA, Inc., 244 Dundee Avenue, Greeley, CO; StarTek USA, Inc., 1250 H Street, Greeley, CO...

    Science.gov (United States)

    2012-05-08

    ... Department's notice of determination was published in the Federal Register on January 14, 2011 (76 FR 2717...., 1250 H Street, Greeley, CO; Amended Certification Regarding Eligibility To Apply for Worker Adjustment... ``north'' center at 1250 H Street); both facilities supply business processes services and operate...

  1. Fission barrier determinations and fragment angular correlations for the 244Pu, 242Pu, 240U, 238U, 234Th, and 232Th compound nuclei from (t, pf) reactions

    International Nuclear Information System (INIS)

    Fission probabilities and the angular distribution of the fission fragments have been measured for six even-even compound nuclear systems using the (t, pf) reaction. Angular correlations of fission fragments obtained in these experiments provide information about the low-lying collective excitations or transition states at the fission barrier. The (t, p) reaction in particular leads to neutron-rich residual nuclei unobtainable by other methods. The absence of spin coupling for (t, p) reactions on even-even targets provides angular distributions with well defined structure in the region of the fission barrier. The experimental data were obtained using an 18-MeV triton beam on targets of 242Pu, 240Pu, 238U, 236U, 232Th and 230Th at Los Alamos Van-de-Graaff accelerator facility. Outgoing protons were detected at 140 deg relative to the incident triton beam. Excitation energies ranging from 3.0 to 9.0 MeV were obtained in these experiments. Fission fragment angular distributions were measured at 24 angles from 0 deg to 140 deg relative to the kinematic recoil angle. The data were fitted to a series of even Legendre polynomials W(θ) = A0 [1 + ΣL gL PL (cos θ)] and the coefficients g2 through g12 and A0 were determined as a function of excitation energy. The fission probability Pf was obtained from the ratio of A0 to the (t, p) cross-section for the target nucleus. The results exhibit well defined structure in the angular coefficients which correlates with structure in the fission probability for most of the nuclei studied. In an attempt to interpret this observed structure the experimentally determined fitting parameters Pf and g are compared with calculated results of a microscopic model. This model takes into consideration the penetrability and angular dependence of fission through each member of the various transition bands at the saddle point and appropriately sums the results for comparison with the data. The effects of barrier penetration through a two-peaked deformation potential are explored in this analysis. This survey of the fission properties of several nuclei indicates some general trends relating the saddle point deformation to the character of the transition level structure. (author)

  2. SU-E-J-244: Development and Validation of a Knowledge Based Planning Model for External Beam Radiation Therapy of Locally Advanced Non-Small Cell Lung Cancer

    International Nuclear Information System (INIS)

    Purpose: The study aims to develop and validate a knowledge based planning (KBP) model for external beam radiation therapy of locally advanced non-small cell lung cancer (LA-NSCLC). Methods: RapidPlan™ technology was used to develop a lung KBP model. Plans from 65 patients with LA-NSCLC were used to train the model. 25 patients were treated with VMAT, and the other patients were treated with IMRT. Organs-at-risk (OARs) included right lung, left lung, heart, esophagus, and spinal cord. DVH and geometric distribution DVH were extracted from the treated plans. The model was trained using principal component analysis and step-wise multiple regression. Box plot and regression plot tools were used to identify geometric outliers and dosimetry outliers and help fine-tune the model. The validation was performed by (a) comparing predicted DVH boundaries to actual DVHs of 63 patients and (b) using an independent set of treatment planning data. Results: 63 out of 65 plans were included in the final KBP model with PTV volume ranging from 102.5cc to 1450.2cc. Total treatment dose prescription varied from 50Gy to 70Gy based on institutional guidelines. One patient was excluded due to geometric outlier where 2.18cc of spinal cord was included in PTV. The other patient was excluded due to dosimetric outlier where the dose sparing to spinal cord was heavily enforced in the clinical plan. Target volume, OAR volume, OAR overlap volume percentage to target, and OAR out-of-field volume were included in the trained model. Lungs and heart had two principal component scores of GEDVH, whereas spinal cord and esophagus had three in the final model. Predicted DVH band (mean ±1 standard deviation) represented 66.2±3.6% of all DVHs. Conclusion: A KBP model was developed and validated for radiotherapy of LA-NSCLC in a commercial treatment planning system. The clinical implementation may improve the consistency of IMRT/VMAT planning

  3. Large-Scale Wind Turbine Testing in the NASA 24.4m (80) by 36.6m(120) Wind Tunnel

    Science.gov (United States)

    Zell, Peter T.; Imprexia, Cliff (Technical Monitor)

    2000-01-01

    The 80- by 120-Foot Wind Tunnel at NASA Ames Research Center in California provides a unique capability to test large-scale wind turbines under controlled conditions. This special capability is now available for domestic and foreign entities wishing to test large-scale wind turbines. The presentation will focus on facility capabilities to perform wind turbine tests and typical research objectives for this type of testing.

  4. SU-E-J-244: Development and Validation of a Knowledge Based Planning Model for External Beam Radiation Therapy of Locally Advanced Non-Small Cell Lung Cancer

    Energy Technology Data Exchange (ETDEWEB)

    Liu, Z; Kennedy, A [Sarah Cannon, Nashville, TN (United States); Larsen, E; Hayes, C; Grow, A [North Florida Cancer Center, Gainesville, FL (United States); Bahamondes, S.; Zheng, Y; Wu, X [JFK Comprehensive Cancer Institute, Lake Worth, FL (United States); Choi, M; Pai, S [Good Samaritan Hospital, Los Gatos, CA (United States); Li, J [Doctors Hospital of Augusta, Augusta, GA (United States); Cranford, K [Trident Medical Center, Charleston, SC (United States)

    2015-06-15

    Purpose: The study aims to develop and validate a knowledge based planning (KBP) model for external beam radiation therapy of locally advanced non-small cell lung cancer (LA-NSCLC). Methods: RapidPlan™ technology was used to develop a lung KBP model. Plans from 65 patients with LA-NSCLC were used to train the model. 25 patients were treated with VMAT, and the other patients were treated with IMRT. Organs-at-risk (OARs) included right lung, left lung, heart, esophagus, and spinal cord. DVH and geometric distribution DVH were extracted from the treated plans. The model was trained using principal component analysis and step-wise multiple regression. Box plot and regression plot tools were used to identify geometric outliers and dosimetry outliers and help fine-tune the model. The validation was performed by (a) comparing predicted DVH boundaries to actual DVHs of 63 patients and (b) using an independent set of treatment planning data. Results: 63 out of 65 plans were included in the final KBP model with PTV volume ranging from 102.5cc to 1450.2cc. Total treatment dose prescription varied from 50Gy to 70Gy based on institutional guidelines. One patient was excluded due to geometric outlier where 2.18cc of spinal cord was included in PTV. The other patient was excluded due to dosimetric outlier where the dose sparing to spinal cord was heavily enforced in the clinical plan. Target volume, OAR volume, OAR overlap volume percentage to target, and OAR out-of-field volume were included in the trained model. Lungs and heart had two principal component scores of GEDVH, whereas spinal cord and esophagus had three in the final model. Predicted DVH band (mean ±1 standard deviation) represented 66.2±3.6% of all DVHs. Conclusion: A KBP model was developed and validated for radiotherapy of LA-NSCLC in a commercial treatment planning system. The clinical implementation may improve the consistency of IMRT/VMAT planning.

  5. El control territorial de la administración ugarítica: el ‘catastro’ TU 4.244

    OpenAIRE

    Zamora, José-Ángel

    2003-01-01

    Estudio ugarítico, y de aspectos de la administración ugarítica que de él se deducen, haciendo uso de los instrumentos informáticos que el homenajeado, Jesús-Luis Cunchillos, proporcionó a la especialidad.

  6. Takotsubo cardiomyopathy associated with sepsis due to Pseudomonas aeruginosa pneumoniadoi: 10.12662/2317-3076jhbs.v3i4.169.p242-244.2015

    Directory of Open Access Journals (Sweden)

    Márcio da Silva Pereira

    2015-12-01

    Full Text Available The authors describe a case report of a 71 year-old female patient admitted at the emergency service due to severe precordial chest pain associated with dyspnea and sweating. The electrocardiogram performed on admission showed ST elevation on V2 and V3 leads and the ventriculography revealed left ventricular apical ballooning, denoting the diagnosis of Takotsubo Cardiomyopathy. At the eighth day of hospitalization, although the heart function was recovered, the patient died due the clinical complications of a septic shock.

  7. Distribution of sup 137 Cs, sup 90 Sr, sup 238 Pu, sup 239 Pu, sup 241 Am and sup 244 Cm in Pond B, Savannah River Site

    Energy Technology Data Exchange (ETDEWEB)

    Whicker, F.W. (Colorado State Univ., Fort Collins, CO (USA)); Pinder, J.E. III; Bowling, J.W. (Savannah River Ecology Lab., Aiken, SC (USA)); Alberts, J.J. (Georgia Univ., Sapelo Island, GA (USA). Marine Inst.); Brisbin, I.L. Jr. (Savannah River Ecology Lab., Aiken, SC (USA))

    1989-05-01

    The gradual senescence of present-day operating nuclear facilities, and resultant contamination of aquatic and terrestrial ecosystems, emphasize the importance of understanding the behavior of radionuclides in the environment. Observations and deductions concerning mechanisms of radionuclide transport can contribute significantly to knowledge of fundamental ecological processes. This study emphasized the ecosystem-level distribution of several long-lived radionuclides in an abandoned reactor cooling impoundment after a twenty year period of chemical and biological equilibration. 90 refs., 14 figs., 5 tabs.

  8. Phenotype and 244k array-CGH characterization of chromosome 13q deletions: an update of the phenotypic map of 13q21.1-qter

    DEFF Research Database (Denmark)

    Kirchhoff, Maria; Bisgaard, Anne-Marie; Stoeva, Radka;

    2009-01-01

    breakpoints in 14 patients with partial deletions of this region. Subsequently, we linked the genotype to the patient's phenotype. Using this approach, we were able to refine the smallest deletion region linked to short stature (13q31.3: 89.5-91.6 Mb), microcephaly (13q33.3-q34), cortical development...

  9. Discovery of Isotopes of the Transuranium Elements with 93 <= Z <= 98

    OpenAIRE

    Fry, C; Thoennessen, M

    2012-01-01

    One hundred and five isotopes of the transuranium elements neptunium, plutonium, americium, curium, berkelium and californium have so far been observed; the discovery of these isotopes is discussed. For each isotope a brief summary of the first refereed publication, including the production and identification method, is presented.

  10. Sonochemical synthesis and characterization of a nano-sized Manganese (II) coordination polymer, [{Mn(NCS)2(4,4´-bipy)(H2O)2}(4,4´-bipy)]n; with 4,4'-Bipyridine (4,4'-bipy) ligand

    OpenAIRE

    N. Mosallanejad

    2014-01-01

    A novel nano – sized  manganese (II) coordination polymer, [{Mn(NCS)2(L)(H2O)2}(L)]n  , (1) (L- = 4,4'-Bipyridine), have been synthesized by a sonochemical process and characterized by scanning electron microscopy (SEM), X-ray diffraction (XRD), IR spectroscopy and elemental analysis.  Direct calcination of the single crystals and nano-sized compound 1 at 400 0C under air atmosphere yields mixture of K2Mn2 (SO4)3, MnOS and Mn3O4 nanoparticles. Results show that the size and morphology of the ...

  11. Sonochemical synthesis and characterization of a nano-sized Manganese (II coordination polymer, [{Mn(NCS2(4,4´-bipy(H2O2}(4,4´-bipy]n; with 4,4'-Bipyridine (4,4'-bipy ligand

    Directory of Open Access Journals (Sweden)

    N. Mosallanejad

    2014-05-01

    Full Text Available A novel nano – sized  manganese (II coordination polymer, [{Mn(NCS2(L(H2O2}(L]n  , (1 (L- = 4,4'-Bipyridine, have been synthesized by a sonochemical process and characterized by scanning electron microscopy (SEM, X-ray diffraction (XRD, IR spectroscopy and elemental analysis.  Direct calcination of the single crystals and nano-sized compound 1 at 400 0C under air atmosphere yields mixture of K2Mn2 (SO43, MnOS and Mn3O4 nanoparticles. Results show that the size and morphology of the K2Mn2 (SO43, MnOS, Mn3O4 nanoparticles depend on the particles size of compound 1. Decrease in the particles size of compound 1 leads to decrease in the particles size of the K2Mn2 (SO43, MnOS and Mn3O4.

  12. Neutron multiplicities for the transplutonium nuclides

    International Nuclear Information System (INIS)

    This paper continues, with respect to the transplutonium nuclides, earlier efforts to collate and evaluate data from the scientific literature on the prompt neutron multiplicity distribution from fission and its first moment = ΣnuPnu. The isotopes considered here for which P/sub nu/ and or data (or both) were found in the literature are of americium (Am), curium (Cm), berkelium (Bk), californium (Cf), einsteinium (Es), fermium (Fm), and nobelium (No)

  13. Multibeam collection for TN244: Multibeam data collected aboard Thomas G. Thompson from 2009-12-05 to 2009-12-08, departing from Seattle, WA and returning to Seattle, WA

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — This data set is part of a larger set of data called the Multibeam Bathymetry Database (MBBDB) where other similar data can be found at...

  14. Evaluation of the TWRS S/RID for Additional Requirements Resulting from W-420 Stack Monitoring System Upgrades [for 241C and 244A and BX and CF and S and TX

    International Nuclear Information System (INIS)

    This document answers the question: ''Do Project W-420 Activities introduce the need to add new requirements to the TWRS S/RID?'' and documents that basis for the answer. It concludes that no additional S/RID requirements are necessary

  15. SU-E-J-244: Validation of a 6D-Robotic-Couch and Image Guidance Radiation Therapy (IGRT) System for Localization in World's First Single-Room Proton Therapy System

    International Nuclear Information System (INIS)

    Purpose: The Mevion S250 proton therapy unit is equipped with a 6D-robotic couch and IGRT system (Verity). The patient alignment process allows corrections in six degrees of freedom: translation (x,y,z), pitch, roll, and yaw (θ,ϑ,ψ). Geometric accuracy of couch corrections and imaging vs. radiation isocenter coincidence were quantified before clinical implementation. Methods: A commercial phantom with sixteen 2mm tungsten BBs was rigidly couch-mounted and imaged with CT. Seventeen rigid translations/rotations of known magnitude were digitally applied to the original CT image using commercial software, validated with Varian OBI system. For each altered image, phantom was mounted on robotic couch in original position, then Verity 2D:2D match (PA-LLAT) was performed using DRRs from altered images. Corrections were recorded and applied, phantom was imaged a second time and residual corrections recorded. Physical measurements verified that applied couch corrections coincided with both physical couch shifts/rotations and known CT image translations/rotations. Additionally, image vs. radiation isocenter coicidence was quantified over couch treatment angles (±90° from setup position) using radiochromic film and an image-guided couch star-shot. Posterior-anterior and left-lateral kV radiographs were taken before each beam was delivered to verify imaging/radiation isocentricity. Results: Verity suggested couch corrections and known CT shifts/rotations agreed within ±1mm (average: Δ lat=0.5mm; Δ vert=0.4mm; Δ long=0.3mm) and ± 0.4° (average: Δ pitch=0.24° Δ roll=0.01°; Δ yaw=0.10°). Physical couch measurements and Verity applied corrections agreed within ± 1mm (average: Δlat=0.5mm; Δvert=0.4mm; Δlong=0.2mm) and ±0.2° (average: Δpitch=0.03°; Δ roll=0.04°; Δ yaw=0.04°). The directionality of all translations and rotations were qualitatively verified. The image vs. radiation isocenter coincidence was <1mm and radiation-isocenter precision was <1mm over the 180° of couch motion, as indicated by film analysis. Conclusion: The Verity IGRT software and 6D-couch combination on the Mevion S250 was verified as accurate within 1mm and 0.5°. This complies with the TG-142 standards for a stereotactic radiotherapy IGRT system. Rob Cessac is employed as Product Manager for Mevion Medical Systems

  16. Beneficios no anticonceptivos de 0,02 mg de etinilestradiol/2 mg de acetato de clormadinona administrados en un régimen de 24+4 días

    Directory of Open Access Journals (Sweden)

    Hans Peter Zahradnik

    2011-01-01

    Full Text Available Objetivo: Demostrar la influencia sobre las molestias emocionales y físicas (beneficios no anticonceptivos experimentadas durante el primer año de uso de un anticonceptivo oral combinado (AOC que contiene 0,02 mg de etinilestradiol (EE y 2 mg de acetato de clormadinona (ACM administrado en un régimen de 24 + 4 días de placebo. Diseño del estudio: Análisis adicional de las sensaciones subjetivas registradas en los diarios de 1665 participantes de un estudio de Fase III multicéntrico, no controlado, de administración múltiple, después de 13 ciclos de EE/ACM en un régimen de administración de 24 + 4 días, publicado previamente. Resultados: Se informó de menor frecuencia de molestias emocionales y físicas en el ciclo de medicación 13 en comparación con los datos en la admisión y en el ciclo 1. La incidencia de ánimo depresivo se redujo en 84,5% y 72,2% respectivamente, y la irritabilidad en 87,3% y 66,0%. Las cefaleas se redujeron en 75,5% y 74,7%, las molestias mamarias en 77,1% y 66,1%, y la dismenorrea preexistente en 77,9% y 67,6% respectivamente. El abandono prematuro del estudio a causa de las molestias fue marginal, y el perfil del sangrado fue aceptable. Conclusiones: Un AOC de baja dosis que contiene 0,02 mg de EE + 2 mg de ACM, administrado en un régimen de 24 + 4 días, reduce significativamente la mayor parte de las molestias emocionales y físicas que se presentan durante los ciclos espontáneos de las mujeres, y se combina con un adecuado perfil de sangrado.Objective: To demonstrate the influence on physical and psychological complaints during the first year of intake of the combined oral contraceptive (COC 0.02 mg ethinylestradiol (EE/2 mg chlormadinone acetate (CMA, administered in a regimen of 24 days of CMA/EE intake followed by 4 days of placebo intake. Study design: The subjective feelings of non-contraceptive benefits registered in women's diaries of 1,665 subjects participating in a multicentre, uncontrolled, multiadministration, Phase III trial, published elsewhere, were analyzed post-hoc after 13 cycles intake of EE/CMA in a 24 +4 days intake regimen. Results: Emotional complaints were reported less frequently at medication cycle 13 compared with admission and cycle 1. Depressive mood was reduced by 84.5% and 72.2%, irritability by 87.3% and 66.0%; physical complaints were also reduced: headaches by 75.5% and 74.7%, breast discomfort by 77.1% and 66.1%; pre-existing dysmenorrhea by 77.9% and 67.6%. Premature termination due to complaints was only marginal, the bleeding profile was accepted. Conclusions: The low-dose COC, 0.02 mg EE/2 mg CMA, administered in a 24 +4 day regimen, reduces significantly most of the emotional and physical complaints occurring during spontaneous cycles of women, combined with an adequate bleeding profile.

  17. A change of in vivo characteristics depending on specific activity of radioiodinated (+)-2-[4-(4-iodophenyl)piperidino]cyclohexanol [(+)-pIV] as a ligand for sigma receptor imaging

    Energy Technology Data Exchange (ETDEWEB)

    Akhter, Nasima [Department of Biotracer Medicine, Kanazawa University, Kanazawa 920-8640, Ishikawa (Japan); Shiba, Kazuhiro [Division of Tracer Kinetics, Advanced Science Research Center, Kanazawa University, Kanazawa 920-8640, Ishikawa (Japan)], E-mail: shiba@med.kanazawa-u.ac.jp; Ogawa, Kazuma [Division of Tracer Kinetics, Advanced Science Research Center, Kanazawa University, Kanazawa 920-8640, Ishikawa (Japan); Tsuji, Shiro [School of Health Sciences, Kanazawa University, Kanazawa 920-8640, Ishikawa (Japan); Kinuya, Seigo; Nakajima, Kenichi [Department of Biotracer Medicine, Kanazawa University, Kanazawa 920-8640, Ishikawa (Japan); Mori, Hirofumi [Division of Tracer Kinetics, Advanced Science Research Center, Kanazawa University, Kanazawa 920-8640, Ishikawa (Japan)

    2008-01-15

    The radioiodinated (+)-p-iodovesamicol [(+)-pIV], which shows a high binding affinity for sigma-1 ({sigma}-1) receptors, is prepared by an exchange reaction. The specific activity (SA) is fairly low and therefore is insufficient for clinical use. In this study, we prepared (+)-[{sup 125}I]pIV with a high SA from tributylstannyl precursor and compared the in vivo characteristics between high and low SA by imaging {sigma}-1 receptors in the central nervous system. In the biodistribution study, a difference in brain accumulation was observed between the two methods. At 30 min postinjection, the brain accumulation (1.58%ID/g) of low SA [0.6-1.1 TBq/mmol (16-30 Ci/mmol)] (+)-[{sup 125}I]pIV was higher than that (1.34%ID/g) of high SA [>88.8 TBq/mmol (>2400 Ci/mmol)] (+)-[{sup 125}I]pIV. In the blocking study, the brain uptake of high SA (+)-[{sup 125}I]pIV was reduced more significantly by the coadministration of sigma ligands such as pentazocine, haloperidol or SA4503 than that of low SA (+)-[{sup 125}I]pIV. These results showed that nonspecific binding of high SA (+)-[{sup 125}I]pIV in the brain was lower than that of low SA (+)-[{sup 125}I]pIV, and high SA (+)-[{sup 125}I]pIV bound more specifically to {sigma}-1 receptors in the brain than low SA (+)-[{sup 125}I]pIV. In contrast, in the blood-binding study, high SA (+)-[{sup 125}I]pIV (58.4%) bound to blood cells with higher affinity than low SA (+)-[{sup 125}I]pIV (46.0%). In metabolite studies, blood metabolites of high SA (+)-[{sup 125}I]pIV (57.3{+-}3.5%) were higher than those of low SA (+)-[{sup 125}I]pIV (45.5{+-}4.1%) at 30 min postinjection. Higher SA may be apt to bind to blood cells with higher affinity and to be metabolized faster.

  18. Poly[[aqua(μ2-4,4′-bipyridine-κ2N:N′[μ3-3-bromo-2-(carboxylatomethylbenzoato-κ3O1:O1′:O2]cadmium] monohydrate

    Directory of Open Access Journals (Sweden)

    Yangmei Liu

    2012-08-01

    Full Text Available In the title compound, {[Cd(C9H5BrO4(C10H8N2(H2O]·H2O}n, the CdII atom has a distorted octahedral coordination geometry. Two N atoms from two 4,4′-bipyridine (bipy ligands occupy the axial positions, while the equatorial positions are furnished by three carboxylate O atoms from three 3-bromo-2-(carboxylatomethylbenzoate (bcb ligands and one O atom from a water molecule. The bipy and bcb ligands link the CdII atoms into a three-dimensional network. O—H...O hydrogen bonds and π–π interactions between the pyridine and benzene rings [centroid–centroid distance = 3.736 (4 Å] are present in the crystal.

  19. TOWARD AN IMPROVED UNDERSTANDING OF STRUCTURE AND MAGNETISM IN NEPTUNIUM AND PLUTONIUM PHOSPHONATES AND SULFONATES

    Energy Technology Data Exchange (ETDEWEB)

    Albrecht-Schmitt, Thomas

    2012-03-01

    This grant supported the exploratory synthesis of new actinide materials with all of the actinides from thorium to californium with the exceptions of protactinium and berkelium. We developed detailed structure-property relationships that allowed for the identification of novel materials with selective ion-exchange, selective oxidation, and long-range magnetic ordering. We found novel bonding motifs and identified periodic trends across the actinide series. We identified structural building units that would lead to desired structural features and novel topologies. We also characterized many different spectroscopic trends across the actinide series. The grant support the preparation of approximately 1200 new compounds all of which were structurally characterized.

  20. Composition containing transuranic elements for use in the homeopathic treatment of aids

    International Nuclear Information System (INIS)

    A homeopathic remedy consisting of a composition containing one or more transuranic elements, particularly plutonium, for preventing and treating acquired immunodeficiency syndrome (AIDS) in humans, as well as seropositivity for human immunodeficiency virus (HIV). Said composition is characterized in that it uses any chemical or isotopic form of one or more transuranic elements (neptunium, plutonium, americium, curium, berkelium, californium or einsteinium), particularly plutonium, said form being diluted and dynamized according to conventional homeopathic methods, particularly the so-called Hahnemann and Korsakov methods, and provided preferably but not exclusively in the form of lactose and/or saccharose globules or granules impregnated with the active principle of said composition. (author)

  1. Detection of rare earth elements in Powder River Basin sub-bituminous coal ash using laser-induced breakdown spectroscopy (LIBS)

    Energy Technology Data Exchange (ETDEWEB)

    Tran, Phuoc [National Energy Technology Lab. (NETL), Pittsburgh, PA, (United State; Mcintyre, Dustin [National Energy Technology Lab. (NETL), Pittsburgh, PA, (United State

    2015-10-01

    We reported our preliminary results on the use of laser-induced breakdown spectroscopy to analyze the rare earth elements contained in ash samples from Powder River Basin sub-bituminous coal (PRB-coal). We have identified many elements in the lanthanide series (cerium, europium, holmium, lanthanum, lutetium, praseodymium, promethium, samarium, terbium, ytterbium) and some elements in the actinide series (actinium, thorium, uranium, plutonium, berkelium, californium) in the ash samples. In addition, various metals were also seen to present in the ash samples

  2. PROCEEDINGS OF THE SYMPOSIUM COMMEMORATING THE 25th ANNIVERSARY OF ELEMENTS 97 and 98 HELD ON JAN. 20, 1975

    Energy Technology Data Exchange (ETDEWEB)

    Seaborg, Glenn T.; Street Jr., Kenneth; Thompson, Stanley G.; Ghiorso, Albert

    1976-07-01

    This volume includes the talks given on January 20, 1975, at a symposium in Berkeley on the occasion of the celebration of the 25th anniversary of the discovery of berkelium and californium. Talks were given at this symposium by the four people involved in the discovery of these elements and by a number of people who have made significant contributions in the intervening years to the investigation of their nuclear and chemical properties. The papers are being published here, without editing, in the form in which they were submitted by the authors in the months following the anniversary symposium, and they reflect rather faithfully the remarks made on that occasion.

  3. Poly[(μ2-4,4′-bipyridine-κ2N:N′(μ2-2,2-dimethylcyclopentane-1,3-dicarboxylato-κ4O1,O1′:O3,O3′cadmium

    Directory of Open Access Journals (Sweden)

    Xian-Fa Zhang

    2011-11-01

    Full Text Available In the title polymeric compound, [Cd(C9H12O4(C10H8N2]n, the CdII atom is located on a twofold rotation axis and is coordinated by two 4,4′-bipyridine ligands and two 2,2-dimethylcyclopentane-1,3-dicarboxylate ions. The carboxylate ion and the N-heterocycle both function as bridges to link adjacent CdII atoms to result in the formation of a layer structure parallel to (010. The mid-point of the central C—C bond of the 4,4′-bipyridine ligand is located on an inversion center. In the crystal, the carboxylate ion is disordered over a twofold rotation axis in respect of its methyl group and the cyclopentane ring.

  4. Dicty_cDB: Contig-U10474-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available t = 1e-83 Identities = 244/244 (100%) Strand = Plus / Plus Query: 17 ctttcncatggggatatngnagctaaagntanaaaanatttatccna...|||| Sbjct: 17 ctttcncatggggatatngnagctaaagntanaaaanatttatccnatggnaaaaatnaa 76 Query: 77 aacccacntgcnnaacata...aattattnccccccatcnttagnctatccctaggnccnaaa 136 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| S...bjct: 77 aacccacntgcnnaacataaattattnccccccatcnttagnctatccctaggnccnaaa 136 Query: ...ngnagctaaagntanaaaanatttatccnatggnaaaaatnaa 76 ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||

  5. An atomic beam source for actinide elements: concept and realization

    International Nuclear Information System (INIS)

    For ultratrace analysis of actinide elements and studies of their atomic properties with resonance ionization mass spectroscopy (RIMS), efficient and stable sources of actinide atomic beams are required. The thermodynamics and kinetics of the evaporation of actinide elements and oxides from a variety of metals were considered, including diffusion, desorption, and associative desorption. On this basis various sandwich-type filaments were studied. The most promising system was found to consist of tantalum as the backing material, an electrolytically deposited actinide hydroxide as the source of the element, and a titanium covering layer for its reduction to the metal. Such sandwich sources were experimentally proven to be well suited for the production of atomic beams of plutonium, curium, berkelium and californium at relatively low operating temperatures and with high and reproducible yields. (orig.)

  6. Nuclear fission and the transuranium elements

    International Nuclear Information System (INIS)

    Many of the transuranium elements are produced and isolated in large quantities through the use of neutrons furnished by nuclear fission reactions: plutonium (atomic number 94) in ton quantities; neptunium (93), americium (95), and curium (96) in kilogram quantities; berkelium (97) in 100 milligram quantities; californium (98) in gram quantities; and einsteinium (99) in milligram quantities. Transuranium isotopes have found many practical applications---as nuclear fuel for the large-scale generation of electricity, as compact, long-lived power sources for use in space exploration, as means for diagnosis and treatment in the medical area, and as tools in numerous industrial processes. Of particular interest is the unusual chemistry and impact of these heaviest elements on the periodic table. This account will feature these aspects. 9 refs., 5 figs

  7. Nuclear fission and the transuranium elements

    Energy Technology Data Exchange (ETDEWEB)

    Seaborg, G.T.

    1989-02-01

    Many of the transuranium elements are produced and isolated in large quantities through the use of neutrons furnished by nuclear fission reactions: plutonium (atomic number 94) in ton quantities; neptunium (93), americium (95), and curium (96) in kilogram quantities; berkelium (97) in 100 milligram quantities; californium (98) in gram quantities; and einsteinium (99) in milligram quantities. Transuranium isotopes have found many practical applications---as nuclear fuel for the large-scale generation of electricity, as compact, long-lived power sources for use in space exploration, as means for diagnosis and treatment in the medical area, and as tools in numerous industrial processes. Of particular interest is the unusual chemistry and impact of these heaviest elements on the periodic table. This account will feature these aspects. 9 refs., 5 figs.

  8. Production of transuranium elements

    International Nuclear Information System (INIS)

    The Radiochemical Engineering Development Center (REDC) has the programmatic responsibility for the Department of Energy's Transuranium Element Program. Principle elements from the program are einsteinium, berkelium, and fermium. Targets containing curium oxide mixed with aluminum powder are fabricated by the REDC and irradiated in the Oak Ridge National Laboratory (ORNL) High Flux Isotope Reactor. Following an irradiation period of 6-12 months, targets are returned to the REDC for chemical processing. Processing operations consists of aluminum dejacketing in a caustic-nitrate solution, filtration, acid dissolution, solvent extraction, anion exchange, and finally a cation exchange to recover the actinides. The processing operations take place in heavily shielded hot cell facilities and all operations are carried out remotely. The chemistry for the separations has been well established over the 26-yr. operating life of the facility

  9. Drug: D01888 [KEGG MEDICUS

    Lifescience Database Archive (English)

    Full Text Available D01888 Drug Safrazine hydrochloride (JAN) C11H16N2O2. HCl 244.0979 244.7179 D01888.gif Antidepressant withdr...awal drug monoamine oxidase (MAO) inhibitor [HSA:4128 4129] [KO:K00274] hsa00260(41

  10. Applications of Text Analysis Tools for Spoken Response Grading

    Science.gov (United States)

    Crossley, Scott; McNamara, Danielle

    2013-01-01

    This study explores the potential for automated indices related to speech delivery, language use, and topic development to model human judgments of TOEFL speaking proficiency in second language (L2) speech samples. For this study, 244 transcribed TOEFL speech samples taken from 244 L2 learners were analyzed using automated indices taken from…

  11. Unigene BLAST: CBRC-CELE-05-0630 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-CELE-05-0630 gnl|UG|Cel#S5720508 Caenorhabditis elegans Serpentine Receptor, c...lass H family member (srh-244) (srh-244) mRNA, complete cds /cds=p(1,1011) /gb=NM_072471 /gi=17557561 /ug=Cel.25680 /len=1011 8e-48 34% ...

  12. ARL Academic Health Sciences Library Statistics 2006-2007

    Science.gov (United States)

    Kyrillidou, Martha, Comp.; Bland, Les, Comp.

    2008-01-01

    This document presents data that describe collections, expenditures, personnel, and services in 65 medical libraries at Association of Research Libraries (ARL) member institutions throughout North America. In 2006-2007, the reporting health sciences libraries held a median of 244,188 volumes, spent a total of $244,188,020, and employed 2,395 FTE…

  13. 76 FR 4823 - Hazardous Waste Management System; Identifying and Listing Hazardous Waste Exclusion

    Science.gov (United States)

    2011-01-27

    ...), in Owosso, Michigan to exclude (or ``delist'') up to 244 cubic yards of wastewater treatment sludge... petitioned EPA to exclude an annual volume of 244 cubic yards of F006 wastewater treatment sludges generated....31. OGAI generates this wastewater treatment sludge from spent solutions that were used for...

  14. Pediatric Palliative Care: A Personal Story

    Medline Plus

    Full Text Available ... 4,244,244 views 1:09:38 Phoebe's Cancer Story - Duration: 7:46. Family A-Fair 621, ... 3:02 Pediatric Palliative Care: helping children with cancer survive and thrive - Duration: 3:29. American Cancer ...

  15. The Road to Market Society

    DEFF Research Database (Denmark)

    Christiansen, Christian O.; Cockburn, Patrick Joseph

    2014-01-01

    Book review of Michael J. Sandel, What Money Can't Buy: The Moral Limits of Markets. London: Penguin Group, 2012, 244 pp., $16.46. ISBN 9781846144714 (hbk).......Book review of Michael J. Sandel, What Money Can't Buy: The Moral Limits of Markets. London: Penguin Group, 2012, 244 pp., $16.46. ISBN 9781846144714 (hbk)....

  16. Nuclear Chemistry Institute, Mainz University. Annual Report 1995

    International Nuclear Information System (INIS)

    The annual report of the Institut fuer Kernchemie addresses inter alia three main research activities. The first belongs to the area of basic research, covering studies in the fields of nuclear fission, chemistry of the super-heavy elements and of heavy-ion reactions extending from the Coulomb barrier to relativistic energies, and nuclear astrophysics in connection with the ''r process''. By means of laser technology, high-precision data could be measured of the ionization energies of berkelium and californium. Studies of atomic clusters in the vacuum of an ionization trap revealed interesting aspects. The second major activity was devoted to the analysis of environmental media, applying inter alia neutron activation analysis and resonance ionization mass spectroscopy (RIMS). The third activity resulted in the development of novel processes, or the enhancement of existing processes or methods, for applications in basic research work and in environmental analytics. Another item of interest is the summarizing report on the operation of the TRIGA research reactor. (orig./SR)

  17. Paul Scherrer Institute Scientific Report 1999. Volume I: Particles and Matter

    International Nuclear Information System (INIS)

    Although originally planned for fundamental research in nuclear physics, the particle beams of pions, muons, protons and neutrons are now used in a large variety of disciplines in both natural science and medicine. The beams at PSI have the world's highest intensities and therefore allow certain experiments to be performed, which would not be possible elsewhere. The highlight of research this year was the first-ever determination of the chemical properties of the superheavy element 107 Bohrium. This was undertaken, by an international team led by H. Gaeggeler of PSI's Laboratory for Radiochemistry. Bohrium was produced by bombarding a Berkelium target with Neon ions from the Injector I cyclotron and six atoms were detected after having passed through an online gas chromatography device. At the Laboratory for Particle Physics the focus has shifted from nuclear physics to elementary particle physics with about a fifty-fifty split between investigations of rare processes or particle decays using the high intensity muon, pion and recently also polarized neutron beams of PSI, and research at the highest energy frontier at CERN (Geneva) and DESY (Hamburg). Important space instrumentation has been contributed by the Laboratory for Astrophysics to the European Space Agency and NASA satellite programmes. The Laboratory for Micro and Nanotechnology continued to focus on research into molecular nanotechnology and SiGeC nanostructures, the latter with the aim of producing silicon based optoelectronics. Progress in 1999 in these topical areas is described in this report. A list of scientific publications in 1999 is also provided

  18. Investigations for the influence of geochemical parameters on the sorption and desorption of lanthanides and uranium onto opalinus clay as potential host rock for a repository

    International Nuclear Information System (INIS)

    The development of a disposal in deep geological formations for radioactive waste is a very important task for the future. The safety assessment for more than a hundred thousand years needs a full understanding of all processes of interaction between the radioactive waste and the surrounded formations. This work contributes to this understanding. The interaction between lanthanides (homologues of the actinides americium, curium and berkelium) / uranium and the host rock opalinus clay under influence of organic substances (NOM) have been analyzed and discussed. The complex system was split into 3 binary basic systems with the following interactions - Interactions between lanthanides / uranium and NOM - Interactions between lanthanides / uranium and the opalinus clay - Interactions between NOM and opalinus clay All binary systems can be influenced by geological parameters like pH, ion strength and competing cations. The sorption / desorption of the lanthanides onto the opalinus clay is analyzed via inductively coupled plasma mass spectrometry. For the investigation of the complexation behavior of metals with NOM we used capillary electrophoresis coupled with inductively coupled plasma mass spectrometry. Under these conditions the chosen model organic humic acid affected the sorption of the lanthanides onto opalinus clay favorably. The smaller organic compounds, which dominate in the composition of the clay organics, remobilized the metals after sorption onto clay and the sorption can be inhibited by NOM. Due to the reduced metal sorption onto Opalinus clay by NOM, a migration through the clay may be possible.

  19. Transformation of Triclosan by Trametes versicolor and Pycnoporus cinnabarinus

    OpenAIRE

    Hundt, Kai; Martin, Dierk; Hammer, Elke; Jonas, Ulrike; Kindermann, Markus Karl; Schauer, Frieder

    2000-01-01

    We investigated the ability of Trametes versicolor and Pycnoporous cinnabarinus to metabolize triclosan. T. versicolor produced three metabolites, 2-O-(2,4,4′-trichlorodiphenyl ether)-β-d-xylopyranoside, 2-O-(2,4,4′-trichlorodiphenyl ether)-β-d-glucopyranoside, and 2,4-dichlorophenol. P. cinnabarinus converted triclosan to 2,4,4′-trichloro-2′-methoxydiphenyl ether and the glucoside conjugate known from T. versicolor. The conjugates showed a distinctly lower cytotoxic and microbicidal activity...

  20. Komisjoni kiuste avaldas Holland valimistulemuse / Arko Olesk

    Index Scriptorium Estoniae

    Olesk, Arko, 1981-

    2004-01-01

    Euroopa Komisjoni keelule ja karistusähvardusele vaatamata avaldasid Hollandi võimud europarlamendi valimiste tulemused, mille kohaselt said valitsevad kristlikud demokraadid 24,4 protsenti ja opositsioonilised sotsiaaldemokraadid 23,6 protsenti häältest

  1. AcEST: DK946138 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU02A01NGRL0011_J16 568 Adiantum capillus-veneris mRNA. clone: YMU02A01NGRL0011_J16. 5' end seq ... NVFIRKVKILKAPKFDIGKLMEVHGDYSEDVGVKL 243 Query: 543 ERP ... 551 +RP Sbjct: 244 DRP 246 >sp|Q42262|RS3A2_ARATH ... VFIRKVKILKAPKFDLGKLMEVHGDYTAEDVGVK 243 Query: 540 VERP ... 551 V+RP Sbjct: 244 VDRP 247 >sp|P33444|RS3A_CATRO ... NVFIRKVKILKAPKFDLGKLMEVHGDYNEDIGTKL 243 Query: 543 ERP ... 551 +RP Sbjct: 244 DRP 246 >sp|Q9CAV0|RS3A1_ARATH ... VFIRKVKILKAPKFDLGKLMDVHGDYSAEDVGVK 243 Query: 540 VERP ... 551 V+RP Sbjct: 244 VDRP 247 >sp|P49397|RS3A_ORYSJ ...

  2. Dicty_cDB: Contig-U00892-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 124 ggattattttaaagaattaaagagatatatatatttncttcatctcttttcaaccaataa 183 Query: 184 attgncaaatgaaaatgtgttaccna...|||||||||||||||| Sbjct: 184 attgncaaatgaaaatgtgttaccnataactcaaaactaaataataatattcnactttgc 243 Query: 244 naaa...aacc 303 Query: 304 cnattttaatggctgncctcccnagcttcnaactantgcttgatattatttananataaa 363 |||||||||||||||||||||||...||||||||||||||||||||||||||||||||||||| Sbjct: 304 cnattttaatggctgncctcccnagcttcnaactantgcttgatattatttananataa...Query: 184 attgncaaatgaaaatgtgttaccnataactcaaaactaaataataatattcnactttgc 243 ||||||||||||||||||||||||||||||||

  3. Characterization of a Novel Radiation-Induced Sarcoma Cell Line

    Czech Academy of Sciences Publication Activity Database

    Lang, J.; Zhu, W.Z.; Nokes, B.; Sheth, S.G.; Novák, Petr; Fuchs, L.; Watts, G.; Futscher, B. W.; Mineyev, N.; Ring, A.

    2015-01-01

    Roč. 111, č. 6 (2015), s. 669-682. ISSN 0022-4790 Institutional support: RVO:60077344 Keywords : Sarcoma * radiation-induced * breast * cancer Subject RIV: FD - Oncology ; Hematology Impact factor: 3.244, year: 2014

  4. Crystallization and preliminary X-ray diffraction studies of infectious bronchitis virus nonstructural protein 9

    OpenAIRE

    Ma, Yanlin; Chen, Cheng; Wei, Lei; Yang, Qingzhu; Liao, Ming; Li, Xuemei

    2010-01-01

    The gene segment encoding avian infectious bronchitis virus nonstructural protein 9 has been cloned and expressed in Escherichia coli. The protein has been crystallized and the crystals diffracted X-rays to 2.44 Å resolution.

  5. Zwischen Gewalt und Toleranz. Die unsichere Existenz der Brüderunität im spätmittelalterlichen Böhmen

    Czech Academy of Sciences Publication Activity Database

    Hlaváček, Petr

    Leipzig: Evangelische Verlagsanstalt, 2014 - (Plasger, G.; Stobbe, H.), s. 237-244 ISBN 978-3-374-03923-4 Institutional support: RVO:67985955 Keywords : Middle Ages * Bohemia * tolerance * violence Subject RIV: AB - History

  6. Structure of filamin A immunoglobulin-like repeat 10 from Homo sapiens

    OpenAIRE

    Page, Richard C; Clark, Jeffrey G.; Misra, Saurav

    2011-01-01

    The structure of immunoglobulin-like repeat 10 from human filamin A solved at 2.44 Å resolution suggests the potential effects of mutations correlated with otopalatodigital syndrome spectrum disorders.

  7. Cestopisné črty v časopisu Poutník

    Czech Academy of Sciences Publication Activity Database

    Vítová, Andrea

    Olomouc: Univerzita Palackého v Olomouci, 2015 - (Hrabal, J.), s. 79-89 ISBN 978-80-244-4876-3 Institutional support: RVO:68378068 Keywords : Czech literature * Travelogue Subject RIV: AJ - Letters, Mass-media, Audiovision

  8. Uranium hydrothermal deposits

    Czech Academy of Sciences Publication Activity Database

    René, Miloš

    New York : Nova Science Publishers, 2012 - (Vasiliev, A.; Sidorov, M.), s. 211-244 ISBN 978-1-62081-207-5 Institutional research plan: CEZ:AV0Z30460519 Keywords : uranium * hydrothermal deposits * uraninite Subject RIV: DB - Geology ; Mineralogy

  9. František Lýsek a lidová píseň

    Czech Academy of Sciences Publication Activity Database

    Toncrová, Marta

    Olomouc: Univerzita Palackého, 2003, s. 47-53. ISBN 80-244-0773-6 Institutional research plan: CEZ:AV0Z9058907 Keywords : folk song * collector * Moravia Subject RIV: AC - Archeology, Anthropology, Ethnology

  10. Německý Mácha, Óda na radost a krize evropské vize

    Czech Academy of Sciences Publication Activity Database

    Pokorný, Martin Z.

    2013-01-01

    Roč. 31, 97-98 (2013), s. 244-251. ISSN 0862-7045 Institutional support: RVO:67985955 Keywords : K. H. Mácha * F. Schiller * A. Mozart * Enlightenment * romanticism Subject RIV: AA - Philosophy ; Religion

  11. Partial genetic characterization of Sedlec virus (Orthobunyavirus, Bunyaviridae)

    Czech Academy of Sciences Publication Activity Database

    Bakonyi, T.; Kolodziejek, J.; Rudolf, Ivo; Berčič, R.; Nowotny, N.; Hubálek, Zdeněk

    2013-01-01

    Roč. 19, October (2013), s. 244-249. ISSN 1567-1348 Institutional support: RVO:68081766 Keywords : Sedlec virus * Leanyer virus * Simbu group * Orthobunyavirus * Acrocephalus Subject RIV: EE - Microbiology, Virology Impact factor: 3.264, year: 2013

  12. K pojmu psychospirituální krize

    Czech Academy of Sciences Publication Activity Database

    Říčan, Pavel

    2012-01-01

    Roč. 56, č. 2 (2012), s. 194-196. ISSN 0009-062X Institutional support: RVO:68081740 Keywords : psychospiritual crisis * spirituality * transpersonal psychology Subject RIV: AN - Psychology Impact factor: 0.244, year: 2012

  13. Miroslav Masák

    Czech Academy of Sciences Publication Activity Database

    Švácha, Rostislav

    [Řevnice]: Arbor vitae, 2012 - (Švácha, R.), s. 244-247 ISBN 978-80-87164-87-7 Institutional support: RVO:68378033 Keywords : architecture * postwar architecture * Liberec Subject RIV: AL - Art, Architecture, Cultural Heritage

  14. Application of Cappilary and Free-Flow Zone Electrophoresis and Isotachophoresis to Analytical and Preparative Separations of Synthetic Peptides

    Czech Academy of Sciences Publication Activity Database

    Kašička, Václav; Prusík, Zdeněk; Barth, Tomislav; Weber, G.; Wagner, H.

    Hamburg : Gesselschaft Deutscher Chemiker (Arbeitskreis Chromatographie), 1993, s. 244. [International Symposium on Column Liquid Chromatography /17./. Hamburg (DB), 09.05.1993-14.05.1993] R&D Projects: GA AV ČR IA45511

  15. Yersinia outer proteins E, H, P, and T differentially target the cytoskeleton and inhibit phagocytic capacity of dendritic cells

    Czech Academy of Sciences Publication Activity Database

    Adkins, Irena; Köberle, M.; Gröbner, S.; Bohn, E.; Autenrieth, I. B.; Borgmann, S.

    2007-01-01

    Roč. 297, - (2007), s. 235-244. ISSN 1438-4221 Institutional research plan: CEZ:AV0Z50200510 Keywords : yersinia * yops * dendritic cells Subject RIV: EC - Immunology Impact factor: 2.524, year: 2007

  16. 40 CFR Appendix D to Part 132 - Great Lakes Water Quality Initiative Methodology for the Development of Wildlife Criteria

    Science.gov (United States)

    2010-07-01

    ... substance which, if not exceeded, should better protect the taxon in question. E. “Tier I wildlife criterion.... American Journal of Physiology. 244:601-606. C. Nagy, K.A. 1987. Field Metabolic Rate and Food...

  17. QTL Information Table: 1009 [Q-TARO

    Lifescience Database Archive (English)

    Full Text Available onomic importance in a recombinant inbred population derived from a subspecific rice cross. TAG Theoretical and Applied Genetics 92, 230-244. http://dx.doi.org/10.1007/s001220050118 ...

  18. Výzkumy zaměřené na cizince v České republice po roce 1989

    Czech Academy of Sciences Publication Activity Database

    Vojtková, Michaela

    2010-01-01

    Roč. 52, č. 4 (2010), s. 230-244. ISSN 0011-8265 Institutional research plan: CEZ:AV0Z70280505 Keywords : Foreigners in the Czech Republic * sociological surveys * international migration Subject RIV: AO - Sociology, Demography

  19. Czech Codifications in the High Middle Ages

    Czech Academy of Sciences Publication Activity Database

    Krafl, Pavel

    Firenze : Firenze University Press, 2014 - (Maffei, P.; Varanini, G.), s. 237-244 ISBN 978-88-6655-632-9 Institutional support: RVO:67985963 Keywords : Bohemia * legal history * codification * High Middle Ages Subject RIV: AB - History

  20. Politische und kirchliche Kontexte der Entstehung des päpstlichen Kollegiums Nepomucenum im Jahre 1929

    Czech Academy of Sciences Publication Activity Database

    Šebek, Jaroslav

    Olomouc : Univerzita Palackého v Olomouci, 2011, s. 107-125 ISBN 978-80-244-2644-0 Institutional support: RVO:67985963 Keywords : religious situation * history * College Nepomucenum Subject RIV: AB - History

  1. K narativnímu pojetí autobiografické paměti: výzkumné možnosti metody čáry života

    Czech Academy of Sciences Publication Activity Database

    Vlčková, Irena; Blatný, Marek

    Olomouc: Univerzita Palackého v Olomouci, 2005, s. 183-199. ISBN 80-244-1159-8 Institutional research plan: CEZ:AV0Z70250504 Keywords : Autobiographical memory * narrative psychology Subject RIV: AN - Psychology

  2. 76 FR 68221 - Notice of Intent To Award-Grant Awards for the Provision of Civil Legal Services to Eligible Low...

    Science.gov (United States)

    2011-11-03

    ... of funding availability on March 30, 2011 (76 FR 17711), and Grant Renewal applications due beginning... Assistance, Inc. Delaware DE-1 Legal Services 686,244 Corporation of Delaware, Inc. MDE Legal Aid Bureau,...

  3. Leaf trace element spectrum in woody plants in south Spain.

    OpenAIRE

    Marañón, Teodoro; Domínguez, María Teresa; Aponte, Cristina; Murillo Carpio, José Manuel; Luis V. García; Villar Montero, Rafael

    2009-01-01

    Poster presentation nº 244. 6th International Symposium on Ecosystem Behaviour BIOGEOMON 2009, 29 June-3 July 2009. The University of Helsinki, Finland. Session 9: Trace element biogeochemistry and ecosystem impact.

  4. Literatura cestopisu zbavená

    Czech Academy of Sciences Publication Activity Database

    Šidák, Pavel

    Olomouc : Univerzita Palackého v Olomouci, 2015 - (Hrabal, J.), s. 29-39 ISBN 978-80-244-4876-3 Institutional support: RVO:68378068 Keywords : Czech literature * Travelogue Subject RIV: AJ - Letters, Mass-media, Audiovision

  5. Drug: D08088 [KEGG MEDICUS

    Lifescience Database Archive (English)

    Full Text Available D08088 Drug Isoaminile (INN); Peracon (TN) C16H24N2 244.1939 244.3752 D08088.gif Antitussive ATC ... assification [BR:br08303] R RESPIRATORY SYSTEM R05 COUGH ... AND COLD PREPARATIONS R05D COUGH ... SUPPRESSANTS, EXC ... L. COMBINATIONS WITH EXPECTORANTS R05DB Other cough ... suppressants R05DB04 Isoaminile D08088 Isoaminile ...

  6. AcEST: BP911471 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000005_D01 583 Adiantum capillus-veneris mRNA. clone: YMU001_000005_D01. BP911471 CL520Co ... GLAVGRSSTDDYLLGKPVEEKKGDDDVTKAAGA-------PGALFVEEKPQSAND TWRK 244 G + D+YLLG+P+++ + K AG PG++F S D K Sbjct: ... GLAVGRSSTDDYLLGKPVEEKKGDDDVTKAAGA-------PGALFVEEKPQSAND TWRK 244 G + D+YLLG+P+++ + + AG PG++F S D K Sbjct: ...

  7. Minor Actinide Burning in Thermal Reactors. A Report by the Working Party on Scientific Issues of Reactor Systems

    International Nuclear Information System (INIS)

    The actinides (or actinoids) are those elements in the periodic table from actinium upwards. Uranium (U) and plutonium (Pu) are two of the principal elements in nuclear fuel that could be classed as major actinides. The minor actinides are normally taken to be the triad of neptunium (Np), americium (Am) and curium (Cm). The combined masses of the remaining actinides (i.e. actinium, thorium, protactinium, berkelium, californium, einsteinium and fermium) are small enough to be regarded as very minor trace contaminants in nuclear fuel. Those elements above uranium in the periodic table are known collectively as the transuranics (TRUs). The operation of a nuclear reactor produces large quantities of irradiated fuel (sometimes referred to as spent fuel), which is either stored prior to eventual deep geological disposal or reprocessed to enable actinide recycling. A modern light water reactor (LWR) of 1 GWe capacity will typically discharge about 20-25 tonnes of irradiated fuel per year of operation. About 93-94% of the mass of uranium oxide irradiated fuel is comprised of uranium (mostly 238U), with about 4-5% fission products and ∼1% plutonium. About 0.1-0.2% of the mass is comprised of neptunium, americium and curium. These latter elements accumulate in nuclear fuel because of neutron captures, and they contribute significantly to decay heat loading and neutron output, as well as to the overall radio-toxic hazard of spent fuel. Although the total minor actinide mass is relatively small - approximately 20-25 kg per year from a 1 GWe LWR - it has a disproportionate impact on spent fuel disposal, and thus the longstanding interest in transmuting these actinides either by fission (to fission products) or neutron capture in order to reduce their impact on the back end of the fuel cycle. The combined masses of the trace actinides actinium, thorium, protactinium, berkelium and californium in irradiated LWR fuel are only about 2 parts per billion, which is far too low for

  8. Radiological safety considerations in the design and operation of the Oak Ridge National Laboratory Transuranium Research Laboratory (TRL)

    International Nuclear Information System (INIS)

    The Transuranium Research Laboratory (TRL) is the central facility at Oak Ridge National Laboratory (ORNL) for chemical and physical research involving transuranium elements. Transuranium Research Laboratory investigations are about equally divided between studies of inorganic and structural chemistry of the heavy elements and nuclear structure and properties of their isotopes. Elements studied include neptunium, plutonium, americium, curium, berkelium, californium, and einsteinium, each in microgram-to-gram quantities depending upon availability and experimental requirements. This paper describes an eight-step safety procedure that is followed in planning and approving individual research projects. This procedure should provide an ''optimum margin of safety'' and should permit the accomplishment of successful research. Steps in the procedure are as follows: (1) Evaluate the external and internal exposure radioactivity hazards. (2) Establish any concurrent conventional industrial safety risks that may be encountered in the operation. (3) Consider, in the proper perspective, the potential consequences of possible interactions of radioactivity risks with associated industrial safety risks and problems, applying the concepts of credibility and probability. (4) Design equipment, develop operating procedures, and ensure the proficiency of operating personnel to provide necessary safeguards to accomplish programme objectives with minimum risks and minimum operational constraints. (5) Ensure that necessary safeguards are, in fact, incorporated in equipment and procedures before actual work is begun. (6) Ensure that appropriate monitoring instrumentation, surveillance, and other necessary protective technical and craft support are available and are used during operation. (7) Make certain that appropriate measures exist to manage credible radiation accidents and other emergencies properly. (8) Inform others, in sufficient detail, of the success or deficiency of design

  9. Radiochemical studies of neutron deficient actinide isotopes

    International Nuclear Information System (INIS)

    The production of neutron deficient actinide isotopes in heavy ion reactions was studied using alpha, gamma, x-ray, and spontaneous fission detection systems. A new isotope of berkelium, 242Bk, was produced with a cross-section of approximately 10 μb in reactions of boron on uranium and nitrogen on thorium. It decays by electron capture with a half-life of 7.0 +- 1.3 minutes. The alpha-branching ratio for this isotope is less than 1% and the spontaneous fission ratio is less than 0.03%. Studies of (Heavy Ion, pxn) and (Heavy Ion, αxn) transfer reactions in comparison with (Heavy ion, xn) compound nucleus reactions revealed transfer reaction cross-sections equal to or greater than the compound nucleus yields. The data show that in some cases the yield of an isotope produced via a (H.I.,pxn) or (H.I.,αxn) reaction may be higher than its production via an xn compound nucleus reaction. These results have dire consequences for proponents of the ''Z1 + Z2 = Z/sub 1+2/'' philosophy. It is no longer acceptable to assume that (H.I.,pxn) and (H.I.,αxn) product yields are of no consequence when studying compound nucleus reactions. No evidence for spontaneous fission decay of 228Pu, 230Pu, 232Cm, or 238Cf was observed indicating that strictly empirical extrapolations of spontaneous fission half-life data is inadequate for predictions of half-lives for unknown neutron deficient actinide isotopes

  10. Transuranium Processing Plant semiannual report of production, status, and plans for period ending December 31, 1975

    Energy Technology Data Exchange (ETDEWEB)

    King, L.J.; Bigelow, J.E.; Collins, E.D.

    1976-10-01

    Between July 1, 1975, and December 31, 1975, maintenance was conducted at TRU for a period of three months, 295 g of curium oxide (enough for approximately 26 HFIR targets) were prepared, 100 mg of high-purity /sup 248/Cm, were separated from /sup 252/Cf that had been purified during earlier periods, 11 HFIR targets were fabricated, and 28 product shipments were made. No changes were made in the chemical processing flowsheets normally used at TRU during this report period. However, three equipment racks were replaced (with two new racks) during this time. In Cubicle 6, the equipment replaced was that used to decontaminate the transplutonium elements from rare earth fission products and to separate curium from the heavier elements by means of the LiCl-based anion-exchange process. In Cubicle 5, the equipment used to separate the transcurium elements by high-pressure ion exchange and to purify berkelium by batch solvent extraction was replaced. Two neutron sources were fabricated, bringing the total fabricated to 79. One source that had been used in a completed project was returned to the TRU inventory and is available for reissue. Three sources, for which no further use was foreseen, were processed to isolate and recover the ingrown /sup 248/Cm and the residual /sup 252/Cf. Eight pellets, each containing 100 ..mu..g of high-purity /sup 248/Cm were prepared for irradiation in HFIR to study the production of /sup 250/Cm. The values currently being used for transuranium element decay data and for cross-section data in planning irradiation-processing cycles, calculating production forecasts, and assaying products are tabulated.

  11. Radiochemical studies of neutron deficient actinide isotopes

    Energy Technology Data Exchange (ETDEWEB)

    Williams, K.E.

    1978-04-01

    The production of neutron deficient actinide isotopes in heavy ion reactions was studied using alpha, gamma, x-ray, and spontaneous fission detection systems. A new isotope of berkelium, /sup 242/Bk, was produced with a cross-section of approximately 10 ..mu..b in reactions of boron on uranium and nitrogen on thorium. It decays by electron capture with a half-life of 7.0 +- 1.3 minutes. The alpha-branching ratio for this isotope is less than 1% and the spontaneous fission ratio is less than 0.03%. Studies of (Heavy Ion, pxn) and (Heavy Ion, ..cap alpha..xn) transfer reactions in comparison with (Heavy ion, xn) compound nucleus reactions revealed transfer reaction cross-sections equal to or greater than the compound nucleus yields. The data show that in some cases the yield of an isotope produced via a (H.I.,pxn) or (H.I.,..cap alpha..xn) reaction may be higher than its production via an xn compound nucleus reaction. These results have dire consequences for proponents of the ''Z/sub 1/ + Z/sub 2/ = Z/sub 1+2/'' philosophy. It is no longer acceptable to assume that (H.I.,pxn) and (H.I.,..cap alpha..xn) product yields are of no consequence when studying compound nucleus reactions. No evidence for spontaneous fission decay of /sup 228/Pu, /sup 230/Pu, /sup 232/Cm, or /sup 238/Cf was observed indicating that strictly empirical extrapolations of spontaneous fission half-life data is inadequate for predictions of half-lives for unknown neutron deficient actinide isotopes.

  12. Paul Scherrer Institute Scientific Report 1999. Volume I: Particles and Matter

    Energy Technology Data Exchange (ETDEWEB)

    Gobrecht, J.; Gaeggeler, H.; Herlach, D.; Junker, K.; Kettle, P.-R.; Kubik, P.; Zehnder, A. [eds.

    2000-07-01

    lthough originally planned for fundamental research in nuclear physics, the particle beams of pions, muons, protons and neutrons are now used in a large variety of disciplines in both natural science and medicine. The beams at PSI have the world's highest intensities and therefore allow certain experiments to be performed, which would not be possible elsewhere. The highlight of research this year was the first-ever determination of the chemical properties of the superheavy element {sup 107} Bohrium. This was undertaken, by an international team led by H. Gaeggeler of PSI's Laboratory for Radiochemistry. Bohrium was produced by bombarding a Berkelium target with Neon ions from the Injector I cyclotron and six atoms were detected after having passed through an online gas chromatography device. At the Laboratory for Particle Physics the focus has shifted from nuclear physics to elementary particle physics with about a fifty-fifty split between investigations of rare processes or particle decays using the high intensity muon, pion and recently also polarized neutron beams of PSI, and research at the highest energy frontier at CERN (Geneva) and DESY (Hamburg). Important space instrumentation has been contributed by the Laboratory for Astrophysics to the European Space Agency and NASA satellite programmes. The Laboratory for Micro and Nanotechnology continued to focus on research into molecular nanotechnology and SiGeC nanostructures, the latter with the aim of producing silicon based optoelectronics. Progress in 1999 in these topical areas is described in this report. A list of scientific publications in 1999 is also provided.

  13. Actinide production in the reaction of heavy ions with curium-248

    International Nuclear Information System (INIS)

    Chemical experiments were performed to examine the usefulness of heavy ion transfer reactions in producing new, neutron-rich actinide nuclides. A general quasi-elastic to deep-inelastic mechanism is proposed, and the utility of this method as opposed to other methods (e.g. complete fusion) is discussed. The relative merits of various techniques of actinide target synthesis are discussed. A description is given of a target system designed to remove the large amounts of heat generated by the passage of a heavy ion beam through matter, thereby maximizing the beam intensity which can be safely used in an experiment. Also described is a general separation scheme for the actinide elements from protactinium (Z=91) to mendelevium (Z=101), and fast specific procedures for plutonium, americium and berkelium. The cross sections for the production of several nuclides from the bombardment of 248Cm with 18O, 86Kr and 136Xe projectiles at several energies near and below the Coulomb barrier were determined. The results are compared with yields from 48Ca and 238U bombardments of 248Cm. Simple extrapolation of the product yields into unknown regions of charge and mass indicates that the use of heavy ion transfer reactions to produce new, neutron-rich above-target species is limited. The substantial production of neutron-rich below-target species, however, indicates that with very heavy ions like 136Xe and 238U the new species 248Am, 249Am and 247Pu should be produced with large cross sections from a 248Cm target. A preliminary, unsuccessful attempt to isolate 247Pu is outlined. The failure is probably due to the half life of the decay, which is calculated to be less than 3 minutes. The absolute gamma ray intensities from 251Bk decay, necessary for calculating the 251Bk cross section, are also determined

  14. The pH-sensitive structure of the C-terminal domain of voltage-gated proton channel and the thermodynamic characteristics of Zn2+ binding to this domain

    International Nuclear Information System (INIS)

    Highlights: • The α-helical content of the C-terminus is decreased with a pH increase. • The thermostability of the C-terminus is decreased with a pH increase. • Zn2+ binds to His244 and His266 residues within the C-terminal domain. • The binding of Zn2+ to His244 residue is an endothermic heat reaction. • The binding of Zn2+ to His266 residue is an exothermic heat reaction. - Abstract: The voltage-gated proton channel Hv1 is strongly sensitive to Zn2+. The H+ conduction is decreased at a high concentration of Zn2+ and Hv1 channel closing is slowed by the internal application of Zn2+. Although the recent studies demonstrated that Zn2+ interacts with the intracellular C-terminal domain, the binding sites and details of the interaction remain unknown. Here, we studied the pH-dependent structural stability of the intracellular C-terminal domain of human Hv1 and showed that Zn2+ binds to His244 and His266 residues. The thermodynamics signature of Zn2+ binding to the two sites was investigated by isothermal titration calorimetry. The binding of Zn2+ to His244 (mutant H266A) and His266 (mutant H244A) were an endothermic heat reaction and an exothermic heat reaction, respectively

  15. Chelation of curium in the adult baboon using Ca- and Zn-DTPA

    International Nuclear Information System (INIS)

    The effectiveness of Ca-DTPA in removing internally deposited Cm-243, 244 was tested in the baboon at 1.5 and 8-month intervals between injection of Cm-243, 244 and treatment. Four young adult female baboons were injected IV with the radionuclides in citrate form. Ca-DTPA was administered three times in five days on alternate days beginning at 1.5 months in one baboon and at 8 months in another. The two remaining control baboons were administered physiological saline only. In vivo counting was performed to determine the total body, skeletal, and liver retention before, during and after chelation therapy. All urine and feces were collected and the Cm-243, 244 content of each was determined daily. A comparison of the efficacy of chelate therapy with Cm-243, 244 and Am-241 when treatment was delayed for 1.5 months after Am-241 injection showed that Ca-DTPA is more effective in enhancing the excretion of established burdens of Cm-243, 244 than that of Am-241 by approximately 34 percent in the urine and 87 percent in the feces during the first seven days after initiation of therapy

  16. 粘结型粉末氯丁橡胶的制备方法%Preparation of bonding powdered chloroprene rubber

    Institute of Scientific and Technical Information of China (English)

    赵志超; 马朋高; 郑聚成; 李波; 胡育林; 秦传高

    2011-01-01

    采用直接凝聚法制备了粉末氯丁橡胶PCR244,并讨论了凝聚剂种类和用量、隔离剂种类和用量、凝聚温度以及凝聚体系的pH值对PCR244粉末化效果的影响.研究表明,在低温条件下凝聚所得粉末氯丁橡胶的成粉率高,溶解速率快,且粘结强度高.%Powdered chloroprene rubber PCR244 was prepared by direct coagulation process,and the effects of kind and amount of coagulating agent, kind and amount of separating agent,coagulation temperature and pH value of coagulating system on powdered ratio of chloroprene rubber PCR244 were studied. The results showed that powdered ratio and bond strength of powdered chloroprene rubber PCR244 obtained under low temperature were higher,and dissolution rate of that was faster.

  17. Solvent Extraction of Zr(IV) from Nitric Acid Solutions using CYANEX 272, CYANEX 301 and CYANEX 302

    International Nuclear Information System (INIS)

    The extraction of Zr(IV) from nitric acid solutions using CYANEX 272 (bis(2,4,4-trimethylpentyl) phosphinic acid), bis (2,4,4-trimethylpentyl) dithio phosphinic acid (CYANEX 301) or (bis(2,4,4-trimethylpentyl) mono phosphinic acid (CYANEX 302) in kerosene has been investigated. The various factors affecting the extraction process of Zr(IV) by each of the investigated extractants such as contact time, loading capacity, extractant, metal ion and nitric acid concentration as well as temperature, are separately investigated. The stripping of the extracted zirconium from loaded organic solutions is also carried out using different stripping reagents. The results are compared and the potential advantages of each extractant over the others are exploited in terms of higher loading capacity and selectivity, less nitric acid extraction, equilibration period and reagent concentration

  18. Extraction and stripping of rare earths using mixtures of acidic phosphorusbased reagents

    Institute of Scientific and Technical Information of China (English)

    WANG Xianglan; LI Wei; LI Deqian

    2011-01-01

    Studies were carried out on the extraction characters of trivalent rare earths from chloride solutions using organophosphorus acids 2-ethylhexylphosphonic acid mono-(2-ethylhexyl) ester (HEHEHP) combined with [di-(2-ethylhexyl)-phosphoric acid (HDEHP), isopropylphosphonic acid l-hexyl-4-ethyloctyl ester (HHEOIPP), bis(2,4,4-trimethylpentyl)-phosphinic acid (Cyanex 272), bis(2,4,4-trimethypen-tyl)-monothiophosphinic acid (Cyanex 302) or bis(2,4,4-trimethypentyl)-dithiophosphinic acid (Cyanex 301)] as extractants. The effect of the equilibrium aqueous acidity on the extraction was studied. According to the corresponding separation factors for adjacent pairs of rare earths,it could be concluded that HEHEHP and Cyanex 272 could be employed for the separation of Tm(Ⅲ), Yb(Ⅲ), Lu(Ⅲ) from the other rare earths. Taking Yb(Ⅲ) as an example, based on the different stripping acid, the potential of the stripping was estimated.

  19. Golden Eagle mortality at a utility-scale wind energy facility near Palm Springs, California

    Science.gov (United States)

    Lovich, Jeffrey E.

    2015-01-01

    Golden Eagle (Aquila chrysaetos) mortality associated with wind energy turbines and infrastructure is under-reported and weakly substantiated in the published literature. I report two cases of mortality at a utility-scale renewable energy facility near Palm Springs, California. The facility has been in operation since 1984 and included 460 65KW turbines mounted on 24.4 m or 42.7 m lattice-style towers with 8 m rotor diameters. One mortality event involved a juvenile eagle that was struck and killed by a spinning turbine blade on 31 August, 1995. The tower was 24.4 m high. The other involved an immature female that was struck by a spinning blade on another 24.4 m tower on 17 April, 1997 and was later euthanized due to the extent of internal injuries. Other raptor mortalities incidentally observed at the site, and likely attributable to turbines, included three Red-tailed Hawks (Buteo jamaicensis) found near turbines.

  20. Combined influence of teichoic acids from Staphylococcus aureus and heterometallik Cu/Cd ethylenediamine complex on peritoneal macrophages and tumor cells.

    Science.gov (United States)

    Nikulina, V V; Garmanchuk, L V; Senchylo, N V; Nikolaenko, T V; Dzhus, O I; Ostapchenko, L I; Khranovska, N M

    2014-01-01

    We investigated the effects of teichoic acid (TA) from Staphylococcus aureus Wood 46 on tumor growth and metastasis of the experimental Lewis lung carcinoma (LLC) in mice. Intranasal administration of TA alone aggravated both tumor growth and metastasis, whereas combined administration of TA with a synthetic bimetallic (copper : cadmium) ethylene diamine complex PO244 resulted in pronounced antitumor and antimetastatic effects. The group of animals subjected to the combined treatment with TA and PO244 manifested the highest degree of lymphocyte infiltration into the tumor tissue, compared to the control group and those exposed to TA or PO244 alone. Moreover, the combined treatment negatively affected the adhesive properties of peritoneal macrophages in the LLC bearing mice. Co-cultivation of the isolated macrophages with primary LLC cultures revealed significant (p < 0.05) cytotoxic and cytostatic effects, detected as an increased level of apoptosis and a reduced fraction of replicating cells. PMID:25536823

  1. Sm-Nd-Pu timepieces in the Angra dos Reis meteorite

    International Nuclear Information System (INIS)

    Sm-Nd systematics in pyroxene and phosphate mineral separates of Angra dos Reis have been studied. A pyroxene-phosphate internal isochron age of T2=4.55+-0.04 AE is obtained, in excellent agreement with reported Pb-Pb ages. 142Nd/144Nd ratios in pyroxene samples are systematically larger than those in phosphates by 6 parts in 105. This variation is tentatively assigned to a radiogenic contribution from extinct 146Sm. Fission xenon components in pyroxene and phosphate separates are characterized by discrete ratios of fission/spallation and evidence is presented for a third ratio in celsian. It is shown that this characteristic is due to a close association of 244Pu with the light REE. Computed ratios 244Pu/Nd are the same in pyroxene and phosphate separates, but 244Pu/238U and 244Pu/232Th ratios are not. Taking the fission xenon retention age to be 4.55 AE, an abundance ratio 244Pu/Nd=1.5x10-4 (or an atomic ratio 244Pu/150Nd=1.6x10-3) is obtained at this time and in the region of the solar system where the Angra dos Reis parent body formed. The exposure age of Angra dos Reis, as obtained by the 81Kr-83Kr method is 55.5+-1.2 m.y. Neutron capture during the 55.5-m.y. exposure to cosmic rays increased the ratio 150Sm/149Sm in Angra dos Reis by 6 parts in 104. (Auth.)

  2. New data on transuranium elements in the ecosystem of the Yenisei river floodplain

    Energy Technology Data Exchange (ETDEWEB)

    Bolsunovsky, A. [Russian Academy of Sciences, Siberian Branch, Krasnoyarsk (Russian Federation). Inst. of Biophysics; Ermakov, A.; Sobolev, A. [SIA ' RADON' , Moscow (Russian Federation)

    2007-07-01

    The aim of the study is to investigate levels of transuranium elements in the ecosystem of the Yenisei river floodplain in the vicinity of the Mining-and-Chemical Combine of Rosatom. For the first time, the transuranium isotopes {sup 243,244}Cm have been detected in sediment, floodplain soil, and a berry shrub (Ribes nigrum - the blackcurrant) in the floodplain of the Yenisei river. The highest level of curium isotopes registered in the sediment of the Yenisei river is 21.4Bq/kg (dry), which is more than twice higher than maximum curium levels reported for soils sampled not far from the Chernobyl Nuclear Plant. Blackcurrant plants growing on radioactively contaminated soils contain the same transuranium elements as the soil (plutonium isotopes, americium, and curium). The highest activity concentrations of all transuranic elements have been found in ashed roots of the blackcurrant plants: {sup 239,240}Pu - 9.3Bq/kg, {sup 241}Am - 6.9Bq/kg, and {sup 243,244}Cm - 1.8Bq/kg. The highest soil-plant transfer factor (TF) for {sup 243,244}Cm is determined for roots - 0.073; the TF of {sup 243,244}Cm in berries is 0.027. The TF for {sup 239,240}Pu in berries is 0.006, which is several times lower than the TF for {sup 243,244}Cm. Analysis of our results and the literature data suggests that TFs for {sup 243,244}Cm are higher than those for {sup 239,240}Pu and {sup 241}Am. (orig.)

  3. Cloned defective interfering influenza virus protects ferrets from pandemic 2009 influenza A virus and allows protective immunity to be established.

    Directory of Open Access Journals (Sweden)

    Nigel J Dimmock

    Full Text Available Influenza A viruses are a major cause of morbidity and mortality in the human population, causing epidemics in the winter, and occasional worldwide pandemics. In addition there are periodic outbreaks in domestic poultry, horses, pigs, dogs, and cats. Infections of domestic birds can be fatal for the birds and their human contacts. Control in man operates through vaccines and antivirals, but both have their limitations. In the search for an alternative treatment we have focussed on defective interfering (DI influenza A virus. Such a DI virus is superficially indistinguishable from a normal virus but has a large deletion in one of the eight RNAs that make up the viral genome. Antiviral activity resides in the deleted RNA. We have cloned one such highly active DI RNA derived from segment 1 (244 DI virus and shown earlier that intranasal administration protects mice from lethal disease caused by a number of different influenza A viruses. A more cogent model of human influenza is the ferret. Here we found that intranasal treatment with a single dose of 2 or 0.2 µg 244 RNA delivered as A/PR/8/34 virus particles protected ferrets from disease caused by pandemic virus A/California/04/09 (A/Cal; H1N1. Specifically, 244 DI virus significantly reduced fever, weight loss, respiratory symptoms, and infectious load. 244 DI RNA, the active principle, was amplified in nasal washes following infection with A/Cal, consistent with its amelioration of clinical disease. Animals that were treated with 244 DI RNA cleared infectious and DI viruses without delay. Despite the attenuation of infection and disease by DI virus, ferrets formed high levels of A/Cal-specific serum haemagglutination-inhibiting antibodies and were solidly immune to rechallenge with A/Cal. Together with earlier data from mouse studies, we conclude that 244 DI virus is a highly effective antiviral with activity potentially against all influenza A subtypes.

  4. Dicty_cDB: CFE467 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CF (Link to library) CFE467 (Link to dictyBase) - G21752 DDB0187369 Contig-U11569-1 CFE467P (Lin ... 5e-63 BC114556_1( BC114556 |pid:none) Homo sapiens thyroid ... hormone recep... 244 5e-63 BC113891_1( BC113891 |p ... id:none) Homo sapiens thyroid ... hormone recep... 244 5e-63 BC105889_1( BC105889 |p ... id:none) Rattus norvegicus thyroid ... hormone ... 243 9e-63 BC100624_1( BC100624 |pid:no ... ne) Rattus norvegicus thyroid ... hormone ... 243 9e-63 BC088304_1( BC088304 |pid:no ...

  5. Distinctiveness in chromosomal behaviour in interspecific hybrid genotypes of cotton

    OpenAIRE

    A.W. More and U.G. Kulkarni

    2010-01-01

    Cytological studies in interspecific hybrid derivatives of cotton viz., IS-244/4/1 and IS-181/7/1 obtained in BC1F8generation of trispecies cross of [ (G. hirsutum x G. barbadanse )x G. arboreum] was carried out to find out thechromosome behaviour. During the meiosis variation in chromosome no. from 26 to 31 in IS-181/7/1 and 19 to 49 inIS244/4/1 was observed against the normal choromosomal behaviour of G. arboretum (2n == 26)and G. hirsutum (2n=4x=52).Chromosome pairing revealed the presence...

  6. EST Table: FS918452 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available FS918452 E_FL_fufe_44G17_F_0 10/09/28 46 %/244 aa ref|XP_975194.1| PREDICTED: similar to something...l|GB19080-PA 10/09/10 46 %/244 aa gi|91081571|ref|XP_975194.1| PREDICTED: similar to something about silencing protein 10 [Tribolium castaneum] FS937283 fufe ... ... about silencing protein 10 [Tribolium castaneum] gb|EFA01562.1| hypothetical protein TcasGA2...93 aa AGAP002960-PA Protein|2R:30130647:30132122:-1|gene:AGAP002960 10/09/10 40 %/253 aa gnl|Ame

  7. Fabrication and stability of fiber bragg gratings for WDM applications using a 266 nm cw-laser

    DEFF Research Database (Denmark)

    Deyerl, Hans-Jürgen; Sørensen, Henrik Rokkjær; Jensen, Jesper Bo Damm;

    2003-01-01

    Diode pumped continuous wave all solid state UV-lasers operating at 266 nm offer an interesting alternative to frequency doubled argon ion lasers. We compare photosensitivity, UV-writing of Bragg gratings and thermal decay at 244, 257 and 266 nm.......Diode pumped continuous wave all solid state UV-lasers operating at 266 nm offer an interesting alternative to frequency doubled argon ion lasers. We compare photosensitivity, UV-writing of Bragg gratings and thermal decay at 244, 257 and 266 nm....

  8. Preparation of powdered adhesiVe type chloroprene rubber

    Institute of Scientific and Technical Information of China (English)

    朱家顺; 王炼石; 梁启浩

    2003-01-01

    研究了包覆剂对黏接型氯丁胶乳(CR 244)包覆性能的影响,并通过扫描电子显微镜研究了所得粉末橡胶的微观结构.结果表明,包覆剂用量大于15份(质量)时,粒径不大于0.9 mm的试样质量分数大于99%.粉末CR 244中存在许多孔洞,使得试样易于干燥和溶解.

  9. Independent Verification of Element 114 Production in the 48Ca+242Pu Reaction

    International Nuclear Information System (INIS)

    Independent verification of the production of element 114 in the reaction of 244-MeV 48Ca with 242Pu is presented. Two chains of time- and position-correlated decays have been assigned to 286114 and 287114. The observed decay modes, half-lives, and decay energies agree with published results. The measured cross sections at a center-of-target energy of 244 MeV for the 242Pu(48Ca,3-4n)287,286114 reactions were 1.4-1.2+3.2 pb each, which are lower than the reported values.

  10. On the Consistency of an Estimator for Hierarchical Archimedean Copulas

    Czech Academy of Sciences Publication Activity Database

    Górecki, J.; Hofert, M.; Holeňa, Martin

    Olomouc : Palacký University, 2014 - (Talašová, J.; Stoklasa, J.; Talášek, T.), s. 239-244 ISBN 978-80-244-4209-9. [MME 2014. International Conference Mathematical Methods in Economics /32./. Olomouc (CZ), 10.09.2014-12.09.2014] R&D Projects: GA ČR GA13-17187S Grant ostatní: Slezská univerzita v Opavě(CZ) SGS/21/2014 Institutional support: RVO:67985807 Keywords : hierarchical Archimedean copula * Kendall distribution function * parameter estimation * structure determination * consistency Subject RIV: IN - Informatics, Computer Science

  11. 氯霉素类三甲基硅衍生物的质谱特征及其残留监测

    Institute of Scientific and Technical Information of China (English)

    贺利民; 曾振灵; 刘雅红; 陈建新; 黄显会

    2004-01-01

    Mass characteristics of TMS derivative of chloramphenicol, florfenicol,and thiamphenicol were interpreted manually, respectively. Then SIM mode was performed at m/z 225, m/z 242, m/z 244, m/z 361 for CAP, m/z 178, m/z 257, m/z 259, m/z 394 for FF,and m/z 242, m/z 244, m/z 257, m/z 330 for TAP. A sensitive, reproducible gas chromatographic-mass spectrometric method was developed for simultaneous monitoring residues of fenicols in pork and tissues.

  12. Comparison of fission and capture cross sections of minor actinides

    CERN Document Server

    Nakagawa, T

    2003-01-01

    The fission and capture cross sections of minor actinides given in JENDL-3.3 are compared with other evaluated data and experimental data. The comparison was made for 32 nuclides of Th-227, 228, 229, 230, 233, 234, Pa-231, 232, 233, U-232, 234, 236, 237, Np-236, 237, 238, Pu-236, 237, 238, 242, 244, Am-241, 242, 242m, 243, Cm-242, 243, 244, 245, 246, 247 and 248. Given in the present report are figures of these cross sections and tables of cross sections at 0.0253 eV and resonance integrals.

  13. Drug: D00029 [KEGG MEDICUS

    Lifescience Database Archive (English)

    Full Text Available utic category of drugs in Japan [BR:br08301] 3 Agents affecting metabolism 31 Vitamins 319 Miscellaneous vitamins... 3190 Miscellaneous vitamins D00029 Biotin (JP16/USP/INN) Anatomical Therapeutic Chemi...AIN VITAMIN PREPARATIONS A11HA Other plain vitamin preparations A11HA05 Biotin D00029 Biotin (JP16/USP/INN) ...D00029 Drug Biotin (JP16/USP/INN); Bioepiderm (TN) C10H16N2O3S 244.0882 244.3106 D00029.gif Vitamin Sam...e as: C00120 Therapeutic category: 3190 ATC code: A11HA05 Vitamin B7 (Vitamin H) Therape

  14. Comparison of fission and capture cross sections of minor actinides

    International Nuclear Information System (INIS)

    The fission and capture cross sections of minor actinides given in JENDL-3.3 are compared with other evaluated data and experimental data. The comparison was made for 32 nuclides of Th-227, 228, 229, 230, 233, 234, Pa-231, 232, 233, U-232, 234, 236, 237, Np-236, 237, 238, Pu-236, 237, 238, 242, 244, Am-241, 242, 242m, 243, Cm-242, 243, 244, 245, 246, 247 and 248. Given in the present report are figures of these cross sections and tables of cross sections at 0.0253 eV and resonance integrals. (author)

  15. Prompt neutron multiplicities for the transplutonium nuclides

    International Nuclear Information System (INIS)

    The direct determination of the average prompt neutron emission values is reviewed, and a method of comparing different sites of neutron emission multiplicity distribution values is described. Measured and recommended values are tabulated for these nuclides: 241Am, 242Am, 242Cm, 243Cm, 244Cm, 246Cm, 247Cm, 248Cm, 250Cm, 245Cm, 249Bk, 246Cf, 249Cf, 250Cf, 252Cf, 254Cf, 251Cf, 253Es, 254Es, 244Fm, 246Fm, 255Fm, 252No, 254Fm, 256Fm, 257Fm. 59 refs., 24 tabs

  16. Čeština „dlouhého 16. století“: zdroje spisovné normy

    Czech Academy of Sciences Publication Activity Database

    Vykypělová, Taťána

    Olomouc : Univerzita Palackého v Olomouci, 2013 - (Dittmann, R.; Uličný, O.), s. 41-63 ISBN 978-80-244-3549-7 Institutional support: RVO:68378092 Keywords : Czech language * Czech Grammar Subject RIV: AI - Linguistics

  17. Svět v perspektivě logocentrismu

    Czech Academy of Sciences Publication Activity Database

    Parusniková, Zuzana

    Olomouc: Univerzita Palackého v Olomouci. Cyrilometodějská teologická fakulta, 2009 - (Nejeschleba, T.; Floss, P.; Michalík, J.; Stehura, E.), s. 109-129 ISBN 978-80-244-2438-5 Institutional research plan: CEZ:AV0Z90090514 Keywords : logocentrism * postmodernism * philosophy Subject RIV: AA - Philosophy ; Religion

  18. Gclust Server: 87214 [Gclust Server

    Lifescience Database Archive (English)

    Full Text Available 87214 SCE_YDR364C=CDC40 Cluster Sequences Related Sequences(244) 455 Pre-mRNA splicing factor, important...quence length 455 Representative annotation Pre-mRNA splicing factor, important for catalytic step II of pre

  19. Natural Formation and Degradation of Chloroacetic Acids and Volatile Organochlorines in Forest Soil

    Czech Academy of Sciences Publication Activity Database

    Laturnus, F.; Fahimi, I.; Gryndler, Milan; Hartmann, A.; Heal, M. R.; Matucha, M.; Schöler, H. F.; Schroll, R.; Svensson, T.

    2005-01-01

    Roč. 12, č. 4 (2005), s. 233-244. ISSN 0944-1344 Institutional research plan: CEZ:AV0Z50200510 Keywords : chloroacetic acids * degradation * fores decline Subject RIV: EE - Microbiology, Virology Impact factor: 1.518, year: 2005

  20. Immunochemical detection of the crustacean cardioactive peptide in the cephalic ganglia cockroaches (Blattodea: Blattidae)

    Czech Academy of Sciences Publication Activity Database

    Gladysz, M.; Guzik, J.; Sehadová, Hana; Baran, B.; Bembenek, J.; Dolezych, B.

    2015-01-01

    Roč. 112, č. 2 (2015), s. 235-244. ISSN 1210-5759 Institutional support: RVO:60077344 Keywords : Blattodea * Periplaneta americana * Gromphadorhina portentosa Subject RIV: ED - Physiology Impact factor: 0.975, year: 2014 http://www.eje.cz/corproof.php?tartkey=eje-000000-0111#.VRVB0PmG8mM

  1. TDI Is in Short Supply

    Institute of Scientific and Technical Information of China (English)

    2007-01-01

    @@ Market price rise in 2006 The apparent consumption of TDI (toluene diisocyanate) in China was around 377 thousand tons in 2006, an increase of only 2.44% over 2005-a big reduction in growth. The outputof TDI was 132 thousand tons in 2006 and the self-sufficiency rate was only 35%.

  2. SAH Gene Variants Revisited in the European Project on Genes in Hypertension

    Czech Academy of Sciences Publication Activity Database

    Tikhonoff, V.; Staessen, J.A.; Kuznetsova, T.; Thijs, L.; Hasenkamp, S.; Stolarz, K.; Seidlerová, J.; Filipovský, J.; Nikitin, Y.; Peleška, Jan; Kawecka-Jaszcz, K.; Casiglia, E.; Brand-Herrmann, S.M.; Brand, E.

    2008-01-01

    Roč. 26, č. 2 (2008), s. 244-250. ISSN 0263-6352 Institutional research plan: CEZ:AV0Z10300504 Keywords : body mass index * hypertension * population study * SAH gene * serum lipids Subject RIV: FA - Cardiovascular Diseases incl. Cardiotharic Surgery Impact factor: 5.132, year: 2008

  3. Lokální hudby v globální vesnici. Etnomuzikologie mezi voskovým válečkem a internetem

    Czech Academy of Sciences Publication Activity Database

    Kratochvíl, Matěj

    Olomouc: Univerzita Palackého v Olomouci, 2007 - (Poledňák, I.), s. 127-138 ISBN 978-80-244-1809-4 Institutional research plan: CEZ:AV0Z90580513 Keywords : traditional music * technology * internet * recording * ethnomusicology Subject RIV: AC - Archeology, Anthropology, Ethnology

  4. Hlučná samota jako obraz světa

    Czech Academy of Sciences Publication Activity Database

    Zumr, Josef

    Praha: Filosofia, 2006 - (Cosentino, A.; Jankovič, M.; Zumr, J.), s. 79-85 ISBN 80-7007-244-X. [Kolem Bohumila Hrabala. Udine (IT), 27.10.2005-29.10.2005] Institutional research plan: CEZ:AV0Z90090514 Keywords : Hrabal Bohumil * Too noisy loneliness * philosophical signification Subject RIV: AA - Philosophy ; Religion

  5. Avantgarda v situaci moderny a "po" moderně

    Czech Academy of Sciences Publication Activity Database

    Kanda, Roman

    Olomouc: Univerzita Palackého v Olomouci, 2013 - (Kubíček, T.; Wiendl, J.), s. 330-337 ISBN 978-80-244-3418-6 Institutional support: RVO:68378068 Keywords : literature * avant-garde * modernism Subject RIV: AJ - Letters, Mass-media, Audiovision

  6. Multihorizontální analýza kritických momentů a pracovním životě herců

    Czech Academy of Sciences Publication Activity Database

    Lindénová, J.; Čermák, Ivo

    Olomouc: Univerzita Palackého v Olomouci, 2005, s. 47-55. ISBN 80-244-1159-8 R&D Projects: GA AV ČR IAA7025402 Institutional research plan: CEZ:AV0Z70250504 Keywords : Diary-in Group method * hermeneutic inquiry Subject RIV: AN - Psychology

  7. Reaching the superlinear convergence phase of the CG method

    Czech Academy of Sciences Publication Activity Database

    Axelsson, Owe; Karátson, J.

    2014-01-01

    Roč. 260, č. 260 (2014), s. 244-257. ISSN 0377-0427 R&D Projects: GA MŠk ED1.1.00/02.0070 Institutional support: RVO:68145535 Keywords : superlinear convergence * conjugate gradient method * eigenvalues Subject RIV: BA - General Mathematics Impact factor: 1.266, year: 2014 http://www.sciencedirect.com/science/article/pii/S0377042713005451

  8. Can voltammetry distinguish glycan isomers?

    Czech Academy of Sciences Publication Activity Database

    Trefulka, Mojmír; Paleček, Emil

    2015-01-01

    Roč. 69, č. 1 (2015), s. 241-244. ISSN 0366-6352 R&D Projects: GA ČR(CZ) GAP301/11/2055 Institutional support: RVO:68081707 Keywords : oligosaccharide isomers * Os(VI) complexes * chemical modification Subject RIV: BO - Biophysics Impact factor: 1.468, year: 2014

  9. Immunity

    Institute of Scientific and Technical Information of China (English)

    1997-01-01

    970239 The effect of interleukin 6 against cytopeniaand suppressed phagocytosis of macrophage caused bychemotherapy. ZHANG Lichao(张利朝), et al.Tangdu Hosp, 4th Milit Med Univ, Xian, 710038. ChinJ Clin Oncol 1997; 24(4): 252-255. Objective: To explore The effect of interleukin 6against cytopenia and suppressed phagocytosis ofmacrophage caused by chemotherapy. Methods:Inter-

  10. Romantika jako epistemologická alternativa otevřená Kantovou Kritikou soudnosti

    Czech Academy of Sciences Publication Activity Database

    Ďurďovič, Martin

    2014-01-01

    Roč. 36, č. 3 (2014), s. 259-281. ISSN 1210-0250 Institutional support: RVO:68378025 Keywords : epistemology * German romanticism * philosophy of arts * teleology * aesthetics Subject RIV: AA - Philosophy ; Religion http://teorievedy.flu.cas.cz/index.php/tv/article/view/244/281

  11. Formation of the reverse micelles of cetyl trimethylammonium bromide in chloroform and their behavior at subzero temperatures

    Czech Academy of Sciences Publication Activity Database

    Klíčová, L.; Šebej, P.; Štacko, P.; Filippov, Sergey K.; Klán, P.

    Philadelphia : American Chemical Society, 2012. s.103-COLL 217. [American Chemical Society National Meeting /244./ & Exposition - Materials for Health & Medicine. 19.08.2012-23.08.2012, Philadelphia] R&D Projects: GA ČR GAP108/12/0640 Institutional support: RVO:61389013 Keywords : aggregation * reverse micelles Subject RIV: CD - Macromolecular Chemistry

  12. Analýza motivace na základě použití TAT u dvou skupin adolescentů

    Czech Academy of Sciences Publication Activity Database

    Urbánek, Tomáš; Czekóová, Kristína; Čermák, Ivo; Fikarová, Táňa; Pokorná, Zuzana

    2012-01-01

    Roč. 56, č. 5 (2012), s. 393-408. ISSN 0009-062X R&D Projects: GA ČR GA406/09/2089 Institutional research plan: CEZ:AV0Z70250504 Keywords : thematic apperception test * thematic content analysis * motivation * adolescents Subject RIV: AN - Psychology Impact factor: 0.244, year: 2012

  13. Jakobson’s Ruse: Artifice in the Context of Functional Aesthetics and the Theory of Sign

    Czech Academy of Sciences Publication Activity Database

    Müller, Richard; Šidák, Pavel

    Olomouc : Palacký University, 2014 - (Kubíček, T.; Lass, A.), s. 155-169 ISBN 978-80-244-4386-7 Institutional support: RVO:68378068 Keywords : sign * semiotics * artifice * icon * index * symbol * parallelism * aesthetic function * Saussure, F. de * Peirce, S. Subject RIV: AJ - Letters, Mass-media, Audiovision

  14. Analýza deníků Sylvie Plathové pomocí HAL

    Czech Academy of Sciences Publication Activity Database

    Kodrlová, Ida; Kaufman, Allison Beth; Kaufman, James Corey; Čermák, Ivo; Burgess, Curt

    Olomouc : Univerzita Palackého v Olomouci, 2005, s. 305-313. ISBN 80-244-1159-8 R&D Projects: GA AV ČR IAA7025402 Keywords : Sylvia Plath * Hyperspace Analog to Language (HAL) Subject RIV: AN - Psychology

  15. Domain-General and Domain-Specific Creative-Thinking Tests: Effects of Gender and Item Content on Test Performance

    Science.gov (United States)

    Hong, Eunsook; Peng, Yun; O'Neil, Harold F., Jr.; Wu, Junbin

    2013-01-01

    The study examined the effects of gender and item content of domain-general and domain-specific creative-thinking tests on four subscale scores of creative-thinking (fluency, flexibility, originality, and elaboration). Chinese tenth-grade students (234 males and 244 females) participated in the study. Domain-general creative thinking was measured…

  16. Powdery Mildew Resistance in 268 Entries of Hordeum vulgare

    DEFF Research Database (Denmark)

    Jiang, W.M.; Jørgensen, Jørgen Helms; Torp, J

    1984-01-01

    A collection of 24 'Spontaneum' barley [H. vulgare ssp. spontaneum] entries and one comprising 244 Ethiopian barleys [H. vulgare ssp. vulgare] were tested for resistance to 4 powdery mildew [used by Erysiphe graminis f. sp. hordei] cultures that carried genes for virulence corresponding to most of...

  17. Expozice komunitnímu násilí a školní šikana a jejich vztah k antisociálnímu chování v rané adolescenci

    Czech Academy of Sciences Publication Activity Database

    Sobotková, Veronika; Osecká, Terezie; Jelínek, Martin; Blatný, Marek; Hrdlička, M.

    2012-01-01

    Roč. 56, č. 5 (2012), s. 409-419. ISSN 0009-062X Institutional research plan: CEZ:AV0Z7025918 Keywords : antisocial behavior * exposure to violence * school bullying Subject RIV: AN - Psychology Impact factor: 0.244, year: 2012

  18. On the Increasing Fragility of Human Teeth with Age: ADeep-Ultraviolet Resonance Raman Study

    Energy Technology Data Exchange (ETDEWEB)

    Ager III, J.W.; Nalla, R.K.; Balooch, G.; Kim, G.; Pugach, M.; Habelitz, S.; Marshall, G.W.; Kinney, J.H.; Ritchie, R.O.

    2006-07-14

    Ultraviolet resonance Raman spectroscopy (UVRRS) using 244nm excitation was used to investigate the impact of aging on humandentin. The intensity of a spectroscopic feature from the peptide bondsin the collagen increases with tissue age, similar to a finding reportedpreviously for human cortical bone.

  19. Počáteční růstová stádia amfipor a archeocyátů – srovnání

    Czech Academy of Sciences Publication Activity Database

    Hladil, Jindřich

    Olomouc : Univerzita Palackého, 2005 - (Lehotský, T.), s. 26-28 ISBN 80-244-1111-3. [Paleontologický seminář /6./. Olomouc (CZ), 14.09.2005-15.09.2005] Institutional research plan: CEZ:AV0Z30130516 Keywords : amphiporids * archaeocyaths * earliest growth stages Subject RIV: DB - Geology ; Mineralogy

  20. How Well Can the Theory of Planned Behavior Account for Occupational Intentions?

    Science.gov (United States)

    Arnold, John; Loan-Clarke, John; Coombs, Crispin; Wilkinson, Adrian; Park, Jennifer; Preston, Diane

    2006-01-01

    We tested the capacity of an extended version of the theory of planned behavior (TPB) to account for intentions to work for the UK's National Health Service (NHS) as a nurse, physiotherapist or radiographer amongst three groups: professionally unqualified (N=507), in professional training (N=244), and professionally qualified (N=227). We found…

  1. The Phaeodactylum genome reveals the evolutionary history of diatom genomes

    Czech Academy of Sciences Publication Activity Database

    Bowler, Ch.; Allen, A. E.; Badger, J. H.; Grimwood, J.; Jabbari, K.; Kuo, A.; Maheswari, U.; Martens, C.; Maumus, F.; Otillar, R. P.; Rayko, E.; Salamov, A.; Vandepoele, K.; Beszteri, B.; Gruber, A.; Heijde, M.; Katinka, M.; Mock, T.; Valentin, K.; Verret, F.; Berges, J. A.; Brownlee, C.; Cadoret, J.-P.; Chiovitti, A.; Choi, Ch. J.; Coesel, S.; De Martino, A.; Detter, J. Ch.; Durkin, C.; Falciatore, A.; Fournet, J.; Haruta, M.; Huysman, M. J. J.; Jenkins, B. D.; Jiroutová, Kateřina; Jorgensen, R. E.; Joubert, Y.; Kaplan, A.; Kröger, N.; Kroth, P. G.; La Roche, J.; Lindquist, E.; Lommer, M.; Martin–Jézéquel, V.; Lopez, P. J.; Lucas, S.; Mangogna, M.; McGinnis, K.; Medlin, L. K.; Montsant, A.; Oudot–Le Secq, M.-P.; Napoli, C.; Oborník, Miroslav; Schnitzler Parker, M.; Petit, J.-L.; Porcel, B. M.; Poulsen, N.; Robison, M.; Rychlewski, L.; Rynearson, T. A.; Schmutz, J.; Shapiro, H.; Siaut, M.; Stanley, M.; Sussman, M. R.; Taylor, A. R.; Vardi, A.; von Dassow, P.; Vyverman, W.; Willis, A.; Wyrwicz, L. S.; Rokhsar, D. S.; Weissenbach, J.; Armbrust, E. V.; Green, B. R.; Van de Peer, Y.; Grigoriev, I. V.

    2008-01-01

    Roč. 456, 13-11-2008 (2008), s. 239-244. ISSN 0028-0836 Institutional research plan: CEZ:AV0Z60220518 Keywords : Phaeodactylum * genome * evolution * diatom Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 31.434, year: 2008

  2. Patterns of Parenting during Adolescence: Perceptions of Adolescents and Parents.

    Science.gov (United States)

    Paulson, Sharon E.; Sputa, Cheryl L.

    1996-01-01

    Explores differences in maternal and paternal parenting styles and involvement, the differences between parents' and adolescents' perceptions of parenting style and involvement, and changes in parenting style and involvement between the adolescents' 9th and 12th grade years. Subjects were 244 ninth graders from the Southeast and Midwest. Discusses…

  3. The change of microtubule lenght caused by endogebous AC fields in cell

    Czech Academy of Sciences Publication Activity Database

    Sataric, M. V.; Žakula, R.B.; Zekovic, S.; Pokorný, Jiří; Fiala, J.

    1996-01-01

    Roč. 39, č. 2 (1996), s. 127-133. ISSN 0303-2647 R&D Projects: GA ČR GA202/94/1055 Grant ostatní: MŠk(CZ) OC 244 Keywords : self -adjusting systems * biophysics * cellular biophysics Impact factor: 0.648, year: 1996

  4. Moiré deflectometry used for refractive index measurements

    Czech Academy of Sciences Publication Activity Database

    Keprt, Jiří; Bartoněk, L.

    1. Olomouc : Univerzita Palackého v Olomouci, 2006 - (Křepelka, J.), s. 133-137 ISBN 80-244-1544-5 R&D Projects: GA MŠk(CZ) 1M06002 Institutional research plan: CEZ:AV0Z10100522 Keywords : Moiré deflectometry Subject RIV: BH - Optics, Masers, Lasers

  5. Případová studie: Pastva ovcí a koz na xerotermních trávnících

    Czech Academy of Sciences Publication Activity Database

    Dostálek, J.; Frantík, Tomáš

    Vol. 2. Olomouc: Univerzita Palackého, 2012 - (Machar, I.; Drobilová, L.), s. 87-95 ISBN 978-80-244-3041-6 Institutional research plan: CEZ:AV0Z60050516 Institutional support: RVO:67985939 Keywords : grazing * dry grasslands * diversity Subject RIV: EF - Botanics http://envirup.profimap.cz/download/ochranaprirody/Pripadove_studie_digitalne.pdf

  6. Rovnica smrti a života. Problematika šoa a rezistencie československých Židov v rokoch 1938-1945

    Czech Academy of Sciences Publication Activity Database

    Zudová-Lešková, Zlatica

    Praha : Historický ústav, 2010 - (Prokš, P.), s. 223-244 ISBN 978-80-7286-165-1. - (Práce Historického ústavu AV ČR, v. v. i. Řada C. Miscellanea. 23) Institutional research plan: CEZ:AV0Z80150510 Keywords : Shoah * Holocaust * Czechoslovak Jews Subject RIV: AB - History

  7. Expression and Signal Transduction Pathways of Melatonin Receptors in the Pituitary

    Czech Academy of Sciences Publication Activity Database

    Zemková, Hana; Balík, Aleš; Stojilkovič, S.S.

    Georgetown: Eurekah.com, 2006 - (Pandi-Perumal, S.; Cardinali, D.), s. 88-104 ISBN 1-58706-244-5 R&D Projects: GA AV ČR IAA5011105; GA AV ČR IAA5011103 Institutional research plan: CEZ:AV0Z50110509 Keywords : melatonin * gonadotropin-releasing hormone * anterior pituitary Subject RIV: ED - Physiology

  8. On additive preservers of semi-Browder operators

    Czech Academy of Sciences Publication Activity Database

    Mbekhta, M.; Müller, Vladimír; Oudghiri, M.

    2014-01-01

    Roč. 59, č. 2 (2014), s. 237-244. ISSN 0035-3965 R&D Projects: GA ČR GA201/09/0473; GA AV ČR IAA100190903 Institutional support: RVO:67985840 Keywords : additive preservers * semi-Browder operators Subject RIV: BA - General Mathematics http://imar.ro/journals/Revue_Mathematique/pdfs/2014/2/6.pdf

  9. Attitudes of Undergraduate Students to the Uses of Animals.

    Science.gov (United States)

    Stanisstreet, Martin; And Others

    1993-01-01

    A survey of 244 British university undergraduates in biology, computer science, and English investigated attitudes about various uses of animals, including killing animals to make luxury clothing, killing of animals for food, general and medical research using animals, and captivity. Response differences by discipline, gender, and age were also…

  10. Catalog of thermal waters in New Mexico. Hydrologic report 4

    Energy Technology Data Exchange (ETDEWEB)

    Summers, W.K.

    1976-01-01

    Waters at 67 locations in New Mexico discharge at anomalous temperatures. Details on these thermal water resources such as the location, temperature, discharge rate, field pH, and specific conductance are presented in 29 tables and 47 figures. Included also are 244 chemical analyses of water from 38 areas.

  11. Fuel selection for radioisotope thermoelectric generators

    International Nuclear Information System (INIS)

    The availability of Radioisotope Thermoeletric Generator fuels is evaluated based on the amount of fuel discharged from selected power reactors. In general, the best alternatives are either to use Plutonium-238 produced by irradiation of Neptunium-237 generated in typical thermal reactors or to use Curium-244 directly separated from the discharged fuels of fast or thermal reactors. (author)

  12. Magnetostratigraphy of the Jurassic/Cretaceouis boundary

    Czech Academy of Sciences Publication Activity Database

    Schnabl, Petr; Grabowski, J.; Oloriz, F.; Pruner, Petr; Čížková, Kristýna; Sobien, K.; Wimbledon, W. A. P.

    Olomouc: Palacký University, 2014 - (Bábek, O.; Matys Grygar, T.; Uličný, D.). s. 87-87 ISBN 978-80-244-4098-9. [Central European Meeting of Sedimentary Geology : an international conference. 09.06.2014-13.06.2014, Olomouc] Institutional support: RVO:67985831 Keywords : magnetostratigraphy * palaeomagnetism Subject RIV: DE - Earth Magnetism, Geodesy, Geography

  13. CW frequency doubling of 1029 nm radiation using single pass bulk and waveguide PPLN crystals

    Czech Academy of Sciences Publication Activity Database

    Chiodo, N.; Du Burck, F.; Hrabina, Jan; Candela, Y.; Wallerand, J. P.; Acef, O.

    2013-01-01

    Roč. 311, 15 January (2013), s. 239-244. ISSN 0030-4018 R&D Projects: GA ČR GPP102/11/P820 Institutional support: RVO:68081731 Keywords : IR laser * second harmonic generation * waveguide and bulk crystals * periodically poled lithium niobate * 1029 nm wavelength Subject RIV: BH - Optics, Masers, Lasers Impact factor: 1.542, year: 2013

  14. Identification of the aeroelastic profile based on optical measurement

    Czech Academy of Sciences Publication Activity Database

    Chládek, Štěpán; Zolotarev, Igor

    Brno: Brno University of Technology , 2014 - (Fuis, V.), s. 244-247 ISBN 978-80-214-4871-1. ISSN 1805-8248. [Engineering Mechanics 2014 /20./. Svratka (CZ), 12.05.2014-15.05.2014] R&D Projects: GA ČR GA13-10527S Institutional support: RVO:61388998 Keywords : system identification * aeroelastic profile * optical measurement Subject RIV: BI - Acoustics

  15. GenBank blastx search result: AK107592 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK107592 002-131-A07 AL158826.23 Human DNA sequence from clone RP11-244N20 on chromosome 9 Conta ... sin type) with thrombospondin type 1 motif 13, the SURF1 ... gene for surfeit 1, the SURF2 gene for surfeit 2, ...

  16. GenBank blastx search result: AK061725 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK061725 001-038-B03 AL158826.23 Human DNA sequence from clone RP11-244N20 on chromosome 9 Conta ... sin type) with thrombospondin type 1 motif 13, the SURF1 ... gene for surfeit 1, the SURF2 gene for surfeit 2, ...

  17. GenBank blastx search result: AK062210 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK062210 001-047-A04 AL158826.23 Human DNA sequence from clone RP11-244N20 on chromosome 9 Conta ... sin type) with thrombospondin type 1 motif 13, the SURF1 ... gene for surfeit 1, the SURF2 gene for surfeit 2, ...

  18. GenBank blastx search result: AK105467 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK105467 001-126-A05 AL158826.23 Human DNA sequence from clone RP11-244N20 on chromosome 9 Conta ... sin type) with thrombospondin type 1 motif 13, the SURF1 ... gene for surfeit 1, the SURF2 gene for surfeit 2, ...

  19. GenBank blastx search result: AK108838 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK108838 002-151-H01 AL158826.23 Human DNA sequence from clone RP11-244N20 on chromosome 9 Conta ... sin type) with thrombospondin type 1 motif 13, the SURF1 ... gene for surfeit 1, the SURF2 gene for surfeit 2, ...

  20. GenBank blastx search result: AK241630 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK241630 J065187N12 AL158826.23 AL158826 Human DNA sequence from clone RP11-244N20 on chromosome ... sin type) with thrombospondin type 1 motif 13, the SURF1 ... gene for surfeit 1, the SURF2 gene for surfeit 2, ...

  1. Mirrors for pion spectrometer DIRAC

    Czech Academy of Sciences Publication Activity Database

    Pech, Miroslav; Schovánek, Petr; Hrabovský, Miroslav; Řídký, Jan; Mandát, Dušan; Nožka, Libor; Palatka, Miroslav

    1. Olomouc : Univerzita Palackého v Olomouci, 2006 - (Křepelka, J.), s. 109-110 ISBN 80-244-1544-5 R&D Projects: GA MŠk(CZ) 1M06002 Institutional research plan: CEZ:AV0Z10100522 Keywords : mirrors * pion spectrometer DIRAC Subject RIV: BH - Optics, Masers, Lasers

  2. The Genus Arsenophonus

    Czech Academy of Sciences Publication Activity Database

    Wilkes, T. E.; Duron, O.; Darby, A. C.; Hypša, Václav; Nováková, Eva; Hurst, G. D. D.

    Florida : CRC Press, Taylor and Francis Group, 2011 - (Zchori-Fein, E.; Bourtzis, K.), s. 225-244 ISBN 9781439827499. - (Frontiers in Microbiology) Institutional research plan: CEZ:AV0Z60220518 Keywords : phenotypes * symbiosis * inherited symbionts of arthropods Subject RIV: EE - Microbiology, Virology

  3. Coordination of auxin and ethylene biosynthesis by the aminotransferase VAS1

    Czech Academy of Sciences Publication Activity Database

    Zheng, Z.Y.; Guo, Y.X.; Novák, Ondřej; Dai, X.H.; Zhao, Y.D.; Ljung, K.; Noel, J.P.; Chory, J.

    2013-01-01

    Roč. 9, č. 4 (2013), s. 244-246. ISSN 1552-4450 R&D Projects: GA AV ČR KAN200380801 Institutional research plan: CEZ:AV0Z50380511 Keywords : PLANT DEVELOPMENT * SHADE AVOIDANCE * ARABIDOPSIS Subject RIV: EC - Immunology Impact factor: 13.217, year: 2013

  4. Data získaná z komparativních politologických šetření

    Czech Academy of Sciences Publication Activity Database

    Lyons, Pat

    Praha : SLON, 2012 - (Krejčí, J.; Leontiyeva, Y.), s. 244-267 ISBN 978-80-7419-111-4; ISBN 978-80-7330-204-7 R&D Projects : GA MŠk LA09010 Institutional support: RVO:68378025 Keywords : political attitudes * voting behaviour * comparative survey research Subject RIV: AO - Sociology, Demography

  5. Identification of the double-bond position in fatty acid methyl esters by liquid chromatography/atmospheric pressure chemical ionisation mass spectrometry

    Czech Academy of Sciences Publication Activity Database

    Vrkoslav, Vladimír; Cvačka, Josef

    2012-01-01

    Roč. 1259, 12 Oct (2012), s. 244-250. ISSN 0021-9673 R&D Projects: GA ČR GA203/09/0139 Institutional research plan: CEZ:AV0Z40550506 Keywords : APCI * double-bond localisation * fatty acids Subject RIV: CC - Organic Chemistry Impact factor: 4.612, year: 2012

  6. Dairy Products, Dietary Calcium, and Risk of Inflammatory Bowel Disease

    DEFF Research Database (Denmark)

    Opstelten, Jorrit L; Leenders, Max; Dik, Vincent K;

    2016-01-01

    , yogurt, and cheese) and dietary calcium was measured using validated food frequency questionnaires. Cases developing incident CD (n = 110) or UC (n = 244) during follow-up were matched with 4 controls. Conditional logistic regression analyses were used to calculate odds ratios (ORs) with 95% confidence...

  7. Microhabitats of Collembola (Insecta: Entognatha) in beech and spruce forests and their influence on biodiversity

    Czech Academy of Sciences Publication Activity Database

    Rusek, Josef

    2001-01-01

    Roč. 37, - (2001), s. 237-244. ISSN 1164-5563 R&D Projects: GA AV ČR IAA6066702; GA ČR GA206/99/1416 Institutional research plan: CEZ:AV0Z6066911 Keywords : Collembola communities * biodiversity Subject RIV: EH - Ecology, Behaviour Impact factor: 0.317, year: 2001

  8. Serologic Evidence of Dengue Infection before Onset of Epidemic, Bangladesh

    OpenAIRE

    Hossain, M Anowar; Khatun, Mahmuda; Arjumand, Farzana; Nisaluk, Ananda; Breiman, Robert F.

    2003-01-01

    Dengue fever emerged in Bangladesh in 2000. We tested 225 serum and plasma samples from febrile patients and 184 blood donors in 1996 and 1997 for dengue antibodies; 55 (24.4%) febrile patients had dengue antibodies (65.5% with secondary infection pattern), compared with one (0.54%) donor (p < 0.001), suggesting that dengue transmission was ongoing well before 1996.

  9. On the Conditioning of Factors in the SR Decomposition

    Czech Academy of Sciences Publication Activity Database

    Fassbender, H.; Rozložník, Miroslav

    2016-01-01

    Roč. 505, 15 September (2016), s. 224-244. ISSN 0024-3795 R&D Projects: GA ČR GA13-06684S Institutional support: RVO:67985807 Keywords : SR decomposition * symplectic matrices * skew-symmetric bilinear forms * orthogonalization * condition number Subject RIV: BA - General Mathematics Impact factor: 0.939, year: 2014

  10. Perceptions of the Utility of Professional Education Topics.

    Science.gov (United States)

    Young, Robert B.; Coldwell, LuAnn Linson

    1993-01-01

    Student affairs professionals (n=244) rater utility of 10 professional developmental competencies, skills, and attributes. Their assessments differed significantly according to their current and projected work responsibilities. Cultural diversity and values/ethics/philosophy were rated very highly, suggesting that student affairs has…

  11. 78 FR 65690 - Extension of the Designation of Somalia for Temporary Protected Status

    Science.gov (United States)

    2013-11-01

    ... not need to pay the fee for the Application for Temporary Protected Status (Form I-821). See 8 CFR 244... Service Center at 800-375-5283 (TTY 800-767-1833). Service is available in English and Spanish. Further... conditions resulting from armed conflict. See 56 FR 46804 (Sept. 16, 1991). The initial designation...

  12. 78 FR 20123 - Extension of the Designation of Honduras for Temporary Protected Status

    Science.gov (United States)

    2013-04-03

    ... an application for re-registration, you do not need to pay the fee for the Application for Temporary...). Service is available in English and Spanish. Further information will also be available at local USCIS..., specifically the devastation resulting from Hurricane Mitch. See 64 FR 524; section 244(b)(1)(B) of the INA,...

  13. 78 FR 20128 - Extension of the Designation of Nicaragua for Temporary Protected Status

    Science.gov (United States)

    2013-04-03

    ... do not need to pay the fee for the Application for Temporary Protected Status (Form I-821). See 8 CFR...). Service is available in English and Spanish. Further information will also be available at local USCIS... FR 526; section 244(b)(1)(B) of the INA, 8 U.S.C. 1254a(b)(1)(B). The Secretary last extended...

  14. Influence of the morphology of organic heterojunction on the photovoltaic cell performance

    Czech Academy of Sciences Publication Activity Database

    Podhájecká, Klára; Pfleger, Jiří

    2006-01-01

    Roč. 36, č. 3 (2006), s. 241-244. ISSN 1286-0042 R&D Projects: GA ČR GP203/06/P226; GA AV ČR IAA4050406 Institutional research plan: CEZ:AV0Z40500505 Keywords : photovoltaic cell * heterojunction * morphology Subject RIV: CD - Macromolecular Chemistry Impact factor: 0.938, year: 2006

  15. AcEST: DK963216 [AcEST

    Lifescience Database Archive (English)

    Full Text Available EU2_CAVPO Vasopressin-neurophysin 2-copeptin OS=Cavia... 32 2.2 sp|Q869S5|DOKA_DICDI Hybrid signal transduct...STSSA 233 Query: 290 ---DADPPSSP 313 D P+ P Sbjct: 234 YSTDQQKPNQP 244 >sp|P10769|NEU2_CAVPO Vasopressin-neurophysin 2-copeptin

  16. A new species of Bathycreadium Kabata, 1961 (Digenea: Opecoelidae) from Phycis blennoides (Brünnich) (Gadiformes: Phycidae) in the western Mediterranean

    Czech Academy of Sciences Publication Activity Database

    Pérez-del-Olmo, A.; Dallarés, S.; Carrasson, M.; Kostadinova, Aneta

    2014-01-01

    Roč. 88, č. 3 (2014), s. 233-244. ISSN 0165-5752 R&D Projects: GA ČR GBP505/12/G112 Institutional support: RVO:60077344 Keywords : Digenea * Mediterranean * fish Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 1.336, year: 2014

  17. Wessen Lehrlinginn? Marie Anna Sager (1719-1805) und der Kulturtransfer im Sozialsystem Literatur

    Czech Academy of Sciences Publication Activity Database

    Wögerbauer, Michael

    Olomouc : Univerzita Palackého, 2011 - (Todorow, A.; Weinberg, M.), s. 47-65 ISBN 978-80-244-2752-2. - (Beiträge zur deutschmährischen Literatur. 16) Institutional research plan: CEZ:AV0Z90560517 Keywords : Czech literature * German literature * Sager, Maria Anna Subject RIV: AJ - Letters, Mass-media, Audiovision

  18. Ti, kteří milují umění jako Anna Grigorjevna, aneb kritika „estetické obhajoby umění“ v kontextu kulturního materialismu

    Czech Academy of Sciences Publication Activity Database

    Müller, Richard

    Olomouc : Univerzita Palackého v Olomouci, 2014 - (Hrabal, J.), s. 9-25 ISBN 978-80-244-4389-8 R&D Projects: GA ČR GAP406/10/2127 Institutional support: RVO:68378068 Keywords : censorship * literature Subject RIV: AJ - Letters, Mass-media, Audiovision

  19. Jaroslav Vrchlický a strategie obhajoby před tiskovým soudem

    Czech Academy of Sciences Publication Activity Database

    Charypar, Michal

    Olomouc : Univerzita Palackého v Olomouci, 2014 - (Hrabal, J.), s. 39-50 ISBN 978-80-244-4389-8 R&D Projects: GA ČR GAP406/10/2127 Institutional support: RVO:68378068 Keywords : censorship * literature * 19th century * Vrchlický, Jaroslav * institutions Subject RIV: AJ - Letters, Mass-media, Audiovision

  20. Geometry of finite deformations and time-incremental analysis

    Czech Academy of Sciences Publication Activity Database

    Fiala, Zdeněk

    2016-01-01

    Roč. 81, May (2016), s. 230-244. ISSN 0020-7462 Institutional support: RVO:68378297 Keywords : solid mechanics * finite deformations * time-incremental analysis * Lagrangian system * evolution equation of Lie type Subject RIV: BE - Theoretical Physics Impact factor: 1.977, year: 2014 http://www.sciencedirect.com/science/article/pii/S0020746216000330

  1. Preparation and characterization of ZnS nanoparticles deposited on montmorillonite

    Czech Academy of Sciences Publication Activity Database

    Kozák, O.; Praus, P.; Kočí, K.; Klementová, Mariana

    2010-01-01

    Roč. 352, č. 2 (2010), s. 244-251. ISSN 0021-9797 Institutional research plan: CEZ:AV0Z40320502 Keywords : ZnS nanoparticles * montmorillonite * photoluminescence * photocatalysis * carbon dioxide Subject RIV: CA - Inorganic Chemistry Impact factor: 3.068, year: 2010

  2. Mutations in MFSD8, encoding a lysosomal membrane protein, are associated with nonsyndromic autosomal recessive macular dystrophy

    NARCIS (Netherlands)

    Roosing, S.; Born, L.I. van den; Sangermano, R.; Banfi, S.; Koenekoop, R.K.; Zonneveld-Vrieling, M.N.; Klaver, C.C.; Lith-Verhoeven, J.J. van; Cremers, F.P.M.; Hollander, A.I. den; Hoyng, C.B.

    2015-01-01

    PURPOSE: This study aimed to identify the genetic defects in 2 families with autosomal recessive macular dystrophy with central cone involvement. DESIGN: Case series. PARTICIPANTS: Two families and a cohort of 244 individuals with various inherited maculopathies and cone disorders. METHODS: Genome-w

  3. A Seat at the Table: K-12 and Higher Ed Collaboration to Align Evaluation Instruments for School Librarians and Teachers

    Science.gov (United States)

    Grigsby, Susan K. S.; Helfrich, Jennifer; Deissler, Christa Harrelson

    2015-01-01

    This article describes how school librarians in Gwinnett County Public Schools (GCPS) in Georgia addressed a concern regarding the performance evaluation tool that stemmed from the passing of House Bill (HB) 244, which was passed in response to the state's Race to the Top (RT3) application requirements. The bill became law on July 1, 2014, and the…

  4. Phospholipase Dζ2 Drives Vesicular Secretion of Auxin for Its Polar Cell-Cell Transport in the Transition Zone of the Root Apex

    Czech Academy of Sciences Publication Activity Database

    Mancuso, S.; Marras, A.M.; Mugnai, S.; Schlicht, M.; Žárský, Viktor; Li, G.; Song, L.; Xue, H.W.; Baluška, F.

    2007-01-01

    Roč. 2, č. 4 (2007), s. 240-244. ISSN 1559-2316 Institutional research plan: CEZ:AV0Z50380511 Keywords : auxin * Brefeldin A * plant synapse * phospholipase D Subject RIV: EB - Genetics ; Molecular Biology www.landesbioscience.com/journals/psb/abstract.php?id=4566

  5. HUBUNGAN SISTEM PEMBELAJARAN, LINGKUNGAN BELAJAR, KONSEP DIRI DAN PENGEMBANGAN EMPLOYABILITY SKILLS MAHASISWA

    OpenAIRE

    I Made Suarta

    2013-01-01

    Tujuan penelitian adalah memperoleh model struktural pengembangan employability skills mahasiswa. Penelitian bersifat ex-post facto, menggunakan pendekatan kuantitatif non-eksperimen. Populasi penelitian adalah lulusan Politeknik Negeri Bali tahun 2009 dan mahasiswa tingkat akhir tahun akademik 2009/2010 yang sedang melakukan praktik kerja lapangan di industri. Ukuran sampel sebanyak 244, dipilih secara proportional random sampling. Pengumpulan data dilakukan menggunakan kuesioner dengan skal...

  6. Children's Moral Self-Concept: The Role of Aggression and Parent-Child Relationships

    Science.gov (United States)

    Sengsavang, Sonia; Krettenauer, Tobias

    2015-01-01

    This study examined the role of aggressiveness and parenting in the development of children's moral self-concept. Participants were 198 elementary school children and their parents (M = 8.65 years, SD = 2.44). Participants completed a structured moral self puppet interview and a questionnaire about their relationship to parents. Parents completed…

  7. Magnetohydrodynamic pumps for molten salts in cooling loops of high-temperature nuclear reactors

    Czech Academy of Sciences Publication Activity Database

    Doležel, Ivo; Kotlan, V.; Ulrych, B.

    2011-01-01

    Roč. 87, č. 5 (2011), s. 28-33. ISSN 0033-2097 Grant ostatní: GA MŠk(CZ) MEB051041 Institutional research plan: CEZ:AV0Z20570509 Keywords : magnetohydrodynamic pump * molten salt * electric field Subject RIV: JA - Electronics ; Optoelectronics, Electrical Engineering Impact factor: 0.244, year: 2011 http://pe.org.pl/

  8. Examining Holland's Person-Environment Fit, Workplace Aggression, Interpersonal Conflict, and Job Satisfaction

    Science.gov (United States)

    Pseekos, A. Chantelle; Bullock-Yowell, Emily; Dahlen, Eric R.

    2011-01-01

    The researchers examined the impact of person-environment (P-E) fit, as defined by Holland's (1997) theory, on interpersonal conflict at work (ICAW) and workplace aggression. In addition, previous relationships found in the job satisfaction literature were examined in the present sample of 244 United States employees. Internet-based surveys were…

  9. Changing School Board Governance in Primary Education through School Inspections

    Science.gov (United States)

    Ehren, Melanie C. M.; Honingh, M. E.; Hooge, E. H.; O'Hara, J.

    2016-01-01

    This paper addresses if, and to what extent, the current working methods of the Dutch Inspectorate of Education affect the governance of school boards in schools for primary education. A key facet of the working method is the inspection meeting with the school board. Drawing upon a large quantitative study (n = 244) we are able to identify some…

  10. A Study of Methods for Estimating Distributions of Test Scores.

    Science.gov (United States)

    Cope, Ronald T.; Kolen, Michael J.

    This study compared five density estimation techniques applied to samples from a population of 272,244 examinees' ACT English Usage and Mathematics Usage raw scores. Unsmoothed frequencies, kernel method, negative hypergeometric, four-parameter beta compound binomial, and Cureton-Tukey methods were applied to 500 replications of random samples of…

  11. Text-analytic Measurement of Effectuation and Causation Orientations among Small and Global Business Managers

    DEFF Research Database (Denmark)

    Mattsson, Jan; Helmersson, Helge

    2012-01-01

    reasons behind company growth. Using Ward’s clustering method (J Am Stat Assoc 58:236–244, 1963) on a binary matrix for connections between textual components, we suggest using the ESS value from clustering to calculate AFFI as an overall measure of quality. By further splitting the AFFI into three sub...

  12. Application of sum rule to the dispersion model of hydrogenated amorphous silicon

    Czech Academy of Sciences Publication Activity Database

    Franta, D.; Nečas, D.; Zajíčková, L.; Ohlídal, I.; Stuchlík, Jiří; Chvostová, Dagmar

    2013-01-01

    Roč. 539, JUL (2013), s. 233-244. ISSN 0040-6090 Institutional support: RVO:68378271 Keywords : optical constants * ellipsometry * spectrophotometry * a-Si:H * Urbach tail * localized states * sum rule Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 1.867, year: 2013

  13. Chinese Adolescents' Social Status Goals: Associations with Behaviors and Attributions for Relational Aggression

    Science.gov (United States)

    Wright, Michelle F.; Li, Yan; Shi, Junqi

    2014-01-01

    This study examined two social status goals in relation to aggressive and prosocial behaviors as well as attributions for relational aggression among 477 (244 girls) Chinese early adolescents. Findings indicate that, after controlling for each other, the social preference goal was negatively related to self-reported overt aggression, and…

  14. Konfigurace zkušenosti: figury a zápletky které žijeme

    Czech Academy of Sciences Publication Activity Database

    Chrz, Vladimír

    1. vyd. Olomouc : Universita Palackého, 2005 - (Miovský, M.; Čermák, I.; Chrz, V.), s. 129-139 ISBN 80-244-1159-8 Institutional research plan: CEZ:AV0Z70250504 Keywords : narrative research * configuration * experience * figure * plot Subject RIV: AN - Psychology

  15. Historical review of californium-252 discovery and development

    International Nuclear Information System (INIS)

    This paper discusses the discovery and history of californium 252. This isotope may be synthesized by irradiating plutonium 239, plutonium 242, americium 243, or curium 244 with neutrons in a nuclear reactor. Various experiments and inventions involving 252Cf conducted at the Savannah River Plant are discussed. The evolution of radiotherapy using californium 252 is reviewed

  16. Zrcadlový systém pro atmosférický LIDAR

    Czech Academy of Sciences Publication Activity Database

    Pech, Miroslav; Schovánek, Petr; Hrabovský, Miroslav; Řídký, Jan; Mandát, Dušan; Nožka, Libor; Palatka, Miroslav

    1. Olomouc : Univerzita Palackého v Olomouci, 2006 - (Křepelka, J.), s. 106-108 ISBN 80-244-1544-5 R&D Projects: GA MŠk(CZ) 1M06002 Institutional research plan: CEZ:AV0Z10100522 Keywords : mirror system LIDAR * LIDAR Subject RIV: BH - Optics, Masers, Lasers

  17. Superkritická fluidní chromatografie

    Czech Academy of Sciences Publication Activity Database

    Planeta, Josef

    Praha : Lucie Nováková, Michal Douša, 2013, s. 244-250 ISBN 978-80-260-4243-3 Institutional support: RVO:68081715 Keywords : supercritical fluid chromatography * overview Subject RIV: CB - Analytical Chemistry, Separation http://hdl.handle.net/11104/0222563

  18. Facial Symmetry in Robust Anthropometrics

    Czech Academy of Sciences Publication Activity Database

    Kalina, Jan

    2012-01-01

    Roč. 57, č. 3 (2012), s. 691-698. ISSN 0022-1198 R&D Projects: GA MŠk(CZ) 1M06014 Institutional research plan: CEZ:AV0Z10300504 Keywords : forensic science * anthropology * robust image analysis * correlation analysis * multivariate data * classification Subject RIV: BB - Applied Statistics, Operational Research Impact factor: 1.244, year: 2012

  19. Unigene BLAST: CBRC-MMUS-09-0209 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-MMUS-09-0209 gnl|UG|Mm#S10844081 Mus musculus adult male hypothalamus cDNA, RIKEN full-leng ... LONE SKMUS2001129, WEAKLY SIMILAR TO NAD-DEPENDENT METHANOL ... DEHYDROGENASE (EC 1.1.1.244) homolog [Homo sapiens ...

  20. Teleskop s velkou elevací - HEAT

    Czech Academy of Sciences Publication Activity Database

    Mandát, Dušan; Hrabovský, Miroslav; Schovánek, Petr; Palatka, Miroslav; Pech, Miroslav; Nožka, Libor; Halenka, Viktor; Marek, Milan

    Olomouc : Univerzita Palackého v Olomouci, 2007 - (Křepelka, J.), s. 123-127 ISBN 978-80-244-1844-5 R&D Projects: GA MŠk(CZ) 1M06002 Institutional research plan: CEZ:AV0Z10100522 Keywords : Pierre Auger * HEAT * fluorescence light * FD detect Subject RIV: BH - Optics, Masers, Lasers

  1. Chinese Teachers' Attributions and Coping Strategies for Student Classroom Misbehaviour

    Science.gov (United States)

    Ding, Meixia; Li, Yeping; Li, Xiaobao; Kulm, Gerald

    2010-01-01

    In this study, we investigated Chinese teachers' attributions and coping strategies for classroom misbehaviour across grade levels. A total of 244 teachers (Grades 1-12) from the Chinese mainland participated in this survey. Results indicated that Chinese teachers first attributed misbehaviour to student characteristics, such as being "lazy, not…

  2. Variation in Raven's Progressive Matrices Scores across Time and Place

    Science.gov (United States)

    Brouwers, Symen A.; Van de Vijver, Fons J. R.; Van Hemert, Dianne A.

    2009-01-01

    The paper describes a cross-cultural and historical meta-analysis of Raven's Progressive Matrices. Data were analyzed of 798 samples from 45 countries (N = 244,316), which were published between 1944 and 2003. Country-level indicators of educational permeation (which involves a broad set of interrelated educational input and output factors that…

  3. Risk and Urban School Transition in Early Adolescence

    Science.gov (United States)

    Ward, Sharon; Sylva, Judith; Gresham, Frank M.; Wantz-Sutton, Jacqueline L.

    2007-01-01

    This is a comparison study of 244 early adolescents attending sixth grade at either an urban elementary school or an urban middle school. Utilizing four data collection instruments, it compares the adolescent groups' degrees of loneliness, levels of positive self-concept, academic competence, problem behaviors, and social skills. Results indicate…

  4. Drug: D03287 [KEGG MEDICUS

    Lifescience Database Archive (English)

    Full Text Available D03287 Drug Elcatonin (JP16/INN); Adevirock (TN) C148H244N42O47 3361.7994 3363.7742 Therapeutic ... ) Neuroactive ligand-receptor interaction map07047 Osteoporosis ... drugs Therapeutic category of drugs in Japan [BR:b ...

  5. Drug: D03545 [KEGG MEDICUS

    Lifescience Database Archive (English)

    Full Text Available D03545 Drug Clodronic acid (USAN/INN) CH4Cl2O6P2 243.886 244.8924 D03545.gif Regulator [calcium] ... ATC code: M05BA02 map07047 Osteoporosis ... drugs Anatomical Therapeutic Chemical (ATC) classi ...

  6. Reprezentace shodných zobrazení

    Czech Academy of Sciences Publication Activity Database

    Roubíček, Filip

    Olomouc : Univerzita Palackého v Olomouci, 2012 - (Uhlířová, M.), s. 241-245 ISBN 978-80-244-3048-5. [Elementary Mathematics Education 2012. Olomouc (CZ), 25.04.2012-27.04.2012] Institutional support: RVO:67985840 Keywords : elementary geometry * isometry in plane * modelling Subject RIV: AM - Education

  7. Die Professoren und Dozenten der Friedrich-Alexander-Universität 1743-1960 : Teil 1: Theologische Fakultät, Juristische Fakultät

    OpenAIRE

    Wedel-Schaper, Eva; Hafner, Christoph; Ley, Astrid

    2010-01-01

    Das Verzeichnis enthält 244 kurze Personalbiographien der Professoren und Privatdozenten, die zwischen 1743 und 1960 mindestens ein Semester lang in der Juristischen oder Rechtswissenschaftlichen Fakultät der Universität Erlangen gelehrt haben. Die Einträge sind alphabetisch nach den Familiennamen geordnet, jedoch nach den Fakultäten getrennt.

  8. Cestopis jako prostředek ke spáse? Poutnické itineráře a odpustkové seznamy do Svaté země ze střední Evropy (14.-16. století)

    Czech Academy of Sciences Publication Activity Database

    Svátek, Jaroslav

    Olomouc: Univerzita Palackého v Olomouci, 2015 - (Hrabal, J.), s. 43-54 ISBN 978-80-244-4876-3 R&D Projects: GA ČR(CZ) GBP405/12/G148 Institutional support: RVO:67985955 Keywords : travelogues * pilgrimage * fourteenth century * fifteenth century * Jerusalem Subject RIV: AB - History

  9. Academic Self-Efficacy Beliefs of Undergraduate Mathematics Education Students

    Science.gov (United States)

    Turgut, Melih

    2013-01-01

    The present paper investigated academic self-efficacy beliefs of undergraduate mathematics education students with respect to gender, academic performance and grade level. The participants were a total of 244 undergraduate students (195 females and 49 males) enrolled to department of mathematics education (57 freshmen, 106 sophomores and 81…

  10. : a highly water-soluble biradical for efficient dynamic nuclear polarization of biomolecules.

    Science.gov (United States)

    Jagtap, Anil P; Geiger, Michel-Andreas; Stöppler, Daniel; Orwick-Rydmark, Marcella; Oschkinat, Hartmut; Sigurdsson, Snorri Th

    2016-05-19

    Dynamic nuclear polarization (DNP) is an efficient method to overcome the inherent low sensitivity of magic-angle spinning (MAS) solid-state NMR. We report a new polarizing agent (), designed for biological applications, that yielded an enhancement value of 244 in a microcrystalline SH3 domain sample at 110 K. PMID:27161650

  11. Deprese z pohledu psychologie osobních konstruktů

    Czech Academy of Sciences Publication Activity Database

    Kovářová, Marie; Filip, Miroslav

    2012-01-01

    Roč. 56, č. 5 (2012), s. 435-447. ISSN 0009-062X R&D Projects: GA ČR(CZ) GAP407/12/2432 Institutional support: RVO:68081740 Keywords : depression * psychology of personal constructs * psychotherapy Subject RIV: AN - Psychology Impact factor: 0.244, year: 2012

  12. Psychologické souvislosti ekonomické recese

    Czech Academy of Sciences Publication Activity Database

    Šolcová, Iva; Slezáčková, Alena; Franková, E.; Greenglass, E.

    2012-01-01

    Roč. 56, č. 1 (2012), s. 64-72. ISSN 0009-062X Institutional research plan: CEZ:AV0Z70250504 Keywords : economic recession * unemployment * financial strain * mental state Subject RIV: AN - Psychology Impact factor: 0.244, year: 2012

  13. 77 FR 18260 - Outer Continental Shelf (OCS), Alaska OCS Region, Cook Inlet Planning Area, Proposed Oil and Gas...

    Science.gov (United States)

    2012-03-27

    ... ecological and socio-cultural effects of oil and gas activities. NEPA analyses were prepared for the previous... level of environmental analysis, if the level of industry interest is such that BOEM recommends... Area, Proposed Oil and Gas Lease Sale 244 for OCS Oil and Gas Leasing Program 2012-2017 AGENCY:...

  14. Long-Term Effects of the Family Bereavement Program on Multiple Indicators of Grief in Parentally Bereaved Children and Adolescents

    Science.gov (United States)

    Sandler, Irwin N.; Ma, Yue; Tein, Jenn-Yun; Ayers, Tim S.; Wolchik, Sharlene; Kennedy, Cara; Millsap, Roger

    2010-01-01

    Objectives: This article reports on results from a randomized experimental trial of the effects of the Family Bereavement Program (FBP) on multiple measures of grief experienced by parentally bereaved children and adolescents over a 6-year period. Method: Participants were 244 youths (ages 8-16, mean age = 11.4 years) from 156 families that had…

  15. Novel recurrent mutations in ethanolamine kinase 1 (ETNK1) gene in systemic mastocytosis with eosinophilia and chronic myelomonocytic leukemia

    International Nuclear Information System (INIS)

    Although KITD816V occurs universally in adult systemic mastocytosis (SM), the clinical heterogeneity of SM suggests presence of additional phenotype-patterning mutations. Because up to 25% of SM patients have KITD816V-positive eosinophilia, we undertook whole-exome sequencing in a patient with aggressive SM with eosinophilia to identify novel genetic alterations. We conducted sequencing of purified eosinophils (clone/tumor sample), with T-lymphocytes as the matched control/non-tumor sample. In addition to KITD816V, we identified a somatic missense mutation in ethanolamine kinase 1 (ETNK1N244S) that was not present in 50 healthy controls. Targeted resequencing of 290 patients showed ETNK1 mutations to be distributed as follows: (i) SM (n=82; 6% mutated); (ii) chronic myelomonocytic leukemia (CMML; n=29; 14% mutated); (iii) idiopathic hypereosinophilia (n=137; <1% mutated); (iv) primary myelofibrosis (n=32; 0% mutated); and (v) others (n=10; 0% mutated). Of the 82 SM cases, 25 had significant eosinophilia; of these 20% carried ETNK1 mutations. The ten mutations (N244S=6, N244T=1, N244K=1, G245A=2) targeted two contiguous amino acids in the ETNK1 kinase domain, and are predicted to be functionally disruptive. In summary, we identified novel somatic missense ETNK1 mutations that were most frequent in SM with eosinophilia and CMML; this suggests a potential pathogenetic role for dysregulated cytidine diphosphate-ethanolamine pathway metabolites in these diseases

  16. Tributyltin disrupts feeding and energy metabolism in the goldfish (Carassius auratus).

    Science.gov (United States)

    Zhang, Jiliang; Sun, Ping; Yang, Fan; Kong, Tao; Zhang, Ruichen

    2016-06-01

    Tributyltin (TBT) can induce obesogen response. However, little is known about the adverse effects of TBT on food intake and energy metabolism. The present study was designed to investigate the effects of TBT, at environmental concentrations of 2.44 and 24.4 ng/L (1 and 10 ng/L as Sn), on feeding and energy metabolism in goldfish (Carassius auratus). After exposure for 54 d, TBT increased the weight gain and food intake in fish. The patterns of brain neuropeptide genes expression were in line with potential orexigenic effects, with increased expression of neuropeptide Y and apelin, and decreased expression of pro-opiomelanocortin, ghrelin, cocaine and amphetamine-regulated transcript, and corticotropin-releasing factor. Interestingly, the energy metabolism indicators (oxygen consumption, ammonia exertion and swimming activity) and the serum thyroid hormones were all significantly increased at the 2.44 ng/L TBT group in fish. However, no changes of energy metabolism indicators or a decrease of thyroid hormones was found at the 24.4 ng/L TBT group, which indicated a complex disrupting effect on metabolism of TBT. In short, TBT can alter feeding and energy metabolism in fish, which might promote the obesogenic responses. PMID:26971175

  17. The stabilization of hypoxia inducible factor modulates differentiation status and inhibits the proliferation of mouse embryonic stem cells

    Czech Academy of Sciences Publication Activity Database

    Binó, Lucia; Kučera, J.; Štefková, K.; Šindlerová, Lenka; Lanová, M.; Kudová, J.; Kubala, Lukáš; Pachernik, J.

    2016-01-01

    Roč. 244, JAN2016 (2016), s. 204-214. ISSN 0009-2797 R&D Projects: GA MŠk(CZ) EE2.3.30.0030 Institutional support: RVO:68081707 Keywords : Hypoxia * HIF-1 * Prolyl hydroxylase Subject RIV: BO - Biophysics Impact factor: 2.577, year: 2014

  18. A. Schopenhauer, "De doctrina deque viris doctis" [translation

    OpenAIRE

    Baasten, M.F.J.

    2014-01-01

    An annotated Latin translation of Arthur Schopenhauer, "Über Gelehrte und Gelehrsamkeit", Parerga und Paralipomena. Kleine philosophische Schriften II (1851; Sämtliche Werke V; ed. W. von Lohneysen; Darmstadt 1976) cap. 21, §§ 244-256 by Martin F.J. Baasten.

  19. Ten Steps to Complex Learning A New Approach to Instruction and Instructional Design

    NARCIS (Netherlands)

    Kirschner, Paul A.; Van Merriënboer, Jeroen

    2010-01-01

    Kirschner, P. A., & Van Merriënboer, J. J. G. (2008). Ten steps to complex learning: A new approach to instruction and instructional design. In T. L. Good (Ed.), 21st century education: A reference handbook (pp. 244-253). Thousand Oaks, CA: Sage.

  20. Comparing Three South African Student Cohorts on Their Attitudes to the Rights of Working Women

    Science.gov (United States)

    Patel, Cynthia Joan

    2016-01-01

    This study compares three cohorts (1998-1999, 2005-2006 and 2010) of undergraduate psychology students at a South African university on the level of support for working women (women in paid employment) on various issues considered to be feminist. Cohort 1 (n?=?244), cohort 2 (n?=?311) and cohort 3 (n?=?266) completed an adapted version of a…

  1. Project W-314 DST and DCRT instrument and control systems, initial assessment

    International Nuclear Information System (INIS)

    This report contains an assessment of the instrument and control systems in the Double Shell Tank Farms and the 244-A DCRT. The assessment report contains data from physical inspection activities and an overall engineering assessment of the instruments and control systems in use in the Double Shell Tanks

  2. Social Skills Expression of Senior High School Age Students in Physical Education Classes

    Science.gov (United States)

    Akelaitis, Arturas V.

    2015-01-01

    The main purpose of the present study is to reveal the peculiarities of social skills expression of senior high school age students in physical education classes. The independent random sample consisted of 244 (15-16 years old) students and 258 (17-18 years old) students, of which there were 224 boys and 278 girls. L. Bulotaite and V. Gudžinskiene…

  3. Na Primeira Margem do Rio: Território e Ecologia do Povo Xavante de Wedezé

    OpenAIRE

    Nicholas C. Kawa

    2014-01-01

    Review of Na Primeira Margem do Rio: Território e Ecologia do Povo Xavante de Wedezé. James R Welch, Ricardo Ventura Santos, Nancy M. Flowers, and Carlos E. A. Coimbra Jr. 2012. Museu do Índio/FUNAI, Rio de Janeiro. Pp. 244. ISBN 978-85-85986-46-9.

  4. Episodic memory for human-like agents and human-like agents for episodic memory

    Czech Academy of Sciences Publication Activity Database

    Brom, C.; Lukavský, Jiří; Kadlec, R.

    2010-01-01

    Roč. 2, č. 2 (2010), s. 227-244. ISSN 1793-8473 Institutional research plan: CEZ:AV0Z70250504 Keywords : episodic memory * virtual agent * modelling Subject RIV: AN - Psychology http://www.worldscinet.com/ijmc/02/0202/S1793843010000461.html

  5. Combination of Evidence-Based Medical Therapy in Acute Phase of Non-ST-Elevation Myocardial Infarction and Reduction of In-Hospital Mortality

    Czech Academy of Sciences Publication Activity Database

    Monhart, Z.; Grünfeldová, H.; Zvárová, Jana; Janský, P.

    2010-01-01

    Roč. 122, č. 2 (2010), e244. ISSN 0009-7322. [World Congress of Cardiology . 16.06.2010-19.06.2010, Beijing] Institutional research plan: CEZ:AV0Z10300504 Keywords : cardioloy * myocardial infarction * in-hospital mortality Subject RIV: FA - Cardiovascular Diseases incl. Cardiotharic Surgery

  6. Childhood dyspraxia predicts adult-onset nonaffective-psychosis-spectrum disorder

    DEFF Research Database (Denmark)

    Schiffman, Jason; Mittal, Vijay; Kline, Emily;

    2015-01-01

    examination performed with children (aged 10-13) at genetic high risk of schizophrenia and controls, several measures of dyspraxia were used to create a scale composed of face/head dyspraxia, oral articulation, ideomotor dyspraxia (clumsiness), and dressing dyspraxia (n = 244). Multinomial logistic regression...

  7. Lithium dimer formation in the Li-conducting garnets Li(5+x)Ba(x)La(3-x)Ta2O12 (0 < x < or =1.6).

    Science.gov (United States)

    O'Callaghan, Michael P; Cussen, Edmund J

    2007-05-28

    The garnet system Li(5+x)Ba(x)La(3-x)Ta2O12 shows an unprecedented Li+ content (x < or = 1.6) and short Li-Li distances of ca 2.44 A between majority occupied sites suggesting that the high Li+ mobility requires a complex cooperative mechanism. PMID:17713074

  8. Výzkum a aplikace laserových technologií

    Czech Academy of Sciences Publication Activity Database

    Chmelíčková, Hana; Lapšanská, Hana; Halenka, V.

    1. Olomouc: Univerzita Palackého v Olomouci, 2006 - (Křepelka, J.), s. 111-115 ISBN 80-244-1544-5 R&D Projects: GA MŠk(CZ) 1M06002 Institutional research plan: CEZ:AV0Z10100522 Keywords : laser technologies Subject RIV: BH - Optics, Masers, Laser s

  9. AcEST: DK948252 [AcEST

    Lifescience Database Archive (English)

    Full Text Available TST38A01NGRL0002_N07 709 Adiantum capillus-veneris mRNA. clone: TST38A01NGRL0002_N07. 5' end seq ... NMLSMDDSTTN 244 Query: 333 TEDSAAVSVTADDQGWAAFQSAAAEPA NPAETVDQPAPSGVEPSASTSTGESAIKSEIMA 512 T ++ ADD WA F ... APAAPVAEAPKVEVPAPAPAPAEP 165 Query: 372 QGWAAFQSAAAEPA NPAETVDQPAP--SGVEPSASTSTGESAIKSEIMAG 515 AA PA PA + ...

  10. It Is Surprising: Do Participial Adjectives after Copular Verbs Form a Special Evaluative Construction? A Contrastive View

    Czech Academy of Sciences Publication Activity Database

    Richterová, Olga

    Olomouc : Palacký University, 2014 - (Martinková, M.; Janebová, M.; Macháček, J.), s. 58-72 ISBN 978-80-244-4287-7 R&D Projects: GA ČR GAP406/11/2021 Keywords : corpus linguistics * construction grammar * contrastive linguistics * participle * -ing forms * parts of speech * categorization Subject RIV: AI - Linguistics

  11. Genetic susceptibility and genotype-phenotype association in 588 Danish children with inflammatory bowel disease

    DEFF Research Database (Denmark)

    Jakobsen, C; Cleynen, I; Andersen, Susanne Pia; Vermeire, S; Munkholm, P; Paerregaard, A; Wewer, Anne Vibeke

    2014-01-01

    retrieved and clinical information was extracted. DNA was obtained from Guthrie cards from the Danish National Neonatal Screening Biobank (PKU-biobanken) at Statens Serum Institut and from blood samples. RESULTS: A total of 588 IBD patients (244 Crohn's disease (CD), 318 ulcerative colitis (UC) and 26 IBD...

  12. Ohňové patenty (Protipožární opatření Marie Terezie a Josefa II.)

    Czech Academy of Sciences Publication Activity Database

    Adamová, Karolina; Lojek, Antonín

    Olomouc : Univerzita Palackého, Právnická fakulta, 2010 - (Bubelová, K.), s. 9-13 ISBN 978-80-244-2491-0. - (Sborníky) Institutional research plan: CEZ:AV0Z70680506 Keywords : legal history * history of 17th century * the Fire Patents Subject RIV: AG - Legal Sciences

  13. SmD1 is required for spliced leader biogenesis

    Czech Academy of Sciences Publication Activity Database

    Zeiner, G. M.; Foldynová, Silvie; Sturm, N. R.; Lukeš, Julius; Campbell, D. A.

    2004-01-01

    Roč. 3, č. 1 (2004), s. 241-244. ISSN 1535-9778 Grant ostatní: NIH(US) AI34536; NIH(US) AI054496 Institutional research plan: CEZ:AV0Z6022909 Keywords : Kinetoplastida * Trypanosoma * spliced leader RNA Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 3.954, year: 2004

  14. Search for singlet fission chromophores

    Czech Academy of Sciences Publication Activity Database

    Havlas, Zdeněk; Akdag, Akin; Smith, M. B.; Dron, P.; Johnson, J. C.; Nozik, A. J.; Michl, Josef

    Philadelphia: American Chemical Society, 2012. 31PHYS. ISSN 0065-7727. [National Fall Meeting of the American Chemical Society /244./. 19.08.2012-23.08.2012, Philadelphia] Institutional support: RVO:61388963 Keywords : singlet fission * chromophores Subject RIV: CF - Physical ; Theoretical Chemistry

  15. Labor supply consequences of family taxation: evidence from the Czech Republic

    Czech Academy of Sciences Publication Activity Database

    Kalíšková, Klára

    2014-01-01

    Roč. 30, October (2014), s. 234-244. ISSN 0927-5371 R&D Projects: GA ČR GB14-36154G Institutional support: RVO:67985998 Keywords : joint taxation * labor supply * diffrence-in-differences Subject RIV: AH - Economics Impact factor: 0.916, year: 2014

  16. Labor supply consequences of family taxation: evidence from the Czech Republic

    Czech Academy of Sciences Publication Activity Database

    Kalíšková, Klára

    2014-01-01

    Roč. 30, October (2014), s. 234-244. ISSN 0927-5371 R&D Projects: GA MŠk(CZ) SVV260126 Grant ostatní: UK(CZ) GAUK 595812 Institutional support: PRVOUK-P23 Keywords : joint taxation * labor supply * diffrence-in-differences Subject RIV: AH - Economics Impact factor: 0.916, year: 2014

  17. Tenisový areál v Praze

    Czech Academy of Sciences Publication Activity Database

    Svobodová, Markéta

    Praha: Prostor - architektura, interiér, design, 2012 - (Švácha, R.), s. 244-247 ISBN 978-80-87064-08-5 Institutional support: RVO:68378033 Keywords : tennis courts * Josef Kales * Jana Novotná Subject RIV: AL - Art, Architecture, Cultural Heritage

  18. Tennis courts in Prague

    Czech Academy of Sciences Publication Activity Database

    Svobodová, Markéta

    Prague: Prostor - architektura, interiér, design, 2012 - (Švácha, R.), s. 244-247 ISBN 978-80-87064-09-2 Institutional support: RVO:68378033 Keywords : tennis courts * Josef Kales * Jana Novotná Subject RIV: AL - Art, Architecture, Cultural Heritage

  19. Projectile deformation effects in the breakup of $^{37}$Mg

    CERN Document Server

    Shubhchintak,; Shyam, R

    2015-01-01

    We study the breakup of $^{37}$Mg on Pb at 244MeV/u with the recently developed extended theory of Coulomb breakup within the post-form finite range distorted wave Born approximation that includes deformation of the projectile. Comparing our calculated cross section with the available Coulomb breakup data we determine the possible ground state configuration of $^{37}$Mg.

  20. Big Rock Point Nuclear Plant. Annual operating report for 1976

    International Nuclear Information System (INIS)

    Net electrical power generated was 244,492.9 MWH with the reactor on line 4,405 hrs. Information is presented concerning operations, power generation, shutdowns, corrective maintenance, chemistry and radiochemistry, occupational radiation exposure, release of radioactive materials, reportable occurrences, and fuel performance

  1. Inteligence a agresivita pachatelů majetkové trestné činnosti

    Czech Academy of Sciences Publication Activity Database

    Polišenská, Veronika; Koubalíková, S.; Borovanská, M.

    2012-01-01

    Roč. 56, č. 6 (2012), s. 574-583. ISSN 0009-062X R&D Projects: GA ČR(CZ) GAP407/12/0706 Institutional research plan: CEZ:AV0Z70250504 Keywords : property crime offenders * intelligence * aggression * Raven progressive matrices * Hand test Subject RIV: AN - Psychology Impact factor: 0.244, year: 2012

  2. Effect of Support on the Synergy in HDS of Thiophene and HDN of Pyridine over Mo Sulfide Catalysts Promoted by Rh

    Czech Academy of Sciences Publication Activity Database

    Vít, Zdeněk; Gulková, Daniela; Kaluža, Luděk; Zdražil, Miroslav

    2004-01-01

    Roč. 83, č. 2 (2004), s. 237-244. ISSN 0133-1736 R&D Projects: GA AV ČR IAA4072103 Institutional research plan: CEZ:AV0Z4072921 Keywords : Rh-Mo catalyst * hydrodesulfurization * synergetic effect Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 0.618, year: 2004

  3. Kostel sv. Michala v Olomouci: typ, architekti a patroni jeho stavby

    Czech Academy of Sciences Publication Activity Database

    Švácha, Rostislav

    Olomouc : Univerzita Palackého v Olomouci, 2012 - (Daniel, L.; Hradil, F.), s. 104-111 ISBN 978-80-244-3373-8 Institutional support: RVO:68378033 Keywords : architecture * 17th century * Bohemia Subject RIV: AL - Art, Architecture, Cultural Heritage

  4. Analysis of Secondary School Students' Perceptions about Information Technologies through a Word Association Test

    Science.gov (United States)

    Eren, Fetah; Sahin, Ismail; Celik, Ismail; Akturk, Ahmet Oguz

    2014-01-01

    The aim of this study is to discover secondary school students' perceptions related to information technologies and the connections between concepts in their cognitive structures. A word association test consisting of six concepts related to information technologies is used to collect data from 244 secondary school students. Concept maps that…

  5. Interferenčně modulovaný laserový svazek a jeho využití v moiré topografii

    Czech Academy of Sciences Publication Activity Database

    Bartoněk, L.; Keprt, Jiří

    1. Olomouc: Univerzita Palackého v Olomouci, 2006 - (Křepelka, J.), s. 138-143 ISBN 80-244-1544-5 R&D Projects: GA MŠk(CZ) 1M06002 Institutional research plan: CEZ:AV0Z10100522 Keywords : moiré * interference modulated laser Subject RIV: BH - Optics, Masers, Laser s

  6. Analýza drsnosti povrchu na přístroji Form Talysurf series 2

    Czech Academy of Sciences Publication Activity Database

    Hiklová, Helena; Havelková, Martina; Havránek, Vítězslav

    1. Olomouc: Univerzita Palackého v Olomouci, 2006 - (Křepelka, J.), s. 116-120 ISBN 80-244-1544-5 R&D Projects: GA MŠk(CZ) 1M06002 Institutional research plan: CEZ:AV0Z10100522 Keywords : surface roughness * Talysurf Subject RIV: BH - Optics, Masers, Laser s

  7. The quenched invariance principle for random walks in random environments admitting a bounded cycle representation

    OpenAIRE

    Deuschel, Jean-Dominique; Kösters, Holger

    2008-01-01

    We derive a quenched invariance principle for random walks in random environments whose transition probabilities are defined in terms of weighted cycles of bounded length. To this end, we adapt the proof for random walks among random conductances by Sidoravicius and Sznitman (Probab. Theory Related Fields 129 (2004) 219--244) to the non-reversible setting.

  8. 40 CFR 89.416 - Raw exhaust gas flow.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 20 2010-07-01 2010-07-01 false Raw exhaust gas flow. 89.416 Section... Procedures § 89.416 Raw exhaust gas flow. The exhaust gas flow shall be determined by one of the methods...) Measurement of the air flow and the fuel flow by suitable metering systems (for details see SAE J244....

  9. Flammable gas/slurry growth unreviewed safety question:justification for continued operation for the tank farms at the Hanford site

    Energy Technology Data Exchange (ETDEWEB)

    Leach, C.E., Westinghouse Hanford

    1996-07-31

    This Justification for Continued Operation (JCO) provides a basis for continued operation in 176 high level waste tanks, double contained receiver tanks (DCRTs), catch tanks, 244-AR Vault, 242-S and 242-T Evaporators and inactive miscellaneous underground storage tanks (IMUSTs) relative to flammable gas hazards. Required controls are specified.

  10. Finance middle managers and financial statement fraud

    NARCIS (Netherlands)

    Linke, Kristina Gisela Babette

    2012-01-01

    Verslaggevingsfraude is het manipuleren van de boekhouding om betere cijfers te laten zien. Kristina Linke onderzocht deze vorm van fraude, waarbij zij vooral keek naar de rol van de controller. Dat gebeurde aan de hand van 244 aanklachten in de periode 2000-2006 in de Verenigde Staten. Uit het onde

  11. Ovarian Reserve Assessment in Users of Oral Contraception Seeking Fertility Advice on their Reproductive Lifespan

    DEFF Research Database (Denmark)

    Petersen, K. Birch; Hvidman, H. W.; Forman, J. L.;

    2016-01-01

    contraceptive vaginal ring). Non-users included women with an intrauterine device (IUD) or no hormonal contraception. MAIN RESULTS AND THE ROLE OF CHANCE: Of the 887 women, 244 (27.5%) used OC. In a linear regression analyses adjusted for age, ovarian volume was 50% lower (95% CI 45.1-53.7%), AMH was 19% lower...

  12. Ovarian reserve assessment in users of oral contraception seeking fertility advice on their reproductive lifespan

    DEFF Research Database (Denmark)

    Birch Petersen, K; Hvidman, H W; Forman, J L;

    2015-01-01

    contraceptive vaginal ring). Non-users included women with an intrauterine device (IUD) or no hormonal contraception. MAIN RESULTS AND THE ROLE OF CHANCE: Of the 887 women, 244 (27.5%) used OC. In a linear regression analyses adjusted for age, ovarian volume was 50% lower (95% CI 45.1-53.7%), AMH was 19% lower...

  13. Recent achievements in chemical studies of heaviest elements

    Science.gov (United States)

    Gäggeler, H. W.

    2011-09-01

    Discovery of heavy elements up to atomic number 118 at FLNR in Dubna has paved the way to also extend chemical knowledge to heavier members of the periodic table. Recent studies on the chemical properties of Cn and element 114 are summarized that have been performed at FLNR in Dubna using the fusion reactions 48Ca + 242/244Pu.

  14. Recent achievements in chemical studies of heaviest elements

    International Nuclear Information System (INIS)

    Discovery of heavy elements up to atomic number 118 at FLNR in Dubna has paved the way to also extend chemical knowledge to heavier members of the periodic table. Recent studies on the chemical properties of Cn and element 114 are summarized that have been performed at FLNR in Dubna using the fusion reactions 48Ca + 242/244Pu.

  15. Revenues and Expenditures for Public Elementary and Secondary Education: School Year 1994-95. Statistics in Brief.

    Science.gov (United States)

    National Center for Education Statistics (ED), Washington, DC.

    Over $273 billion of revenues were raised by local, state, and federal governments to fund public education for students in prekindergarten through the 12th grade in school year 1994-95. Current expenditures (those excluding construction, equipment, and debt financing) came to $244 billion. Three out of every five dollars were spent on teachers,…

  16. Comparison of specificity and sensitivity of immunochemical and molecular techniques for determination of Clavibacter michiganensis subsp. michiganensis

    Czech Academy of Sciences Publication Activity Database

    Kokošková, B.; Mráz, Ivan; Fousek, Jan

    2010-01-01

    Roč. 55, č. 3 (2010), s. 239-244. ISSN 0015-5632 R&D Projects: GA MZe QH71229 Institutional research plan: CEZ:AV0Z50510513 Keywords : Clavibacter michiganensis subsp. michiganensis (Cmm) * PCR * ELISA * IFAS Subject RIV: EF - Botanics Impact factor: 0.977, year: 2010

  17. InterProScan Result: FS789884 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available FS789884 FS789884_1_ORF2 59FE94464D244E28 PANTHER PTHR11461 SERINE PROTEASE INHIBITOR, SERP...IN 9.9e-66 T IPR000215 Protease inhibitor I4, serpin Molecular Function: serine-type endopeptidase inhibitor activity (GO:0004867) ...

  18. DEVELOPING A TOOL FOR ENVIRONMENTALLY PREFERABLE PURCHASING: JOURNAL ARTICLE

    Science.gov (United States)

    NRMRL-CIN-1246 Curran*, M.A. Developing a Tool for Environmentally Preferable Purchasing. Environmental Management and Health (Filho, W.L. (Ed.), MCB University Press) 12 (3):244-253 (2001). EPA/600/J-02/238, http://www.emerald-library.com/ft. 12/04/2000 LCA-based guidance wa...

  19. Richard Werner

    Czech Academy of Sciences Publication Activity Database

    Šimůnek, Michal V.

    Červený Kostelec : Pavel Mervart, 2013 - (Šimůnek, M.; Kostlán, A.), s. 244-248 ISBN 978-80-7465-041-3. - (Studies in the History of Sciences and Humanities. 29) Institutional support: RVO:68378114 Keywords : holocaust * intellectual elite * history of science Subject RIV: AB - History

  20. Concept Development of Decimals in Chinese Elementary Students: A Conceptual Change Approach

    Science.gov (United States)

    Liu, Ru-De; Ding, Yi; Zong, Min; Zhang, Dake

    2014-01-01

    The aim of this study was to examine the concept development of decimal numbers in 244 Chinese elementary students in grades 4-6. Three grades of students differed in their intuitive sense of decimals and conceptual understanding of decimals, with more strategic approaches used by older students. Misconceptions regarding the density nature of…

  1. A Comparison of Burnout in Selected Occupational Fields.

    Science.gov (United States)

    Matthews, Doris B.

    1990-01-01

    Examined whether degree or extent of burnout is differentiated among workers in six people-oriented fields: health services, banking, social welfare, industry, education, and postal service. Findings from 244 employees in these 6 fields indicated that employees in social welfare tended to experience more burnout than some persons in education,…

  2. The Structure and Intensity of Emotional Experiences: Method and Context Convergence.

    Science.gov (United States)

    Mano, Haim

    1991-01-01

    Structure and intensity of naturally occurring and induced affect were studied with 244 university students and 1 employee in 2 studies using 2 methodological paradigms (dimensionality and classification) and 2 everyday contexts (lecture and television advertising). A circular structure of feeling was experienced during the lecture (naturally…

  3. Twenty-Year Follow-Up of Children with and without Speech-Language Impairments: Family, Educational, Occupational, and Quality of Life Outcomes

    Science.gov (United States)

    Johnson, Carla J.; Beitchman, Joseph H.; Brownlie, E. B.

    2010-01-01

    Purpose: Parents, professionals, and policy makers need information on the long-term prognosis for children with communication disorders. Our primary purpose in this report was to help fill this gap by profiling the family, educational, occupational, and quality of life outcomes of young adults at 25 years of age (N = 244) from the Ottawa Language…

  4. 75 FR 2457 - Defense Federal Acquisition Regulation Supplement; Business Systems-Definition and Administration...

    Science.gov (United States)

    2010-01-15

    ... Subjects in 48 CFR Parts 215, 234, 242, 244, and 252 Government procurement. Amy G. Williams, Editor... contract award. (8) Evaluate price, quality, delivery, technical capabilities, and financial capabilities... applicable for any sole or single source award. (10) Perform appropriate cost or price analysis and...

  5. National Comorbidity Survey Replication Adolescent Supplement (NCS-A): II. Overview and Design

    Science.gov (United States)

    Kessler, Ronald C.; Avenevoli, Shelli; Costello, E. Jane; Green, Jennifer Greif; Gruber, Michael J.; Heeringa, Steven; Merikangas, Kathleen R.; Pennell, Beth-Ellen; Sampson, Nancy A.; Zaslavsky, Alan M.

    2009-01-01

    The national comorbidity survey that seeks to determine the prevalence and correlates of mental disorders among U.S. adolescents is based on a dual-frame design that includes 904 adolescents from a previous household survey and 9,244 adolescent students from a sample of 320 schools. Replacement schools for those that refuse to participate do not…

  6. Ecology of aerobic anoxygenic phototrophs in aquatic environments

    Czech Academy of Sciences Publication Activity Database

    Koblížek, Michal

    2015-01-01

    Roč. 39, č. 6 (2015), s. 854-870. ISSN 0168-6445 R&D Projects: GA ČR GA13-11281S; GA MŠk LO1416 Institutional support: RVO:61388971 Keywords : photoheterotrophs * microbial loop * aquatic food webs Subject RIV: EE - Microbiology, Virology Impact factor: 13.244, year: 2014

  7. 78 FR 36223 - Extension and Redesignation of Syria for Temporary Protected Status

    Science.gov (United States)

    2013-06-17

    ... Status, 77 FR 19026 (Mar. 29, 2012), and correction at 77 FR 20046 (Apr. 3, 2012); see also section 244(b... and Redesignation of South Sudan for Temporary Protected Status, 78 FR 1866 (Jan. 9, 2013); Extension and Redesignation of Sudan for Temporary Protected Status, 78 FR 1872 (Jan. 9, 2013); Extension...

  8. Investigating Children's Mathematics Readiness

    Science.gov (United States)

    Lee, Joohi; Autry, Mary Murray; Fox, Jill; Williams, Cynthia

    2008-01-01

    A sample of 244 children (average age: 61 months) and their parents from the Dallas and Fort Worth (DFW) metroplex area in Texas were surveyed to investigate children's mathematics readiness. This study was conducted as part of a project funded by a local child care council, composed of business, civic, and education leaders in the community. The…

  9. 10 CFR 30.72 - Schedule C-Quantities of radioactive materials requiring consideration of the need for an...

    Science.gov (United States)

    2010-01-01

    ... consideration of the need for an emergency plan for responding to a release. 30.72 Section 30.72 Energy NUCLEAR... emergency plan for responding to a release. Radioactive material 1 Release fraction Quantity (curies... .01 200,000 Curium-242 .001 60 Curium-243 .001 3 Curium-244 .001 4 Curium-245 .001 2 Europium-152...

  10. Etalon of optical frequency for the telecommunication spectral region

    Czech Academy of Sciences Publication Activity Database

    Lazar, Josef; Růžička, Bohdan; Číp, Ondřej

    Strasbourg : SPIE, 2004, s. 240-244. ISBN 0-8194-5379-X. [Photonics Europe 2004. Strasbourg (FR), 26.04.2004-30.04.2004] R&D Projects: GA AV ČR IBS2508201 Keywords : laser diode * frequency stabilization * absorption spectroscopy Subject RIV: BH - Optics, Masers, Laser s

  11. The Relations among Feminist Identity Development, Gender-Role Orientation, and Psychological Well-Being in Women

    Science.gov (United States)

    Saunders, Kendra J.; Kashubeck-West, Susan

    2006-01-01

    This study examined relations between feminist identity development, gender-role orientation, and psychological well-being in 244 women of varying ages and backgrounds. As hypothesized, both feminist identity development and gender-role orientation contributed independently to the explanation of variance in psychological well-being.…

  12. Impact of Literacy Influences and Perceived Reading Ability on Self-Rated Health of Public Middle School Students

    Science.gov (United States)

    Zullig, Keith J.; Ubbes, Valerie A.

    2010-01-01

    This study investigated the impact of literacy influences and perceived reading ability on the self-rated health (SRH) of 244 middle school students. Five literacy influences and reading ability independent variables resulted in moderate to substantial test-retest reliability [Kappas 46.6 to 63.8] over a two-week period. SRH served as the…

  13. The use of antipsychotic medication in child and adolescent psychiatric treatment in Denmark. A cross-sectional survey

    DEFF Research Database (Denmark)

    Deurell, Maria; Weischer, Merete; Pagsberg, Anne Katrine;

    2008-01-01

    patients in antipsychotic treatment were: schizophrenia, schizotypal disorder, autism spectrum disorders and personality disorders. Monotherapy was used in 87% of cases. Sixty-four per cent of patients treated with antipsychotics, received a second-generation antipsychotic as the main treatment. All 244...

  14. IR and Near IR Laser Ablative Deposition of Amorphous Titanium Coats Containing Nanocrystalline Grains of Titanium and Titanium Suboxides

    Czech Academy of Sciences Publication Activity Database

    Urbanová, Markéta; Pokorná, Dana; Kupčík, Jaroslav; Medlín, R.; Křenek, T.; Pola, Josef

    2014-01-01

    Roč. 67, NOV 2014 (2014), s. 237-244. ISSN 1350-4495 Grant ostatní: GA MŠMT(CZ) CZ.1.05/2.1.00/03.0088 Institutional support: RVO:67985858 Keywords : laser ablation * laser deposition * amorphous titanium coats Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 1.550, year: 2014

  15. Posttraumatický stres a posttraumatický rozvoj v dětské onkologii

    Czech Academy of Sciences Publication Activity Database

    Slezáčková, Alena; Loučka, M.; Bartošová, K.

    2012-01-01

    Roč. 56, č. 2 (2012), s. 132-147. ISSN 0009-062X R&D Projects: GA ČR(CZ) GAP407/11/2421 Institutional research plan: CEZ:AV0Z70250504 Keywords : postttraumatic stress * posttraumatic growth * childhood cancer Subject RIV: AN - Psychology Impact factor: 0.244, year: 2012

  16. Predictors of HIV Testing and Intention to Test Among Hispanic Farmworkers in South Florida

    Science.gov (United States)

    Fernandez, M. Isabel; Collazo, Jose B.; Bowen, G. Stephen; Varga, Leah M.; Hernandez, Nilda; Perrino, Tatiana

    2005-01-01

    Context and Purpose: This study examined the predictors of HIV testing and factors associated with intention to accept a free HIV test among 244 Hispanic migrant/seasonal farmworkers in South Florida. Methods: Time and space sampling procedures were used to recruit participants in public venues. Bilingual staff interviewed eligible respondents in…

  17. Cenzura vězeňské korespondence v Československu v letech 1948–1955

    Czech Academy of Sciences Publication Activity Database

    Čáslavová, Petra

    Olomouc: Univerzita Palackého v Olomouci, 2014 - (Hrabal, J.), s. 186-204 ISBN 978-80-244-4389-8 R&D Projects: GA ČR GAP406/10/2127 Institutional support: RVO:68378068 Keywords : censorship * literature * prison literature Subject RIV: AJ - Letters, Mass-media, Audiovision

  18. Případová studie: Doupovské hory - biodiverzita vs. velkoplošná sukcese

    Czech Academy of Sciences Publication Activity Database

    Vojta, J.; Brůna, Josef; Kubát, M.; Drhovská, L.

    Vol. 2. Olomouc : Univerzita Palackého, 2012 - (Machar, I.; Drobilová, L.), s. 210-220 ISBN 978-80-244-3041-6 R&D Projects: GA ČR GA526/06/0818 Institutional support: RVO:67985939 Keywords : abandoned landscape * succession * biodiversity Subject RIV: EF - Botanics http://envirup.profimap.cz/download/ochranaprirody/Pripadove_studie_digitalne.pdf

  19. Virotherapy of ovarian cancer with polymer-cloaked adenovirus retargeted to the epidermal growth factor receptor

    Czech Academy of Sciences Publication Activity Database

    Morrison, J.; Briggs, S. S.; Green, N.; Fisher, K.; Šubr, Vladimír; Ulbrich, Karel; Kehoe, S.; Seymour, L. W.

    2008-01-01

    Roč. 16, č. 2 (2008), s. 244-251. ISSN 1525-0016 EU Projects: European Commission(XE) 512087 - GIANT Institutional research plan: CEZ:AV0Z40500505 Keywords : adenovirus * gene delivery * N-(2-hydroxypropyl)methacrylamide Subject RIV: CD - Macromolecular Chemistry Impact factor: 5.970, year: 2008

  20. Vektory pro genovou terapii směrované pomocí syntetických oligopeptidů

    Czech Academy of Sciences Publication Activity Database

    Pechar, Michal; Pola, Robert; Ulbrich, Karel; Carlisle, R. C.; Seymour, L.

    2007-01-01

    Roč. 61, č. 1 (2007), s. 244. ISSN 1336-7242. [Zjazd chemikov /59./. 02.09.2007-06.09.2007, Tatranské Matliare] R&D Projects: GA AV ČR KAN200200651 Institutional research plan: CEZ:AV0Z40500505 Keywords : gene therapy * synthetic oligopeptides * adenovirus Subject RIV: CD - Macromolecular Chemistry

  1. Fine Motor Skills and Mathematics Achievement in East Asian American and European American Kindergartners and First Graders

    Science.gov (United States)

    Luo, Zupei; Jose, Paul E.; Huntsinger, Carol S.; Pigott, Therese D.

    2007-01-01

    This study examined whether fine motor skills were related to the initial scores and growth rate of mathematics achievement in American kindergartners and first graders. Participants were 244 East Asian American and 9,816 European American children from the US-based Early Childhood Longitudinal Study (ECLS-K). To control sampling bias, two…

  2. Ammonia release from heated "street" cannabis leaf and its potential toxic effects on cannabis users

    Czech Academy of Sciences Publication Activity Database

    Bloor, R.; Wang, T. S.; Španěl, Patrik; Smith, D.

    2008-01-01

    Roč. 103, č. 10 (2008), s. 1671-1677. ISSN 0965-2140 Institutional research plan: CEZ:AV0Z40400503 Keywords : ammonia * cannabis * respiratory Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 4.244, year: 2008

  3. Cenzura a autocenzura Slezských písní Petra Bezruče. Editologické poznámky

    Czech Academy of Sciences Publication Activity Database

    Kosák, Michal

    Olomouc: Univerzita Palackého v Olomouci, 2014 - (Hrabal, J.), s. 104-117 ISBN 978-80-244-4389-8 R&D Projects: GA ČR GAP406/10/2127 Institutional support: RVO:68378068 Keywords : censorship * literature * Bezruč, Petr Subject RIV: AJ - Letters, Mass-media, Audiovision

  4. U-Shaped Fiber-Optic Detection Elements for Investigation of Photocatalytic Decomposition of Toluene Dissolved in Water

    Czech Academy of Sciences Publication Activity Database

    Matějec, Vlastimil; Bartoň, Ivo; Mrázek, Jan; Podrazký, Ondřej

    2014-01-01

    Roč. 27, May (2014), s. 244-252. ISSN 2306-8515 R&D Projects: GA ČR GAP102/12/2361 Institutional support: RVO:67985882 Keywords : Toluene detection * Photocatalytic decomposition * U-Shaped fiber Subject RIV: JA - Electronics ; Optoelectronics, Electrical Engineering

  5. Diverzita či odlišné chování? Sociální distance od Romů, gayů, lidí s AIDS a dalších menšin

    Czech Academy of Sciences Publication Activity Database

    Klicperová-Baker, Martina; Košťál, J.

    2012-01-01

    Roč. 56, č. 4 (2012), s. 297-314. ISSN 0009-062X Institutional research plan: CEZ:AV0Z70250504 Keywords : diversity * minorities * social distance Subject RIV: AN - Psychology Impact factor: 0.244, year: 2012

  6. Functional design criteria radioactive liquid waste line replacement, Project W-087. Revision 3

    International Nuclear Information System (INIS)

    This document provides the functional design criteria for the 222-S Laboratory radioactive waste drain piping and transfer pipeline replacement. The project will replace the radioactive waste drain piping from the hot cells in 222-S to the 219-S Waste Handling Facility and provide a new waste transfer route from 219-S to the 244-S Catch Station in Tank Farms

  7. The effect of Ga-doping on the defect chemistry of RE.sub.3./sub.Al.sub.5./sub.O.sub.12./sub. garnets

    Czech Academy of Sciences Publication Activity Database

    Stanek, C.R.; Jiang, C.; Yadav, S.K.; McClellan, K.J.; Uberuaga, B.P.; Andersson, D.A.; Nikl, Martin

    2013-01-01

    Roč. 250, č. 2 (2013), s. 244-248. ISSN 0370-1972 R&D Projects: GA ČR GAP204/12/0805 Institutional support: RVO:68378271 Keywords : aluminate garnets * antisite defects * Ga doping Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 1.605, year: 2013

  8. Fate map of the dental mesenchyme: Dynamic development of the dental papilla and follicle

    Czech Academy of Sciences Publication Activity Database

    Rothová, Michaela; Peterková, Renata; Tucker, A. S.

    2012-01-01

    Roč. 366, č. 2 (2012), s. 244-254. ISSN 0012-1606 R&D Projects: GA ČR GA304/07/0223 Institutional research plan: CEZ:AV0Z50390703; CEZ:AV0Z50390512 Keywords : tooth * mouse * mesenchyme Subject RIV: EA - Cell Biology Impact factor: 3.868, year: 2012

  9. Mechanism of reactive compatibilization of a blend of recycled LDPE/HIPS using an EPDM/SB/aromatic diamine co-additive system

    Czech Academy of Sciences Publication Activity Database

    Pospíšil, Jan; Fortelný, Ivan; Michálková, Danuše; Kruliš, Zdeněk; Šlouf, Miroslav

    2005-01-01

    Roč. 90, č. 2 (2005), s. 244-249. ISSN 0141-3910 R&D Projects: GA AV ČR KSK4050111; GA ČR GA106/02/1248 Keywords : pre-aged LDPE * blends LDPE-HIPS * recycled upgrading Subject RIV: CD - Macromolecular Chemistry Impact factor: 1.749, year: 2005

  10. 40 CFR 98.7 - What standardized methods are incorporated by reference into this part?

    Science.gov (United States)

    2010-07-01

    ... 98.364(e). (2) ASME MFC-4M-1986 (Reaffirmed 1997) Measurement of Gas Flow by Turbine Meters, IBR... Flow Using Small Bore Precision Orifice Meters, IBR approved for §§ 98.244(b), 98.254(c), 98.344(c... 1994) Measurement of Liquid Flow in Closed Conduits Using Transit-Time Ultrasonic Flowmeters,...

  11. Raman spectroscopy and spectroelectrochemistry of the chemically n-doped DWCNT

    Czech Academy of Sciences Publication Activity Database

    Kalbáč, Martin; Kavan, Ladislav; Zukalová, Markéta; Dunsch, L.

    2007-01-01

    Roč. 244, č. 11 (2007), s. 4086-4091. ISSN 0370-1972 R&D Projects: GA AV ČR KJB400400601; GA MŠk LC510 Institutional research plan: CEZ:AV0Z40400503 Keywords : Raman spectroscopy * spectroelectrochemistry * DWCNT Subject RIV: CG - Electrochemistry Impact factor: 1.071, year: 2007

  12. Testing Three Explanations of the Emergence of Weapon Carrying in Peer Context : The Roles of Aggression, Victimization, and the Social Network

    NARCIS (Netherlands)

    Dijkstra, Jan; Gest, Scott D.; Lindenberg, Siegwart; Veenstra, René; Cillessen, A.H.N.

    2012-01-01

    Purpose: To examine the relative contribution of weapon carrying of peers, aggression, and victimization to weapon carrying of male and female adolescents over time. Methods: Data were derived from a population-based sample of male (N = 224) and female (N = 244) adolescents followed from grade 10 (M

  13. Testing Three Explanations of the Emergence of Weapon Carrying in Peer Context: The Roles of Aggression, Victimization, and the Social Network

    NARCIS (Netherlands)

    Dijkstra, J.K.; Gest, S.D.; Lindenberg, S.M.; Veenstra, D.R.; Cillessen, A.H.N.

    2012-01-01

    Purpose: To examine the relative contribution of weapon carrying of peers, aggression, and victimization to weapon carrying of male and female adolescents over time. Methods: Data were derived from a population-based sample of male (N = 224) and female (N = 244) adolescents followed from grade 10 (M

  14. Globalizace a gender

    Czech Academy of Sciences Publication Activity Database

    Kolářová, Marta

    Praha : Univerzita Karlova, Centrum pro otázky životního prostředí, 2006 - (Dlouhá, J.; Dlouhý, J.; Mezřický, V.), s. 237-244 ISBN 80-87076-01-X Institutional research plan: CEZ:AV0Z70280505 Keywords : globalization * gender * labour Subject RIV: AO - Sociology, Demography

  15. It should not hurt to be a child : prevalence of child maltreatment across the globe

    NARCIS (Netherlands)

    Stoltenborgh, Marije

    2012-01-01

    In this thesis we describe, combine and compare results of a series of meta-analyses on the prevalence of child sexual, physical, and emotional abuse and of physical and emotional neglect, including 244 publications and 577 prevalence rates for the various types of maltreatment. Child maltreatment r

  16. First ever production of a transactinide element in Switzerland

    Energy Technology Data Exchange (ETDEWEB)

    Jost, D.T.; Dressler, R.; Eichler, B.; Piguet, D.; Tuerler, A.; Gaeggeler, H.W. [Paul Scherrer Inst. (PSI), Villigen (Switzerland); Thoerle, P.; Trautmann, N.; Zauner, S. [Mainz Univ. (Germany)

    1997-09-01

    The transactinide element {sup 261}Rf was produced for the first time at the PSI Phillips cyclotron in the reaction {sup 244}Pu({sup 22}Ne,5n). At bombarding energy of 116 MeV the production cross section was 3 nb. (author) 2 figs., 1 tab., 1 ref.

  17. Aerospace medicine and biology. A continuing bibliography with indexes

    International Nuclear Information System (INIS)

    This bibliography lists 244 reports, articles, and other documents introduced into the NASA scientific and technical information system in February 1981. Aerospace medicine and aerobiology topics are included. Listings for physiological factors, astronaut performance, control theory, artificial intelligence, and cybernetics are included

  18. EST Table: FS908617 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available FS908617 E_FL_fufe_14L20_F_0 10/09/28 92 %/242 aa ref|NP_001138804.1| lipid storage droplet 2-li ... LIN [Bombyx mori] 10/09/12 40 %/203 aa FBpp0110268|Lsd -2-PB 10/08/29 n.h 10/09/10 39 %/244 aa AGAP000167- ...

  19. Disease: H01327 [KEGG MEDICUS

    Lifescience Database Archive (English)

    Full Text Available often accompanied by fever, sore throat, and pain on swallowing. Infectious disease Human enterovirus A [VG...erovirus 71 in Taiwan, 1998-2005. Pediatrics 120:e244-52 (2007) ... ... Wang ST, Cheng YT, Yang JY Epidemiologic features of hand-foot-mouth disease and herpangina caused by ent

  20. Domain Modeling: NP_112562.3 [SAHG[Archive

    Lifescience Database Archive (English)

    Full Text Available NP_112562.3 chr17 Src kinase in complex with a quinazoline inhibitor c1fmka_ chr17/NP_112562.3/NP_112562....3_apo_71-521.pdb c2h8ha_ chr17/NP_112562.3/NP_112562.3_holo_71-521.pdb psi-blast 244F,

  1. AcEST: BP916979 [AcEST

    Lifescience Database Archive (English)

    Full Text Available ptional regulator, AraC family OS... 34 4.2 tr|B1JNC5|B1JNC5_YERPY Transcriptional regulator, AraC family OS...NYSEAVEWPELADRFALPLRTLHRQLKNKTGMTPQRYLTRLRLLQARHQLCYSDNS 238 Query: 244 VTNLFYLC 221 VT++ YLC Sbjct: 239 VTDIAYLC 246 >tr|B1JNC

  2. The Role of Moral Emotions in the Development of Children's Sharing Behavior

    Science.gov (United States)

    Ongley, Sophia F.; Malti, Tina

    2014-01-01

    This study investigated the role of moral emotions in the development of children's sharing behavior (N = 244 4-, 8-, and 12-year-old children). Children's sympathy was measured with both self- and primary caregiver-reports, and participants anticipated their negatively and positively valenced moral emotions (i.e., feeling guilty, sad,…

  3. Kvalitativní a kvantitativní psychologie

    Czech Academy of Sciences Publication Activity Database

    Říčan, Pavel

    1. vyd. Olomouc : Universita Palackého, 2005 - (Miovský, M.; Čermák, I.; Chrz, V.), s. 13-17 ISBN 80-244-1159-8 R&D Projects: GA ČR GA406/05/0940 Institutional research plan: CEZ:AV0Z70250504 Keywords : Methodology * Qualitative methods * Humanistic Psychology Subject RIV: AN - Psychology

  4. 75 FR 67383 - Extension of the Designation of Somalia for Temporary Protected Status

    Science.gov (United States)

    2010-11-02

    ... designation continue to be met. Armed conflict in Somalia is ongoing and, due to such conflict and other..., 1991, the Attorney General designated Somalia for TPS based on the ongoing armed conflict and extraordinary and temporary conditions within the country. 56 FR 46804. See section 244(a)(b)(1)(A) and (C)...

  5. Půdní makrofauna (Diplopoda, Chilopoda, Oniscidea) v podmínkách obnovených povodňových stavů v lučních a lesních biotopech jižní Moravy

    Czech Academy of Sciences Publication Activity Database

    Tajovský, Karel

    Olomouc: Univerzita Palackého v Olomouci, 2004, s. 289-297. ISBN 80-244-0942-9. [Říční krajina /2./. Olomouc (CZ), 10.11.2004] Institutional research plan: CEZ:AV0Z6066911 Keywords : soil macrofauna * restoration of flood conditions * South Moravia Subject RIV: EH - Ecology, Behaviour

  6. 78 FR 24239 - Temporary Mailing Promotion

    Science.gov (United States)

    2013-04-24

    ... that employ Full Service Intelligent Mail barcodes (IMb). The total value of the promotion will be... Periodicals, and Package Services Bound Printed Matter Flats (collectively, Qualifying Mail). Id. at 3. To be.... Pricing Class of mail authority (%) First-Class Mail 0.077 Standard Mail 0.158 Periodicals 0.244...

  7. Kelten

    Czech Academy of Sciences Publication Activity Database

    Krmnicek, S.; Mihailescu-Bîrliba, V.; Militký, Jiří; Nieto-Pelletier, S.; Ziegaus, B.

    Taormina : Arbor, 2015 - (Arnold-Biucch, C.; Caccamo Caltabiano, M.; Bland, R.), s. 244-277 ISBN 978-88-97805-42-7. - (International Association of Professional Numismatists. Special publication. 16). [International Numismatic Congress /15./. Taormina (IT), 20150921] Institutional support: RVO:67985955 Keywords : Czech Republic * Austria * Slovakia * Celts * coins Subject RIV: AB - History

  8. Dynamics of Acculturation, Enculturation, and Ethnic Identity: Influence of Psychocultural Constructs on Conscientiousness and Expectations of Higher Education among Latinos

    Science.gov (United States)

    Cano, Miguel Angel; Castillo, Linda G.; Davis, Matthew J.; Lopez-Arenas, Araceli; Vaquero, Juana; Thompson, Keisha V.; Saldivar, Isaac M.

    2012-01-01

    This study investigated the influence of psychocultural variables (e.g., acculturation, enculturation, ethnic identity) and personality characteristics in relation to educational expectations among 345 Latino middle school students in the U.S. Results from a path model indicate that 24.4% of the variance of educational expectations was accounted…

  9. 76 FR 46783 - Commission Information Collection Activities (FERC-549); Comment Request; Extension

    Science.gov (United States)

    2011-08-03

    ... and to monitor and evaluate transactions and operations of interstate pipelines and blanket marketing... activities and unbundled sales activities of interstate natural gas pipelines and blanket marketing... orders to which the price data may be relevant. \\2\\ 18 CFR 1c.1 and 1c.2, 71 FR 4,244 (2006). Failure...

  10. Psychologické souvislosti fyzikálních a fyziologických determinant výkonnosti člověka v kosmu

    Czech Academy of Sciences Publication Activity Database

    Poláčková Šolcová, Iva

    2012-01-01

    Roč. 56, č. 2 (2012), s. 119-131. ISSN 0009-062X R&D Projects: GA ČR(CZ) GAP407/11/2226 Institutional research plan: CEZ:AV0Z70250504 Keywords : spaceflight * microgravity * radiation * circadian rhythms * psychological adaptation Subject RIV: AN - Psychology Impact factor: 0.244, year: 2012

  11. Rozbor volby odpověďových kategorií v testu prostorové představivosti s využitím teorie odpovědi na položku

    Czech Academy of Sciences Publication Activity Database

    Květon, Petr; Jelínek, Martin; Vobořil, Dalibor; Klimusová, H.

    2012-01-01

    Roč. 56, č. 1 (2012), s. 31-40. ISSN 0009-062X R&D Projects: GA ČR GP406/09/P284 Institutional research plan: CEZ:AV0Z70250504 Keywords : nominal categories model * item response theory * distractor * test Subject RIV: AN - Psychology Impact factor: 0.244, year: 2012

  12. 76 FR 73783 - Residential, Business, and Wind and Solar Resource Leases on Indian Land

    Science.gov (United States)

    2011-11-29

    ... Native American Tribal Governments,'' Executive Order 13175 (59 FR 22951, November 6, 2000), and 512 DM 2.... (3) A 25 U.S.C. 477 corporate entity You must record documents in that holds the Indian land directly..., Notification of good New. 162.593. faith negotiations with holdover. 162.207, 162.242-244, 162.604(a),...

  13. TIR kolimační čočky pro LED diody

    Czech Academy of Sciences Publication Activity Database

    Palatka, Miroslav; Schovánek, Petr; Pech, Miroslav; Kočnar, Antonín; Hiklová, Helena; Havelková, Martina

    Olomouc: Univerzita Palackého v Olomouci, 2007 - (Křepelka, J.), s. 134-139 ISBN 978-80-244-1844-5 R&D Projects: GA MŠk(CZ) 1M06002 Institutional research plan: CEZ:AV0Z10100522 Keywords : TIR lens * LED optics Subject RIV: BH - Optics, Masers, Lasers

  14. Predictors and Outcomes of Parental Involvement with High School Students in Science

    Science.gov (United States)

    Shumow, Lee; Lyutykh, Elena; Schmidt, Jennifer A.

    2011-01-01

    Demographic and psychological predictors of parent involvement with their children's science education both at home and at school were examined during high school. Associations between both types of parent involvement and numerous academic outcomes were tested. Data were collected from 244 high school students in 12 different science classrooms…

  15. Heating of Large Industrial and Agricultural Buildings

    Czech Academy of Sciences Publication Activity Database

    Zajíček, Milan; Kic, Pavel

    Tartu: Estonian University of Life Sciences, 2014, s. 237-244. ISSN 1406-894X. [Biosystems Engineering 2014. Tartu (EE), 08.05.2014-09.05.2014] Institutional support: RVO:67985556 Keywords : energy * radiation * thermal comfort * simulation Subject RIV: GB - Machines ; Buildings for Agriculture http://library.utia.cas.cz/separaty/2014/VS/zajicek-0428055.pdf

  16. Shape measuring of ultralight mirrors

    Czech Academy of Sciences Publication Activity Database

    Pech, Miroslav; Hrabovský, Miroslav; Schovánek, Petr; Mandát, Dušan; Nožka, Libor

    Olomouc: Univerzita Palackého v Olomouci, 2007 - (Křepelka, J.), s. 146-150 ISBN 978-80-244-1844-5 R&D Projects: GA MŠk(CZ) 1M06002 Institutional research plan: CEZ:AV0Z10100522 Keywords : ultralight mirror * Hartmann test * Pierre Auger Subject RIV: BH - Optics, Masers, Lasers

  17. 8 CFR 1003.43 - Motions to reopen for suspension of deportation and cancellation of removal pursuant to section...

    Science.gov (United States)

    2010-01-01

    ... prima facie eligible for suspension of deportation pursuant to former section 244(a) of the Act (as in... LIFE Act Amendments, must establish that the alien: (1) Is prima facie eligible for suspension of... section and such person is prima facie eligible for and has applied for suspension of deportation...

  18. Prostor versus mapa. "Selhání mapy" jako topos a metafora v textech Terezy Brdečkové

    Czech Academy of Sciences Publication Activity Database

    Řezníková, Lenka

    Olomouc : Univerzita Palackého, 2012 - (Komenda, P.; Malinová, L.; Změlík, R.), s. 199-208 ISBN 978-80-244-3023-2. - (Günther. 7) Institutional support: RVO:67985955 Keywords : space * map * mapping * literary representation of the space * map failure Subject RIV: AA - Philosophy ; Religion

  19. Prostory paměti jakožto klíčový pojem v koncepci kulturní paměti Aleidy Assmannové (a kontext dalších kulturně teoretických přístupů)

    Czech Academy of Sciences Publication Activity Database

    Flanderka, Jakub

    Olomouc: Univerzita Palackého, 2012 - (Komenda, P.; Malinová, L.; Změlík, R.), s. 217-221. (Günther. 7). ISBN 978-80-244-3023-2 Institutional research plan: CEZ:AV0Z90560517 Keywords : theory of literature * cultural memory * Assman, Aleida Subject RIV: AJ - Letters, Mass-media, Audiovision

  20. Households Touched by Crime, 1987. Bureau of Justice Statistics Bulletin.

    Science.gov (United States)

    Rand, Michael R.; And Others

    For the year 1987, 24.4 % of American households were touched by crime. A household is considered touched by crime if during the year it was affected by a burglarly, auto theft, or household theft or if a household member was raped, robbed, or assaulted or was a victim of personal theft, no matter where the crime occurred. These offenses, which…

  1. Optical 3D methods for the measurement of wear in total hip arthroplasty: principles and results

    Czech Academy of Sciences Publication Activity Database

    Rössler, T.; Gallo, J.; Hrabovský, Miroslav; Pochmon, Michal; Mandát, Dušan; Havránek, Vítězslav

    Olomouc : Univerzita Palackého v Olomouci, 2007 - (Křepelka, J.), s. 155-159 ISBN 978-80-244-1844-5 R&D Projects: GA MŠk(CZ) 1M06002 Institutional research plan: CEZ:AV0Z10100522 Keywords : prosthetic wear * total hip arthroplasty * optical profilometry Subject RIV: BH - Optics, Masers, Lasers

  2. Prevalence of electrocardiographic ST-T changes during acute ischemic stroke in patients without known ischemic heart disease

    DEFF Research Database (Denmark)

    Jensen, Jesper K; Bak, Søren; Flemming Høilund-Carlsen, Poul;

    2008-01-01

    We evaluated characteristics and prevalence of ST-segment depression and/or T-wave inversion in the resting electrocardiogram of 244 consecutive patients with acute ischemic stroke, but without ischemic heart disease. The prevalence of ST-T changes ranged from 13% to 16% and this is what to expect...

  3. Magnetic Moment of Vector Mesons in the Background Field Method

    CERN Document Server

    Lee, F X; Wilcox, Walter

    2007-01-01

    We report some results for the magnetic moments of vector mesons extracted from mass shifts in the presence of static external magnetic fields. The calculations are done on $24^4$ quenched lattices using standard Wilson actions, with $\\beta$=6.0 and pion mass down to 500 MeV. The results are compared to those from the form factor method.

  4. 36 CFR 6.8 - National Park Service solid waste responsibilities.

    Science.gov (United States)

    2010-07-01

    ... will ensure full compliance with regulations at 40 CFR part 244, Solid Waste Management Guidelines For..., DEPARTMENT OF THE INTERIOR SOLID WASTE DISPOSAL SITES IN UNITS OF THE NATIONAL PARK SYSTEM § 6.8 National Park Service solid waste responsibilities. (a) Beginning one year after January 23, 1995,...

  5. Realita nadreality

    Czech Academy of Sciences Publication Activity Database

    Bydžovská, Lenka

    Řevnice : Arbor vitae , 2011 - (Rousová, H.), s. 223-244 ISBN 978-80-87164-64-8 Institutional research plan: CEZ:AV0Z80330511 Keywords : Czech avant-garde * surrealism Subject RIV: AL - Art, Architecture, Cultural Heritage

  6. The Shared Traumatic and Professional Posttraumatic Growth Inventory

    Science.gov (United States)

    Tosone, Carol; Bauwens, Jennifer; Glassman, Marc

    2016-01-01

    Purpose: While there are established instruments offering psychometrically sound measurement of primary or secondary trauma, none capture the essence of dual exposure for mental health professionals living and working in traumatological environments. Methods: This study examined the experience of 244 mental health workers who lived and worked in…

  7. Fission Xenon on Mars

    Science.gov (United States)

    Mathew, K. J.; Marti, K.; Marty, B.

    2002-01-01

    Fission Xe components due to Pu-244 decay in the early history of Mars have been identified in nakhlites; as in the case of ALH84001 and Chassigny the fission gas was assimilated into indigenous solar-type Xe. Additional information is contained in the original extended abstract.

  8. Different for Girls? An Exploration of the Impact of "Playing for Success."

    Science.gov (United States)

    Sharp, Caroline; Kendall, Lesley; Schagen, Ian

    2003-01-01

    A program providing study support to underachieving youth using British football as a motivator was evaluated by comparing 1,247 participants and 244 controls. The program helped raise achievement and seemed equally effective for males and females. There was no evidence that the sports emphasis marginalized girls or ethnic minorities. (Contains 25…

  9. Kombinace dvojlomných materiálů pro achromatické fázové destičky

    Czech Academy of Sciences Publication Activity Database

    Melich, Radek

    2011-01-01

    Roč. 56, č. 9 (2011), s. 242-244. ISSN 0447-6441 R&D Projects: GA MŠk(CZ) ED2.1.00/03.0079 Institutional research plan: CEZ:AV0Z20430508 Keywords : Phasic wafers * achromatic wafers * birefringent materials Subject RIV: BH - Optics, Masers, Lasers

  10. Rozvíjení profesních kompetencí učitelů

    Czech Academy of Sciences Publication Activity Database

    Tichá, Marie

    Olomouc : Univerzita Palackého v Olomouci, 2012 - (Uhlířová, M.), s. 25-29 ISBN 978-80-244-3048-5. [Elementary Mathematics Education 2012. Olomouc (CZ), 25.04.2012-27.04.2012] Institutional support: RVO:67985840 Keywords : professional competence * subject didactical competence * pedagogical content knowledge * mathematical literacy Subject RIV: AM - Education

  11. Electrical and chemical signals involved in short-term systemic photosynthetic responses of tobacco plants to local burning

    Czech Academy of Sciences Publication Activity Database

    Hlaváčková, V.; Krchňák, P.; Nauš, J.; Novák, Ondřej; Špundová, M.; Strnad, Miroslav

    2006-01-01

    Roč. 225, č. 1 (2006), s. 235-244. ISSN 0032-0935 R&D Projects: GA ČR GA206/05/0894 Institutional research plan: CEZ:AV0Z50380511 Keywords : Abscisic acid * Electrical signals * Gas exchange Subject RIV: CE - Biochemistry Impact factor: 2.963, year: 2006

  12. Population status, habitat associations, and distribution of the steppe polecat Mustela eversmanii in Europe

    Czech Academy of Sciences Publication Activity Database

    Šálek, Martin; Spassov, N.; Anděra, M.; Enzinger, K.; Ottlecz, B.; Hegyeli, Z.

    2013-01-01

    Roč. 58, č. 3 (2013), s. 233-244. ISSN 0001-7051 Institutional support: RVO:68081766 Keywords : Steppe polecat * Mustela eversmanii * Distribution * Habitat associations * Population status * Europe Subject RIV: EG - Zoology Impact factor: 1.161, year: 2013

  13. Čeština „dlouhého 16. století“: kontexty

    Czech Academy of Sciences Publication Activity Database

    Vykypělová, Taťána

    Olomouc : Univerzita Palackého v Olomouci, 2013 - (Dittmann, R.; Uličný, O.), s. 26-40 ISBN 978-80-244-3549-7 Institutional support: RVO:68378092 Keywords : Czech language * Czech Grammar Subject RIV: AI - Linguistics

  14. SEDIMENT TOXICITY AND COMMUNITY COMPOSITION OF BENTHOS AND COLONIZED PERIPHYTON IN THE EVERGLADES - FLORIDA BAY TRANSITIONAL ZONE.

    Science.gov (United States)

    Lewis, Michael A., Larry R. Goodman, John M. Macauley and James C. Moore. 2004. Sediment Toxicity and Community Composition of Benthos and Colonized Periphyton in the Everglades-Florida Bay Transitional Zone. Ecotoxicology. 13(3):231-244. (ERL,GB 1164). This survey provid...

  15. Species richness of arbuscular mycorrhizal fungi: associations with grassland plant richness and biomass

    Czech Academy of Sciences Publication Activity Database

    Hiiesalu, Inga; Pärtel, M.; Davison, J.; Gerhold, P.; Metsis, M.; Moora, M.; Öpik, M.; Vasar, M.; Zobel, M.; Wilson, S. D.

    2014-01-01

    Roč. 203, č. 1 (2014), s. 233-244. ISSN 1469-8137 R&D Projects: GA MŠk EE2.3.30.0048 Institutional research plan: CEZ:AV0Z60050516 Institutional support: RVO:67985939 Keywords : belowground plant richness * diversity * productivity Subject RIV: EH - Ecology, Behaviour Impact factor: 6.373, year: 2013

  16. Towards a Unified Formulation of Dynamics and Thermodynamics. II. Dissipative Processes and Entropy Production

    Czech Academy of Sciences Publication Activity Database

    Paidarová, Ivana; Durand, P.

    2011-01-01

    Roč. 111, č. 2 (2011), s. 237-244. ISSN 0020-7608 R&D Projects: GA AV ČR IAA100400501; GA AV ČR IAA401870702 Institutional research plan: CEZ:AV0Z40400503 Keywords : irreversible thermodynamics * fluctuations * chemical kinetics Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 1.357, year: 2011

  17. 10 CFR Appendix D to Subpart B of... - Uniform Test Method for Measuring the Energy Consumption of Clothes Dryers

    Science.gov (United States)

    2010-01-01

    ... should be taped to avoid air leakage. Disconnect all console light or other lighting systems on the... of the measured value. 2.4.4Dry and wet bulb psychrometer. The dry and wet bulb psychrometer shall... pilot light—the cubic feet of gas, Epg, consumed by the gas pilot light in one hour. 3.4.6.4Correct...

  18. Gclust Server: 68961 [Gclust Server

    Lifescience Database Archive (English)

    Full Text Available ace protein required for swimming motility 1 1.00e-06 0.0 0.0 4.0 0.0 0.0 0.0 Show 68961 Cluster ID 68961 Se...quences(244) Sequence length 835 Representative annotation SwmA-cell surface protein required for swimming

  19. Gender, Previous Knowledge, Personality Traits and Subject-Specific Motivation as Predictors of Students' Math Grade in Upper-Secondary School

    Science.gov (United States)

    Peklaj, Cirila; Podlesek, Anja; Pecjak, Sonja

    2015-01-01

    The aim of the study was to examine the relationships between gender, previous knowledge, different personality traits, subject-specific motivational dimensions and students' math grade in secondary school. A total of 386 first-year students (142 boys and 244 girls) from secondary schools in Slovenia (mean age was 15.7 years) participated in the…

  20. Self-Reported History of Sexual Coercion and Rape Negatively Impacts Resilience to Suicide among Women Students

    Science.gov (United States)

    Segal, Daniel L.

    2009-01-01

    A substantial literature has documented that sexual abuse relates to suicidal behaviors but relatively less is known about resilience to suicide, especially cognitive deterrents to suicide. The present study investigated the effects of a history of sexual victimization on reasons for living. Female participants (N = 138; M age = 24.4 years; SD =…