WorldWideScience

Sample records for berkelium 243

  1. Chemistry of berkelium: a review

    International Nuclear Information System (INIS)

    Hobart, D.E.; Peterson, J.R.

    1985-01-01

    Element 97 was first produced in December 1949, by the bombardment of americium-241 with accelerated alpha particles. This new element was named berkelium (Bk) after Berkeley, California, the city of its discovery [Thompson, Ghiorso, and Seaborg, Phys. Rev. 77, 838 (1950); 80, 781 (1950)]. In the 36 years since the discovery of Bk, a substantial amount of knowledge concerning the physicochemical properties of this relatively scarce transplutonium element has been acquired. All of the Bk isotopes of mass numbers 240 and 242 through 251 are presently known, but only berkelium-249 (β - decay, 0.125 MeV, t/sub 1/2/ = 325 days) is available in sufficient quantities for bulk chemical studies. About 0.7 gram of this isotope has been isolated at the HFIR/TRU Complex in Oak Ridge, Tennessee in the last 18 years. Over the same time period, the scale of experimental work using berkelium-249 has increased from the tracer level to bulk studies at the microgram level to solution and solid state investigations with milligram quantities. Extended knowledge of the physicochemical behavior of berkelium is important in its own right, because Bk is the first member of the second half of the actinide series. In addition, such information should enable more accurate extrapolations to the predicted behavior of heavier elements for which experimental studies are severely limited by lack of material and/or by intense radioactivity

  2. Berkelium (4) and cerium (4) extraction with tertiary amines

    International Nuclear Information System (INIS)

    Milyukova, M.S.; Malikov, D.A.; Myasoedov, B.V.

    1978-01-01

    Oxidation of indicator quantities of berkelium and cerium by a mixture of silver nitrate and ammonium persulfate in the solutions of nitric and sulfuric acid has been examined. The stability of the elements in a tetravalent state and their extraction by the solutions of ternary amines have been investigated. It has been established that berkelium and cerium oxidation under these conditions occurs under the effect of ions of divalent silver which is formed owing to oxidation of monovalent silver by peroxide sulfate ions. The following supposition has been put forward: a difference in the behaviour of tetravalent berkelium and cerium during their extraction by ternary amines is explained by their different stability in this state, but not by the formation of complex compounds with nitrate ions

  3. Citric complexes of trivalent cerium and berkelium

    International Nuclear Information System (INIS)

    Boulhassa, S.

    1977-01-01

    The extraction by thenoyltrifluoroacetone (TTA) in benzene of trivalent cerium, berkelium and californium, at the indicator scale, hydrolysis and complexation by citric acid of these cations are studied. The radionuclides used were 144 Ce, 249 Bk and 249 Cf respectively γ, β and α emitters. The solvent extraction technique of the elements by TTA in benzene from a perchloric medium at the ionic stength 0.1 was employed. The distribution coefficients D were measured by the γ, β or α radiometry. Cerium and berkelium, which have a comparable redox behavior, show in solution a relatively stable valency IV. Therefore the study by solvent extraction of their trivalent form required the standing up of complete reducing conditions of these elements and their stabilization in solution at the valency III. The thermodynamic data obtained for berkelium and californium contribute to understand the chemistry of these elements and permit to complete the third 'tetrad branch' of 5f elements from Cm 3+ to Es 3+ . This tetrad effect is a manifestation of thermodynamic consequence of the 'nephelauxetic effect'. As for Ce(III), the data confirm the pronounced acid property and may be show no neglected ligand effect for f 1 configuration [fr

  4. Chelation and stabilization of berkelium in oxidation state +IV

    Science.gov (United States)

    Deblonde, Gauthier J.-P.; Sturzbecher-Hoehne, Manuel; Rupert, Peter B.; An, Dahlia D.; Illy, Marie-Claire; Ralston, Corie Y.; Brabec, Jiri; de Jong, Wibe A.; Strong, Roland K.; Abergel, Rebecca J.

    2017-09-01

    Berkelium (Bk) has been predicted to be the only transplutonium element able to exhibit both +III and +IV oxidation states in solution, but evidence of a stable oxidized Bk chelate has so far remained elusive. Here we describe the stabilization of the heaviest 4+ ion of the periodic table, under mild aqueous conditions, using a siderophore derivative. The resulting Bk(IV) complex exhibits luminescence via sensitization through an intramolecular antenna effect. This neutral Bk(IV) coordination compound is not sequestered by the protein siderocalin—a mammalian metal transporter—in contrast to the negatively charged species obtained with neighbouring trivalent actinides americium, curium and californium (Cf). The corresponding Cf(III)-ligand-protein ternary adduct was characterized by X-ray diffraction analysis. Combined with theoretical predictions, these data add significant insight to the field of transplutonium chemistry, and may lead to innovative Bk separation and purification processes.

  5. Possible stabilization of the tetravalent oxidation state of berkelium and californium in acetonitrile with triphenylarsine oxide

    International Nuclear Information System (INIS)

    Payne, G.F.; Peterson, J.R.

    1987-01-01

    It appears that we may have prepared Bk(IV) nitrate.nTPAs0 and Bk(IV) perchlorate.nTPAs0 complexes which formed the corresponding Cf(IV) complexes through the beta decay of Bk-249. Definitive proof should come from similar experiments with quantities of Bk-249 large enough to allow spectrophotometric detection of the characteristic f→f transitions in these berkelium and californium species. It is clear, however, that TPAs0 and acetonitrile can play a pivotal role in the stabilization of lanact(IV) species

  6. 243Cm half-life determinaton

    International Nuclear Information System (INIS)

    Timofeev, G.A.; Kalygin, V.V.; Privalova, P.A.

    1986-01-01

    By molar ratios of 243 Cm mixture with 244 Cm and Pu nuclides formed as a result of Cm nuclides α-decay the 243 Cm half-life T α243 is determined. The 244 Cm half-life is measured earlier with high accuracy. The 243 Cm/ 244 Cm ratio measured by means of a mass spectrometer equals 0.989+-0.004. The obtained value T α243 =29.20+-0.14 years

  7. 40 CFR 243.201 - Safety.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 24 2010-07-01 2010-07-01 false Safety. 243.201 Section 243.201 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) SOLID WASTES GUIDELINES FOR THE STORAGE... Procedures § 243.201 Safety. ...

  8. 48 CFR 243.204 - Administration.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Administration. 243.204... OF DEFENSE CONTRACT MANAGEMENT CONTRACT MODIFICATIONS Change Orders 243.204 Administration. Follow the procedures at PGI 243.204 for administration of change orders. [75 FR 48277, Aug. 10, 2010] ...

  9. Dicty_cDB: SLH243 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SL (Link to library) SLH243 (Link to dictyBase) - - - Contig-U15469-1 SLH243P (Link to Original site) SLH2...43F 436 SLH243Z 369 SLH243P 805 - - Show SLH243 Library SL (Link to library) Clone ID SLH2... URL http://dictycdb.biol.tsukuba.ac.jp/CSM/SL/SLH2-B/SLH243Q.Seq.d/ Representative seq. ID SLH2...43P (Link to Original site) Representative DNA sequence >SLH243 (SLH243Q) /CSM/SL/SLH2-B/SLH2...SA605. 785 0.0 1 ( AU062023 ) Dictyostelium discoideum slug cDNA, clone SLH243. 785 0.0 1 ( BJ416791 ) Dicty

  10. 40 CFR 243.204 - Collection management.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 24 2010-07-01 2010-07-01 false Collection management. 243.204 Section 243.204 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) SOLID WASTES GUIDELINES... and Recommended Procedures § 243.204 Collection management. ...

  11. 49 CFR 192.243 - Nondestructive testing.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 3 2010-10-01 2010-10-01 false Nondestructive testing. 192.243 Section 192.243... BY PIPELINE: MINIMUM FEDERAL SAFETY STANDARDS Welding of Steel in Pipelines § 192.243 Nondestructive testing. (a) Nondestructive testing of welds must be performed by any process, other than trepanning, that...

  12. 7 CFR 58.243 - Checking quality.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 3 2010-01-01 2010-01-01 false Checking quality. 58.243 Section 58.243 Agriculture... Procedures § 58.243 Checking quality. All milk, milk products and dry milk products shall be subject to inspection and analysis by the dairy plant for quality and condition throughout each processing operation...

  13. 43 CFR 24.3 - General jurisdictional principles.

    Science.gov (United States)

    2010-10-01

    ... 43 Public Lands: Interior 1 2010-10-01 2010-10-01 false General jurisdictional principles. 24.3 Section 24.3 Public Lands: Interior Office of the Secretary of the Interior DEPARTMENT OF THE INTERIOR FISH AND WILDLIFE POLICY: STATE-FEDERAL RELATIONSHIPS § 24.3 General jurisdictional principles. (a) In...

  14. 12 CFR 24.3 - Public welfare investments.

    Science.gov (United States)

    2010-01-01

    ... 12 Banks and Banking 1 2010-01-01 2010-01-01 false Public welfare investments. 24.3 Section 24.3... DEVELOPMENT ENTITIES, COMMUNITY DEVELOPMENT PROJECTS, AND OTHER PUBLIC WELFARE INVESTMENTS § 24.3 Public welfare investments. A national bank or national bank subsidiary may make an investment directly or...

  15. 20 CFR 243.4 - Taxation of benefits.

    Science.gov (United States)

    2010-04-01

    ... 20 Employees' Benefits 1 2010-04-01 2010-04-01 false Taxation of benefits. 243.4 Section 243.4 Employees' Benefits RAILROAD RETIREMENT BOARD REGULATIONS UNDER THE RAILROAD RETIREMENT ACT TRANSFER, ASSIGNMENT, OR WAIVER OF PAYMENTS § 243.4 Taxation of benefits. (a) Annuities paid by the Board are subject...

  16. 7 CFR 1220.243 - Confidential treatment.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 10 2010-01-01 2010-01-01 false Confidential treatment. 1220.243 Section 1220.243 Agriculture Regulations of the Department of Agriculture (Continued) AGRICULTURAL MARKETING SERVICE (MARKETING... Confidential treatment. Except as otherwise provided in the Act, financial or commercial information that is...

  17. Dicty_cDB: VHP243 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHP243 (Link to dictyBase) - - - Contig-U16236-1 - (Link to Or...iginal site) VHP243F 134 - - - - - - Show VHP243 Library VH (Link to library) Clone ID VHP243 (Link to dicty...Base) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16236-1 Original site URL http://dictycdb.b...AXXXXXXXXXX sequence update 2002.10.25 Translated Amino Acid sequence CWPTGIXKTTICT...kilsif*ynfkyyqqpkkk--- Frame B: llaywyxqnnnlyqyyyyfyl*kyflsfniilniinnpkk--- Frame C: CWPTGIXKTTICTNTTIISICKN

  18. 40 CFR 86.243-94 - [Reserved

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 18 2010-07-01 2010-07-01 false [Reserved] 86.243-94 Section 86.243-94 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) AIR PROGRAMS (CONTINUED) CONTROL OF... Year Gasoline-Fueled New Light-Duty Vehicles, New Light-Duty Trucks and New Medium-Duty Passenger...

  19. 27 CFR 24.243 - Filtering aids.

    Science.gov (United States)

    2010-04-01

    ... 27 Alcohol, Tobacco Products and Firearms 1 2010-04-01 2010-04-01 false Filtering aids. 24.243... OF THE TREASURY LIQUORS WINE Storage, Treatment and Finishing of Wine § 24.243 Filtering aids. Inert fibers, pulps, earths, or similar materials, may be used as filtering aids in the cellar treatment and...

  20. 49 CFR 372.243 - Controlling distances and population data.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 5 2010-10-01 2010-10-01 false Controlling distances and population data. 372.243 Section 372.243 Transportation Other Regulations Relating to Transportation (Continued) FEDERAL MOTOR... EXEMPTIONS, COMMERCIAL ZONES, AND TERMINAL AREAS Commercial Zones § 372.243 Controlling distances and...

  1. 42 CFR 456.243 - Content of medical care evaluation studies.

    Science.gov (United States)

    2010-10-01

    ... 42 Public Health 4 2010-10-01 2010-10-01 false Content of medical care evaluation studies. 456.243 Section 456.243 Public Health CENTERS FOR MEDICARE & MEDICAID SERVICES, DEPARTMENT OF HEALTH AND HUMAN... Ur Plan: Medical Care Evaluation Studies § 456.243 Content of medical care evaluation studies. Each...

  2. 12 CFR 19.243 - Removal, suspension, or debarment.

    Science.gov (United States)

    2010-01-01

    ... 12 Banks and Banking 1 2010-01-01 2010-01-01 false Removal, suspension, or debarment. 19.243 Section 19.243 Banks and Banking COMPTROLLER OF THE CURRENCY, DEPARTMENT OF THE TREASURY RULES OF PRACTICE AND PROCEDURE Removal, Suspension, and Debarment of Accountants From Performing Audit Services § 19...

  3. 48 CFR 243.204-70-2 - Price ceiling.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Price ceiling. 243.204-70..., DEPARTMENT OF DEFENSE CONTRACT MANAGEMENT CONTRACT MODIFICATIONS Change Orders 243.204-70-2 Price ceiling. Unpriced change orders shall include a not-to-exceed price. [75 FR 48277, Aug. 10, 2010] ...

  4. 14 CFR 243.15 - Conflict with foreign laws.

    Science.gov (United States)

    2010-01-01

    ... 14 Aeronautics and Space 4 2010-01-01 2010-01-01 false Conflict with foreign laws. 243.15 Section... PROCEEDINGS) ECONOMIC REGULATIONS PASSENGER MANIFEST INFORMATION § 243.15 Conflict with foreign laws. (a) If a... portion of this part is not required because of a conflict with applicable foreign law. [Doc. No. OST-95...

  5. 30 CFR 243.202 - When will MMS monitor my financial solvency?

    Science.gov (United States)

    2010-07-01

    ... you ask us to consult a business-information or credit-reporting service or program under § 243.201(c...? 243.202 Section 243.202 Mineral Resources MINERALS MANAGEMENT SERVICE, DEPARTMENT OF THE INTERIOR MINERALS REVENUE MANAGEMENT SUSPENSIONS PENDING APPEAL AND BONDING-MINERALS REVENUE MANAGEMENT Financial...

  6. Gclust Server: 243 [Gclust Server

    Lifescience Database Archive (English)

    Full Text Available 243 CEL_K07E3.3_17568735 Cluster Sequences Related Sequences(40) 303 dao-3: Dauer or Aging... sequences Related Sequences(40) Sequence length 303 Representative annotation dao-3: Dauer or Aging

  7. 39 CFR 243.2 - Quarters.

    Science.gov (United States)

    2010-07-01

    ... UNITED STATES POSTAL SERVICE ORGANIZATION AND ADMINISTRATION CONDUCT OF OFFICES § 243.2 Quarters. (a.... Postal Service, General Accounting Office Building, Washington, DC 20260, with a memorandum of... depositing mail in front of or next to the post office. Show collection time schedules on letterboxes. At...

  8. Functional annotation of the genome unravels probiotic potential of Bacillus coagulans HS243.

    Science.gov (United States)

    Kapse, N G; Engineer, A S; Gowdaman, V; Wagh, S; Dhakephalkar, P K

    2018-05-30

    Spore forming Bacillus species are widely used as probiotics for human dietary supplements and in animal feeds. However, information on genetic basis of their probiotic action is obscure. Therefore, the present investigation was undertaken to elucidate probiotic traits of B. coagulans HS243 through its genome analysis. Genome mining revealed the presence of an arsenal of marker genes attributed to genuine probiotic traits. In silico analysis of HS243 genome revealed the presence of multi subunit ATPases, ADI pathway genes, chologlycine hydrolase, adhesion proteins for surviving and colonizing harsh gastric transit. HS243 genome harbored vitamin and essential amino acid biosynthetic genes, suggesting the use of HS243 as a nutrient supplement. Bacteriocin producing genes highlighted the disease preventing potential of HS243. Thus, this work established that HS243 possessed the genetic repertoire required for surviving harsh gastric transit and conferring health benefits to the host which were further validated by wet lab evidences. Copyright © 2018. Published by Elsevier Inc.

  9. 5 CFR 591.243 - How many members are on each COLA Advisory Committee?

    Science.gov (United States)

    2010-01-01

    ... 5 Administrative Personnel 1 2010-01-01 2010-01-01 false How many members are on each COLA Advisory Committee? 591.243 Section 591.243 Administrative Personnel OFFICE OF PERSONNEL MANAGEMENT CIVIL... Areas Program Administration § 591.243 How many members are on each COLA Advisory Committee? A COLA...

  10. 30 CFR 243.201 - How will MMS determine if I am financially solvent?

    Science.gov (United States)

    2010-07-01

    ... Section by one of the methods in § 243.200(a): (1) A written request asking us to consult a business... active appeals. (d) If you request that we consult a business-information or credit-reporting service or... solvent? 243.201 Section 243.201 Mineral Resources MINERALS MANAGEMENT SERVICE, DEPARTMENT OF THE INTERIOR...

  11. Fission-product yields for thermal-neutron fission of curium-243

    International Nuclear Information System (INIS)

    Breederland, D.G.

    1982-01-01

    Cumulative fission yields for 25 gamma rays emitted during the decay of 23 fission products produced by thermal-neutron fission of 243 Cm have been determined. Using Ge(Li) spectroscopy, 33 successive pulse-height spectra of gamma rays emitted from a 77-ng sample of 243 Cm over a period of approximately two and one-half months were analyzed. Reduction of these spectra resulted in the identification and matching of gamma-ray energies and half-lives to specific radionuclides. Using these results, 23 cumulative fission-product yields were calculated. Only those radionuclides having half-lives between 6 hours and 65 days were observed. Prior to this experiment, no fission-product yields had been recorded for 243 Cm

  12. Review of fission product yields and delayed neutron data for the actinides NP-237, PU-242, AM-242M, AM-243, CM-243 and CM-245

    International Nuclear Information System (INIS)

    Mills, R.W.

    1990-07-01

    A review of fission product yields and delayed neutron data for Np-237, Pu-242, Am-242m, Am-243, Cm-243 and Cm-245 has been undertaken. Gaps in understanding and inconsistencies in existing data were identified and priority areas for further experimental, theoretical and evaluation investigation detailed

  13. Käibemaksu maksmine maksab 243 miljonit

    Index Scriptorium Estoniae

    2005-01-01

    Poliitikauuringute keskuse PRAXIS uurimus näitas, et Eesti ettevõtetel kulub käibemaksu administreerimisele ja seadustega kursis hoidmisele aastas kokku 243 miljonit krooni, mis võrdub 0,25% SKP-st. Tabel: Suurim kulu ettevõtetele on enda kursishoidmine käibemaksuküsimustes. Vt. samas: Kuidas PRAXIS halduskoormust hindas

  14. 40 CFR 98.243 - Calculating GHG emissions.

    Science.gov (United States)

    2010-07-01

    ... feedstock). (MWf)i = Molecular weight of gaseous feedstock i (kg/kg-mole). MVC = Molar volume conversion... (CONTINUED) MANDATORY GREENHOUSE GAS REPORTING Petrochemical Production § 98.243 Calculating GHG emissions. (a) If you route all process vent emissions and emissions from combustion of process off-gas to one...

  15. 3-Amino-1,2,4-triazolium ion in [24(3at)]Cl and [24(3at)]2SnCl6·H2O. Comparative X-ray, vibrational and theoretical studies

    Science.gov (United States)

    Daszkiewicz, Marek; Marchewka, Mariusz K.

    2012-09-01

    Crystal structures of 3-amino-1,2,4-triazolium chloride and bis(3-amino-1,2,4-triazolium) hexachloridostannate monohydrate were determined by means of X-ray single crystal diffraction. The route of protonation of organic molecule and tautomer equilibrium constants for the cationic forms were calculated using B3LYP/6-31G* method. The most stable protonated species is 2,4-H2-3-amino-1,2,4-triazolium ion, 24(3at)+. Very good agreement between theoretical and experimental frequencies was achieved due to very weak interactions existing in studied compounds. Significantly weaker intermolecular interactions are found in [24(3at)]2SnCl6·H2O than in [24(3at)]Cl. The differences in strength of interactions are manifested in red and blue shifts for stretching and bending motions, respectively. PED calculations show that for 24(3at)+ ion the stretching type of motion of two Nringsbnd H bonds is independent, whereas bending is coupled.

  16. 48 CFR 52.243-6 - Change Order Accounting.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 2 2010-10-01 2010-10-01 false Change Order Accounting....243-6 Change Order Accounting. As prescribed in 43.205(f), the contracting officer may insert a clause, substantially the same as follows: Change Order Accounting (APR 1984) The Contracting Officer may require change...

  17. 48 CFR 52.243-2 - Changes-Cost-Reimbursement.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 2 2010-10-01 2010-10-01 false Changes-Cost-Reimbursement....243-2 Changes—Cost-Reimbursement. As prescribed in 43.205(b)(1), insert the following clause. The 30-day period may be varied according to agency procedures. Changes—Cost-Reimbursement (AUG 1987) (a) The...

  18. 40 CFR 61.243-2 - Alternative standards for valves in VHAP service-skip period leak detection and repair.

    Science.gov (United States)

    2010-07-01

    ... VHAP service-skip period leak detection and repair. 61.243-2 Section 61.243-2 Protection of Environment... AIR POLLUTANTS National Emission Standard for Equipment Leaks (Fugitive Emission Sources) § 61.243-2 Alternative standards for valves in VHAP service—skip period leak detection and repair. (a)(1) An owner or...

  19. 48 CFR 52.243-1 - Changes-Fixed-Price.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 2 2010-10-01 2010-10-01 false Changes-Fixed-Price. 52....243-1 Changes—Fixed-Price. As prescribed in 43.205(e), insert the following clause: Changes—Fixed-Price (AUG 1987) (a) The Contracting Officer may at any time, by written order, and without notice to...

  20. CL316,243, a β3-adrenergic receptor agonist, induces muscle hypertrophy and increased strength.

    Science.gov (United States)

    Puzzo, Daniela; Raiteri, Roberto; Castaldo, Clotilde; Capasso, Raffaele; Pagano, Ester; Tedesco, Mariateresa; Gulisano, Walter; Drozd, Lisaveta; Lippiello, Pellegrino; Palmeri, Agostino; Scotto, Pietro; Miniaci, Maria Concetta

    2016-11-22

    Studies in vitro have demonstrated that β3-adrenergic receptors (β3-ARs) regulate protein metabolism in skeletal muscle by promoting protein synthesis and inhibiting protein degradation. In this study, we evaluated whether activation of β3-ARs by the selective agonist CL316,243 modifies the functional and structural properties of skeletal muscles of healthy mice. Daily injections of CL316,243 for 15 days resulted in a significant improvement in muscle force production, assessed by grip strength and weight tests, and an increased myofiber cross-sectional area, indicative of muscle hypertrophy. In addition, atomic force microscopy revealed a significant effect of CL316,243 on the transversal stiffness of isolated muscle fibers. Interestingly, the expression level of mammalian target of rapamycin (mTOR) downstream targets and neuronal nitric oxide synthase (NOS) was also found to be enhanced in tibialis anterior and soleus muscles of CL316,243 treated mice, in accordance with previous data linking β3-ARs to mTOR and NOS signaling pathways. In conclusion, our data suggest that CL316,243 systemic administration might be a novel therapeutic strategy worthy of further investigations in conditions of muscle wasting and weakness associated with aging and muscular diseases.

  1. Measurement of the 243Am capture cross section at the n{sub T}OF facility; Medida de la sección eficaz de captura del 243Am en la instalación n{sub T}OF

    Energy Technology Data Exchange (ETDEWEB)

    Mendoza Cembranos, E.

    2014-07-01

    Nuclear data for minor actinides are necessary for improving the design and performance of advanced reactors and transmutation devices for the incineration of radioactive nuclear waste [Sal08, Gon09, Ali04, Ali06]. In particular, the 243Am isotope is relevant since it is the minor actinide which contributes more to the radiotoxicity of the nuclear waste between s3 03 and s3 04 years. In addition, the neutron capture in 243Am is the main gate to the creation of 244Cm and higher mass isotopes. The purpose of the this work is to provide experimental data on the 243Am(n, ) for improving the current evaluations. At present, there is no published neutron capture measurement of 243Am below 250 eV, and all the existing evaluations of the elastic and capture cross sections are based essentially on a single transmission measurement [Sim74]. Above 250 eV there are only a few capture measurements available [Wes85, Wis83], which show discrepancies that make them incompatible. Due to the lack of experimental data on 243Am the standard ENDF-6 format libraries present sizeable di rences between each other...(Author)

  2. 27 CFR 46.243 - Articles at multiple locations.

    Science.gov (United States)

    2010-04-01

    ... 27 Alcohol, Tobacco Products and Firearms 2 2010-04-01 2010-04-01 false Articles at multiple... Cigarette Tubes Held for Sale on April 1, 2009 Records § 46.243 Articles at multiple locations. The dealer must maintain a list of all places where the dealer holds articles subject to the floor stocks tax...

  3. Neutron capture cross section of ^243Am

    Science.gov (United States)

    Jandel, M.

    2009-10-01

    The Detector for Advanced Neutron Capture Experiments (DANCE) at Los Alamos National Laboratory (LANL) was used for neutron capture cross section measurement on ^243Am. The high granularity of DANCE (160 BaF2 detectors in a 4π geometry) enables the efficient detection of prompt gamma-rays following neutron capture. DANCE is located on the 20.26 m neutron flight path 14 (FP14) at the Manuel Lujan Jr. Neutron Scattering Center at the Los Alamos Neutron Science Center (LANSCE). The methods and techniques established in [1] were used for the determination of the ^243Am neutron capture cross section. The cross sections were obtained in the range of neutron energies from 0.02 eV to 400 keV. The resonance region was analyzed using SAMMY7 and resonance parameters were extracted. The results will be compared to existing evaluations and calculations. Work was performed under the auspices of the U.S. Department of Energy at Los Alamos National Laboratory by the Los Alamos National Security, LLC under Contract No. DE-AC52-06NA25396 and at Lawrence Livermore National Laboratory by the Lawrence Livermore National Security, LLC under Contract No. DE-AC52-07NA27344. [4pt] [1] M. Jandel et al., Phys. Rev. C78, 034609 (2008)

  4. 19 CFR 24.3a - CBP bills; interest assessment; delinquency; notice to principal and surety.

    Science.gov (United States)

    2010-04-01

    ... 19 Customs Duties 1 2010-04-01 2010-04-01 false CBP bills; interest assessment; delinquency; notice to principal and surety. 24.3a Section 24.3a Customs Duties U.S. CUSTOMS AND BORDER PROTECTION....3a CBP bills; interest assessment; delinquency; notice to principal and surety. (a) Due date of CBP...

  5. 5 CFR 531.243 - Promotion of a GM employee.

    Science.gov (United States)

    2010-01-01

    ... 5 Administrative Personnel 1 2010-01-01 2010-01-01 false Promotion of a GM employee. 531.243... Promotion of a GM employee. (a) Upon promotion, an employee's status as a GM employee ends, as provided in § 531.241(b). (b) When an employee loses status as a GM employee because of a temporary promotion and is...

  6. Measurement of 24.3 keV activation cross sections with the iron filter technique

    International Nuclear Information System (INIS)

    Rimawi, K.; Chrien, R.E.

    1975-01-01

    By using high-resolution detection techniques, intensities of specific activation lines from 197 Au(n,gamma), 238 U(n,gamma), 127 I(n,gamma), and 115 In(n,gamma) [54 min + 2.2 sec] were recorded, by using the BNL HFBR iron-filtered neutron beam. From a com- parison with the reaction 10 B(n,αgamma), cross sections at 24.3 keV were determined. (24.3 keV neutron activation cross sections, relative 10 B standard). (4 figures) (U.S.)

  7. Critical mass calculations for 241Am, 242mAm and 243Am

    International Nuclear Information System (INIS)

    Dias, Hemanth; Tancock, Nigel; Clayton, Angela

    2003-01-01

    Criticality mass calculations are reported for 241 Am, 242m Am and 243 Am using the MONK and MCNP computer codes with the UKNDL, JEF-2.2, ENDF/B-VI and JENDL-3.2 nuclear data libraries. Results are reported for spheres of americium metal and dioxide in bare, water reflected and steel reflected systems. Comparison of results led to the identification of a serious inconsistency in the 241 Am ENDF/B-VI DICE library used by MONK - this demonstrates the importance of using different codes to verify critical mass calculations. The 241 Am critical mass estimates obtained using UKNDL and ENDF/B-VI show good agreement with experimentally inferred data, whilst both JEF-2.2 and JENDL-3.2 produce higher estimates of critical mass. The computed critical mass estimates for 242m Am obtained using ENDF/B-VI are lower than the results produced using the other nuclear data libraries - the ENDF/B-VI fission cross-section for 242m Am is significantly higher than the other evaluations in the fast region and is not supported by recent experimental data. There is wide variation in the computed 243 Am critical mass estimates suggesting that there is still considerable uncertainty in the 243 Am nuclear data. (author)

  8. Americium-241 and -243 as an ion-engine propellant

    International Nuclear Information System (INIS)

    Schachter, M.M.

    1994-01-01

    Commercially available americium-241 and -243 can be obtained as the mixture of the two isotopes in 100-gram quantities--a product of reprocessing spent nuclear powerplant fuel elements along with plutonium. The half-lives of the isotopes are 450 years for the -241 and 8,000 years for the -243 (the plutonium half-life isotope so obtained is 24,000 years). Americium rolled out in thin foil sheets emits alpha-rays (helium-4 ions) and beta-rays--2 valence electrons for each helium ion. Electrons are also considered as ions. As a foil, the americium radiates only a minimal amount of gamma-rays via the Curie effect. With appropriately designed permanent magnet rings insulated with Wood's alloy, the + and - ions can be accelerated from their already 5.5 million electron-Volts to billion and even trillions of electron-Volts by electronic control grids powered by the magnetohydrodynamic effect of electrons and helium ions streaming at the post-rocket nozzle of the ion engine. Protocol for the estimated thrust of this ion rocket engine is more than ten kilograms continuously sustainable for several thousand years

  9. 76 FR 13075 - Airworthiness Directives; Airbus Model A330-243F Airplanes

    Science.gov (United States)

    2011-03-10

    ... Airworthiness Directives; Airbus Model A330-243F Airplanes AGENCY: Federal Aviation Administration (FAA... recent in-service event the flight crew of a Trent 700 powered A330 aircraft [[Page 13076

  10. Measurements of neutron cross section of the {sup 243}Am(n,{gamma}){sup 244}Am reaction

    Energy Technology Data Exchange (ETDEWEB)

    Hatsukawa, Yuichi; Shinohara, Nobuo; Hata, Kentaro [Japan Atomic Energy Research Inst., Tokai, Ibaraki (Japan). Tokai Research Establishment

    1998-03-01

    The effective thermal neutron cross section of {sup 243}Am(n,{gamma}){sup 244}Am reaction was measured by the activation method. Highly-purified {sup 243}Am target was irradiated in an aluminum capsule by using a research reactor JRR-3M. The tentative effective thermal neutron cross sections are 3.92 b, and 84.44 b for the production of {sup 244g}Am and {sup 244m}Am, respectively. (author)

  11. Peaceful berkelium

    Science.gov (United States)

    Trabesinger, Andreas

    2017-09-01

    The first new element produced after the Second World War has led a rather peaceful life since entering the period table -- until it became the target of those producing superheavy elements, as Andreas Trabesinger describes.

  12. Biological transport of curium-243 in dairy animals

    International Nuclear Information System (INIS)

    Sutton, W.W.; Patzer, R.G.; Hahn, P.B.; Potter, G.D.

    1979-04-01

    Lactating cows and goats were used to examine the biological transport of curium-243 in dairy animals. After either single oral or intravenous nuclide doses were administered, samples of milk, urine, blood, and feces were taken over a 144-hr priod, and the curium concentrations were determined by gamma counting. Gastrointestinal uptake of curium was estimated to be 0.02 and 0.006% of the oral dose for cows and goats, respectively. The cumulative percentage of oral dose transported to milk and urine was 4.6 x 10 -4 and 1.9 x 10 -3 , respectively, for a cow and 2.7 x 10 -4 and 1.6 x 10 -4 , respectively, for goats. Plasma concentrations of curium decreased rapidly following all intravenous injections. The average percentage of injected curium transferred to milk, urine, and feces was 2, 8, and 1, respectively, for a cow and 2, 5, and 5, respectively, for goats. All animals were sacrificed one week after dosing. Bovine bone retained the greatest fraction of the administered dose and the next highest was the liver. However, in all three intravenously dosed goats the liver contained the greatest amount of curium. Nuclide deposition in bone and liver was essentially equal for two of the three orally dosed goats while the skeleton contained the most curium in the other animal. Comparisons are presented between curium-243 and americium-241 transport in dairy cows

  13. Measurement and analysis of the $^{243}$Am neutron capture cross section at the n_TOF facility at CERN

    CERN Document Server

    Mendoza, E; Guerrero, C; Berthoumieux, E; Abbondanno, U; Aerts, G; Alvarez-Velarde, F; Andriamonje, S; Andrzejewski, J; Assimakopoulos, P; Audouin, L; Badurek, G; Balibrea, J; Baumann, P; Becvar, F; Belloni, F; Calvino, F; Calviani, M; Capote, R; Carrapico, C; Carrillo de Albornoz, A; Cennini, P; Chepel, V; Chiaveri, E; Colonna, N; Cortes, G; Couture, A; Cox, J; Dahlfors, M; David, S; Dillmann, I; Dolfini, R; Domingo-Pardo, C; Dridi, W; Duran, I; Eleftheriadis, C; Ferrant†, L; Ferrari, A; Ferreira-Marques, R; Fitzpatrick, L; Frais-Koelbl, H; Fujii, K; Furman, W; Goncalves, I; Gonz alez-Romero, E; Goverdovski, A; Gramegna, F; Griesmayer, E; Gunsing, F; Haas, B; Haight, R; Heil, M; Herrera-Martinez, A; Igashira, M; Isaev, S; Jericha, E; Kappeler, F; Kadi, Y; Karadimos, D; Karamanis, D; Ketlerov, V; Kerveno, M; Koehler, P; Konovalov, V; Kossionides, E; Krticka, M; Lampoudis, C; Leeb, H; Lindote, A; Lopes, I; Lossito, R; Lozano, M; Lukic, S; Marganiec, J; Marques, L; Marrone, S; Martınez, T; Massimi, C; Mastinu, P; Mengoni, A; Milazzo, P M; Moreau, C; Mosconi, M; Neves, F; Oberhummer, H; O’Brien, S; Oshima, M; Pancin, J; Papachristodoulou, C; Papadopoulos, C; Paradela, C; Patronis, N; Pavlik, A; Pavlopoulos, P; Perrot, L; Pigni, M T; Plag, R; Plompen, A; Plukis, A; Poch, A; Praena, J; Pretel, C; Quesada, J; Rauscher, T; Reifarth, R; Rosetti, M; Rubbia, C; Rudolf, G; Rullhusen, P; Salgado, J; Santos, C; Sarchiapone, L; Savvidis, I; Stephan, C; Tagliente, G; Tain, J L; Tassan-Got, L; Tavora, L; Terlizzi, R; Vannini, G; Vaz, P; Ventura, A; Villamarin, D; Vicente, M C; Vlachoudis, V; Vlastou, R; Voss, F; Walter, S; Wendler, H; Wiescher, M; Wisshak, K

    2014-01-01

    Background:The design of new nuclear reactors and transmutation devices requires to reduce the present neutron cross section uncertainties of minor actinides. Purpose: Reduce the $^{243}$Am(n,$\\gamma$) cross section uncertainty. Method: The $^{243}$Am(n,$\\gamma$) cross section has been measured at the n_TOF facility at CERN with a BaF$_{2}$ Total Absorption Calorimeter, in the energy range between 0.7 eV and 2.5 keV. Results: The $^{243}$Am(n,$\\gamma$) cross section has been successfully measured in the mentioned energy range. The resolved resonance region has been extended from 250 eV up to 400 eV. In the unresolved resonance region our results are compatible with one of the two incompatible capture data sets available below 2.5 keV. The data available in EXFOR and in the literature has been used to perform a simple analysis above 2.5 keV. Conclusions: The results of this measurement contribute to reduce the $^{243}$Am(n,$\\gamma$) cross section uncertainty and suggest that this cross section is underestimate...

  14. LncRNA CASC2 inhibited the viability and induced the apoptosis of hepatocellular carcinoma cells through regulating miR-24-3p.

    Science.gov (United States)

    Zeng, Fei; Le, Yi-Guan; Fan, Ji-Chang; Xin, Lin

    2017-11-01

    Background Cancer susceptibility candidate 2 (CASC2), a recently discovered long non-coding RNA (lncRNA), was confirmed to play numerous roles in several human cancers. However, the involvement and concrete mechanism of CASC2 in hepatocellular carcinoma (HCC) still need to be further elucidated. Methods The relative expressions of CASC2 and miR-24-3p in HCC tissue and cell lines were determined by quantitative real-time PCR (qRT-PCR). The effects of CASC2 and miR-24-3p on HCC cells were further assessed via cell viability and apoptosis. In vivo tumorigenesis assay was performed to verify the inhibition effect of CASC2 on the tumor growth and further clarify the important role of miR-24-3p in this mechanism. Results Compared with the paired normal tissues, the relative expression of CASC2 significantly reduced in the HCC tissues, while miR-24-3p as determined by qRT-PCR obviously increased in the HCC tissues. This observation was also found in HCC cell lines. Meanwhile, the expression of CASC2 was negatively related to miR-24-3p expression in the HCC tissues (r = -0.804, p cells, but the up-regulation of miR-24-3p greatly eliminated the CASC2-induced effects. The tumorigenesis of HCC cells was restrained significantly by CASC2 overexpression as shown by decreased tumor volume and growth rate. However, miR-24-3p up-regulation rescued the inhibition of CASC2 on the tumor growth in tumor-bearing mice. Conclusion LncRNA CASC2 inhibited the viability and induced the apoptosis of HCC cells through regulating miR-24-3p. This article is protected by copyright. All rights reserved. This article is protected by copyright. All rights reserved.

  15. Photodissociation of the OD radical at 226 and 243 nm

    International Nuclear Information System (INIS)

    Radenovic, Dragana C.; Roij, Andre J.A. van; Chestakov, Dmitri A.; Eppink, Andre T.J.B.; Meulen, J.J. ter; Parker, David H.; Loo, Mark P.J. van der; Groenenboom, Gerrit C.; Greenslade, Margaret E.; Lester, Marsha I.

    2003-01-01

    The photodissociation dynamics of state selected OD radicals has been examined at 243 and 226 nm using velocity map imaging to probe the angle-speed distributions of the D( 2 S) and O( 3 P 2 ) products. Both experiment and complementary first principle calculations demonstrate that photodissociation occurs by promotion of OD from high vibrational levels of the ground X 2 Π state to the repulsive 1 2 Σ - state

  16. Investigating the Role of the Post-transcriptional Gene Regulator MiR-24-3p in the Proliferation, Migration and Apoptosis of Human Arterial Smooth Muscle Cells in Arteriosclerosis Obliterans

    Directory of Open Access Journals (Sweden)

    Xiao-feng Zhu

    2015-07-01

    Full Text Available Aims: To explore the expression of miR-24-3p in human arteries with arteriosclerosis obliterans (ASO as well as the role of miR-24-3p in the pathogenesis of ASO. Methods: We used quantitative real-time PCR (qRT-PCR and in situ hybridization to monitor miR-24-3p expression in human arteries. To investigate the effect of miR-24-3p on human arterial smooth muscle cells (HASMCs, we applied cell counting and EdU assays to monitor proliferation and transwell and wound healing assays to investigate migration and flow cytometry to investigate apoptosis. Furthermore, we applied 3'-untranslated region (3'-UTR luciferase assays to investigate the role of miR-24-3p in targeting platelet-derived growth factor receptor B (PDGFRB and c-Myc. Results: MiR-24-3p was mainly located in the media of arteries and was downregulated in ASO arteries compared with normal arteries. Platelet-derived growth factor BB (PDGF-BB treatment reduced the expression of miR-24-3p in primary cultured HASMCs. MiR-24-3p mimic oligos inhibited the proliferation and migration, and promotes apoptosis of HASMCs. Our 3'-UTR luciferase assays confirmed that PDGFRB and c-Myc were targets of miR-24-3p. Conclusion: The results suggest that miR-24-3p regulates the proliferation and migration of HASMCs by targeting PDGFRB and c-Myc. The PDGF/miR-24-3p/PDGFRB and PDGF/miR-24-3p/c-Myc pathways may play critical roles in the pathogenesis of ASO. These findings highlight the potential for new therapeutic targets for ASO.

  17. Measurement of the 241Am and the 243Am Neutron Capture Cross Sections at the n_TOF Facility at CERN

    CERN Document Server

    Mendoza, E; Guerrero, C; Altstadt, S; Andrzejewski, J; Audouin, L; Barbagallo, M; Bécares, V; Bečvář, F; Belloni, F; Berthoumieux, E; Billowes, J; Boccone, V; Bosnar, D; Brugger, M; Calviani, M; Calviño, F; Carrapiço, C; Cerutti, F; Chiaveri, E; Chin, M; Colonna, N; Cortés, G; Cortés-Giraldo, M A; Diakaki, M; Domingo-Pardo, C; Duran, I; Dressler, R; Dzysiuk, N; Eleftheriadis, C; Ferrari, A; Fraval, K; Ganesan, S; García, A R; Giubrone, G; Gómez-Hornillos, M B; Gonçalves, I F; González-Romero, E; Griesmayer, E; Gunsing, F; Gurusamy, P; Jenkins, D G; Jericha, E; Kadi, Y; Käppeler, F; Karadimos, D; Kivel, N; Koehler, P; Kokkoris, M; Korschinek, G; Krtička, M; Kroll, J; Langer, C; Lederer, C; Leeb, H; Leong, L S; Losito, R; Manousos, A; Marganiec, J; Martínez, T; Mastinu, P F; Mastromarco, M; Massimi, C; Meaze, M; Mengoni, A; Milazzo, P M; Mingrone, F; Mirea, M; Mondelaers, W; Paradela, C; Pavlik, A; Perkowski, J; Pignatari, M; Plompen, A; Praena, J; Quesada, J M; Rauscher, T; Reifarth, R; Riego, A; Roman, F; Rubbia, C; Sarmento, R; Schillebeeckx, P; Schmidt, S; Schumann, D; Tagliente, G; Tain, J L; Tarrío, D; Tassan-Got, L; Tsinganis, A; Valenta, S; Vannini, G; Variale, V; Vaz, P; Ventura, A; Versaci, R; Vermeulen, M J; Vlachoudis, V; Vlastou, R; Wallner, A; Ware, T; Weigand, M; Weiß, C; Wright, T J; Žugec, P

    2014-01-01

    The capture cross sections of Am-241 and Am-243 were measured at the n\\_TOF facility at CERN in the epithermal energy range with a BaF2 Total Absorption Calorimeter. A preliminary analysis of the Am-241 and a complete analysis of the Am-243 measurement, including the data reduction and the resonance analysis, have been performed.

  18. Evaluation of neutron nuclear data for 243Am

    International Nuclear Information System (INIS)

    Igarasi, Sin-iti; Nakagawa, Tsuneo

    1977-06-01

    Evaluation of neutron nuclear data for 243 Am was performed below 16 MeV. The energy region above 250 eV was separated from the lower region where the resonance parameters were given. Evaluation was made to select suitable resonance parameters, and thermal values of the capture and fission cross sections were obtained with the adopted resonance parameters. An average fission width was assumed to bridge the cross sections at 0.0253 eV and above 250 eV. Using a semi-empirical formula, the fission cross section was reproduced above 250 eV. Optical and statistical model calculations were made in order to obtain the total, capture, inelastic and elastic scattering, and (n,2n) reaction cross sections. (auth.)

  19. Pesticides: Benefaction or Pandora's Box? A synopsis of the environmental aspects of 243 pesticides

    NARCIS (Netherlands)

    Linders JBHJ; Jansma JW; Mensink BJWG; Otermann K; ACT

    1994-01-01

    The report provides an overview of physical, chemical and environmental data of 243 pesticides. The data mentioned are based on confidential information supplied by the manufacturers of the pesticides. For all pesticides mentioned a Final Environmental File, which is public, is derived. Tables with

  20. miR-24-3p/FGFR3 Signaling as a Novel Axis Is Involved in Epithelial-Mesenchymal Transition and Regulates Lung Adenocarcinoma Progression

    Directory of Open Access Journals (Sweden)

    Pengyu Jing

    2018-01-01

    Full Text Available Our previous studies showed that Fibroblast growth factor receptor 3 (FGFR3 contributed to cell growth in lung cancer. However, the correlation between FGFR3 and tumor progression, coupled with the underlying mechanisms, are not fully understood. The clinical significance of FGFR3 was determined in two cohorts of clinical samples (n=22, n=78. A panel of biochemical assays and functional experiments was utilized to elucidate the underlying mechanisms and effects of FGFR3 and miR-24-3p on lung adenocarcinoma progression. Upregulated FGFR3 expression indicated an adverse prognosis for lung adenocarcinoma individuals and promoted metastatic potential of lung adenocarcinoma cells. Owing to the direct regulation towards FGFR3, miR-24-3p could interfere with the potential of proliferation, migration, and invasion in lung adenocarcinoma, following variations of EMT-related protein expression. As a significant marker of EMT, E-cadherin was negatively correlated with FGFR3, of which ectopic overexpression could neutralize the antitumour effects of miR-24-3p and reverse its regulatory effects on EMT markers. Taken together, these findings define a novel insight into the miR-24-3p/FGFR3 signaling axis in regulating lung adenocarcinoma progression and suggest that targeting the miR-24-3p/FGFR3 axis could be an effective and efficient way to prevent tumor progression.

  1. The influence of impurities for cross section measurement of {sup 241,243}Am(n,f) reactions

    Energy Technology Data Exchange (ETDEWEB)

    Kai, Tetsuya; Kobayashi, Katsuhei; Yamamoto, Shuji; Fujita, Yoshiaki; Kimura, Itsuro; Miyoshi, Mitsuharu; Yamamoto, Hideki [Kyoto Univ. (Japan); Shinohara, Nobuo

    1997-03-01

    The influence of the impurities on the fission cross section measurements for {sup 241}Am and {sup 243}Am has been investigated with the practical results. Following cases have been considered as the influence of impurities; (a) experiments with the {sup 241}Am sample that contains impurities originally, and (b) experiments with the {sup 243}Am sample that contains impurities produced by {alpha}, {beta} decays after the chemical purification. The present study has demonstrated the usefulness of pure samples by the comparison of the experiments using the sample on the market with those using the pure sample processed by the authors. Particularly on the case (b), the correction of the impurity through the periodical measurements was experimentally performed (about 18% around 0.3 eV in 4 weeks after the chemical purification). (author)

  2. Hydration Experiments and Physical Observations at 193 K and 243 K for Mg-Sulfates Relevant to Mars

    Science.gov (United States)

    Vaniman, D. T.; Chipera, S. J.; Carey, J. W.

    2006-03-01

    Hydration of kieserite and amorphous Mg-sulfate at 243 K progresses along simple pathways involving only hexahydrite and kieserite. Kieserite forms a duricrust-like cement, but the anhydrous precursor does not.

  3. Independent Yields of Kr and Xe Fragments at Photofission of Odd Nuclei ^{237}Np and ^{243}Am

    CERN Document Server

    Gangrsky, Yu P; Myshinskii, G V; Penionzhkevich, Yu E

    2004-01-01

    he independent yields of fragments Kr (A=89-93) and Xe (A=135-142) at photofission of odd nuclei 237Np and 243Am are presented. The experiments were performed using the bremsstrahlung of 25 MeV electrons on the microtron of FLNR, JINR. A technique was used that included the transportation of fragments which escaped from the target with the gas flow through a capillary and the condensation of inert gases in a cryostat at the temperature of liquid nitrogen. Kr and Xe isotopes were identified by the spectra of their daughter products. The mass number distributions of the independent yields of Kr and Xe isotopes and of the complementary fragments (Y and La at the photofission of ^{237}Np and Nb and Pr at the photofission of ^{243}Am) were obtained.

  4. Recoil-alpha-fission and recoil-alpha-alpha-fission events observed in the reaction Ca-48 + Am-243

    NARCIS (Netherlands)

    Forsberg, U.; Rudolph, D.; Andersson, L. -L.; Nitto, A. Di; Düllmann, Ch E.; Gates, J. M.; Golubev, P.; Gregorich, K. E.; Gross, C. J.; Herzberg, R. -D.; Hessberger, F. P.; Khuyagbaatar, J.; Kratz, J. V.; Rykaczewski, K.; Sarmiento, L. G.; Schädel, M.; Yakushev, A.; Åberg, S.; Ackermann, D.; Block, M.; Brand, H.; Carlsson, B. G.; Cox, D.; Derkx, X.; Dobaczewski, J.; Eberhardt, K.; Even, J.; Fahlander, C.; Gerl, J.; Jäger, E.; Kindler, B.; Krier, J.; Kojouharov, I.; Kurz, N.; Lommel, B.; Mistry, A.; Mokry, C.; Nazarewicz, W.; Nitsche, H.; Omtvedt, J. P.; Papadakis, P.; Ragnarsson, I.; Runke, J.; Schaffner, H.; Schausten, B.; Shi, Y.; Thörle-Pospiech, P.; Torres, T.; Traut, T.; Trautmann, N.; Türler, A.; Ward, A.; Ward, D. E.; Wiehl, N.

    2016-01-01

    Products of the fusion-evaporation reaction Ca-48 + Am-243 were studied with the TASISpec set-up at the gas-filled separator TASCA at the GSI Helmholtzzentrum f\\"ur Schwerionenforschung. Amongst the detected thirty correlated alpha-decay chains associated with the production of element Z=115, two

  5. Evaluation of neutron nuclear data for 241Am and 243Am

    International Nuclear Information System (INIS)

    Kikuchi, Yasuyuki

    1982-08-01

    Neutron nuclear data of 241 Am and 243 Am were evaluated for JENDL-2. Evaluated quantities are the total, elastic and inelastic scattering, fission, capture, (n,2n), (n,3n) and (n,4n) reaction cross sections, the resolved and unresolved resonance parameters, the angular or energy distribution of the emitted neutrons, and the average number of neutrons emitted per fission. The fission cross section was evaluated on the basis of newly measured data, and lower values than JENDL-1 were given in the subthreshold energy region. The reliability of the calculation parameters are also much improved, because experimental data became available for the total and capture cross sections of 241 Am in the high energy region. (author)

  6. RV SONNE SO243 Cruise Report / Fahrtbericht Guayaquil, Ecuador: 05. October 2015 Antofagasta, Chile: 22. October 2015 SO243 ASTRA-OMZ: AIR SEA INTERACTION OF TRACE ELEMENTS IN OXYGEN MINIMUM ZONES

    OpenAIRE

    Marandino, Christa A.

    2016-01-01

    The ASTRA-OMZ SO243 cruise on board the R/V Sonne took place between the 5th and 22nd October 2015 from Guayaquil, Ecuador to Antofagasta, Chile. Scientists from Germany, the U.S.A, and Norway participated, spanning chemical, biological, and physical oceanography, as well as atmospheric science. The main goal of the cruise was to determine the impact of low oxygen conditions on trace element cycling and distributions, as well as to determine how air-sea exchange of trace elements is influence...

  7. 2.43 kW narrow linewidth linearly polarized all-fiber amplifier based on mode instability suppression

    Science.gov (United States)

    Su, Rongtao; Tao, Rumao; Wang, Xiaolin; Zhang, Hanwei; Ma, Pengfei; Zhou, Pu; Xu, Xiaojun

    2017-08-01

    We demonstrate an experimental study on scaling mode instability (MI) threshold in fiber amplifiers based on fiber coiling. The experimental results show that coiling the active fiber in the cylindrical spiral shape is superior to the coiling in the plane spiral shape. When the polarization maintained Yb-doped fiber (PM YDF: with a core/inner-cladding diameter of 20/400 µm) is coiled on an aluminous plate with a bend diameter of 9-16 cm, the MI threshold is ~1.55 kW. When such a PM YDF is coiled on an aluminous cylinder with diameter of 9 cm, no MI is observed at the output power of 2.43 kW, which is limited by the available pump power. The spectral width and polarization extinction ratio is 0.255 nm and 18.3 dB, respectively, at 2.43 kW. To the best of our knowledge, this is the highest output power from a linear polarized narrow linewidth all-fiberized amplifier. By using a theoretical model, the potential MI-free scaling capability in such an amplifier is estimated to be 3.5 kW.

  8. Decay properties of Bk97243 and Bk97244

    Energy Technology Data Exchange (ETDEWEB)

    Ahmad, I.; Kondev, F. G.; Greene, J. P.; Zhu, S.

    2018-01-01

    Electron capture decays of Bk-243 and Bk-244 have been studied by measuring the gamma-ray spectra of mass-separated sources and level structures of Cm-243 and Cm-244 have been deduced. In Cm-243, the electron capture population to the ground state, 1/2(+)[631], and 1/2(+)[620] Nilsson states have been observed. The octupole K-pi = 2(-) band was identified in Cm-244 at 933.6 keV. In addition, spins and parities were deduced for several other states and two-quasiparticle configurations have been tentatively assigned to them

  9. Fission-product yields for thermal-neutron fission of 243Cm determined from measurements with a high-resolution low-energy germanium gamma-ray detector

    International Nuclear Information System (INIS)

    Merriman, L.D.

    1984-04-01

    Cumulative fission-product yields have been determined for 13 gamma rays emitted during the decay of 12 fission products created by thermal-neutron fission of 243 Cm. A high-resolution low-energy germanium detector was used to measure the pulse-height spectra of gamma rays emitted from a 77-nanogram sample of 243 Cm after the sample had been irradiated by thermal neutrons. Analysis of the data resulted in the identification and matching of gamma-ray energies and half-lives to individual radioisotopes. From these results, 12 cumulative fission product yields were deduced for radionuclides with half-lives between 4.2 min and 84.2 min. 7 references

  10. Measurement of fast neutron induced fission cross sections of 232Th, 238U, 237Np and 243Am

    International Nuclear Information System (INIS)

    Kanda, Kazutaka; Sato, Osamu; Yoshida, Kazuo; Imaruoka, Hiromitsu; Terayama, Hiromichi; Yoshida, Masashi; Hirakawa, Naohiro

    1984-01-01

    Neutron induced fission cross sections of 232 Th, 238 U, 237 Np and 243 Am relative to 235 U were measured in the energy range from 1.5 to 6.6 MeV. The present results are compared with experimental results of others and evaluated data in JENDL-2 and ENDF/B-IV. (author)

  11. Cluster decay channel in 238U + 40Ar (243 MeV)

    International Nuclear Information System (INIS)

    Pyatkov, Yu.V.; Penionzhkevich, Yu.Eh.; Osetrov, O.I.

    1999-01-01

    The reaction 238 U + 40 Ar (E lab = 243 MeV) was studied. For the first time a pronounced fine structure (FS) in the form of distinct peaks has been observed in the mass yields of the fragments of the 278 110 nuclear system decay at the initial excitation of about 60 MeV. The FS peaks are located in the vicinity of the mass numbers A ∼ 70, 100, 130, which are specific for magic nuclei (clusters) of Ni, Ge, Zr, Sn, Sr. The FS peaks contain only low-energy events linked with the very elongated prescission configurations of the system. Some events are observed which can be treated as an indication of ternary fission via such configurations with the appearance of two equal clusters. Hence presumably the collinear cluster tripartition channel is realized observed earlier in the spontaneous fission of 248 Cm and 252 Cf nuclei

  12. Reaction mechanisms in 24.3 MeV/nucleon 238U induced reactions through a comprehensive study of fission

    International Nuclear Information System (INIS)

    Chbihi, A.; Galin; Guerreau, D.; Lewitowicz, M.; Morjean, M.; Pouthas, J.; Piasecki, E.; Kordyasz, A.; Iwanicki, J.; Jastrzebski, J.; Pienkowski, L.; Crema, E.; Gatty, B.; Jacquet, D.; Muchorowska, M.

    1994-01-01

    Nuclear reaction mechanisms for system characterized by very different asymmetries (U+C, Si, Ni, Au) have been investigated at 24.3 MeV/nucleon, using as observables both the fission products and the neutron multiplicity. It is clearly observed that the fusion process-whatever its completeness- can only occur with rather light target nuclei, indicating the persistence of potential energy effects much above the interaction barrier. (authors). 22 refs., 1 fig

  13. Chemical Identification of Dubnium as a Decay Product of Element 115 Produced in the Reaction $\\rm {^{48}Ca}+{^{243}Am}$

    CERN Document Server

    Dmitriev, S N; Utyonkov, V K; Shishkin, S V; Eremin, A V; Lobanov, Yu V; Chepigin, V I; Sokol, E A; Tsyganov, Yu S; Vostokin, G K; Aksenov, N V; Hussonnois, M; Itkis, M G; Aggeler, H W; Schumann, D; Bruchertseifer, H; Eichler, R; Shaughnessy, D A; Wilk, P A; Kenneally, J M; Stoyer, M A; Wild, J F

    2004-01-01

    The results of an experiment designed to identify $^{268}$Db as the terminal isotope in the $\\alpha $-decay chain of element 115 produced via the ${\\rm {^{243}Am}}({\\rm {^{48}Ca}},3n){\\rm {^{288}115}}$ reaction are presented. The $^{243}$Am target was bombarded with a beam dose of $3.4\\cdot 10^{18}$ $^{48}$Ca projectiles at an energy of 247 MeV at the center of the target. The reaction products were collected in the surface layer of a copper catcher block, which was removed with a lathe and then dissolved in concentrated HNO$_{3}$. The group-5 elements were separated by sorption onto Dowex $50{\\times} 8$ cation-exchange resin with subsequent desorption using 1 M HF, which forms anionic fluoride complexes of group-5 elements. The eluent was evaporated onto a 0.4 $\\mu$m thick polyethylene foil that was placed between a pair of semiconductor detectors surrounded by $^{3}$He neutron counters for measurement of $\\alpha$ particles, fission fragments, and neutrons. In the course of the experiment, we observed 15 spo...

  14. Motion of the moonlet in the binary system 243 Ida

    Science.gov (United States)

    Lan, L.; Ni, Y.; Jiang, Y.; Li, J.

    2018-02-01

    The motion of the moonlet Dactyl in the binary system 243 Ida is investigated in this paper. First, periodic orbits in the vicinity of the primary are calculated, including the orbits around the equilibrium points and large-scale orbits. The Floquet multipliers' topological cases of periodic orbits are calculated to study the orbits' stabilities. During the continuation of the retrograde near-circular orbits near the equatorial plane, two period-doubling bifurcations and one Neimark-Sacker bifurcation occur one by one, leading to two stable regions and two unstable regions. Bifurcations occur at the boundaries of these regions. Periodic orbits in the stable regions are all stable, but in the unstable regions are all unstable. Moreover, many quasi-periodic orbits exist near the equatorial plane. Long-term integration indicates that a particle in a quasi-periodic orbit runs in a space like a tire. Quasi-periodic orbits in different regions have different styles of motion indicated by the Poincare sections. There is the possibility that moonlet Dactyl is in a quasi-periodic orbit near the stable region I, which is enlightening for the stability of the binary system.

  15. In vitro evaluation of Lactobacillus crispatus K313 and K243: high-adhesion activity and anti-inflammatory effect on Salmonella braenderup infected intestinal epithelial cell.

    Science.gov (United States)

    Sun, Zhilan; Huang, Lihua; Kong, Jian; Hu, Shumin; Zhang, Xiaowei; Kong, Wentao

    2012-09-14

    Currently, there is an increasing interest in the use of probiotics as an alternative strategy to antimicrobial compounds. In this study, two high adhesive strains Lactobacillus crispatus K313 adhering to HT-29 cells as well as Lb. crispatus K243 adhering to collagen type IV were isolated from chicken intestines. SDS-PAGE analysis revealed the presence of the potential S-proteins SlpA and SlpB in Lb. crispatus K243 and K313. SlpA and SlpB, rich in hydrophobic amino acids, were proved to be involved in adhering to collagen type IV and HT-29 cells, respectively, based on the LiCl treatment assay. After removal of S-proteins, the viability and tolerance of the two Lb. crispatus strains to simulated gastric and small intestinal juice were reduced, indicating the protective role of S-proteins against the hostile environments. Lb. crispatus K313 exhibited the stronger autoaggregation ability and inhibitive activity against Salmonella braenderup H9812 adhesion to HT-29 cells than the strain K243. To elucidate the inhibitive mechanism, cultured epithelial cells were exposed with Lb. crispatus strains, and followed by a challenge with S. braenderup H9812. The pro-inflammatory signaling factors (IL-8, CXCL1 and CCL20) from HT-29 were detected by real-time PCR technology. The results showed that both of Lb. crispatus strains down-regulated the transcription level of those pro-inflammatory genes induced by S. braenderup H9812 by 36.2-58.8%. ELISA analysis was further confirmed that Lb. crispatus K243 and K313 inhibited the IL-8 secretion triggered by S. braenderup H9812 by 32.8% and 47.0%, indicating that the two isolates could attenuate the pro-inflammatory signaling induced by S. braenderup H9812, and have the potential application in clinical practice to prevent diarrhea. Copyright © 2012 Elsevier B.V. All rights reserved.

  16. Partial monosomy 8q and partial trisomy 9q due to the maternal translocation t(8;9(q24.3;q34.1)

    DEFF Research Database (Denmark)

    Tos, T; Alp, M Y; Eker, H K

    2014-01-01

    Partial trisomy 9q34-qter and partial monosomy 8q24.3-qter are very rare chromosomal abnormalities. Characteristic features of partial trisomy 9q34-qter are hypotonia, developmental delay, mild intellectual disability, dolichocephaly, distinct facial phenotype, long and thin fingers, and cardiac...

  17. Tat protein vaccination of cynomolgus macaques influences SHIV-89.6P cy243 epitope variability.

    Science.gov (United States)

    Ridolfi, Barbara; Genovese, Domenico; Argentini, Claudio; Maggiorella, Maria Teresa; Sernicola, Leonardo; Buttò, Stefano; Titti, Fausto; Borsetti, Alessandra; Ensoli, Barbara

    2008-02-01

    In a previous study we showed that vaccination with the native Tat protein controlled virus replication in five out of seven monkeys against challenge with the simian human immunodeficiency virus (SHIV)-89.6P cy243 and that this protection correlated with T helper (Th)-1 response and cytotoxic T lymphocyte (CTL) activity. To address the evolution of the SHIV-89.6P cy243 both in control and vaccinated infected monkeys, the sequence of the human immunodeficiency virus (HIV)-1 Tat protein and the C2-V3 Env region of the proviral-DNA-derived clones were analyzed in both control and vaccinated but unprotected animals. We also performed analysis of the T cell epitope using a predictive epitope model taking into consideration the phylogeny of the variants. Our results suggest that even though the viral evolution observed in both groups of monkeys was directed toward variations in the major histocompatibility complex (MHC)-I epitopes, in the control animals it was associated with mutational escape of such epitopes. On the contrary, it is possible that viral evolution in the vaccinated monkeys was linked to mutations that arose to keep high the viral fitness. In the vaccinated animals the reduction of epitope variability, obtained prompting the immune system by vaccination and inducing a specific immunological response against virus, was able to reduce the emergence of escape mutants. Thus the intervention of host's selective forces in driving CTL escape mutants and in modulating viral fitness appeared to be different in the two groups of monkeys. We concluded that in the vaccinated unprotected animals, vaccination with the Tat protein induced a broad antiviral response, as demonstrated by the reduced ability to develop escape mutants, which is known to help in the control of viral replication.

  18. Thermal neutron capture cross-section measurements of 243Am and 242Pu using the new mini-INCA α- and γ-spectroscopy station

    International Nuclear Information System (INIS)

    Marie, F.; Letourneau, A.; Fioni, G.; Deruelle, O.; Veyssiere, Ch.; Faust, H.; Mutti, P.; AlMahamid, I.; Muhammad, B.

    2006-01-01

    In the framework of the Mini-INCA project, dedicated to the study of Minor Actinide transmutation process in high neutron fluxes, an α- and γ-spectroscopy station has been developed and installed at the High Flux Reactor of the Laue-Langevin Institut. This set-up allows short irradiations as well as long irradiations in a high quasi-thermal neutron flux and post-irradiation spectroscopy analysis. It is well suited to measure precisely, in reference to 59 Co cross-section, neutron capture cross-sections, for all the actinides, in the thermal energy region. The first measurements using this set-up were done on 243 Am and 242 Pu isotopes. Cross-section values, at E n =0.025eV, were found to be (81.8+/-3.6)b for 243 Am and (22.5+/-1.1)b for 242 Pu. These values differ from evaluated data libraries by a factor of 9% and 17%, respectively, but are compatible with the most recent measurements, validating by the way the experimental apparatus

  19. The production of {sup 238-242}Pu(n,γ){sup 239-243}Pu fissionable fluids in a fusion-fission hybrid reactor

    Energy Technology Data Exchange (ETDEWEB)

    Guenay, Mehtap [Inoenue Univ., Malatya (Turkey). Physics Dept.

    2014-03-15

    In this study, the effect of spent fuel grade plutonium content on {sup 239-243}Pu was investigated in a designed hybrid reactor system. In this system, the fluids were composed of a molten salt, heavy metal mixture with increased mole fractions 99-95 % Li{sub 20}Sn{sub 80}-1-5 % SFG-Pu, 99-95 % Li{sub 20}Sn{sub 80}-1-5 % SFG-PuF{sub 4}, 99-95 % Li{sub 20}Sn{sub 80}-1-5 % SFG-PuO{sub 2}. Beryllium (Be) is a neutron multiplier by (n,2n) reactions. Thence, a Be zone of 3 cm thickness was used in order to contribute to fissile fuel breeding between the liquid first wall and a 9Cr2WVTa ferritic steel blanket which is used as structural material. The production of {sup 238-242}Pu(n,γ){sup 239-243}Pu was calculated in liquid first wall, blanket and shielding zones. Three-dimensional nucleonic calculations were performed by using the most recent version MCNPX-2.7.0 Monte Carlo code and nuclear data library ENDF/B-VII.0. (orig.)

  20. The use of isotopic correlation technique for determination of sup(241)Am and sup(243)Am concentration in nuclear irradiated fuels

    International Nuclear Information System (INIS)

    Souza Sarkis, J.E. de.

    1990-01-01

    In the last years the isotopic correlation technique is emerging as a powerful tool for the determination of concentration and isotopic composition of heavy nuclides in the nuclear fuel cycle. Accordingly, this technique has gained significant importance for the safeguard of the nuclear materials as well as for the accounting and build up of actinides elements in the irradiated nuclear fuels. In this work 42 isotopic correlations between the nuclides sup(241)Am and sup(243)Am and post irradiation isotopic data of 7 samples from fuel element BE-124 and 1 sample from fuel element BE-120 from the Obrigheim pressurized water nuclear power reactor, Federal Republic of Germany, were proposed. These isotopic correlations allowed to estimate the isotopic concentrations of sup(241)Am and sup(243)Am with an average deviation, relative to the experimental data obtained from isotopic dilution mass spectrometry technique, of 10%. These results are more precise than those found using the computer code ORIGEN 2 demonstrating the great potential of this technique for the determination of isotopic concentration and build up of those nuclides in irradiated nuclear fuels. The analytical and other experimental aspects of the post irradiation isotopic analysis of nuclear fuels are also discussed. (author)

  1. Measurement of fission cross section with pure Am-243 sample using lead slowing-down spectrometer

    Energy Technology Data Exchange (ETDEWEB)

    Kobayashi, Katsuhei; Yamamoto, Shuji; Kai, T.; Fujita, Yoshiaki; Yamamoto, Hideki; Kimura, Itsuro [Kyoto Univ. (Japan); Shinohara, Nobuo

    1997-03-01

    By making use of back-to-back type double fission chambers and a lead slowing-down spectrometer coupled to an electron linear accelerator, the fission cross section for the {sup 243}Am(n,f) reaction has been measured relative to that for the {sup 235}U(n,f) reaction in the energy range from 0.1 eV to 10 keV. The measured result was compared with the evaluated nuclear data appeared in ENDF/B-VI and JENDL-3.2, whose evaluated data were broadened by the energy resolution function of the spectrometer. General agreement was seen between the evaluated data and the measurement except that the ENDF/B-VI data were lower in the range from 15 to 60 eV and that the JENDL-3.2 data seemed to be lower above 100 eV. (author)

  2. (-)-P7C3-S243 Protects a Rat Model of Alzheimer's Disease From Neuropsychiatric Deficits and Neurodegeneration Without Altering Amyloid Deposition or Reactive Glia.

    Science.gov (United States)

    Voorhees, Jaymie R; Remy, Matthew T; Cintrón-Pérez, Coral J; El Rassi, Eli; Khan, Michael Z; Dutca, Laura M; Yin, Terry C; McDaniel, Latisha N; Williams, Noelle S; Brat, Daniel J; Pieper, Andrew A

    2017-11-06

    In addition to cognitive deficits, Alzheimer's disease (AD) is associated with other neuropsychiatric symptoms, including severe depression. Indeed, depression often precedes cognitive deficits in patients with AD. Unfortunately, the field has seen only minimal therapeutic advances, underscoring the critical need for new treatments. P7C3 aminopropyl carbazoles promote neuronal survival by enhancing nicotinamide adenine dinucleotide flux in injured neurons. Neuroprotection with P7C3 compounds has been demonstrated in preclinical models of neurodegeneration by virtue of promoting neuronal survival independently of early disease-specific pathology, resulting in protection from cognitive deficits and depressive-like behavior. We hypothesize that P7C3 compounds might be uniquely applicable to patients with AD, given the comorbid presentation of depression and cognitive deficits. Aging male and female wild-type and TgF344-AD rats, a well-characterized preclinical AD model, were administered (-)-P7C3-S243 daily for 9 and 18 months, beginning at 6 months of age. Behavioral phenotypes related to cognition and depression were assessed at 15 and 24 months, and brain pathology and biochemistry were assessed at 24 months. (-)-P7C3-S243 safely protected aging male and female wild-type and TgF344-AD rats from cognitive deficits and depressive-like behavior. Depressive-like behavior occurred earlier than cognitive deficits in TgF344-AD rats, consistent with AD in many patients. Treatment with (-)-P7C3-S243 blocked neurodegeneration in TgF344-AD rats, without altering amyloid deposition or indicators of neuroinflammation. Neuronal cell death-specific treatment approaches, such as P7C3 compounds, may represent a new treatment approach for patients experiencing the combination of cognitive deficits and depression associated with AD. Published by Elsevier Inc.

  3. Remaining Sites Verification Package for the 600-243 Petroleum-Contaminated Soil Bioremediation Pad. Attachment to Waste Site Reclassification Form 2007-033

    International Nuclear Information System (INIS)

    Capron, J.M.

    2008-01-01

    The 600-243 waste site consisted of a bioremediation pad for petroleum-contaminated soils resulting from the 1100 Area Underground Storage Tank (UST) upgrades in 1994. In accordance with this evaluation, the verification sampling results support a reclassification of this site to Interim Closed Out. The results of verification sampling show that residual contaminant concentrations do not preclude any future uses and allow for unrestricted use of shallow zone soils. The results also demonstrate that residual contaminant concentrations are protective of groundwater and the Columbia River

  4. Critical and subcritical mass calculations of curium-243 to -247 based on JENDL-3.2 for revision of ANSI/ANS-8.15

    International Nuclear Information System (INIS)

    Okuno, Hiroshi

    2002-01-01

    Critical and subcritical masses were calculated for a sphere of five curium isotopes from 243 Cm to 247 Cm in metal and in metal-water mixtures considering three reflector conditions: bare, with a water reflector or a stainless steel reflector. The calculation were made mainly with a combination of a continuous energy Monte Carlo neutron transport calculation code, MCNP, and the Japanese Evaluated Nuclear Data Library, JENDL-3.2. Other evaluated nuclear data files, ENDF/B-VI and JEF-2.2, were also applied to find differences in calculation results of the neutron multiplication factor originated from different nuclear data files. A large dependence on the evaluated nuclear data files was found in the calculation results: more than 10%Δk/k relative differences in the neutron multiplication factor for a homogeneous mixture of 243 Cm metal and water when JENDL-3.2 was replaced with ENDF/B-VI and JEF-2.2, respectively; and a 44% reduction in the critical mass by changing from JENDL-3.2 to ENDF/B-VI for 246 Cm metal. The present study supplied basic information to the ANSI/ANS-8.15 Working Group for revision of the standard for nuclear criticality control of special actinide elements. The new or revised values of the subcritical mass limits for curium isotopes accepted by the ANSI/ANS-8.15 Working Group were finally summarized. (author)

  5. Investigating SLIM Disk Solutions FOR HLX-1 IN ESO 243-49

    Science.gov (United States)

    Godet, O.; Plazolles, B.; Kawaguchi, T.; Lasota, J.-P; Barret, d.; Farrell, S. A.; Braito, V.; Servillat, M.; Webb, N.; Gehrels, N.

    2012-01-01

    The hyperluminous X-ray source HLX-1 in the galaxy ESO 243-49, currently the best intermediate-mass blackhole (BH) candidate, displays spectral transitions similar to those observed in Galactic BH binaries, but with aluminosity 100-1000 times higher. We investigated the X-ray properties of this unique source by fitting multiepochdata collected by Swift, XMM-Newton, and Chandra with a disk model computing spectra for a wide rangeof sub- and super-Eddington accretion rates assuming a non-spinning BH and a face-on disk (i=0 deg.). Under theseassumptions we find that the BH in HLX-1 is in the intermediate-mass range (approximately 2 x 10(exp 4) solar mass) and the accretionflow is in the sub-Eddington regime. The disk radiation efficiency is eta = 0.11 plus or minus 0.03. We also show that the source does follow the LX is proportional to T(exp 4) relation for our mass estimate. At the outburst peaks, the source radiates near the Eddington limit. The accretion rate then stays constant around 4 x 10(exp 4) solar mass yr (sup -1) for several days and then decreases exponentially. Such plateaus in the accretion rate could be evidence that enhanced mass-transfer rateis the driving outburst mechanism in HLX-1. We also report on the new outburst observed in 2011 August by theSwift X-Ray Telescope. The time of this new outburst further strengthens the approximately 1 year recurrence timescale.

  6. De novo 14q24.2q24.3 microdeletion including IFT43 is associated with intellectual disability, skeletal anomalies, cardiac anomalies, and myopia.

    Science.gov (United States)

    Stokman, Marijn F; Oud, Machteld M; van Binsbergen, Ellen; Slaats, Gisela G; Nicolaou, Nayia; Renkema, Kirsten Y; Nijman, Isaac J; Roepman, Ronald; Giles, Rachel H; Arts, Heleen H; Knoers, Nine V A M; van Haelst, Mieke M

    2016-06-01

    We report an 11-year-old girl with mild intellectual disability, skeletal anomalies, congenital heart defect, myopia, and facial dysmorphisms including an extra incisor, cup-shaped ears, and a preauricular skin tag. Array comparative genomic hybridization analysis identified a de novo 4.5-Mb microdeletion on chromosome 14q24.2q24.3. The deleted region and phenotype partially overlap with previously reported patients. Here, we provide an overview of the literature on 14q24 microdeletions and further delineate the associated phenotype. We performed exome sequencing to examine other causes for the phenotype and queried genes present in the 14q24.2q24.3 microdeletion that are associated with recessive disease for variants in the non-deleted allele. The deleted region contains 65 protein-coding genes, including the ciliary gene IFT43. Although Sanger and exome sequencing did not identify variants in the second IFT43 allele or in other IFT complex A-protein-encoding genes, immunocytochemistry showed increased accumulation of IFT-B proteins at the ciliary tip in patient-derived fibroblasts compared to control cells, demonstrating defective retrograde ciliary transport. This could suggest a ciliary defect in the pathogenesis of this disorder. © 2016 Wiley Periodicals, Inc. © 2016 Wiley Periodicals, Inc.

  7. Directed evolution of the periodic table: probing the electronic structure of late actinides.

    Science.gov (United States)

    Marsh, M L; Albrecht-Schmitt, T E

    2017-07-25

    Recent investigations of the coordination chemistry and physical properties of berkelium (Z = 97) and californium (Z = 98) have revealed fundamental differences between post-curium elements and lighter members of the actinide series. This review highlights these developments and chronicles key findings and concepts from the last half-century that have helped usher in a new understanding of the evolution of electronic structure in the periodic table.

  8. Critical and subcritical mass calculations of curium-243 to -247 based on JENDL-3.2 for revision of ANSI/ANS-8.15

    Energy Technology Data Exchange (ETDEWEB)

    Okuno, Hiroshi [Japan Atomic Energy Research Inst., Tokai, Ibaraki (Japan). Tokai Research Establishment; Kawasaki, Hiromitsu [CRC Solutions Corporation, Hitachinaka, Ibaraki (Japan)

    2002-10-01

    Critical and subcritical masses were calculated for a sphere of five curium isotopes from {sup 243}Cm to {sup 247}Cm in metal and in metal-water mixtures considering three reflector conditions: bare, with a water reflector or a stainless steel reflector. The calculation were made mainly with a combination of a continuous energy Monte Carlo neutron transport calculation code, MCNP, and the Japanese Evaluated Nuclear Data Library, JENDL-3.2. Other evaluated nuclear data files, ENDF/B-VI and JEF-2.2, were also applied to find differences in calculation results of the neutron multiplication factor originated from different nuclear data files. A large dependence on the evaluated nuclear data files was found in the calculation results: more than 10%{delta}k/k relative differences in the neutron multiplication factor for a homogeneous mixture of {sup 243}Cm metal and water when JENDL-3.2 was replaced with ENDF/B-VI and JEF-2.2, respectively; and a 44% reduction in the critical mass by changing from JENDL-3.2 to ENDF/B-VI for {sup 246}Cm metal. The present study supplied basic information to the ANSI/ANS-8.15 Working Group for revision of the standard for nuclear criticality control of special actinide elements. The new or revised values of the subcritical mass limits for curium isotopes accepted by the ANSI/ANS-8.15 Working Group were finally summarized. (author)

  9. Neutron capture cross section measurements of $^{238}$U, $^{241}$Am and $^{243}$Am at n_TOF

    CERN Multimedia

    Koehler, P E; Plag, R

    The increase of the world energy demand and the need of low carbon energy sources have triggered the renaissance and/or enhancement of nuclear energy in many countries. Fundamental nuclear physics can contribute in a practical way to the sustainability and safety of the nuclear energy production and the management of the nuclear waste. There exists a series of recent studies which address the most relevant isotopes, decay data, nuclear reaction channels and energy ranges which have to be investigated in more detail for improving the design of different advanced nuclear systems [1] and nuclear fuel cycles [2]. In this proposal, we aim at the measurement of the neutron capture cross sections of $^{238}$U, $^{241}$Am and $^{243}$Am. All three isotopes are listed in the NEA High Priority Request List [37], are recommended for measurements [1] and play an important role in the nuclear energy production and fuel cycle scenarios. The measurements will provide as well valuable nuclear structure data necessary for the...

  10. Role of the functional MNS16A VNTR-243 variant of the human telomerase reverse transcriptase gene in progression and response to therapy of patients with non-Hodgkin's B-cell lymphomas.

    Science.gov (United States)

    Wysoczanska, B; Wrobel, T; Dobrzynska, O; Mazur, G; Bogunia-Kubik, K

    2015-04-01

    MNS16A is a functional polymorphic tandem repeat within the human telomerase reverse transcriptase (hTERT) gene. To investigate whether any of the MNS16A repeats represents a genetic risk factor for NHL susceptibility, progression of or response to therapy in 75 patients with non-Hodgkin's lymphomas (NHLs) and 126 healthy individuals were genotyped using the PCR-VNTR technique. A slightly higher frequency of the MNS16A VNTR-243 variant was detected among patients who did not respond to treatment (NR) as compared to patients with complete or partial remission (0.83 vs. 0.51, P = 0.055). NR patients more frequently developed aggressive than indolent type of the disease (0.92 vs. 0.41, P = 0.001). The VNTR-243 allele was more frequently detected among patients with an intermediate-high/high International Prognostic Index (IPI 3-4) score (P = 0.063), especially in patients with advanced age and IPI 3-4 (P = 0.040). In multivariate analysis, higher IPI 3-4 score (OR = 11.364, P = 0.051) and aggressive type of the disease (OR = 18.182, P = 0.012) were found to be independent genetic markers associated with nonresponse to treatment. Presence of the MNS16A VNTR-243 variant also strongly tended to affect the risk of a less favourable response to therapy and was more frequently present among nonresponders (OR = 5.848, P = 0.059). Genetic variation within the hTERT gene may affect the progression and treatment of lymphoproliferative disorders. © 2015 John Wiley & Sons Ltd.

  11. Modified salicylanilide and 3-phenyl-2H-benzo[e][1,3]oxazine-2,4(3H)-dione derivatives as novel inhibitors of osteoclast differentiation and bone resorption.

    Science.gov (United States)

    Chen, Chun-Liang; Liu, Fei-Lan; Lee, Chia-Chung; Chen, Tsung-Chih; Ahmed Ali, Ahmed Atef; Sytwu, Huey-Kang; Chang, Deh-Ming; Huang, Hsu-Shan

    2014-10-09

    Inhibition of osteoclast formation is a potential strategy to prevent inflammatory bone resorption and to treat bone diseases. In the present work, the purpose was to discover modified salicylanilides and 3-phenyl-2H-benzo[e][1,3]oxazine-2,4(3H)-dione derivatives as potential antiosteoclastogenic agents. Their inhibitory effects on RANKL-induced osteoclastogenesis from RAW264.7 cells were evaluated by TRAP stain assay. The most potent compounds, 1d and 5d, suppressed RANKL-induced osteoclast formation and TRAP activity dose-dependently. The cytotoxicity assay on RAW264.7 cells suggested that the inhibition of osteoclastic bone resorption by these compounds did not result from their cytotoxicity. Moreover, both compounds downregulated RANKL-induced NF-κB and NFATc1 in the nucleus, suppressed the expression of osteoclastogenesis-related marker genes during osteoclastogenesis, and prevented osteoclastic bone resorption but did not impair osteoblast differentiation in MC3T3-E1. Therefore, these modified salicylanilides and 3-phenyl-2H-benzo[e][1,3]oxazine-2,4(3H)-diones could be potential lead compounds for the development of a new class of antiresorptive agents.

  12. Measurement of the Neutron Capture Cross Sections of $^{233}$U, $^{237}$Np, $^{240,242}$Pu, $^{241,243}$Am and $^{245}$Cm with a Total Absorption Calorimeter at n_TOF

    CERN Multimedia

    Beer, H; Wiescher, M; Cox, J; Rapp, W; Embid, M; Dababneh, S

    2002-01-01

    Accurate and reliable neutron capture cross section data for actinides are necessary for the poper design, safety regulation and precise performance assessment of transmutation devices such as Fast Critical Reactors or Accelerator Driven Systems (ADS). The goal of this proposal is the measurement of the neutron capture cross sections of $^{233}$U, $^{237}$Np, $^{240,242}$Pu, $^{241,243}$Am and $^{245}$Cm at n_TOF with an accuracy of 5~\\%. $^{233}$U plays an essential role in the Th fuel cycle, which has been proposed as a safer and cleaner alternative to the U fuel cycle. The capture cross sections of $^{237}$Np,$^{240,242}$Pu, $^{241,243}$Am and $^{245}$Cm play a key role in the design and optimization of a strategy for the Nuclear Waste Transmutation. A high accuracy can be achieved at n_TOF in such measurements due to a combination of features unique in the world: high instantaneous neutron fluence and excellent energy resolution of the facility, innovative Data Acquisition System based on flash ADCs and t...

  13. Fission Cross-section Measurements of (233)U, (245)Cm and (241,243)Am at CERN n_TOF Facility

    CERN Document Server

    Calviani, M; Andriamonje, S; Chiaveri, E; Vlachoudis, V; Colonna, N; Meaze, M H; Marrone, S; Tagliente, G; Terlizzi, R; Belloni, F; Abbondanno, U; Fujii, K; Milazzo, P M; Moreau, C; Aerts, G; Berthoumieux, E; Dridi, W; Gunsing, F; Pancin, J; Perrot, L; Plukis, A; Alvarez, H; Duran, I; Paradela, C; Alvarez-Velarde, F; Cano-Ott, D; Gonzalez-Romero, E; Guerrero, C; Martinez, T; Villamarin, D; Vicente, M C; Andrzejewski, J; Marganiec, J; Assimakopoulos, P; Karadimos, D; Karamanis, D; Papachristodoulou, C; Patronis, N; Audouin, L; David, S; Ferrant, L; Isaev, S; Stephan, C; Tassan-Got, L; Badurek, G; Jericha, E; Leeb, H; Oberhummer, H; Pigni, M T; Baumann, P; Kerveno, M; Lukic, S; Rudolf, G; Becvar, F; Krticka, M; Calvino, F; Capote, R; Carrillo De Albornoz, A; Marques, L; Salgado, J; Tavora, L; Vaz, P; Cennini, P; Dahlfors, M; Ferrari, A; Gramegna, F; Herrera-Martinez, A; Kadi, Y; Mastinu, P; Praena, J; Sarchiapone, L; Wendler, H; Chepel, V; Ferreira-Marques, R; Goncalves, I; Lindote, A; Lopes, I; Neves, F; Cortes, G; Poch, A; Pretel, C; Couture, A; Cox, J; O'brien, S; Wiescher, M; Dillman, I; Heil, M; Kappeler, F; Mosconi, M; Plag, R; Voss, F; Walter, S; Wisshak, K; Dolfini, R; Rubbia, C; Domingo-Pardo, C; Tain, J L; Eleftheriadis, C; Savvidis, I; Frais-Koelbl, H; Griesmayer, E; Furman, W; Konovalov, V; Goverdovski, A; Ketlerov, V; Haas, B; Haight, R; Reifarth, R; Igashira, M; Koehler, P; Kossionides, E; Lampoudis, C; Lozano, M; Quesada, J; Massimi, C; Vannini, G; Mengoni, A; Oshima, M; Papadopoulos, C; Vlastou, R; Pavlik, A; Pavlopoulos, P; Plompen, A; Rullhusen, P; Rauscher, T; Rosetti, M; Ventura, A

    2011-01-01

    Neutron-induced fission cross-sections of minor actinides have been measured using the n_TOF white neutron source at CERN, Geneva, as part of a large experimental program aiming at collecting new data relevant for nuclear astrophysics and for the design of advanced reactor systems. The measurements at n_TOF take advantage of the innovative features of the n_TOF facility, namely the wide energy range, high instantaneous neutron flux and good energy resolution. Final results on the fission cross-section of 233U, 245Cm and 243Am from thermal to 20 MeV are here reported, together with preliminary results for 241Am. The measurement have been performed with a dedicated Fast Ionization Chamber (FIC), a fission fragment detector with a very high efficiency, relative to the very well known cross-section of 235U, measured simultaneously with the same detector.

  14. Monozygotic twins with a de novo 0.32 Mb 16q24.3 deletion, including TUBB3 presenting with developmental delay and mild facial dysmorphism but without overt brain malformation

    DEFF Research Database (Denmark)

    Grønborg, Sabine; Kjaergaard, Susanne; Hove, Hanne

    2015-01-01

    been associated with missense mutations in this group of genes. Here, we report two patients, monozygotic twins, carrying a de novo 0.32 Mb deletion of chromosome 16q24.3 including the TUBB3 gene. The patients presented with global developmental delay, mild facial dysmorphism, secondary microcephaly...

  15. Interstitial deletion of 14q24.3-q32.2 in a male patient with plagiocephaly, BPES features, developmental delay, and congenital heart defects

    DEFF Research Database (Denmark)

    Cingöz, Sultan; Bache, Iben; Bjerglund, Lise

    2011-01-01

    Distal interstitial deletions of chromosome 14 involving the 14q24-q23.2 region are rare, and only been reported so far in 20 patients. Ten of these patients were analyzed both clinically and genetically. Here we present a de novo interstitial deletion of chromosome 14q24.3-q32.2 in a male patient...... on genotype-phenotype comparisons of the 10 previously published patients and the present case, we suggest that the shortest regions for deletion overlap may include candidate genes for speech impairment, mental retardation, and hypotonia....

  16. Backbone and sidechain methyl Ile (δ1), Leu and Val chemical shift assignments of RDE-4 (1-243), an RNA interference initiation protein in C. elegans.

    Science.gov (United States)

    Chiliveri, Sai Chaitanya; Kumar, Sonu; Marelli, Udaya Kiran; Deshmukh, Mandar V

    2012-10-01

    The RNAi pathway of several organisms requires presence of double stranded RNA binding proteins for functioning of Dicer in gene regulation. In C. elegans, a double stranded RNA binding protein, RDE-4 (385 aa, 44 kDa) recognizes long exogenous dsRNA and initiates the RNAi pathway. We have achieved complete backbone and stereospecific methyl sidechain Ile (δ1), Leu and Val chemical shifts of first 243 amino acids of RDE-4, namely RDE-4ΔC.

  17. Safety analysis report for packaging: neutron shipping cask, model 0.5T

    International Nuclear Information System (INIS)

    Peterson, R.T.

    1976-01-01

    The Safety Analysis Report for Packaging demonstrates that the neutron shipping cask can safely transport, in solid or powder form, all isotopes of uranium, plutonium, americium, curium, berkelium, californium, einsteinium, and fermium. The shipping cask and its contents are described. It also evaluates transport conditions, structural parameters (e.g., load resistance, pressure and impact effects, lifting and tiedown devices), and shielding. Finally, it discusses compliance with Chapter 0529 of the Energy Research and Development Administration Manual

  18. Estimation of Ni63, Pu241, Pu242 and Am243 from Co60, Pu239, and Cm244 activities in groundwater samples

    International Nuclear Information System (INIS)

    Holcomb, H.P.

    1993-01-01

    The Part B Permit for F ampersand H Seepage Basins calls for analysis of several constituents of concern in groundwater monitoring wells. Four of these analytes are the radionuclides Ni 63 , Pu 241 , Pu 242 , and Am 243 . These are currently not being analyzed due to their very difficult, tedious analytical schemes coupled with their relatively low activity values. This report demonstrates how the activity value for Ni 63 , a week beta emitter, can be estimated from that of Co 60 , an easily detectable, high-energy gamma emitter. Similarly, estimates of Pu 241 , a beta emitter, and the alpha-emitting Pu 242 can be made from the activity value of the more easily detected Pu 239 . Am 243 can be estimated from the activity of Cm 244 , which is easier to detect because of a shorter half-life (higher specific activity) and the emission of higher energy alpha particles. These correlations are made under very specific parameters in order to ensure the validity of this approach. Therefore, assumptions must be established setting ground rules for establishing these activity relationships. Bases for these assumptions are explained and/or referenced. Their degree of uncertainty limits the accuracy of the data so that the term ''estimate'' is used. Such soundly-based, conservative estimates for these four rads can provide a tool for evaluating any hazards from their presence over the next several years. Hopefully, during this time, sufficient advances will be made in their radiochemical analyses and in counting techniques so that in the future, their activities may be quantitatively determined more easily and also more cost effectively

  19. Neutron capture and fission cross section of Americium-243 in the energy range from 5 to 250 keV

    International Nuclear Information System (INIS)

    Wisshak, K.; Kaeppeler, F.

    1983-04-01

    The neutron capture and subthreshold fission cross section of 243 Am was measured in the energy range from 5 to 250 keV using 197 Au and 235 U as the respective standards. Neutrons were produced via the 7 Li(p,n) and the T(p,n) reaction with the Karlsruhe 3-MV pulsed Van de Graaff accelerator. Capture events were detected by two MoxonRae detectors with graphite and bismuthgraphite converters, respectively. Fission events were registered by a NE-213 liquid scintillator with pulse-shape discriminator equipment. Flight paths as short as 50-70 mm were used to obtain optimum signal-to-background ratio. After correction for the different efficiency of the individual converter materials the capture cross section could be determined with a total uncertainty of 3-6%. The respective values for the fission cross section are 8-12%. The results are compared to predictions of recent evaluations, which in some cases are severely discrepant. (orig.)

  20. Safety analysis report for packaging: neutron shipping cask, model 4T

    International Nuclear Information System (INIS)

    Peterson, R.T.

    1977-01-01

    This Safety Analysis Report for Packaging demonstrates that the neutron shipping cask can safely transport, in solid or powder form, all isotopes of uranium, plutonium, americium, curium, berkelium, californium, einsteinium, and fermium. The cask and its contents are described. It also evaluates transport conditions, structural parameters (e.g., load resistance, pressure and impact effects, lifting and tiedown devices), and shielding. Finally, it discusses compliance with Chapter 0529 of the Energy Research and Development Administration Manual, Safety Standards for the Packaging of Fissile and Other Radioactive Materials

  1. Chelation and stabilization of berkelium in oxidation state +IV

    Czech Academy of Sciences Publication Activity Database

    Deblonde, G. J.-P.; Sturzbecher-Hoehne, M.; Rupert, P. B.; An, D. D.; Illy, M.-C.; Ralston, C. Y.; Brabec, Jiří; de Jong, W. A.; Strong, R. K.; Abergel, R. J.

    2017-01-01

    Roč. 9, č. 9 (2017), s. 843-849 ISSN 1755-4330 Institutional support: RVO:61388955 Keywords : bioorganic chemistry * chemical bonding * mass spectrometry Subject RIV: CF - Physical ; Theoretical Chemistry OBOR OECD: Physical chemistry Impact factor: 25.870, year: 2016

  2. Association of the −243A>G, +61450C>A Polymorphisms of the Glutamate Decarboxylase 2 (GAD2) Gene with Obesity and Insu¬lin Level in North Indian Population

    OpenAIRE

    Jai PRAKASH; Balraj MITTAL; Shally AWASTHI; Neena SRIVASTAVA

    2016-01-01

    Background: Obesity associated with type 2 diabetes, and hypertension increased mortality and morbidity. Glutamate decarboxylase 2 (GAD2) gene is associated with obesity and it regulate food intake and insulin level. We investigated the association of GAD-2gene −243A>G (rs2236418) and +61450C>A (rs992990) polymorphisms with obesity and related phenotypes.Methods: Insulin, glucose and lipid levels were estimated using standard protocols. All subjects were genotyped (PCR-RFLP) method.Resu...

  3. Actinides

    International Nuclear Information System (INIS)

    Martinot, L.; Fuger, J.

    1985-01-01

    The oxidation behavior of the actinides is explained on the basis of their electronic structure. The actinide elements, actinium, thorium, protactinium, uranium, neptunium, plutonium, americium, curium, berkelium, californium, einsteinium, fermium, mendelevium, nobelium, and laurencium are included. For all except the last three elements, the points of discussion are oxidation states, Gibbs energies and potentials, and potential diagram for the element in acid solution; and thermodynamic properties of these same elements are tabulated. References are cited following discussion of each element with a total of 97 references being cited. 13 tables

  4. Experiments on the Synthesis of Element 115 in the Reaction ^{243}Am (^{48}Ca, xn)^{291-x}115

    CERN Document Server

    Oganessian, Yu T; Lobanov, Yu V; Abdullin, F S; Polyakov, A N; Shirokovsky, I V; Tsyganov, Yu S; Gulbekyan, G G; Bogomolov, S L; Mezentsev, A N; Iliev, S; Subbotin, V G; Sukhov, A M; Voinov, A A; Buklanov, G V; Subotic, K M; Zagrebaev, V I; Itkis, M G; Patin, J B; Moody, K J; Wild, J F; Stoyer, M A; Stoyer, N J; Shaughnessy, D A; Kenneally, J M; Lougheed, R W

    2003-01-01

    The results of experiments designed to synthesize element 115 isotopes in the ^{243}Am(^{48}Ca,xn)^{291-x}115 reaction are presented. With a beam dose of 4.3\\cdot 10^{18} 248-Mev ^{48}Ca projectiles, we observed three similar decay chains consisting of five consecutive alpha-decays, all detected in time intervals of about 20 s and terminated at a later time by a spontaneous fission with a high energy release (TKE \\sim 220 MeV). At a higher bombarding energy of 253 MeV, with an equal ^{48}Ca beam dose, we registered a different decay chain of four consecutive alpha-decays detected in a time interval of about 0.5 s, also terminated by spontaneous fission. The alpha-decay energies and half-lives for nine new alpha-decaying nuclei were determined. The decay properties of these synthesized nuclei are consistent with consecutive alpha-decays originating from the parent isotopes of the new element 115, ^{288}115 and ^{287}115, produced in the 3n- and 4n-evaporation channels with cross sections of about 3 and 1 pb, r...

  5. Enhanced anticaries efficacy of a 0.243% sodium fluoride/10% xylitol/silica dentifrice: 3-year clinical results.

    Science.gov (United States)

    Sintes, J L; Escalante, C; Stewart, B; McCool, J J; Garcia, L; Volpe, A R; Triol, C

    1995-10-01

    To evaluate the efficacy of a sodium fluoride (NaF)/silica/xylitol dentifrice compared with that of a positive control NaF/silica dentifrice on caries increments in school children over a 3-year period in an area without an optimal level of fluoride in the drinking water (mean level schools in the San Jose, Costa Rica metropolitan area. Clinical dental examinations were performed at participating schools utilizing portable dental equipment. Caries evaluations employed conventional tactile/visual methodology consisting of artificial light, dental mirrors and single-edge #23 explorers. Children accepted into the study were stratified by age and sex into two balanced groups within each school, and randomly assigned to use either a positive control dentifrice containing 0.243% NaF/silica or a test dentifrice containing 0.234% NaF/silica/10% xylitol. Children were instructed to brush with the assigned dentifrice twice daily. Caries evaluations were conducted at baseline, 2 years, and 3 years. After 3 years, subjects using the 0.234% NaF/silica/10% xylitol dentifrice had statistically significantly reduced decayed/filled surfaces (DFS; -12.3% reduction; P < or = 0.001) and decayed/filled buccal and lingual surfaces (DFS-BL; -10.5% reduction; P < or = 0/01).

  6. Joint Institute for Nuclear Research Data Analysis Guide - Berkelium Edition

    International Nuclear Information System (INIS)

    Henderson, R.A.

    2009-01-01

    This is a data analysis guide to the JINR system developed by Roger Henderson. It is intended as a complete guide to the data format and the calibration parameters utilized for the analysis of the data. This guide will provide the basic structure of the data files, the description of the individual data items, and the basic equations developed for the calculation of the results. Currently (7/17/2009), calculation of the calibration parameters is not a covered topic. It is intended that this will be covered in a future update

  7. Implications of the delayed 2013 outburst of ESO 243-49 HLX-1

    Energy Technology Data Exchange (ETDEWEB)

    Godet, O.; Webb, N. A. [Institut de Recherche en Astrophysique and Planétologie (IRAP), Université de Toulouse, UPS, 9 Avenue du colonel Roche, F-31028 Toulouse Cedex 4 (France); Lombardi, J. C.; Vingless, J.; Thomas, M. [Department of Physics, Allegheny College, Meadville, PA 16335 (United States); Antonini, F.; Barret, D. [Canadian Institute for Theoretical Astrophysics, University of Toronto, 60 St. George Street, Toronto, Ontario M5S 3H8 (Canada)

    2014-10-01

    After showing four quasi-periodic outbursts spaced by ∼1 yr from 2009 to 2012, the hyper luminous X-ray source ESO 243-49 HLX-1, currently the best intermediate mass black hole (IMBH) candidate, showed an outburst in 2013 delayed by more than a month. In Lasota et al., we proposed that the X-ray light curve is the result of enhanced mass transfer episodes at periapsis from a donor star orbiting the IMBH in a highly eccentric orbit. In this scenario, the delay can be explained only if the orbital parameters can change suddenly from orbit to orbit. To investigate this, we ran Newtonian smooth particle hydrodynamical simulations starting with an incoming donor approaching an IMBH on a parabolic orbit. We survey a large parameter space by varying the star-to-black hole mass ratio (10{sup –5}-10{sup –3}) and the periapsis separation r{sub p} from 2.2 to 2.7r{sub t} with r{sub t} , the tidal radius. To model the donor, we choose several polytropes (Γ = 5/2, n = 3/2, Γ = 3/2, n = 2, Γ = 5/3, n = 2, and Γ = 5/3, n = 3). Once the system is formed, the orbital period decreases until reaching a minimum that may be shallow. Then, the period tends to increase over several periapsis passages due to tidal effects and increasing mass transfer, leading ultimately to the ejection of the donor. We show that the development of stochastic fluctuations inside the donor by adding or removing orbital energy from the system could lead to sudden changes in the orbital period from orbit to orbit with the appropriate order of magnitude to that which has been observed for HLX-1. We also show that given the constraints on the black hole (BH) mass (M {sub BH} > 10{sup 4} M {sub ☉}) and assuming that the HLX-1 system is currently near a minimum in period of ∼1 yr, the donor has to be a white dwarf or a stripped giant core. We predict that if HLX-1 is indeed emerging from a minimum in orbital period, then the period would generally increase with each passage, although substantial

  8. Radiological safety considerations in the design and operation of the ORNL Transuranium Research Laboratory (TRL)

    International Nuclear Information System (INIS)

    Haynes, C.E.

    1976-01-01

    The Transuranium Research Laboratory (TRL) is the central facility at Oak Ridge National Laboratory (ORNL) for chemical and physical research involving transuranium elements. Transuranium Research Laboratory investigations are about equally divided between studies of inorganic and structural chemistry of the heavy elements and nuclear structure and properties of their isotopes. Elements studied include neptunium, plutonium, americium, curium, berkelium, californium, and einsteinium, each in microgram-to-gram quantities depending upon availability and experimental requirements. This paper describes an eight-step safety procedure followed in planning and approving individual research projects. This procedure should provide an optimum margin of safety and should permit the accomplishment of successful research

  9. Composition containing transuranic elements for use in the homeopathic treatment of aids

    International Nuclear Information System (INIS)

    Lustig, D.

    1996-01-01

    A homeopathic remedy consisting of a composition containing one or more transuranic elements, particularly plutonium, for preventing and treating acquired immunodeficiency syndrome (AIDS) in humans, as well as seropositivity for human immunodeficiency virus (HIV). Said composition is characterized in that it uses any chemical or isotopic form of one or more transuranic elements (neptunium, plutonium, americium, curium, berkelium, californium or einsteinium), particularly plutonium, said form being diluted and dynamized according to conventional homeopathic methods, particularly the so-called Hahnemann and Korsakov methods, and provided preferably but not exclusively in the form of lactose and/or saccharose globules or granules impregnated with the active principle of said composition. (author)

  10. PROCEEDINGS OF THE SYMPOSIUM COMMEMORATING THE 25th ANNIVERSARY OF ELEMENTS 97 and 98 HELD ON JAN. 20, 1975

    Energy Technology Data Exchange (ETDEWEB)

    Seaborg, Glenn T.; Street Jr., Kenneth; Thompson, Stanley G.; Ghiorso, Albert

    1976-07-01

    This volume includes the talks given on January 20, 1975, at a symposium in Berkeley on the occasion of the celebration of the 25th anniversary of the discovery of berkelium and californium. Talks were given at this symposium by the four people involved in the discovery of these elements and by a number of people who have made significant contributions in the intervening years to the investigation of their nuclear and chemical properties. The papers are being published here, without editing, in the form in which they were submitted by the authors in the months following the anniversary symposium, and they reflect rather faithfully the remarks made on that occasion.

  11. TOWARD AN IMPROVED UNDERSTANDING OF STRUCTURE AND MAGNETISM IN NEPTUNIUM AND PLUTONIUM PHOSPHONATES AND SULFONATES

    Energy Technology Data Exchange (ETDEWEB)

    Albrecht-Schmitt, Thomas

    2012-03-01

    This grant supported the exploratory synthesis of new actinide materials with all of the actinides from thorium to californium with the exceptions of protactinium and berkelium. We developed detailed structure-property relationships that allowed for the identification of novel materials with selective ion-exchange, selective oxidation, and long-range magnetic ordering. We found novel bonding motifs and identified periodic trends across the actinide series. We identified structural building units that would lead to desired structural features and novel topologies. We also characterized many different spectroscopic trends across the actinide series. The grant support the preparation of approximately 1200 new compounds all of which were structurally characterized.

  12. Thermomechanical behavior and microstructural evolution of a Ni(Pd)-rich Ni{sub 24.3}Ti{sub 49.7}Pd{sub 26} high temperature shape memory alloy

    Energy Technology Data Exchange (ETDEWEB)

    Benafan, O., E-mail: othmane.benafan@nasa.gov [NASA Glenn Research Center, Structures and Materials Division, Cleveland, OH 44135 (United States); Garg, A. [University of Toledo, Toledo, OH 43606 (United States); NASA Glenn Research Center, Structures and Materials Division, Cleveland, OH 44135 (United States); Noebe, R.D.; Bigelow, G.S.; Padula, S.A. [NASA Glenn Research Center, Structures and Materials Division, Cleveland, OH 44135 (United States); Gaydosh, D.J. [Ohio Aerospace Institute, Cleveland, OH 44142 (United States); NASA Glenn Research Center, Structures and Materials Division, Cleveland, OH 44135 (United States); Vaidyanathan, R. [Advanced Materials Processing and Analysis Center, Materials Science and Engineering Department, University of Central Florida, Orlando, FL 32816 (United States); Clausen, B.; Vogel, S.C. [Materials Science and Technology Division, Los Alamos National Laboratory, Los Alamos, NM 87545 (United States)

    2015-09-15

    Highlights: • A Ni(Pd)-rich Ni{sub 24.3}Ti{sub 49.7}Pd{sub 26} high temperature shape memory alloy was characterized. • Aging resulted in fine dispersion of nano-sized precipitates. • Thermomechanical cycling resulted in dimensional instabilities due to lattice defects. • A two-way shape memory effect strain of 2% strain was obtained after cycling. - Abstract: The effect of thermomechanical cycling on a slightly Ni(Pd)-rich Ni{sub 24.3}Ti{sub 49.7}Pd{sub 26} (near stochiometric Ni–Ti basis with Pd replacing Ni) high temperature shape memory alloy was investigated. Aged tensile specimens (400 °C/24 h/furnace cooled) were subjected to constant-stress thermal cycling in conjunction with microstructural assessment via in situ neutron diffraction and transmission electron microscopy (TEM), before and after testing. It was shown that in spite of the slightly Ni(Pd)-rich composition and heat treatment used to precipitation harden the alloy, the material exhibited dimensional instabilities with residual strain accumulation reaching 1.5% over 10 thermomechanical cycles. This was attributed to insufficient strengthening of the material (insufficient volume fraction of precipitate phase) to prevent plasticity from occurring concomitant with the martensitic transformation. In situ neutron diffraction revealed the presence of retained martensite while cycling under 300 MPa stress, which was also confirmed by transmission electron microscopy of post-cycled samples. Neutron diffraction analysis of the post-thermally-cycled samples under no-load revealed residual lattice strains in the martensite and austenite phases, remnant texture in the martensite phase, and peak broadening of the austenite phase. Texture developed in the martensite phase was composed mainly of those martensitic tensile variants observed during thermomechanical cycling. Presence of a high density of dislocations, deformation twins, and retained martensite was revealed in the austenite state via in

  13. Intellectual disability, muscle weakness and characteristic face in three siblings: A newly described recessive syndrome mapping to 3p24.3-p25.3.

    Science.gov (United States)

    Kariminejad, Ariana; Nafissi, Shahriar; Nilipoor, Yalda; Tavasoli, Alireza; Van Veldhoven, Paul P; Bonnard, Carine; Ng, Yeng Ting; Majoie, Charles B; Reversade, Bruno; Hennekam, Raoul C

    2015-11-01

    We report on a sister and two brothers born to healthy Iranian parents with mild intellectual disability, progressive muscle weakness, and characteristic facies. including highly arched eyebrows, down-slanting palpebral fissures, prominent nasal bridge, prominent nose, columella extending below alae nasi, narrow mouth, narrow palate, and dental caries, and in one of them an inability to abduct the left eye. Electrophysiological studies showed signs of myopathy, and muscle biopsies demonstrated only nonspecific signs. Brain MRIs in two of the sibs showed leukencephalopathy with delayed myelination, frontal and parietal hyperintensities, and hippocampal atrophy in one. We have been unable to find a description of this association of features in literature. Based on the occurrence in siblings, no significant difference in phenotype between the brothers and sister, absence of manifestations in parents, and a likely consanguinity between parents we performed a homozygosity mapping. A single identical-by-descent bloc encompassing 57 genes located at 3p24.3-p25.3 was found to segregate within the family with this phenotype. © 2015 Wiley Periodicals, Inc. © 2015 Wiley Periodicals, Inc.

  14. Neutron-induced fission cross-section of 233U, 241Am and 243Am in the energy range 0.5 MeV ≤ En ≤ 20 MeV

    International Nuclear Information System (INIS)

    Belloni, F.; Milazzo, P.M.; Calviani, M.

    2011-01-01

    Neutron-induced fission cross-sections of 233 U, 241 Am and 243 Am relative to 235 U have been measured in a wide energy range at the neutron time of flight facility n-TOF in Geneva to address the present discrepancies in evaluated and experimental databases for reactions and isotopes relevant for transmutation and new generation fast reactors. A dedicated fast ionization chamber was used. Each isotope was mounted in a different cell of the modular detector. The measurements took advantage of the characteristics of the n-TOF installation. Its intrinsically low background, coupled to its high instantaneous neutron flux, results in high accuracy data. Its wide energy neutron spectrum helps to reduce systematic uncertainties due to energy-domain matching problems while the 185 m flight path and a 6 ns pulse width assure an excellent energy resolution. This paper presents results obtained between 500 keV and 20 MeV neutron energy. (authors)

  15. 243 ORIGINAL ARTICLE

    African Journals Online (AJOL)

    boaz

    Isolates were identified as A. baumannii using API 20NE and E-test was used to define IRAB. Out of 146 A. ... L'étude des facteurs de risque associe à l'infection IRAB est d'une importance capitale ..... Pimentel JD1, Low J, Styles K, Harris OC,.

  16. pmker 24(3)

    African Journals Online (AJOL)

    HP Pro 2000

    L. AFOUDA1, H. BAIMEY2, F. X. BACHABI2, D. H. SERO-KPERA1 et R. BALOGOUN1. 1Faculté ... rates ranging from 20 to 95 % 6 days after exposure. The effect of extracts was found ... integrated management of Meloidogyne spp. Keywords ...

  17. Erosion and Ejecta Reaccretion on 243 Ida and Its Moon

    Science.gov (United States)

    Geissler, Paul; Petit, Jean-Marc; Durda, Daniel D.; Greenberg, Richard; Bottke, William; Nolan, Michael; Moore, Jeffrey

    1996-03-01

    Galileo images of Asteroid 243 Ida and its satellite Dactyl show surfaces which are dominantly shaped by impact cratering. A number of observations suggest that ejecta from hypervelocity impacts on Ida can be distributed far and wide across the Ida system, following trajectories substantially affected by the low gravity, nonspherical shape, and rapid rotation of the asteroid. We explore the processes of reaccretion and escape of ejecta on Ida and Dactyl using three-dimensional numerical simulations which allow us to compare the theoretical effects of orbital dynamics with observations of surface morphology. The effects of rotation, launch location, and initial launch speed are first examined for the case of an ideal triaxial ellipsoid with Ida's approximate shape and density. Ejecta launched at low speeds (V≪Vesc) reimpact near the source craters, forming well-defined ejecta blankets which are asymmetric in morphology between leading and trailing rotational surfaces. The net effect of cratering at low ejecta launch velocities is to produce a thick regolith which is evenly distributed across the surface of the asteroid. In contrast, no clearly defined ejecta blankets are formed when ejecta is launched at higher initial velocities (V∼Vesc). Most of the ejecta escapes, while that which is retained is preferentially derived from the rotational trailing surfaces. These particles spend a significant time in temporary orbit around the asteroid, in comparison to the asteroid's rotation period, and tend to be swept up onto rotational leading surfaces upon reimpact. The net effect of impact cratering with high ejecta launch velocities is to produce a thinner and less uniform soil cover, with concentrations on the asteroids' rotational leading surfaces. Using a realistic model for the shape of Ida (P. Thomas, J. Veverka, B. Carcich, M. J. S. Belton, R. Sullivan, and M. Davies 1996,Icarus120, 000-000), we find that an extensive color/albedo unit which dominates the

  18. Chemical consequences of radioactive decay. 1. Study of 249Cf ingrowth into crystalline 249BkBr3: a new crystalline phase of CfBr3

    International Nuclear Information System (INIS)

    Young, J.P.; Haire, R.G.; Peterson, J.R.; Ensor, D.D.; Fellows, R.L.

    1980-01-01

    Spectrophotometric and x-ray powder diffraction methods have been applied to a study of the ingrowth of californium-249 by β - decay of berkelium-249 in crystalline 249 BkBr 3 . It was found that the Cf daughter grows in with the same oxidation state and crystal structure as the parent. Thus, six-coordinate BkBr 3 (AlCl 3 -type monoclinic structure) generates six-coordinate CfBr 3 , and eight-coordinate BkBr 3 (PuBr 3 -type orthorhombic structure) generates eight-coordinate CfBr 3 , a previously unknown form of CfBr 3 . It was also found that the daughter Cf(III) in the BkBr 3 parent compound can be reduced to Cf(II) by treatment with H 2 , as it can in pure CfBr 3 . 5 figures

  19. Nuclear fission and the transuranium elements

    International Nuclear Information System (INIS)

    Seaborg, G.T.

    1989-02-01

    Many of the transuranium elements are produced and isolated in large quantities through the use of neutrons furnished by nuclear fission reactions: plutonium (atomic number 94) in ton quantities; neptunium (93), americium (95), and curium (96) in kilogram quantities; berkelium (97) in 100 milligram quantities; californium (98) in gram quantities; and einsteinium (99) in milligram quantities. Transuranium isotopes have found many practical applications---as nuclear fuel for the large-scale generation of electricity, as compact, long-lived power sources for use in space exploration, as means for diagnosis and treatment in the medical area, and as tools in numerous industrial processes. Of particular interest is the unusual chemistry and impact of these heaviest elements on the periodic table. This account will feature these aspects. 9 refs., 5 figs

  20. Nuclear fission and the transuranium elements

    Energy Technology Data Exchange (ETDEWEB)

    Seaborg, G.T.

    1989-02-01

    Many of the transuranium elements are produced and isolated in large quantities through the use of neutrons furnished by nuclear fission reactions: plutonium (atomic number 94) in ton quantities; neptunium (93), americium (95), and curium (96) in kilogram quantities; berkelium (97) in 100 milligram quantities; californium (98) in gram quantities; and einsteinium (99) in milligram quantities. Transuranium isotopes have found many practical applications---as nuclear fuel for the large-scale generation of electricity, as compact, long-lived power sources for use in space exploration, as means for diagnosis and treatment in the medical area, and as tools in numerous industrial processes. Of particular interest is the unusual chemistry and impact of these heaviest elements on the periodic table. This account will feature these aspects. 9 refs., 5 figs.

  1. The investigation on the vapour liquid phase equilibrium of (ammonia + 1,1,1,2-tetrafluoroethane) system over the temperatures ranging from (243.150 to 283.150) K

    International Nuclear Information System (INIS)

    Zhao, Yanxing; Dong, Xueqiang; Zhong, Quan; Gong, Maoqiong; Shen, Jun

    2017-01-01

    Highlights: • The vapour liquid equilibrium for ammonia + 1,1,1,2-tetrafluoroethane system was studied. • Measurements were based on vapour phase single recirculation method. • A positive azeotropic behaviour was exhibited at the experimental temperature range. - Abstract: To blend ammonia with some hydrofluorocarbons may give these mixed refrigerants lower flammability and global warming potential. In this paper, the isothermal vapour liquid equilibrium (VLE) of (ammonia + 1,1,1,2-tetrafluoroethane) system at temperatures ranging from (243.150 to 283.150) K are presented. Two models were employed to regress the experimental VLE results, namely the Peng–Robinson (PR) equation of state with the simple van der waals (VDW) mixing rule; the Peng–Robinson equation of state combined non-random two-liquid (NRTL) activity coefficient model with the modified Huron-Vidal one-order (MHV1) mixing rule. The maximum average absolute relative deviation of pressure (AARDp) and average absolute deviation of the vapour phase mole fraction (AADy) for PR-VDW are 0.56% and 0.010, respectively, while the maximum AARDp and AADy for PR-MHV1-NRTL are 0.27% and 0.014, respectively. Positive azeotropic behaviour was exhibited at each temperature investigated.

  2. Viscosity of n-hexadecane, n-octadecane and n-eicosane at pressures up to 243 MPa and temperatures up to 534 K

    International Nuclear Information System (INIS)

    Baled, Hseen O.; Xing, Dazun; Katz, Harrison; Tapriyal, Deepak; Gamwo, Isaac K.; Soong, Yee; Bamgbade, Babatunde A.; Wu, Yue; Liu, Kun; McHugh, Mark A.; Enick, Robert M.

    2014-01-01

    Highlights: • A novel windowed Inconel rolling-ball viscometer is designed and used by our team. • Viscosity data are reported for n-hexadecane, n-octadecane, and n-eicosane at high temperatures and pressures. • The viscosity results are compared with the available literature data. • The viscosity results are modeled with the free volume theory model. - Abstract: Viscosity data are reported for n-hexadecane (C16), n-octadecane (C18), and n-eicosane (C20) at pressures between (3 and 243) MPa and temperatures between (304 and 534) K. These extreme conditions are representative of those encountered in ultra-deep petroleum formations beneath the deepwaters of the Gulf of Mexico. The measurements are taken with a novel windowed Inconel rolling-ball viscometer designed by our team that is calibrated with n-decane. A comparison of the reported viscosity values with the available literature data that cover limited pressure and temperature ranges, shows that the mean absolute percentage deviation, δ, ranges between 1.1% and 4.8%. The reported data extend the database of viscosity to the high-temperature, high-pressure region where most gaps occur in the literature data for n-hexadecane and n-octadecane. To the best of our knowledge, the results for n-eicosane are the first reported viscosity values at pressures above 2 MPa over the entire temperature range. The viscosity results are modeled with the free volume theory model in conjunction with density values obtained using the Peng–Robinson equation of state (EoS) and the PC-SAFT EoS. The δ values obtained with this model range from 2.0% to 3.5%. The data are also correlated by a non-linear surface fit as a simultaneous function of temperature and pressure that yields δ values of 0.40%, 0.43%, and 0.38% for C16, C18, and C20, respectively

  3. Total neutron cross sections of berkelium-249 and californium-249 below 100 eV

    International Nuclear Information System (INIS)

    Benjamin, R.W.; Harvey, J.A.; Hill, N.W.; Pandey, M.S.; Carlton, R.F.

    1979-01-01

    The neutron total cross sections of 249 Bk and 249 Cf have been measured from 0.03 to 100 eV using the Oak Ridge Electron Linear Accelerator (ORELA) as a source of pulsed neutrons. The 1.6 mm dia. cylindrical transmission samples contained initially up to 5.3 mg of 98% 249 Bk and 2% 249 Cf: 4.5 years later, when the final measurements were made, the composition of the samples had become 2.5% 249 Bk, 96.9% 249 Cf, and 0.6% 245 Cm. Samples were cooled with liquid nitrogen to reduce Doppler broadening. Thirty-nine resonances were identified in 249 Bk and analyzed using a single-level Breit-Wigner formalism. Fifty-five resonances were identified in 249 Cf and analyzed using an R-matrix multilevel formalism. Fifty-five resonances were identified in 249 Cf and analyzed using an R-matrix multilevel formalism. The resonance parameters obtained have been used to determine the average level spacings and the s-wave neutron and fission strength functions. Where possible, bound-level parameters were derived to fit the thermal neutron total cross section data

  4. 15 CFR 24.3 - Definitions.

    Science.gov (United States)

    2010-01-01

    ..., nonexpendable, personal property having a useful life of more than one year and an acquisition cost of $5,000 or... are made for construction work according to the percentage of completion of the work, rather than to... the unobligated balance in a prior period; (2) Withdrawal of the unobligated balance as of the...

  5. 40 CFR 243.101 - Definitions.

    Science.gov (United States)

    2010-07-01

    ... means the act of removing solid waste (or materials which have been separated for the purpose of recycling) from a central storage point. (f) Collection frequency means the number of times collection is... the purpose of these guidelines. United States Government installations located on foreign soil or on...

  6. 40 CFR 243.100 - Scope.

    Science.gov (United States)

    2010-07-01

    ... additional actions or preferred methods by which the objectives of the requirements can be realized. The... post offices, military recruiting stations, and other offices where local community solid waste...

  7. Determination of Neptunium, Americium and Curium in Spent Nuclear Fuel Samples by Alpha Spectrometry Using 239Np and 243Am as a Spike and a Tracer

    International Nuclear Information System (INIS)

    Jeo, Kih-Soo; Song, Byung-Chul; Kim, Young-Bok; Han, Sun-Ho; Jeon, Young-Shin; Jung, Euo-Chang; Jee, Kwang-Yong

    2007-01-01

    Determination of actinide elements and fission products in spent nuclear fuels is of importance for a burnup determination and source term evaluation. Especially, the amounts of uranium and plutonium isotopes are used for the evaluation of a burnup credit in spent nuclear fuels. Additionally, other actinides such as Np, Am and Cm in spent nuclear fuel samples is also required for the purposes mentioned above. In this study, 237 Np, 241 Am and 244 Cm were determined by an alpha spectrometry for the source term data for high burnup spent nuclear fuels ranging from 37 to 62.9 GWD/MtU as a burnup. Generally, mass spectrometry has been known as the most powerful method for isotope determinations such as high concentrations of uranium and plutonium. However, in the case of minor actinides such as Np, Am and Cm, alpha spectrometry would be recommended instead. Determination of the transuranic elements in spent nuclear fuel samples is different from that for environmental samples because the amount of each nuclide in the spent fuel samples is higher and the relative ratios between each nuclide are also different from those for environmental samples. So, it is important to select an appropriate tracer and an optimum sample size depending on the nuclides and analytical method. In this study 237 Np was determined by an isotope dilution alpha(gamma) spectrometry using 239 Np as a spike, and 241 Am and curium isotopes were determined by alpha spectrometry using 243 Am as a tracer. The content of each nuclide was compared with that by the Origen-2 code

  8. Identification of the new isotope sup 2 sup 4 sup 1 Bk

    CERN Document Server

    Asai, M; Ichikawa, S; Nagame, Y; Nishinaka, I; Akiyama, K; Toyoshima, A; Kaneko, T; Sakama, M; Haba, H; Oura, Y; Kojima, Y; Shibata, M

    2003-01-01

    A new neutron-deficient berkelium isotope sup 2 sup 4 sup 1 Bk produced in the sup 2 sup 3 sup 9 Pu( sup 6 Li, 4n) reaction has been identified using a gas-jet coupled on-line isotope separator. Cm K and L X-rays associated with the EC decay of sup 2 sup 4 sup 1 Bk were observed in the mass-241 fraction, and three gamma transitions were attributed to the EC decay of sup 2 sup 4 sup 1 Bk through X-gamma coincidences. The half-life of sup 2 sup 4 sup 1 Bk was determined to be 4.6+-0.4 min which is 1/2-1/4 of that of theoretical predictions. The half-life value and the observed gamma transitions can be consistently explained as a consequence of the allowed EC transition of pi 7/2 sup + [633] -> nu 7/2 sup + [624]. (orig.)

  9. Reactor production of 252Cf and transcurium isotopes

    International Nuclear Information System (INIS)

    Alexander, C.W.; Halperin, J.; Walker, R.L.; Bigelow, J.E.

    1990-01-01

    Berkelium, californium, einsteinium, and fermium are currently produced in the High Flux Isotope Reactor (HFIR) and recovered in the Radiochemical Engineering Development Center (REDC) at the Oak Ridge National Laboratory (ORNL). All the isotopes are used for research. In addition, 252 Cf, 253 Es, and 255 Fm have been considered or are used for industrial or medical applications. ORNL is the sole producer of these transcurium isotopes in the western world. A wide range of actinide samples were irradiated in special test assemblies at the Fast Flux Test Facility (FFTF) at Hanford, Washington. The purpose of the experiments was to evaluate the usefulness of the two-group flux model for transmutations in the special assemblies with an eventual goal of determining the feasibility of producing macro amounts of transcurium isotopes in the FFTF. Preliminary results from the production of 254g Es from 252 Cf will be discussed. 14 refs., 5 tabs

  10. Actinide metals

    Energy Technology Data Exchange (ETDEWEB)

    Brown, Paul L. [Geochem Australia, Kiama, NSW (Australia); Ekberg, Christian [Chalmers Univ. of Technology, Goeteborg (Sweden). Nuclear Chemistry/Industrial Materials Recycling

    2016-07-01

    All isotopes of actinium are radioactive and exist in aqueous solution only in the trivalent state. There have been very few studies on the hydrolytic reactions of actinium(III). The hydrolysis reactions for uranium would only be important in alkaline pH conditions. Thermodynamic parameters for the hydrolysis species of uranium(VI) and its oxide and hydroxide phases can be determined from the stability and solubility constants. The hydrolytic behaviour of neptunium(VI) is quite similar to that of uranium(VI). The solubility constant of NpO{sub 2}OH(am) has been reported a number of times for both zero ionic strength and in fixed ionic strength media. Americium can form four oxidation states in aqueous solution, namely trivalent, tetravalent, pentavalent and hexavalent. Desire, Hussonnois and Guillaumont determined stability constants for the species AmOH{sup 2+} for the actinides, plutonium(III), americium(III), curium(III), berkelium(III) and californium(III) using a solvent extraction technique.

  11. Actinide metals

    International Nuclear Information System (INIS)

    Brown, Paul L.; Ekberg, Christian

    2016-01-01

    All isotopes of actinium are radioactive and exist in aqueous solution only in the trivalent state. There have been very few studies on the hydrolytic reactions of actinium(III). The hydrolysis reactions for uranium would only be important in alkaline pH conditions. Thermodynamic parameters for the hydrolysis species of uranium(VI) and its oxide and hydroxide phases can be determined from the stability and solubility constants. The hydrolytic behaviour of neptunium(VI) is quite similar to that of uranium(VI). The solubility constant of NpO 2 OH(am) has been reported a number of times for both zero ionic strength and in fixed ionic strength media. Americium can form four oxidation states in aqueous solution, namely trivalent, tetravalent, pentavalent and hexavalent. Desire, Hussonnois and Guillaumont determined stability constants for the species AmOH 2+ for the actinides, plutonium(III), americium(III), curium(III), berkelium(III) and californium(III) using a solvent extraction technique.

  12. Nuclear Chemistry Institute, Mainz University. Annual Report 1995

    International Nuclear Information System (INIS)

    Denschlag, H.O.

    1996-03-01

    The annual report of the Institut fuer Kernchemie addresses inter alia three main research activities. The first belongs to the area of basic research, covering studies in the fields of nuclear fission, chemistry of the super-heavy elements and of heavy-ion reactions extending from the Coulomb barrier to relativistic energies, and nuclear astrophysics in connection with the ''r process''. By means of laser technology, high-precision data could be measured of the ionization energies of berkelium and californium. Studies of atomic clusters in the vacuum of an ionization trap revealed interesting aspects. The second major activity was devoted to the analysis of environmental media, applying inter alia neutron activation analysis and resonance ionization mass spectroscopy (RIMS). The third activity resulted in the development of novel processes, or the enhancement of existing processes or methods, for applications in basic research work and in environmental analytics. Another item of interest is the summarizing report on the operation of the TRIGA research reactor. (orig./SR) [de

  13. Remarkably High Stability of Late Actinide Dioxide Cations: Extending Chemistry to Pentavalent Berkelium and Californium.

    Science.gov (United States)

    Dau, Phuong D; Vasiliu, Monica; Peterson, Kirk A; Dixon, David A; Gibson, John K

    2017-12-06

    Actinyl chemistry is extended beyond Cm to BkO 2 + and CfO 2 + through transfer of an O atom from NO 2 to BkO + or CfO + , establishing a surprisingly high lower limit of 73 kcal mol -1 for the dissociation energies, D[O-(BkO + )] and D[O-(CfO + )]. CCSD(T) computations are in accord with the observed reactions, and characterize the newly observed dioxide ions as linear pentavalent actinyls; these being the first Bk and Cf species with oxidation states above IV. Computations of actinide dioxide cations AnO 2 + for An=Pa to Lr reveal an unexpected minimum for D[O-(CmO + )]. For CmO 2 + , and AnO 2 + beyond EsO 2 + , the most stable structure has side-on bonded η 2 -(O 2 ), as An III peroxides for An=Cm and Lr, and as An II superoxides for An=Fm, Md, and No. It is predicted that the most stable structure of EsO 2 + is linear [O=Es V =O] + , einsteinyl, and that FmO 2 + and MdO 2 + , like CmO 2 + , also have actinyl(V) structures as local energy minima. The results expand actinide oxidation state chemistry, the realm of the distinctive actinyl moiety, and the non-periodic character towards the end of the periodic table. © 2017 Wiley-VCH Verlag GmbH & Co. KGaA, Weinheim.

  14. Genome-wide linkage scan for maximum and length-dependent knee muscle strength in young men: significant evidence for linkage at chromosome 14q24.3.

    Science.gov (United States)

    De Mars, G; Windelinckx, A; Huygens, W; Peeters, M W; Beunen, G P; Aerssens, J; Vlietinck, R; Thomis, M A I

    2008-05-01

    Maintenance of high muscular fitness is positively related to bone health, functionality in daily life and increasing insulin sensitivity, and negatively related to falls and fractures, morbidity and mortality. Heritability of muscle strength phenotypes ranges between 31% and 95%, but little is known about the identity of the genes underlying this complex trait. As a first attempt, this genome-wide linkage study aimed to identify chromosomal regions linked to muscle and bone cross-sectional area, isometric knee flexion and extension torque, and torque-length relationship for knee flexors and extensors. In total, 283 informative male siblings (17-36 years old), belonging to 105 families, were used to conduct a genome-wide SNP-based multipoint linkage analysis. The strongest evidence for linkage was found for the torque-length relationship of the knee flexors at 14q24.3 (LOD = 4.09; p<10(-5)). Suggestive evidence for linkage was found at 14q32.2 (LOD = 3.00; P = 0.005) for muscle and bone cross-sectional area, at 2p24.2 (LOD = 2.57; p = 0.01) for isometric knee torque at 30 degrees flexion, at 1q21.3, 2p23.3 and 18q11.2 (LOD = 2.33, 2.69 and 2.21; p<10(-4) for all) for the torque-length relationship of the knee extensors and at 18p11.31 (LOD = 2.39; p = 0.0004) for muscle-mass adjusted isometric knee extension torque. We conclude that many small contributing genes rather than a few important genes are involved in causing variation in different underlying phenotypes of muscle strength. Furthermore, some overlap in promising genomic regions were identified among different strength phenotypes.

  15. Publications | Page 243 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    In Guyana and Colombia, as in most Latin American countries, mining has dramatically increased over the past two decades. But from the contamination of healthy rivers to the lawless atmosphere of mining towns, few have felt the ill effects. ... Collecting data in the slums of Nairobi, Kenya can be a dangerous job.

  16. 40 CFR 243.200-1 - Requirement.

    Science.gov (United States)

    2010-07-01

    ... for the purpose of recycling) shall be stored in such a manner that they do not constitute a fire... recycling) must meet the standards established by the American National Standards Institute (ANSI) for waste...

  17. 40 CFR 243.202-1 - Requirement.

    Science.gov (United States)

    2010-07-01

    ... solid waste (or materials which have been separated for the purpose of recycling) which are considered... transportation of solid waste (or materials which have been separated for the purpose of recycling) shall be... materials which have been separated for the purpose of recycling) shall be constructed, operated, and...

  18. 28 CFR 2.43 - Early termination.

    Science.gov (United States)

    2010-07-01

    ... terminated because there is a likelihood that the parolee will engage in conduct violating any criminal law... shall review the status of the parolee to determine the need for continued supervision. The Commission shall also conduct a status review whenever the supervision officer recommends early termination of the...

  19. Galileo photometry of asteroid 243 Ida

    Science.gov (United States)

    Helfenstein, P.; Veverka, J.; Thomas, P.C.; Simonelli, D.P.; Klaasen, K.; Johnson, T.V.; Fanale, F.; Granahan, J.; McEwen, A.S.; Belton, M.; Chapman, C.

    1996-01-01

    Galileo imaging observations over phase angles 19.5?? to 109.8?? are combined with near-opposition Earth-based data to derive the photometric properties of Ida. To first order these properties are uniform over the surface and well modeled at ?? = 0.55 ??m by Hapke parameters ????0 = 0.22, h = 0.020, B0 = 1.5, g = -0.33, and ?? = 18?? with corresponding geometric albedo p = 0.21??0.030.01 and Bond albedo AB = 0.081??0.0170.008. Ida's photometric properties are more similar to those of "average S-asteroids" (P. Helfenstein and J. Veverka 1989, Asteroids II, Univ. of Arizona Press, Tucson) than are those of 951 Gaspra. Two primary color units are identified on Ida: Terrain A exhibits a spectrum with relatively shallower 1-??m absorption and a relatively steeper red spectral slope than average Ida, while Terrain B has a deeper 1-??m absorption and a less steep red slope. The average photometric properties of Ida and Terrain A are similar while those of Terrain B differ mostly in having a slightly higher value of ????0 (0.22 versus 0.21), suggesting that Terrain B consists of slightly brighter, more transparent regolith particles. Galileo observations of Ida's satellite Dactyl over phase angles 19.5?? to 47.6?? suggest photometric characteristics similar to those of Ida, the major difference being Dactyl's slightly lower albedo (0.20 compared to 0.21). ?? 1990 Academic Press, Inc.

  20. Publications | Page 243 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    IDRC works with developing-country researchers and institutions to build local ... aim to widen the impact of our investment and advance development research. ... A new window on the world for women ... In doing so, it emphasizes obstacles to peace rather than root causes of conflict. ... Declining poverty, rising inequality.

  1. Evaluation of thermal neutron cross-sections and resonance integrals of protactinium, americium, curium, and berkelium isotopes

    International Nuclear Information System (INIS)

    Belanova, T.S.

    1994-12-01

    Data on the thermal neutron fission and capture cross-sections as well as their corresponding resonance integrals are reviewed and analysed. The data are classified according to the form of neutron spectra under investigation. The weighted mean values of the cross-sections and resonance integrals for every type of neutron spectra were adopted as evaluated data. (author). 87 refs, 2 tabs

  2. Extraction of transplutonium elements from carbonate solutions by alkylpyrocatechol

    International Nuclear Information System (INIS)

    Karalova, Z.K.; Myasoedov, B.F.; Rodionova, L.M.; Kuznetsova, V.S.

    1983-01-01

    Extraction of americium, berkelium as well as Ce, Eu, Th, U, Zr, Cs, Fe with solution of 4(α, α-dioctylethyl)pyrocatechol (DOP) in toluene from carbonate solutions to determine conditions of their separation has been studied. It is established that americium extraction is quite sensitive to the changes of potassium carbonate concentration. The maximum extraction of americium (R >90%) is observed in the case of 0.1-0.5 mol/l of K 2 CO 3 solutions and the minimum one (R=2.5%) - in the case of 8 mol/l K 2 CO 3 . Americium extraction increases sharply when sodium hydroxide is introduced in carbonate solutions. It is shown that varying sodium hydroxide concentration it is possible to achieve qualitative extraction of americium even from saturated solution of potassium carbonate. Reextraction of TPE is easily realized with 3 mol/l HCl solution. The system K 2 CO 3 (KOH)-DOP proved to be perspective for Am separation from Bk, Ce, Cs, actinoid elements as well as from Fe

  3. Functional Characterization of a Novel Truncating Mutation in Lamin A/C Gene in a Family with a Severe Cardiomyopathy with Conduction Defects

    Directory of Open Access Journals (Sweden)

    Andrea Gerbino

    2017-12-01

    Full Text Available Background/Aims: Truncating LMNA gene mutations occur in many inherited cardiomyopathy cases, but the molecular mechanisms involved in the disease they cause have not yet been systematically investigated. Here, we studied a novel frameshift LMNA variant (p.D243Gfs*4 identified in three members of an Italian family co-segregating with a severe form of cardiomyopathy with conduction defects. Methods: HEK293 cells and HL-1 cardiomyocytes were transiently transfected with either Lamin A or D243Gfs*4 tagged with GFP (or mCherry. D243Gfs*4 expression, cellular localization and its effects on diverse cellular mechanisms were evaluated with western blotting, laser-scanning confocal microscopy and video-imaging analysis in single cells. Results: When expressed in HEK293 cells, GFP- (or mCherry-tagged LMNA D243Gfs*4 colocalized with calnexin within the ER. ER mislocalization of LMNA D243Gfs*4 did not significantly induce ER stress response, abnormal Ca2+ handling and apoptosis when compared with HEK293 cells expressing another truncated mutant of LMNA (R321X which similarly accumulates within the ER. Of note, HEK293-LMNA D243Gfs*4 cells showed a significant reduction of connexin 43 (CX43 expression level, which was completely rescued by activation of the WNT/β-catenin signaling pathway. When expressed in HL-1 cardiomyocytes, D243Gfs*4 significantly impaired the spontaneous Ca2+ oscillations recorded in these cells as result of propagation of the depolarizing waves through the gap junctions between non-transfected cells surrounding a cell harboring the mutation. Furthermore, mCh-D243Gfs*4 HL-1 cardiomyocytes showed reduced CX43-dependent Lucifer Yellow (LY loading and propagation. Of note, activation of β-catenin rescued both LY loading and LMNA D243Gfs*4 -HL-1 cells spontaneous activity propagation. Conclusion: Overall, the present results clearly indicate the involvement of the aberrant CX43 expression/activity as a pathogenic mechanism for the

  4. ORF Alignment: NC_002940 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available FHAVLETVQKKQI Sbjct: 1 ... IPRIYHPEPLKNQTSCSLSEDATNHIGRVLRMNVGEKIILFDGSNHIFHAVLETVQKKQI 60 ... Query: 123 RQDKKLQQWQKIAIAACEQCERN...QVPQIRPIMKLTDWCKEQDEMLKLNLHPRAKYTIRQL 182 ... RQDKKLQQWQKIAIAACEQCERNQVPQIRPIMKLTDWCK...EQDEMLKLNLHPRAKYTIRQL Sbjct: 121 RQDKKLQQWQKIAIAACEQCERNQVPQIRPIMKLTDWCKEQDEMLKLNLHPRAKYTIRQL 180 ... Query: 243 L 243 ... L Sbjct: 241 L 241

  5. Protein (Cyanobacteria): 230634 [PGDBj - Ortholog DB

    Lifescience Database Archive (English)

    Full Text Available ZP_11685390.1 1117:4412 1118:3009 263510:243 263511:243 423471:1998 Na-Ca exchanger/integri...n-beta4, partial Crocosphaera watsonii WH 0003 MDNTQFRGAFSRETNTIYFSEKLVRDTVLQFETVEDINSDNQYIQAFVAVWLEEIGHSVEAQLNEEEIAGDEGRI

  6. Zajímavý záchyt korynebakterie, maskující se jako koagulázanegativní stafylokok

    Czech Academy of Sciences Publication Activity Database

    Petráš, P.; Novotná, Gabriela; Machová, I.; Glavach-Hlaváčová, N.; Šimečková, E.

    2005-01-01

    Roč. 14, č. 5 (2005), s. 243-243 ISSN 1211-7358 Institutional research plan: CEZ:AV0Z50200510 Keywords : staphylococci * corynebacterium * biochemical identification Subject RIV: EE - Microbiology, Virology

  7. Preface: phys. stat. sol. (b) 243/5

    Science.gov (United States)

    Artacho, Emilio; Beck, Thomas L.; Hernández, Eduardo

    Between 20 and 24 June 2005 the Centre Européen de Calcul Atomique et Moléculaire - or CECAM, as it is more widely known - hosted a workshop entitled State-of-the-art, developments and perspectives of real-space electronic structure methods in condensed-matter and chemical physics, organized with the support of CECAM itself and the ?k network. The workshop was attended by some forty participants coming from fifteen countries, and about thirty presentations were given. The workshop provided a lively forum for the discussion of recent methodological developments in electronic structure calculations, ranging from linear-scaling methods, mesh techniques, time-dependent density functional methods, and a long etcetera, which had been our ultimate objective when undertaking its organization.The first-principles simulation of solids, liquids and complex matter in general has jumped in the last few years from the relatively confined niches in condensed matter and materials physics and in quantum chemistry, to cover most of the sciences, including nano, bio, geo, environmental sciences and engineering. This effect has been propitiated by the ability of simulation techniques to deal with an ever larger degree of complexity. Although this is partially to be attributed to the steady increase in computer power, the main factor behind this change has been the coming of age of the main theoretical framework for most of the simulations performed today, together with an extremely active development of the basic algorithms for its computer implementation. It is this latter aspect that is the topic of this special issue of physica status solidi.There is a relentless effort in the scientific community seeking to achieve not only higher accuracy, but also more efficient, cost-effective and if possible simpler computational methods in electronic structure calculations [1]. From the early 1990s onwards there has been a keen interest in the computational condensed matter and chemical physics communities in methods that had the potential to overcome the unfavourable scaling of the computational cost with the system size, implicit in the momentum-space formalism familiar to solid-state physicists and the quantum chemistry approaches more common in chemical physics and physical chemistry. This interest was sparkled by the famous paper in which Weitao Yang [2] introduced the Divide and Conquer method. Soon afterwards several practical schemes aiming to achieve linear-scaling calculations, by exploiting what Walter Kohn called most aptly the near-sightedness of quantum mechanics [3], were proposed and explored (for a review on linear-scaling methods, see [4]). This search for novel, more efficient and better scaling algorithms proved to be fruitful in more than one way. Not only was it the start of several packages which are well-known today (such as Siesta, Conquest, etc.), but it also leads to new ways of representing electronic states and orbitals, such as grids [5, 6], wavelets [7], finite elements, etc. Also, the drive to exploit near-sightedness attracted computational solid state physicists to the type of atomic-like basis functions traditionally used in the quantum chemistry community. At the same time computational chemists learnt about plane waves and density functional theory, and thus a fruitful dialogue was started between two communities that hitherto had not had much contact.Another interesting development that has begun to take place over the last decade or so is the convergence of several branches of science, notably physics, chemistry and biology, at the nanoscale. Experimentalists in all these different fields are now performing highly sophisticated measurements on systems of nanometer size, the kind of systems that us theoreticians can address with our computational methods, and this convergence of experiment and theory at this scale has also been very fruitful, particularly in the fields of electronic transport and STM image simulation. It is now quite common to find papers at the cutting edge of nanoscience and nanotechnology co-authored by experimentalists and theorists, and it can only be expected that this fruitful interplay between theory and experiment will increase in the future.It was considerations such as these that moved us to propose to CECAM and ?k the celebration of a workshop devoted to the discussion of recent developments in electronic structure techniques, a proposal that was enthusiastically received, not just by CECAM and ?k, but also by our invited speakers and participants. Interest in novel electronic structure methods is now as high as ever, and we are therefore very happy that physica status solidi has given us the opportunity to devote a special issue to the topics covered in the workshop. This special issue of physica status solidi gathers invited contributions from several attendants to the workshop, contributions that are representative of the range of topics and issues discussed then, including progress in linear scaling methods, electronic transport, simulation of STM images, time-dependent DFT methods, etc. It rests for us to thank all the contributors to this special issue for their efforts, CECAM and ?k for funding the workshop, physica status solidi for agreeing to devote this special issue to the workshop, and last but not least Emmanuelle and Emilie, the CECAM secretaries, for their invaluable practical help in putting this workshop together

  8. 9 CFR 354.243 - Operations and procedures.

    Science.gov (United States)

    2010-01-01

    ... INSPECTION AND CERTIFICATION VOLUNTARY INSPECTION OF RABBITS AND EDIBLE PRODUCTS THEREOF Maintenance of..., and insects), considering the means intended to be employed in transporting the product from the plant... hygiene of personnel: (1) All employees coming in contact with exposed edible products or edible products...

  9. 29 CFR 1952.243 - Final approval determination.

    Science.gov (United States)

    2010-07-01

    ... over agricultural temporary labor camps for employees engaged in egg, poultry, or red meat production... Labor Regulations Relating to Labor (Continued) OCCUPATIONAL SAFETY AND HEALTH ADMINISTRATION..., or the U.S. Department of Commerce—National Oceanic and Atmospheric Administration, and operated by...

  10. 12 CFR 303.243 - Brokered deposit waivers.

    Science.gov (United States)

    2010-01-01

    ... and use of brokered deposits; (7) A recent consolidated financial statement with balance sheet and income statements; and (8) The reasons the institution believes its acceptance, renewal or rollover of...) The time period for which the waiver is requested; (2) A statement of the policy governing the use of...

  11. 48 CFR 1852.243-71 - Shared savings.

    Science.gov (United States)

    2010-10-01

    ... organizational support of a contract or group of contracts. These alternatives must result in a net reduction of... organizational support which are proposed to be changed. (2) A description of the difference between the current... make any structural or organizational changes in order to implement an approved CRP. (5) Government...

  12. A DETAILED GRAVITATIONAL LENS MODEL BASED ON SUBMILLIMETER ARRAY AND KECK ADAPTIVE OPTICS IMAGING OF A HERSCHEL-ATLAS SUBMILLIMETER GALAXY AT z = 4.243 {sup ,} {sup ,}

    Energy Technology Data Exchange (ETDEWEB)

    Bussmann, R. S.; Gurwell, M. A. [Harvard-Smithsonian Center for Astrophysics, 60 Garden Street, Cambridge, MA 02138 (United States); Fu Hai; Cooray, A. [Department of Physics and Astronomy, University of California, Irvine, CA 92697 (United States); Smith, D. J. B.; Bonfield, D.; Dunne, L. [Centre for Astrophysics, Science and Technology Research Institute, University of Hertfordshire, Hatfield, Herts AL10 9AB (United Kingdom); Dye, S.; Eales, S. [School of Physics and Astronomy, University of Nottingham, University Park, Nottingham NG7 2RD (United Kingdom); Auld, R. [Cardiff University, School of Physics and Astronomy, Queens Buildings, The Parade, Cardiff CF24 3AA (United Kingdom); Baes, M.; Fritz, J. [Sterrenkundig Observatorium, Universiteit Gent, Krijgslaan 281 S9, B-9000 Gent (Belgium); Baker, A. J. [Department of Physics and Astronomy, Rutgers, the State University of New Jersey, 136 Frelinghuysen Road, Piscataway, NJ 08854-8019 (United States); Cava, A. [Departamento de Astrofisica, Facultad de CC. Fisicas, Universidad Complutense de Madrid, E-28040 Madrid (Spain); Clements, D. L.; Dariush, A. [Imperial College London, Blackett Laboratory, Prince Consort Road, London SW7 2AZ (United Kingdom); Coppin, K. [Department of Physics, McGill University, Ernest Rutherford Building, 3600 Rue University, Montreal, Quebec, H3A 2T8 (Canada); Dannerbauer, H. [Universitaet Wien, Institut fuer Astronomie, Tuerkenschanzstrasse 17, 1180 Wien, Oesterreich (Austria); De Zotti, G. [Universita di Padova, Dipto di Astronomia, Vicolo dell' Osservatorio 2, IT 35122, Padova (Italy); Hopwood, R., E-mail: rbussmann@cfa.harvard.edu [Department of Physics and Astronomy, Open University, Walton Hall, Milton Keynes, MK7 6AA (United Kingdom); and others

    2012-09-10

    We present high-spatial resolution imaging obtained with the Submillimeter Array (SMA) at 880 {mu}m and the Keck adaptive optics (AO) system at the K{sub S}-band of a gravitationally lensed submillimeter galaxy (SMG) at z = 4.243 discovered in the Herschel Astrophysical Terahertz Large Area Survey. The SMA data (angular resolution Almost-Equal-To 0.''6) resolve the dust emission into multiple lensed images, while the Keck AO K{sub S}-band data (angular resolution Almost-Equal-To 0.''1) resolve the lens into a pair of galaxies separated by 0.''3. We present an optical spectrum of the foreground lens obtained with the Gemini-South telescope that provides a lens redshift of z{sub lens} = 0.595 {+-} 0.005. We develop and apply a new lens modeling technique in the visibility plane that shows that the SMG is magnified by a factor of {mu} = 4.1 {+-} 0.2 and has an intrinsic infrared (IR) luminosity of L{sub IR} = (2.1 {+-} 0.2) Multiplication-Sign 10{sup 13} L{sub Sun }. We measure a half-light radius of the background source of r{sub s} = 4.4 {+-} 0.5 kpc which implies an IR luminosity surface density of {Sigma}{sub IR} (3.4 {+-} 0.9) Multiplication-Sign 10{sup 11} L{sub Sun} kpc{sup -2}, a value that is typical of z > 2 SMGs but significantly lower than IR luminous galaxies at z {approx} 0. The two lens galaxies are compact (r{sub lens} Almost-Equal-To 0.9 kpc) early-types with Einstein radii of {theta}{sub E1} 0.57 {+-} 0.01 and {theta}{sub E2} = 0.40 {+-} 0.01 that imply masses of M{sub lens1} = (7.4 {+-} 0.5) Multiplication-Sign 10{sup 10} M{sub Sun} and M{sub lens2} = (3.7 {+-} 0.3) Multiplication-Sign 10{sup 10} M{sub Sun }. The two lensing galaxies are likely about to undergo a dissipationless merger, and the mass and size of the resultant system should be similar to other early-type galaxies at z {approx} 0.6. This work highlights the importance of high spatial resolution imaging in developing models of strongly lensed galaxies

  13. Radioactivity studies. Progress report. Volume II

    International Nuclear Information System (INIS)

    Cohen, N.

    1981-09-01

    The metabolism of 243 244 Cm in nine adult female baboons following intravenous injection was studied. Curium-243,244 was administered as a single injection of curium citrate in dosages of 0.053 to 0.220 μCi/kg. The behavior of 243 244 Cm at these low dosages was quantitated by external whole-body and partial-body counting, bioassay of blood, urine and feces samples, liver biopsies, and post-mortem tissues analysis. Curium-243,244 rapidly passed from the blood to other tissues. At 1 and 24 h after injection, the amounts circulating were 10% and 1%, respectively. At 24 h after injection 70% of the 243 244 Cm was located within soft tissues, probably associated with extracellular fluid; the liver alone contained 32% of the injected activity. During the first weeks the content of 243 244 Cm in soft tissues decreased sharply. As time progressed, significant deposition was noted in the liver and the skeleton. Approximately 20% of the injected activity was in the liver at 1 month with a 40 day half-time. The skeleton reached a maximum burden of 57% by 100 days; the half-time observed in bone was 4 to 16 y. During the first 24 h, 10% of the injected activity appeared in the urine decreasing to 0.1%/day at 30 days and 0.01%/day at 200 days. Fecal excretion increased reaching a maximum level at four weeks. The amount of 243 244 Cm excreted in the feces during the initial 4 to 5 months (approx. 20%) and the rate of elimination in the feces after the first month paralleled the retention in the liver indicating an hepatic-biliary-fecal pathway. A model illustrating the interaction of seven internal compartments with respect to the translocation kinetics of 243 244 Cm was derived based upon this data. Solutions of the model were derived for two specific time-related exposures

  14. Estimation of radioactive contaminants in Cm242 and Cm244 isotopic fuels

    International Nuclear Information System (INIS)

    Terent'ev, V.P.; Makarenko, A.I.

    1972-01-01

    The radiation properties of Cm 242 and Cm 244 preparations and the effect on them of possible contaminants are considered. One of the most important requirements for K alpha active fuels for radioisotope thermoelectric batteries is ensuring a low ionizing radiation background. In determining the effect of impurities on the radiation properties of a preparation, quantitative evaluation of certain factors is sufficient. In a Cm 242 preparation it is possible to show that Am 241 and Cm 243 are undesirable impurities. The presence of Am 241 increases the soft gamma output by 20%. The presence of Cm 243 may double the dose rate from an unshielded preparation and increase the hard gamma output 10-fold. The properties of Cm 242 preparations deteriorate when Am 243 and Cm 243 are present

  15. Petroleum hydrocarbons in surface sediments in Kandla creek (Gujarat)

    Digital Repository Service at National Institute of Oceanography (India)

    Kadam, A.N.

    stream_size 6 stream_content_type text/plain stream_name Mahasagar_20_243.pdf.txt stream_source_info Mahasagar_20_243.pdf.txt Content-Encoding ISO-8859-1 Content-Type text/plain; charset=ISO-8859-1 ...

  16. Management of nuclear materials in an R ampersand D environment at the Los Alamos National Laboratory

    International Nuclear Information System (INIS)

    Behrens, R.G.; Roth, S.B.; Jones, S.R.

    1991-01-01

    Los Alamos National Laboratory is a multidisciplinary R ampersand D organization and, as such, its nuclear materials inventory is diverse. Accordingly, major inventories of isotopes such as Pu-238, Pu-239, Pu-242, U-235, Th, tritium, and deuterium, and lesser amounts of isotopes of Am, Cm, Np and exotic isotopes such as berkelium must be managed in accordance with Department of Energy Orders and Laboratory policies. Los Alamos also acts as a national resource for many one-of-a-kind materials which are supplied to universities, industry, and other government agencies within the US and throughout the world. Management of these materials requires effective interaction and communication with many nuclear materials custodians residing in over forty technical groups as well as effective interaction with numerous outside organizations. This paper discusses the role, philosophy, and organizational structure of Nuclear Materials Management at Los Alamos and also briefly presents results of two special nuclear materials management projects: 1- Revision of Item Description Codes for use in the Los Alamos nuclear material data base and 2- The recommendation of new economic discard limits for Pu-239. 2 refs., 1 fig

  17. Marine data and information management system for the Indian Ocean

    Digital Repository Service at National Institute of Oceanography (India)

    Sarupria, J.S.

    stream_size 8 stream_content_type text/plain stream_name IGBP_India_2000_243.pdf.txt stream_source_info IGBP_India_2000_243.pdf.txt Content-Encoding ISO-8859-1 Content-Type text/plain; charset=ISO-8859-1 ...

  18. Male gender, Charnley class C, and severity of bone defects predict the risk for aseptic loosening in the cup of ABG I hip arthroplasty

    Czech Academy of Sciences Publication Activity Database

    Gallo, J.; Havránek, Vítězslav; Zapletalová, J.; Lošťák, J.

    2010-01-01

    Roč. 11, č. 10 (2010), 243/1-243/7 E-ISSN 1471-2474 Institutional research plan: CEZ:AV0Z10100522 Keywords : hip arthroplasty * ABG I Subject RIV: BH - Optics, Masers, Lasers Impact factor: 1.941, year: 2010

  19. Maslov. Evaluated neutron reaction data for Am and Cm isotopes. Summary documentation

    International Nuclear Information System (INIS)

    Lemmel, H.D.

    1996-01-01

    The nuclear data file by V.M. Maslov et al includes evaluated neutron reaction data for Am-241,243 Cm-243-245,246 in EDNF-6 format. The data are available from the IAEA Nuclear Data Section, costfree upon request. (author)

  20. Study of the /sup 12/N 2. 43 MeV level. [Differential cross sections; 44 MeV /sup 3/He; 52 MeV p

    Energy Technology Data Exchange (ETDEWEB)

    Cecil, F E; Shepard, J R; Sercely, R R; Peterson, R J [Colorado Univ., Boulder (USA). Nuclear Physics Lab.; King, N S.P. [California Univ., Davis (USA). Crocker Nuclear Lab.

    1976-10-11

    The differential cross sections have been measured for the reactions /sup 12/C(/sup 3/He, /sup 3/He')/sup 12/C(17.77 MeV 0/sup +/ T = 1) and /sup 12/C(/sup 3/He, t)/sup 12/N(2.43 MeV) at Esub(/sup 3/He) = 44 MeV. The similar shapes of the angular distributions and the relative magnitudes of the cross sections suggest that the /sup 12/N 2.43 MeV level is the 0/sup +/ T = 1 analog to the /sup 12/C 17.77 MeV level. The reaction /sup 14/N(p, t)/sup 12/N(2.43 MeV) at Esub(p) = 52 MeV is also studied. The strength with which this level is excited in this reaction is consistent with reasonable two-step calculations assuming the 2.43 MeV level to have Jsup(..pi..) = 0/sup +/.

  1. Sacred Space and Sublime Sacramental Piety

    DEFF Research Database (Denmark)

    Petersen, Nils Holger

    2012-01-01

    Analyses and Discussions of Mozart's Sacramental Litanies K. 125 and K. 243 in relation to the notions of the Sacred and the Sublime.......Analyses and Discussions of Mozart's Sacramental Litanies K. 125 and K. 243 in relation to the notions of the Sacred and the Sublime....

  2. A small-molecule inhibitor of the ubiquitin activating enzyme for cancer treatment.

    Science.gov (United States)

    Hyer, Marc L; Milhollen, Michael A; Ciavarri, Jeff; Fleming, Paul; Traore, Tary; Sappal, Darshan; Huck, Jessica; Shi, Judy; Gavin, James; Brownell, Jim; Yang, Yu; Stringer, Bradley; Griffin, Robert; Bruzzese, Frank; Soucy, Teresa; Duffy, Jennifer; Rabino, Claudia; Riceberg, Jessica; Hoar, Kara; Lublinsky, Anya; Menon, Saurabh; Sintchak, Michael; Bump, Nancy; Pulukuri, Sai M; Langston, Steve; Tirrell, Stephen; Kuranda, Mike; Veiby, Petter; Newcomb, John; Li, Ping; Wu, Jing Tao; Powe, Josh; Dick, Lawrence R; Greenspan, Paul; Galvin, Katherine; Manfredi, Mark; Claiborne, Chris; Amidon, Benjamin S; Bence, Neil F

    2018-02-01

    The ubiquitin-proteasome system (UPS) comprises a network of enzymes that is responsible for maintaining cellular protein homeostasis. The therapeutic potential of this pathway has been validated by the clinical successes of a number of UPS modulators, including proteasome inhibitors and immunomodulatory imide drugs (IMiDs). Here we identified TAK-243 (formerly known as MLN7243) as a potent, mechanism-based small-molecule inhibitor of the ubiquitin activating enzyme (UAE), the primary mammalian E1 enzyme that regulates the ubiquitin conjugation cascade. TAK-243 treatment caused depletion of cellular ubiquitin conjugates, resulting in disruption of signaling events, induction of proteotoxic stress, and impairment of cell cycle progression and DNA damage repair pathways. TAK-243 treatment caused death of cancer cells and, in primary human xenograft studies, demonstrated antitumor activity at tolerated doses. Due to its specificity and potency, TAK-243 allows for interrogation of ubiquitin biology and for assessment of UAE inhibition as a new approach for cancer treatment.

  3. U.S. Trends in Solid Waste Management and GHG Emissions

    Science.gov (United States)

    In 2009, 243 million tons of municipal solid waste (MSW) was produced in the United States. Currently, 34% of the 243 million tons of MSW is recovered and recycled or composted which conserves energy and natural resources as well as avoid waste disposal. Of the remaining MSW th...

  4. 40 CFR 243.200-2 - Recommended procedures: Design.

    Science.gov (United States)

    2010-07-01

    ... waste containers should be constructed of corrosion resistant metal or other material which will not.... Containers should have covers which are tight-fitting to resist the intrusion of water and vectors, and...

  5. 48 CFR 243.204-70-6 - Allowable profit.

    Science.gov (United States)

    2010-10-01

    ... profit allowed reflects— (a) Any reduced cost risk to the contractor for costs incurred during contract performance before negotiation of the final price; (b) The contractor's reduced cost risk for costs incurred during performance of the remainder of the contract; and (c) The extent to which costs have been incurred...

  6. 1935 15' Quad #243 Aerial Photo Mosaic Index

    Data.gov (United States)

    Earth Data Analysis Center, University of New Mexico — Aerial Photo Reference Mosaics contain aerial photographs that are retrievable on a frame by frame basis. The inventory contains imagery from various sources that...

  7. 40 CFR 243.202-3 - Recommended procedures: Operations.

    Science.gov (United States)

    2010-07-01

    ... receive periodic vehicle safety checks, including, but not limited to, inspection of brakes, windshield wipers, taillights, backup lights, audible reverse warning devices, tires, and hydraulic systems. Any... should only be left in a vehicle overnight when this practice does not constitute a fire, health, or...

  8. 40 CFR Appendix to Part 243 - Recommended Bibliography

    Science.gov (United States)

    2010-07-01

    .... Government Printing Office, 1974. 3. Grupenhoff, B. L., and K. A. Shuster. Paper and plastic solid waste... Sanitation Foundation standard no. 32 for paper refuse sacks. Ann Arbor, The National Sanitation Foundation..., General Services Administration, Washington, DC 20409. 9. Ralph Stone and Company, Inc. The use of bags...

  9. 48 CFR 1852.243-70 - Engineering change proposals.

    Science.gov (United States)

    2010-10-01

    ... reserves the right to request additional information if that provided by the Contractor is considered... cost or pricing data, it shall cite the exception and provide rationale for its applicability. (e) If...

  10. 7 CFR 2.43 - Administrator, Foreign Agricultural Service.

    Science.gov (United States)

    2010-01-01

    ... the provisions concerning the end-use certificate system authorized pursuant to section 321(f) of that... amended (7 U.S.C. 5601 et seq.). (15) Formulate policies and administer barter programs under which... intelligence and reporting system, including provision for foreign agricultural representation abroad to...

  11. 40 CFR 243.204-2 - Recommended procedures: Operations.

    Science.gov (United States)

    2010-07-01

    ... achieve the most efficient compaction. (3) Compactor trucks should be used to reduce the number of trips... commercial wastes which do not contain food wastes, storage capacity should be increased in lieu of more...

  12. Dicty_cDB: AFL243 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available llsc*rl*wwcs*twsirsh*trytnyldhfr***fsinesrr*rskskrcsyyrhyk *fnfg*tyrs*yhfnsk*wyfnctfscnsitiiaxkgncknmtqtskkl...SQVTVLSLVANWFAQHRGIEEG KRRQVNRFSSSFTNKFGYGITCS*tm*snrsknl*kefnlcfg*rfr*tnri*rcfen*r nhllsc*rl*wwcs*twsirsh*trytnyldhfr***fsines

  13. Dicty_cDB: SHB243 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available R103667 |CR103667.1 Forward strand read from insert in 3'HPRT insertion targeting and chromosome engineering... in 3'HPRT insertion targeting and chromosome engineering clone MHPP186g09. 50 0.13 1 dna update 2005.12.21

  14. 40 CFR 243.201-2 - Recommended procedures: Operations.

    Science.gov (United States)

    2010-07-01

    ..., safety glasses, respirators, and footwear should be used by collection employees, as appropriate. This equipment should meet the applicable provisions of the Occupational Safety and Health Administration...

  15. Integrative analysis of copy number alteration and gene expression profiling in ovarian clear cell adenocarcinoma.

    Science.gov (United States)

    Sung, Chang Ohk; Choi, Chel Hun; Ko, Young-Hyeh; Ju, Hyunjeong; Choi, Yoon-La; Kim, Nyunsu; Kang, So Young; Ha, Sang Yun; Choi, Kyusam; Bae, Duk-Soo; Lee, Jeong-Won; Kim, Tae-Joong; Song, Sang Yong; Kim, Byoung-Gie

    2013-05-01

    Ovarian clear cell adenocarcinoma (Ov-CCA) is a distinctive subtype of ovarian epithelial carcinoma. In this study, we performed array comparative genomic hybridization (aCGH) and paired gene expression microarray of 19 fresh-frozen samples and conducted integrative analysis. For the copy number alterations, significantly amplified regions (false discovery rate [FDR] q genes demonstrating frequent copy number alterations (>25% of samples) that correlated with gene expression (FDR genes were mainly located on 8p11.21, 8p21.2-p21.3, 8q22.1, 8q24.3, 17q23.2-q23.3, 19p13.3, and 19p13.11. Among the regions, 8q24.3 was found to contain the most genes (30 of 94 genes) including PTK2. The 8q24.3 region was indicated as the most significant region, as supported by copy number, GISTIC, and integrative analysis. Pathway analysis using differentially expressed genes on 8q24.3 revealed several major nodes, including PTK2. In conclusion, we identified a set of 94 candidate genes with frequent copy number alterations that correlated with gene expression. Specific chromosomal alterations, such as the 8q24.3 gain containing PTK2, could be a therapeutic target in a subset of Ov-CCAs. Copyright © 2013. Published by Elsevier Inc.

  16. 77 FR 26998 - Airworthiness Directives; Airbus Airplanes

    Science.gov (United States)

    2012-05-08

    ...-0428; Directorate Identifier 2011-NM-078-AD] RIN 2120-AA64 Airworthiness Directives; Airbus Airplanes...: We propose to adopt a new airworthiness directive (AD) for all Airbus Model A330-243, -243F, -342..., between 9 a.m. and 5 p.m., Monday through Friday, except Federal holidays. For Airbus service information...

  17. The creation of new nuclei

    International Nuclear Information System (INIS)

    Armbruster, P.; Hessberger, F.P.

    1998-01-01

    In the last 60 years physicists have created 20 artificial elements beyond uranium. In 1934 Enrico Fermi predicted the creation of new elements by bombarding atoms with neutrons. This method led to the discovery of neptunium (Z=93), plutonium, americium, curium, berkelium, californium, einsteinium and fermium (Z=100). In fact the capture of a neutron is followed by a beta-decay which increases the atomic number (Z) by one unit. Beyond Z=100 beta-decay no more occurs so a new approach was necessary. Between the American Lawrence Berkeley Laboratory and the Russian Dubna Institute a fierce competition broke out to produce new elements by bombarding transuranium nuclei with light elements such as helium, carbon, nitrogen. This new method required heavy equipment: ion accelerator and detectors but led to the creation of all the elements from Z=101 to Z=106. A new idea was to provoke the fusion of heavy nuclei such as lead and bismuth with colliding argon, nickel or zinc ion beams. This method called 'cold fusion' opened the way to reach the nuclei beyond Z=107. In 1996 the element Z=112 was the last discovered. The next step could be the element Z=114 for which a particular stability is expected. (A.C.)

  18. Characterization of a Viking Blade Fabricated by Traditional Forging Techniques

    Science.gov (United States)

    Vo, H.; Frazer, D.; Bailey, N.; Traylor, R.; Austin, J.; Pringle, J.; Bickel, J.; Connick, R.; Connick, W.; Hosemann, P.

    2016-12-01

    A team of students from the University of California, Berkeley, participated in a blade-smithing competition hosted by the Minerals, Metals, and Materials Society at the TMS 2015 144th annual meeting and exhibition. Motivated by ancient forging methods, the UC Berkeley team chose to fabricate our blade from historical smithing techniques utilizing naturally-occurring deposits of iron ore. This approach resulted in receiving the "Best Example of a Traditional Blade Process/Ore Smelting Technique" award for our blade named "Berkelium." First, iron-enriched sand was collected from local beaches. Magnetite (Fe3O4) was then extracted from the sand and smelted into individual high- and low-carbon steel ingots. Layers of high- and low-carbon steels were forge-welded together, predominantly by hand, to form a composite material. Optical microscopy, energy dispersive spectroscopy, and Vickers hardness mechanical testing were conducted at different stages throughout the blade-making process to evaluate the microstructure and hardness evolution during formation. It was found that the pre-heat-treated blade microstructure was composed of ferrite and pearlite, and contained many nonmetallic inclusions. A final heat treatment was performed, which caused the average hardness of the blade edge to increase by more than a factor of two, indicating a martensitic transformation.

  19. Fluorescence and excitation spectra of Bk3+, Cf3+, and Es3+ ions in single crystals of LaCl3

    International Nuclear Information System (INIS)

    Hessler, J.P.; Caird, J.A.; Carnall, W.T.; Crosswhite, H.M.; Sjoblom, R.K.; Wagner, F. Jr.

    1978-01-01

    Dye laser techniques have been used to study the energy level structure of the heavier actinides in single crystals of lanthanum chloride. In the case of einsteinium, fluorescence was detected and measured from the following manifolds: J = 5 at 0.984 μm -1 , J = 4 at 1.572 μm -1 , J = 6 at 2.930 μm -1 . This fluorescence was observed to the five lowest manifolds: J = 8, 5, 7, 2, 6. For californium, fluorescence has been detected from the manifolds: J = 11/2 at 1.190 μm -1 , J = 7/2 at 1.389 μm -1 , J = 5/2 at 1.977 μm -1 . This fluorescence was observed to the three lowest manifolds: J = 15/2, 9/2, 11/2. The fluorescence manifolds of berkelium are J = 6 at 1.540 μm -1 , and J = 4 at 1.953 μm -1 . The three lowest manifolds, J = 6, 5, and 4, have been observed in fluorescence. Absorption spectra data have yielded crystal-field splitting measurements in the higher manifolds of Es + . The location of the manifolds in general confirmed earlier approximate free-ion level structure calculations based on assumed regularities in the energy level parameters derived from spectra of the actinide ions through Cf + . 2 figures

  20. Oxidation-reduction properties of americium, curium, berkelium, californium, einsteinium and fermium, and thermodynamic consequences for the 5f series

    International Nuclear Information System (INIS)

    Samhoun, K.

    1976-01-01

    The amalgamation of 5f elements from Am to Fm has been studied by using 241 Am, 244 Cm, 249 Bk, 249 Cf, 252 Cf, 253 Es, 254 Es, 252 Fm and 255 Fm with two electrochemical methods, radiocoulometry and radiopolarography, perfectly adapted to investigate extremely diluted solutions when the concentration of electroactive species is as low as 10 -16 M. The theory of radiocoulometry has been developed in the general cases of reversible and irreversible electrode process. It has been used to interpret the experimental data on the kinetic curves of amalgamation, and to estimate the standard rate constant of the electrode process in complexing medium (citric). On the other hand the radiopolarographic method has been applied to study the mechanism of reduction at the dropping mercury electrode of cations M 3+ in aqueous medium to the metal M with formation of amalgam. The results are exploited into two directions: 1- Acquisition of some data concerning the oxidation-reduction properties of elements from Am to Fm. Therefore the standard electrode E 0 [M(III-0)] potentials for Bk, Cf and Es, and the standard electrode E 0 [M(II-0)] potential for Fm are estimated and the relative stability of each oxidation state (from II to VII) of 5f elements is discussed; 2- Acquisition of unknown thermodynamic data on transcalifornium elements. Correlations between 4f and 5f elements are precised and some divergences appear for the second half of 4f and 5f series (i.e. for 65 [fr

  1. Off-line tuning of a PI speed controller for a permanent magnet brushless DC motor using DSP

    Energy Technology Data Exchange (ETDEWEB)

    Demirtas, Metin, E-mail: mdtas@balikesir.edu.t [Electrical and Electronics Engineering Department, Balikesir University, Balikesir (Turkey)

    2011-01-15

    In this paper, a new method of tuning Proportional Integral (PI) coefficients for a permanent magnet brushless DC (PMBLDC) motor drives is proposed. Artificial neural network is used to identify the whole system using maximum overshoot and settling time obtained from the application circuit for different K{sub p}-K{sub i} pairs. Optimal values of PI controller coefficients are obtained using genetic algorithm. Motion Control Kit (MCK243) is used to carry out digital motion control applications. The MCK243 kit includes a power module and a three-phase brushless motor. TMS320F243 programs are used for PMBLDC motor speed control. Experimental results are given to show the validity of this method.

  2. Impaction grafting in the femur in cementless modular revision total hip arthroplasty: a descriptive outcome analysis of 243 cases with the MRP-TITAN revision implant

    Directory of Open Access Journals (Sweden)

    Wimmer Matthias D

    2013-01-01

    Full Text Available Abstract Background We present a descriptive and retrospective analysis of revision total hip arthroplasties (THA using the MRP-TITAN stem (Peter Brehm, Weisendorf, GER with distal diaphyseal fixation and metaphyseal defect augmentation. Our hypothesis was that the metaphyseal defect augmentation (Impaction Bone Grafting improves the stem survival. Methods We retrospectively analyzed the aggregated and anonymized data of 243 femoral stem revisions. 68 patients with 70 implants (28.8% received an allograft augmentation for metaphyseal defects; 165 patients with 173 implants (71.2% did not, and served as controls. The mean follow-up was 4.4 ± 1.8 years (range, 2.1–9.6 years. There were no significant differences (p > 0.05 between the study and control group regarding age, body mass index (BMI, femoral defects (types I-III as described by Paprosky, and preoperative Harris Hip Score (HHS. Postoperative clinical function was evaluated using the HHS. Postoperative radiologic examination evaluated implant stability, axial implant migration, signs of implant loosening, periprosthetic radiolucencies, as well as bone regeneration and resorption. Results There were comparable rates of intraoperative and postoperative complications in the study and control groups (p > 0.05. Clinical function, expressed as the increase in the postoperative HHS over the preoperative score, showed significantly greater improvement in the group with Impaction Bone Grafting (35.6 ± 14.3 vs. 30.8 ± 15.8; p ≤ 0.05. The study group showed better outcome especially for larger defects (types II C and III as described by Paprosky and stem diameters ≥ 17 mm. The two groups did not show significant differences in the rate of aseptic loosening (1.4% vs. 2.9% and the rate of revisions (8.6% vs. 11%. The Kaplan-Meier survival for the MRP-TITAN stem in both groups together was 93.8% after 8.8 years. [Study group 95.7% after 8.54 years ; control group 93

  3. Threats to Aircraft Structural Safety Including a Compendium of Selected Structural Accidents/Incidents

    Science.gov (United States)

    2010-03-01

    April 28, 1988 Aloha Airlines Flight No. 243 departed Hilo , Hawaii with a crew and 89 passengers on board. When leveling off at 24,000 feet, there was an...89/03, “Aloha Airlines, Flight 243, Boeing 737-200, N73711, Near Maui, Hawaii April 28, 1988,” adopted on 14 June 1989, Washington DC. http

  4. Carbohydrate-modified magnetic nanoparticles for radical scavenging

    Czech Academy of Sciences Publication Activity Database

    Moskvin, Maksym; Horák, Daniel

    2016-01-01

    Roč. 65, Suppl. 2 (2016), S243-S251 ISSN 0862-8408 R&D Projects: GA MŠk(CZ) LQ1604 Institutional support: RVO:61389013 Keywords : magnetic nanoparticles * silica * glucose Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 1.461, year: 2016 http://www.biomed.cas.cz/physiolres/pdf/65%20Suppl%202/65_S243.pdf

  5. Browse Title Index

    African Journals Online (AJOL)

    Items 201 - 243 of 243 ... Vol 23, No 2 (2013), The Kidney in Pregnancy, Abstract. S Adam. Vol 12, No 4 ... Vol 14, No 2 (2004), The role of chemotherapy in the management of cervical cancer: review article, Details. WPW Mdluli ... Vol 13, No 3 (2003), The role of radiation therapy in epithelial ovarian cancer, Abstract. G Dreyer.

  6. Case report of newborn with de novo partial trisomy 2q31.2–37.3 ...

    Indian Academy of Sciences (India)

    Case report of newborn with de novo partial trisomy 2q31.2–37.3 and monosomy 9p24.3 ... This is the first report of molecular cytogenetic characterization of a partial trisomy 2q31.2–37.3 with monosomy 9p24.3. ... Manuscript received: 10 November 2016; Manuscript revised: 13 March 2017; Accepted: 21 March 2017 ...

  7. Analysis of a Partial Male-Sterile Mutant of Arabidopsis thaliana Isolated from a Low-Energy Argon Ion Beam Mutagenized Pool

    International Nuclear Information System (INIS)

    Xu Min; Bian Po; Wu Yuejin; Yu Zengliang

    2008-01-01

    A screen for Arabidopsis fertility mutants, mutagenized by low-energy argon ion beam, yielded two partial male-sterile mutants tc243-1 and tc243-2 which have similar phenotypes. tc243-2 was investigated in detail. The segregation ratio of the mutant phenotypes in the M2 pools suggested that mutation behaved as single Mendelian recessive mutations. tc243 showed a series of mutant phenotypes, among which partial male-sterile was its striking mutant characteristic. Phenotype analysis indicates that there are four factors leading to male sterility. a. Floral organs normally develop inside the closed bud, but the anther filaments do not elongate sufficiently to position the locules above the stigma at anthesis. b. The anther locules do not dehisce at the time of flower opening (although limited dehiscence occurs later). c. Pollens of mutant plants develop into several types of pollens at the trinucleated stage, as determined by staining with DAPI (4',6-diamidino-2-phenylindole), which shows a variable size, shape and number of nucleus. d. The viability of pollens is lower than that of the wild type on the germination test in vivo and vitro.

  8. Functional properties and structural requirements of the plasmid pMV158-encoded MobM relaxase domain.

    Science.gov (United States)

    Fernández-López, Cris; Pluta, Radoslaw; Pérez-Luque, Rosa; Rodríguez-González, Lorena; Espinosa, Manuel; Coll, Miquel; Lorenzo-Díaz, Fabián; Boer, D Roeland

    2013-07-01

    A crucial element in the horizontal transfer of mobilizable and conjugative plasmids is the relaxase, a single-stranded endonuclease that nicks the origin of transfer (oriT) of the plasmid DNA. The relaxase of the pMV158 mobilizable plasmid is MobM (494 residues). In solution, MobM forms a dimer through its C-terminal domain, which is proposed to anchor the protein to the cell membrane and to participate in type 4 secretion system (T4SS) protein-protein interactions. In order to gain a deeper insight into the structural MobM requirements for efficient DNA catalysis, we studied two endonuclease domain variants that include the first 199 or 243 amino acid residues (MobMN199 and MobMN243, respectively). Our results confirmed that the two proteins behaved as monomers in solution. Interestingly, MobMN243 relaxed supercoiled DNA and cleaved single-stranded oligonucleotides harboring oriTpMV158, whereas MobMN199 was active only on supercoiled DNA. Protein stability studies using gel electrophoresis and mass spectrometry showed increased susceptibility to degradation at the domain boundary between the N- and C-terminal domains, suggesting that the domains change their relative orientation upon DNA binding. Overall, these results demonstrate that MobMN243 is capable of nicking the DNA substrate independently of its topology and that the amino acids 200 to 243 modulate substrate specificity but not the nicking activity per se. These findings suggest that these amino acids are involved in positioning the DNA for the nuclease reaction rather than in the nicking mechanism itself.

  9. Efficacy of triclosan-based toothpastes in the prevention and treatment of plaque-induced periodontal and peri-implant diseases.

    Science.gov (United States)

    Trombelli, L; Farina, R

    2013-03-01

    To evaluate the efficacy of triclosan (T)-based toothpaste formulations in the prevention and treatment of plaque-induced periodontal and peri-implant diseases. A review of the existing literature was conducted with a systematic approach in order to retrieve pertinent articles. i) Compared with a control fluoride dentifrice, a fluoride dentifrice containing T formulations provides a more effective level of plaque control and gingival health in patients affected by gingivitis; ii) 0.3% T/2% copolymer/0.243% NaF formulation and 0.3% T/0.13% Ca glicerophosphate/1000 ppm F toothpaste in a natural Ca carbonate base seem the most effective T-based toothpaste formulations in controlling plaque and gingival inflammation in patients with gingivitis or mild/moderate periodontitis over a 6-month period; iii) 0.3% T/2% copolymer/0.243% NaF toothpaste formulation can reduce clinical attachment loss in young adolescents when compared with a 0.243% NaF toothpaste formulation, the magnitude of the difference being greater for patients with deep periodontal pockets at baseline; iv) 0.3% T/2% copolymer/0.243% NaF toothpaste formulation is either similarly or more efficacious in preventing the progression/recurrence of periodontal destruction when compared to a conventional fluoride toothpaste; v) 0.3% T/2% copolymer/0.243% NaF toothpaste formulation seems to be more effective than a fluoride toothpaste formulation in controlling the severity of mucosal inflammation, the incidence of mucosal bleeding as well as reducing probing pocket depth around dental implants.

  10. The effect of co-administration of DNA carrying chicken interferon-gamma gene on protection of chickens against infectious bursal disease by DNA-mediated vaccination.

    Science.gov (United States)

    Hsieh, Ming Kun; Wu, Ching Ching; Lin, Tsang Long

    2006-11-17

    The purpose of the present study was to determine whether DNA vaccination by co-administration of DNA coding for chicken interferon-gamma (IFN-gamma) gene and DNA encoding for the VP243 gene of IBDV could enhance immune response and protection efficacy of chickens against challenge by IBDV. Plasmids carrying VP243 gene of IBDV strain variant E (VE) (P/VP243/E) and chicken IFN-gamma gene (P/cIFN-gamma) were constructed, respectively. One-day-old chickens were intramuscularly injected with P/VP243/E, or P/cIFN-gamma, or both once, twice, or three times into the thigh muscle of one leg or the thigh muscles of two separate legs at weekly intervals. Chickens were orally challenged with IBDV strain VE at 3 weeks of age and observed for 10 days. Chickens receiving two plasmids in the same site two times had significantly higher (Pprotection and those receiving two plasmids in the same sites did not have any protection against IBD. The enzyme-linked immunosorbent assay (ELISA) and virus neutralization (VN) titers to IBDV of chickens in the groups with three doses of P/VP243/E were significantly higher (Pprotected by DNA vaccination did not have detectable IBDV antigen in the bursae as determined by immunofluorescent antibody assay (IFA). The results indicated that co-administration of plasmid encoding chicken IFN-gamma gene with plasmid encoding a large segment gene of the IBDV did not enhance immune response and protection against challenge by IBDV.

  11. Total and spontaneous fission half-lives of the americium and curium nuclides

    International Nuclear Information System (INIS)

    Holden, N.E.

    1984-01-01

    The total half-life and the half-life for spontaneous fission are evaluated for the various long-lived nuclides of interest. Recommended values are presented for 241 Am, /sup 242m/Am, 243 Am, 242 Cm, 243 Cm, 244 Cm, 245 Cm, 246 Cm, 247 Cm, 248 Cm, and 250 Cm. The uncertainties are provided at the 95% confidence limit for each of the recommended values

  12. Genetic and Hormonal Risk Factors for Cancer in African American Men

    Science.gov (United States)

    2006-05-01

    rs2740574 CYP3A4 7q21.1 5’ UTR (-293) G to A 49.6 46.8 rs700519 CYP19 15q21.1 Exon 6 (codon 264) C to T 30.1 30.8 rs9282858 SDR5A2 2p23 Exon 1...HSD17B2 Months 12-24 CYP19 CYP3A4 IGF1 We had initially planned to perform our SNP assays using either ABI PRISM® 7700 Sequence Detection...31.4 rs6163 CYP17 10q24.3 Exon 1 (Codon 65) G to T 57.9 66.4 rs6162 CYP17 10q24.3 Exon 1 (Codon 46) C to T 58.7 66.9 rs743572 CYP17 10q24.3 5’-UTR

  13. 29 CFR 1910.243 - Guarding of portable powered tools.

    Science.gov (United States)

    2010-07-01

    ..., powered tampers, jack hammers, rock drills, garden appliances, household and kitchen appliances, personal... clearance between the wheel hole and the machine spindle (or wheel sleeves or adaptors) is essential to...

  14. 48 CFR 252.243-7002 - Requests for equitable adjustment.

    Science.gov (United States)

    2010-10-01

    ... clause does not apply to— (1) Requests for routine contract payments; for example, requests for payment for accepted supplies and services, routine vouchers under a cost-reimbursement type contract, or progress payment invoices; or (2) Final adjustment under an incentive provision of the contract. (End of...

  15. All projects related to | Page 243 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Rethinking Political Legitimacy: Citizen Inclusion and Social Digital Media. Project. In Chile, a mobilized, invigorated civil society is using new digital technologies to transform political participation. ... Program: Agriculture and Food Security.

  16. 19 CFR 10.243 - Articles eligible for preferential treatment.

    Science.gov (United States)

    2010-04-01

    ... articles had been imported directly from Canada or Mexico; or (iv) Fabrics or yarns that the President or... folklore apparel or other textile article of an ATPDEA beneficiary country that the President or his....61.00 of the HTSUS and that is entered free of duty from Canada, Mexico, or Israel. (d) Imported...

  17. Pengaruh Kombinasi Pupuk Kandang Sapi dan Abu Sabut Kelapa sebagai Pupuk Utama dalam Budidaya Tanaman Brokoli (Brassica oleracia L.

    Directory of Open Access Journals (Sweden)

    Eko Binti Lestari

    2016-08-01

    Full Text Available This research aims to study the effectiveness of coconut fibre ash as an additive nutrient for growth and yield of Broccoli (Brassica oleracia L., and to determine the best combination between manure and coconut fibre ash in organic farming of Broccoli. This research conducted using single factor experiment that arranged in Randomized Completely Block Design (RCBD. The treatments are (1 Manure 0,75 kg + Coconut fire ash 24,3 g (2 Manure 0,75 kg + Coconut fibre ash12,15 g, (3 Manure 0,75 kg + without Coconut fibre ash, (4 Manure 1 kg + Coconut fibre ash 24,3 g, (5 Manure 1 kg + Coconut fibre ash 12,15  g, (6 Manure 1 kg + without coconut fibre ash, (7 Manure 1,25 kg + Coconut fibre ash 24,3 g, (8 Manure 1,25 kg + Coconut fibre ash 12,15 g, (9 Manure 1,25 kg + without coconut fibre ash. The result showed that the combination between manure and coconut fibre ash have not significantly different in number of leaves, flowering time, fresh weight, flower size, fresh weight of flower. However, the combination between manure 1,25 kg and coconut fibre ash 24,3 g is considered to be the most efficient in organic farming of Broccoli.

  18. Obesity/Overweight in Persons With Early and Chronic SCI: A Randomized, Multicenter, Controlled Lifestyle Intervention

    Science.gov (United States)

    2014-10-01

    decrease in insulin resistance ( HOMA - IR ) (Table 3, Figure 3; appendix). The 2 tetraplegic participants have completed 6-month clinical...ISI   HOMA -­‐ IR   Page 1 of 2 Ph.: 305-243-3195 Fax: 305-243-3328 www.hsro.miami.edu University of Miami Human Subjects Research Office (M8089) P.O...training (CRT) on fasting and postprandial (PP) blood glucose (BG) and insulin, the homeostasis model assessment ( HOMA ) for insulin resistance ( IR

  19. The Transplutonium. The superheavy nuclei found in the micas of Madagascar and their interests

    International Nuclear Information System (INIS)

    Raoelina Andriambololona

    1976-01-01

    Since June 1976, evidence for the existence of superheavy elements is discussed about. After having recalled artificial elements with atomic numbers Z of wich go from Z=95 (Americium) to Z=107 (built in 1976), superheavy elements having Z greater than 110 are considered. They have been discovered by american searchers in giant halos seen in Madagascar micas. The samples have been recoked in the Fort-Dauphin region (Haut Mandrare). The corresponding numbers Z are 114, 115, 116, 124, 125, 125, 126, 127. It seems that the existence of Z=126 element should be accepted with a greater degree of confidence. But different experiences done by other groups seem to show the evidence of superheavy elements in micas looks weaker. Nevertheless, it is interesting to investigate the evidence or the non-evidence of those elements. We estimate the mass numbers A of those superheavy elements in the liquid drop model if we assume that they are stable versus β. The results thus obtained agree with the shell-model ones within 4 % approximation. We propose if the evidence of superheavies is confirmed to give the name of madagascarium to one of them (Z=126) by similitude with francium, lutetium, polonium, berkelium, americium, europium, ...Their evidence was first conjectured in Madagascar micas in 1976. Superheavy nuclei are to be distinguished from hypernuclei. [fr

  20. [Etiological analysis and establishment of a discriminant model for lower respiratory tract infections in hospitalized patients].

    Science.gov (United States)

    Chen, Y S; Lin, X H; Li, H R; Hua, Z D; Lin, M Q; Huang, W S; Yu, T; Lyu, H Y; Mao, W P; Liang, Y Q; Peng, X R; Chen, S J; Zheng, H; Lian, S Q; Hu, X L; Yao, X Q

    2017-12-12

    Objective: To analyze the pathogens of lower respiratory tract infection(LRTI) including bacterial, viral and mixed infection, and to establish a discriminant model based on clinical features in order to predict the pathogens. Methods: A total of 243 hospitalized patients with lower respiratory tract infections were enrolled in Fujian Provincial Hospital from April 2012 to September 2015. The clinical data and airway (sputum and/or bronchoalveolar lavage) samples were collected. Microbes were identified by traditional culture (for bacteria), loop-mediated isothermal amplification(LAMP) and gene sequencing (for bacteria and atypical pathogen), or Real-time quantitative polymerase chain reaction (Real-time PCR)for viruses. Finally, a discriminant model was established by using the discriminant analysis methods to help to predict bacterial, viral and mixed infections. Results: Pathogens were detected in 53.9% (131/243) of the 243 cases.Bacteria accounted for 23.5%(57/243, of which 17 cases with the virus, 1 case with Mycoplasma pneumoniae and virus), mainly Pseudomonas Aeruginosa and Klebsiella Pneumonia. Atypical pathogens for 4.9% (12/243, of which 3 cases with the virus, 1 case of bacteria and viruses), all were mycoplasma pneumonia. Viruses for 34.6% (84/243, of which 17 cases of bacteria, 3 cases with Mycoplasma pneumoniae, 1 case with Mycoplasma pneumoniae and bacteria) of the cases, mainly Influenza A virus and Human Cytomegalovirus, and other virus like adenovirus, human parainfluenza virus, respiratory syncytial virus, human metapneumovirus, human boca virus were also detected fewly. Seven parameters including mental status, using antibiotics prior to admission, complications, abnormal breath sounds, neutrophil alkaline phosphatase (NAP) score, pneumonia severity index (PSI) score and CRUB-65 score were enrolled after univariate analysis, and discriminant analysis was used to establish the discriminant model by applying the identified pathogens as the

  1. A high-sensitive and quantitative in-line monitoring method for transplutonium elements separation processes

    International Nuclear Information System (INIS)

    Zhu Rongbao; Wang Shiju; Xu Yingpu; Zhang Zengrui

    1986-04-01

    A high-sensitive monitoring device and a quantitative analys technigue for transplutonium elements separation processes are described. X-ray and low energy γ-ray are measured by means of a scintillation monitor with two NaI(Tl) thin crystals. The α spectra of the fluents of ion-exchange column is measured by means of Si(Au) surface barrier in-line monitor. The construction of the monitors, auxiliary electronics, investigation result for the α spectra character of thick source and the calibration method were described. The determination results for extracting process of 243 Am and 244 Cm by ion-exchange chromatography were given. The sensitivity of total adding amount for 243 Am using the 4π scintillation monitor is better than 0.1 μCi. The precision of 243 Am and 244 Cm concentration determination using Si(Au) monitor is +- 5%. The precision of the two metals contents in containers is about +- 10%

  2. People and things. CERN Courier, Apr 1984, v. 24(3)

    Energy Technology Data Exchange (ETDEWEB)

    Anon.

    1984-04-15

    The article reports on achievements of various people, staff changes and position opportunities within the CERN organization and contains news updates on upcoming or past events. The CERN Accelerator School, in collaboration with the Orsay and Saclay Laboratories, is organizing a 'General Accelerator Physics' course at the Ecole Supérieure d'Electricité, Gif-sur-Yvette, France, from 3-14 September.The Scottish Universities Summer School in Physics will be held in St. Andrews from 12 August to 1 September. This is the twenty-seventh school in a series of NATO Advanced Study Institutes organized by the Scottish Universities.From 10-14 September, Geneva University will host the first of a planned biennial series of scientific lectures, sponsored by Dudley Wright. A Conference on the Intersections between Particle and Nuclear Physics' will be held from 23-30 May in Steamboat Springs, Colorado, USA. The meetings will focus on the physics interests of the many diverse groups who work in Particle and/or Nuclear Physics.

  3. Synthesis of [2,4-3H] 17β-dihydroequilin sulfate

    International Nuclear Information System (INIS)

    Bhavnani, B.R.

    1994-01-01

    [2,4- 3 H] 17β-dihydroequilin-3-sulfate ammonium salt suitable for in vivo pharmacokinetic studies was synthesized from [2,4- 3 H] equilin. Sulfation of [2,4- 3 H] equilin with pyridine-chlorosulfonic acid mixture gave in high yields [2,4- 3 H] equilin sulfate, which was then reduced with sodium borohydride to yield [2,4- 3 H] 17β-dihydroequilin sulfate. The reduction was sterospecific and no 17α-reduced products were formed. (author)

  4. People and things. CERN Courier, Apr 1984, v. 24(3)

    International Nuclear Information System (INIS)

    Anon.

    1984-01-01

    The article reports on achievements of various people, staff changes and position opportunities within the CERN organization and contains news updates on upcoming or past events. The CERN Accelerator School, in collaboration with the Orsay and Saclay Laboratories, is organizing a 'General Accelerator Physics' course at the Ecole Supérieure d'Electricité, Gif-sur-Yvette, France, from 3-14 September.The Scottish Universities Summer School in Physics will be held in St. Andrews from 12 August to 1 September. This is the twenty-seventh school in a series of NATO Advanced Study Institutes organized by the Scottish Universities.From 10-14 September, Geneva University will host the first of a planned biennial series of scientific lectures, sponsored by Dudley Wright. A Conference on the Intersections between Particle and Nuclear Physics' will be held from 23-30 May in Steamboat Springs, Colorado, USA. The meetings will focus on the physics interests of the many diverse groups who work in Particle and/or Nuclear Physics

  5. Mercado/Robb/Buchdahl coefficients: an update of 243 common glasses

    Science.gov (United States)

    Bolser, Michael

    2002-12-01

    The 1983 Mercado/Robb listing of Buchdahl chromatic coordinate coefficients is supplemented with glasses from the Schott and O'Hara catalogues. The coefficients were calculated by using Buchdahl's cubic model. Appropriately selected materials yield a superachromat.

  6. Lack of support for the association between GAD2 polymorphisms and severe human obesity.

    Directory of Open Access Journals (Sweden)

    Michael M Swarbrick

    2005-09-01

    Full Text Available The demonstration of association between common genetic variants and chronic human diseases such as obesity could have profound implications for the prediction, prevention, and treatment of these conditions. Unequivocal proof of such an association, however, requires independent replication of initial positive findings. Recently, three (-243 A>G, +61450 C>A, and +83897 T>A single nucleotide polymorphisms (SNPs within glutamate decarboxylase 2 (GAD2 were found to be associated with class III obesity (body mass index > 40 kg/m2. The association was observed among 188 families (612 individuals segregating the condition, and a case-control study of 575 cases and 646 lean controls. Functional data supporting a pathophysiological role for one of the SNPs (-243 A>G were also presented. The gene GAD2 encodes the 65-kDa subunit of glutamic acid decarboxylase-GAD65. In the present study, we attempted to replicate this association in larger groups of individuals, and to extend the functional studies of the -243 A>G SNP. Among 2,359 individuals comprising 693 German nuclear families with severe, early-onset obesity, we found no evidence for a relationship between the three GAD2 SNPs and obesity, whether SNPs were studied individually or as haplotypes. In two independent case-control studies (a total of 680 class III obesity cases and 1,186 lean controls, there was no significant relationship between the -243 A>G SNP and obesity (OR = 0.99, 95% CI 0.83-1.18, p = 0.89 in the pooled sample. These negative findings were recapitulated in a meta-analysis, incorporating all published data for the association between the -243G allele and class III obesity, which yielded an OR of 1.11 (95% CI 0.90-1.36, p = 0.28 in a total sample of 1,252 class III obese cases and 1,800 lean controls. Moreover, analysis of common haplotypes encompassing the GAD2 locus revealed no association with severe obesity in families with the condition. We also obtained functional data for the

  7. Modeling of Waves, Hydrodynamics and Sediment Transport for Protection of Wetlands at Braddock Bay, New York

    Science.gov (United States)

    2015-03-01

    contributing environmental forcings. 3.3 Metocean forcings The Lake Ontario IGLD85 Low Water Datum ( LWD ) is 243.3 ft (74.15 m). This datum is used as...in this study was the International Great Lakes Datum of 1985 (IGLD85). The Lake Ontario chart datum is 243.3 ft (74.15 m), which is the LWD . The...ft (65 m), and 230 ft (70 m). The breakwater crest elevation was 6 ft (1.83 m), LWD . Alternative S-2 was a dual-breakwater system, and it was

  8. Optical properties of X-ray stars. 3

    International Nuclear Information System (INIS)

    Hudec, R.

    1984-01-01

    822 observations of X-ray system HZ Her/Her X-1 on Sonneberg sky-patrol-camera plates are interpreted with the following main results: (i) altogether 3 (and possibly 4) active and 3 (possibly 4) inactive states were revealed during the time span 1928 to 1979, (ii) the comparison of individual active-state light curves shows no clear differences, (iii) a very quick transition between active and inactive state JD 243 1313.382-JD 243 1321.403 was observed. Some other studies of the optical data were carried out and are briefly described. (author)

  9. ORF Alignment: NC_005071 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available GLDPKRGQCLEVGAILFHAPQRAVLAQHSFLLPVETNAAESI 60 ... Query: 190 DIAWPVDRQLRSRPSVRDLALAYGVPVWAAHRALTDCIYLAEVFARCKDL...ETLL 243 ... DIAWPVDRQLRSRPSVRDLALAYGVPVWAAHRALTDCIYLAEVFARCKDLETLL Sbjct: 121 DIAWPVDRQLRSRPSVRDLALAYGVPVWAAHRALTDCIYLAEVFARCKDLETLL 174

  10. Lack of Support for the Association Between GAD2 Polymorphisms andSevere Human Obesity

    Energy Technology Data Exchange (ETDEWEB)

    Swarbrick, Michael M.; Waldenmaier, Bjorn; Pennacchio, Len A.; Lind,Denise L.; Cavazos, Martha M.; Geller, Frank; Merriman, Raphael; Ustaszewska, Anna; Malloy, Mary; Scherag, Andre; Hsueh, Wen-Chi; Rief,Winfried; Mauvais-Jarvis, Franck; Pullinger, Clive R.; Kane, John P.; Dent, Robert; McPherson, Ruth; Kwok, Pui-Yan; Hinney, Anke; Hebebrand,Johannes; Vaisse, Christian

    2004-11-17

    Demonstration of association between common genetic variants and chronic human diseases such as obesity could have profound implications for the prediction, prevention and treatment of these conditions. Unequivocal proof of such an association, however, requires adherence to established methodological guidelines, which include independent replication of initial positive findings. Recently, single nucleotide polymorphisms (SNPs) within GAD2 were found to be associated with class III obesity (BMI > 40 kg/m2) in 188 families (612 individuals) segregating the condition and a case-control study of 575 cases and 646 lean controls. Functional data supporting a pathophysiological role for one of the SNPs (-243A>G) were also presented. In the present study, we attempted to replicate this association in larger groups of subjects, and to extend the functional studies of the -243A>G SNP. In 2,327 subjects comprising 692 German nuclear families with severe, early-onset obesity, we found no evidence for a relationship between the three GAD2 SNPs and obesity, whether SNPs were studied individually or as haplotypes. In two independent case-control studies (a total of 680 class III obesity cases and 1,186 lean controls), there was no significant relationship between the -243A>G SNP and obesity (odds ratio (OR) = 0.99, 95% CI 0.83 - 1.18,in the pooled sample). These negative findings were reinforced by a meta-analysis for the association between the 243G allele and class III obesity, which yielded an OR of 1.11 (95% CI 0.90 - 1.36) in a total sample of 1,252 class III obese cases and 1,800 lean controls. Finally,we were unable to confirm or extend the functional data pertaining to the -243A>G variant. Potential confounding variables in association studies involving common variants and complex diseases (low power to detect modest genetic effects, over-interpretation of marginal data, population stratification and biological plausibility) are also discussed in the context of GAD2 and

  11. Radiochemical studies of neutron deficient actinide isotopes

    International Nuclear Information System (INIS)

    Williams, K.E.

    1978-04-01

    The production of neutron deficient actinide isotopes in heavy ion reactions was studied using alpha, gamma, x-ray, and spontaneous fission detection systems. A new isotope of berkelium, 242 Bk, was produced with a cross-section of approximately 10 μb in reactions of boron on uranium and nitrogen on thorium. It decays by electron capture with a half-life of 7.0 +- 1.3 minutes. The alpha-branching ratio for this isotope is less than 1% and the spontaneous fission ratio is less than 0.03%. Studies of (Heavy Ion, pxn) and (Heavy Ion, αxn) transfer reactions in comparison with (Heavy ion, xn) compound nucleus reactions revealed transfer reaction cross-sections equal to or greater than the compound nucleus yields. The data show that in some cases the yield of an isotope produced via a (H.I.,pxn) or (H.I.,αxn) reaction may be higher than its production via an xn compound nucleus reaction. These results have dire consequences for proponents of the ''Z 1 + Z 2 = Z/sub 1+2/'' philosophy. It is no longer acceptable to assume that (H.I.,pxn) and (H.I.,αxn) product yields are of no consequence when studying compound nucleus reactions. No evidence for spontaneous fission decay of 228 Pu, 230 Pu, 232 Cm, or 238 Cf was observed indicating that strictly empirical extrapolations of spontaneous fission half-life data is inadequate for predictions of half-lives for unknown neutron deficient actinide isotopes

  12. Investigations for the influence of geochemical parameters on the sorption and desorption of lanthanides and uranium onto opalinus clay as potential host rock for a repository

    International Nuclear Information System (INIS)

    Moeser, Christina

    2010-01-01

    The development of a disposal in deep geological formations for radioactive waste is a very important task for the future. The safety assessment for more than a hundred thousand years needs a full understanding of all processes of interaction between the radioactive waste and the surrounded formations. This work contributes to this understanding. The interaction between lanthanides (homologues of the actinides americium, curium and berkelium) / uranium and the host rock opalinus clay under influence of organic substances (NOM) have been analyzed and discussed. The complex system was split into 3 binary basic systems with the following interactions - Interactions between lanthanides / uranium and NOM - Interactions between lanthanides / uranium and the opalinus clay - Interactions between NOM and opalinus clay All binary systems can be influenced by geological parameters like pH, ion strength and competing cations. The sorption / desorption of the lanthanides onto the opalinus clay is analyzed via inductively coupled plasma mass spectrometry. For the investigation of the complexation behavior of metals with NOM we used capillary electrophoresis coupled with inductively coupled plasma mass spectrometry. Under these conditions the chosen model organic humic acid affected the sorption of the lanthanides onto opalinus clay favorably. The smaller organic compounds, which dominate in the composition of the clay organics, remobilized the metals after sorption onto clay and the sorption can be inhibited by NOM. Due to the reduced metal sorption onto Opalinus clay by NOM, a migration through the clay may be possible.

  13. Protein (Cyanobacteria): 647660116 [PGDBj - Ortholog DB

    Lifescience Database Archive (English)

    Full Text Available :162 ... hypothetical protein, partial Prochlorococcus sp. scB243_496A2 MRILLAAAECAPMIKVGGMGDVVGSLPPSLIKLGHDVRVIIPGYGKLWSLLEVSNEPVFRTNTMGTDFAVYEAKHPIHNYVIYLVGHPTFDSDQIYGGENEDWRFTFFASAT

  14. Mechanical properties of molybdenum-titanium alloys micro-structurally controlled by multi-step internal nitriding

    International Nuclear Information System (INIS)

    Nagae, M.; Yoshio, T.; Takemoto, Y.; Takada, J.; Hiraoka, Y.

    2001-01-01

    Internally nitrided dilute Mo-Ti alloys having a heavily deformed microstructure near the specimen surface were prepared by a novel two-step nitriding process at 1173 to 1773 K in N 2 gas. For the nitrided specimens three-point bend tests were performed at temperatures from 77 to 298 K in order to investigate the effect of microstructure control by internal nitriding on the ductile-to-brittle transition temperature (DBTT) of the alloy Yield strength obtained at 243 K of the specimen maintaining the deformed microstructure by the two-step nitriding was about 1.7 times as much as recrystallized specimen. The specimen subjected to the two-step nitriding was bent more than 90 degree at 243 K, whereas recrystallized specimen was fractured after showing a slight ductility at 243 K. DBTT of the specimen subjected to the two-step nitriding and recrystallized specimen was about 153 K and 203 K, respectively. These results indicate that multi-step internal nitriding is very effective to the improvement in the embrittlement by the recrystallization of molybdenum alloys. (author)

  15. Protein (Cyanobacteria): 661290558 [PGDBj - Ortholog DB

    Lifescience Database Archive (English)

    Full Text Available SPYFYASWMPEKEDDYRFTNKKRTPLECSTGTKDARSAALKAISWVKEKQKDCLRKITEYQEVKTKCLEHYWEEHFIDFSSTRASRKSVTKLINDEKLKWCSPTYGIG...6:352 ... hypothetical protein Prochlorococcus sp. scB243_495N4 MTSLSAMDGKLNDRTWINISESRYELELGNRVSFPINLYLKKRVN

  16. Selective Oxidation and Reactive Wetting During Hot-Dip Galvanizing of a 1.0 pct Al-0.5 pct Si TRIP-Assisted Steel

    Science.gov (United States)

    Bellhouse, E. M.; McDermid, J. R.

    2012-07-01

    Selective oxidation and reactive wetting during continuous galvanizing were studied for a low-alloy transformation induced plasticity (TRIP)-assisted steel with 0.2 pct C, 1.5 pct Mn, 1.0 pct Al and 0.5 pct Si. Three process atmospheres were tested during annealing prior to galvanizing: 220 K (-53 °C) dew point (dp) N2-20 pct H2, 243 K (-30 °C) dp N2-5 pct H2 and 278 K (+5 °C) dp N2-5 pct H2. The process atmosphere oxygen partial pressure affected the oxide chemistry, morphology and thickness. For the 220 K (-53 °C) dp and 243 K (-30 °C) dp process atmospheres, film and nodule-type manganese, silicon and aluminum containing oxides were observed at the surface. For the 278 K (+5 °C) dp atmosphere, MnO was observed at the grain boundaries and as thicker localized surface films. Oxide morphology, thickness and chemistry affected reactive wetting, with complete wetting being observed for the 220 K (-53 °C) dp and 243 K (-30 °C) dp process atmospheres and incomplete reactive wetting being observed for the 278 K (+5 °C) dp atmosphere. Complete reactive wetting for the 220 K (-53 °C) dp and 243 K (-30 °C) dp process atmospheres was attributed to a combination of zinc bridging of oxides, aluminothermic reduction of surface oxides and wetting of the oxides. Incomplete wetting for the 278 K (+5 °C) dp atmosphere was attributed to localized thick MnO films.

  17. ORF Alignment: NC_003366 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available QFGKLISAYKRWGNEEALEE Sbjct: 121 AKPFHVGHLFTTAIGHSLYRMLNFEGYNPIRINHLGDWGTQFGKLISAYKRWGNEEALEE 180 ... Query: 243 DMLGVDFDSWAGES...FYNDKMDKVVEELEKANILTESNGAKVVMLDEYNMPPCIVVKSDGA 302 ... DMLGVDFDSWAGESFYNDKMDKVVEELEKAN...ILTESNGAKVVMLDEYNMPPCIVVKSDGA Sbjct: 241 DMLGVDFDSWAGESFYNDKMDKVVEELEKANILTESNGAK

  18. Protein (Cyanobacteria): 661286037 [PGDBj - Ortholog DB

    Lifescience Database Archive (English)

    Full Text Available 0:477 ... hypothetical protein, partial Prochlorococcus sp. scB243_498P3 MSTKSDSLKEKLIENFSDFSKLSDYSFMNYLRADPQ...STKDGNDHKPRSVYSGHYVPVLPTAIPEPEYISHSKKLFKELRLSSDLTKDKNFCLFFSGDISVANYPMSPVGWATGYALSIYGTEYTQQCPFGTGNGYGDGIAISVFEGLFNGKRMEMQLKGGGPTPYCRGA

  19. Comparison of fission and capture cross sections of minor actinides

    International Nuclear Information System (INIS)

    Nakagawa, Tsuneo; Iwamoto, Osamu

    2003-01-01

    The fission and capture cross sections of minor actinides given in JENDL-3.3 are compared with other evaluated data and experimental data. The comparison was made for 32 nuclides of Th-227, 228, 229, 230, 233, 234, Pa-231, 232, 233, U-232, 234, 236, 237, Np-236, 237, 238, Pu-236, 237, 238, 242, 244, Am-241, 242, 242m, 243, Cm-242, 243, 244, 245, 246, 247 and 248. Given in the present report are figures of these cross sections and tables of cross sections at 0.0253 eV and resonance integrals. (author)

  20. Estudo da reologia e espessura do reboco de fluidos de perfuração: influência de dispersantes e umectante aniônicos Study of rheology and filter-cake thickness of drilling fluids: influence of anionic dispersants and surfactant

    Directory of Open Access Journals (Sweden)

    K. V. Farias

    2006-12-01

    Full Text Available Este trabalho teve como objetivo avaliar a influência de aditivos dispersantes e umectante aniônicos nas viscosidades aparente (VA e plástica (VP, no volume de filtrado (VF e na espessura do reboco (ER de fluidos de perfuração á base de água e argila bentonítica. Os fluidos foram preparados com 4,86% em massa de argila bentonítica e os aditivos estudados nas concentrações de 0,025 g a 0,300 g/24,3 g de argila seca para os dispersantes e de 0,005 g a 0,300 g/24,3 g de argila seca para o umectante aniônico. Os resultados mostraram que a espessura do reboco foi significativamente reduzida pela presença do umectante aniônico, sem, contudo, alterar as taxas de filtração dos fluidos estudados. Como era esperado, observou-se a redução nos valores de VA e VP após a aditivação dos fluidos com os aditivos dispersantes. Além disso, a mudança brusca nos valores de VA, VP e ER dos fluidos aditivados com o umectante aniônico na concentração de 0,100 g/24,3 g de argila seca evidenciou que esta é muito provavelmente a concentração micelar crítica deste aditivo.The aim of this work is to evaluate the influence of dispersants additives and anionic surfactants in the apparent viscosity (AV, plastic viscosity (PV, water loss (WL and filter-cake thickness (FT of the water based drilling fluids with bentonite clay. The fluids were prepared with 4.86 wt % of bentonite clay and the additives studied in the concentrations of 0.025 g to 0.300 g/24.3 g of dry clay for the dispersants and 0.005 g to 0.300 g/24.3 g of dry clay for the anionic surfactant. The results had shown the filter-cake thickness was significantly reduced by the presence of the anionic surfactant, without, however, to modify the taxes of filtration of studied fluids. As it was waited, it was observed the reduction in the values of AV and PV after treating the fluids with dispersants addictives. Also, the abrupt change in the values of AV, PV and FT of fluids treated with

  1. ORF Alignment: NC_004605 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available VIATLDKHDYQVSLEELQARMLE Sbjct: 1 ... SFSGIVKAKETASLSFRVPGTVESVFVNKGSVVEKGQVIATLDKHDYQVSLEELQARMLE 60 ... Query: 184 TLRAPFTGIVADVSVDPHE...QTLPGGSVVSIQQEDSWEVDIDVPENMIAQFALGQPASLTW 243 ... TLRAPFTGIVADVSVDPHEQTLPGGSVVS...IQQEDSWEVDIDVPENMIAQFALGQPASLTW Sbjct: 121 TLRAPFTGIVADVSVDPHEQTLPGGSVVSIQQEDSWEVDIDVPENMIAQFALGQPASLTW 180 ...

  2. ORF Alignment: NC_006814 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available IANLVTENNTKIKAISISF 60 ... Query: 123 VSDFAVXXXXXXXXXXXXXXXKLFRGTSFSAGEFGMMITDYTGHGFKSAHELASTSALIS 182 ... ... ... VSDFAV ... KLFRGTSFSAGEFGMMITDYTGHGFKSAHELASTSALIS Sbjct: 121 VSDFAV...ITLGNGVGGGIFINNKLFRGTSFSAGEFGMMITDYTGHGFKSAHELASTSALIS 180 ... Query: 243 SQNSELIPIIKEKLNQIPNWTDFQAEIQSCRFFNDAS

  3. ORF Alignment: NC_002754 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available SYPGDVYRNYKKHLEIIESSSADCVIFPELSLTGYIIKDLTYEIYKDAEEA 60 ... Query: 123 DPLKDLKIFEYKDLKFGVVICEDAWHPEPIEALSLMGADAIFIPSAS...PMRKLRENLAIEE 182 ... DPLKDLKIFEYKDLKFGVVICEDAWHPEPIEALSLMGADAIFIPSAS...PMRKLRENLAIEE Sbjct: 121 DPLKDLKIFEYKDLKFGVVICEDAWHPEPIEALSLMGADAIFIPSASPMRKLRENLAIEE 180 ... Query: 243 TENEL

  4. 243 Caractérisation floristique et analyse des formes de pression ...

    African Journals Online (AJOL)

    Afrique Sciences

    Résumé. L'objectif de cette étude est d'évaluer les ressources biologiques des forêts sacrées en vue de définir des stratégies pour leur maintien. Le SIG a permis de réaliser la carte de végétation de la forêt qui a servi de base pour la collecte des données floristiques et dendrométriques. La classification hiérarchique des ...

  5. : tous les projets | Page 243 | CRDI - Centre de recherches pour le ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Sujet: Climate change, ADAPTATION TO CHANGE, DROUGHT, FLOODS, HYDROLOGY, AGRICULTURAL LAND, CULTIVATED LAND, LAND USE, PLANNING. Région: Argentina, South America, Paraguay, North and Central America. Programme: Changements climatiques. Financement total : CA$ 391,900.00.

  6. 243 The Challenges of Theatre Workshop in Katsina-Ala and Oju ...

    African Journals Online (AJOL)

    USER

    recommends more funding by the College management for Theatre. Arts Department ... exploring and expressing human feelings and predicaments. This is because .... atmosphere where talents and creativity is built in students, fostering ...

  7. Sor/88-243, 21 April 1988, uranium and thorium mining regulations

    International Nuclear Information System (INIS)

    1988-05-01

    These Regulations deal with radiological health and safety in uranium mining facilities and in effect, they formalise previous requirements imposed on such facilities through licence conditions. Licences are required for removing or excavating uranium or thorium; siting, constructing or operating a mine or a mill; and for decommissioning a mining facility. Applications for licences include technical conditions relevant to each type of activity concerned, the common condition being detailed descriptions of the activity, the radiation protection and environmental protection measures as well as the radiation monitoring programme [fr

  8. 243 The Challenges of Theatre Workshop in Katsina-Ala and Oju ...

    African Journals Online (AJOL)

    USER

    primary and secondary methods of carrying out research with interviews, focus ... people working together in order to communicate ideas and also explore social issues to ... affected the effective teaching and learning of Theatre Arts thereby affecting the training of ..... making it different for students to misbehave. Besides, he ...

  9. Sud du Sahara | Page 243 | CRDI - Centre de recherches pour le ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Langue English. Read more about Autres modèles de prestation de services publics dans les domaines de la santé, de l'eau et de l'éléctricité (Afrique, Asie, Amérique latine)103828. Langue French. Read more about Alternative Public Service Delivery Models in Health, Water and Electricity (Africa, Asia, Latin America).

  10. Application of a gamma spectroscopy system to the measurement of neutron cross sections necessary to the development of nuclear energy; Mise au point d'un systeme de spectroscopie pour mesurer des sections efficaces neutroniques applicables a un possible developpement du nucleaire comme source d'energie

    Energy Technology Data Exchange (ETDEWEB)

    Deruelle, O

    2002-09-01

    This work concerns the development of nuclear energy and nuclear waste management in particular. Two parts of this study can be distinguished. In the first part (theoretical), a thorium-plutonium fuel based on MOX and dedicated for PWR was investigated in order to transmute plutonium in a potentially low waste fuel cycle. It was shown that this type of fuel is not regenerative but could be used for a transition to the industrial thorium fuel cycle without building new reactors. Thanks to moderated neutron spectra and high loaded actinide mass in the core, U-233 is quickly created ({approx}300 kg/y) for a loss of about {approx}1200 kg of fissile plutonium. In the second part (experimental), we have developed and built a new reaction chamber to measure neutron cross sections of actinides by alpha-gamma spectroscopy. This experimental device (in principle transportable) was commissioned in the high flux reactor of ILL Grenoble. Neutron flux was measured by gamma spectroscopy of irradiated Al and Co samples and was found to be of the order of 6,0. 10{sup 14} n.cm{sup -2}.s{sup -1} (4%). By the irradiation of 11{mu}g of Am-243 and Pu-242, corresponding capture cross sections were measured in the thermal neutron flux at 50 deg C. These are the results: {sup 243}Am(n,{gamma}) {sup 244fond.}Am = 4,72{+-}1,42b; {sup 243}Am(n,{gamma}) {sup 244total}Am = 74,8{+-}3,25b; {sup 242}Pu (n,{gamma}){sup 243}Pu = 22,7{+-}1,09b. Uncertainties of the measurements are mostly due to the determination of the neutron flux, efficiency of the electronics and ambiguities related to the definition of the area under {alpha}-{gamma} spectra. Although our measured cross sections deviate (by 10-30%) from the corresponding values widely used in evaluated data libraries such as ENDF, JEF and JENDL, in this work we have demonstrated the feasibility and principle of our experimental method. Furthermore, the value for the 243-americium capture cross-section is in very good agreement with the last two

  11. Application of a gamma spectroscopy system to the measurement of neutron cross sections necessary to the development of nuclear energy

    International Nuclear Information System (INIS)

    Deruelle, O.

    2002-09-01

    This work concerns the development of nuclear energy and nuclear waste management in particular. Two parts of this study can be distinguished. In the first part (theoretical), a thorium-plutonium fuel based on MOX and dedicated for PWR was investigated in order to transmute plutonium in a potentially low waste fuel cycle. It was shown that this type of fuel is not regenerative but could be used for a transition to the industrial thorium fuel cycle without building new reactors. Thanks to moderated neutron spectra and high loaded actinide mass in the core, U-233 is quickly created (∼300 kg/y) for a loss of about ∼1200 kg of fissile plutonium. In the second part (experimental), we have developed and built a new reaction chamber to measure neutron cross sections of actinides by alpha-gamma spectroscopy. This experimental device (in principle transportable) was commissioned in the high flux reactor of ILL Grenoble. Neutron flux was measured by gamma spectroscopy of irradiated Al and Co samples and was found to be of the order of 6,0. 10 14 n.cm -2 .s -1 (4%). By the irradiation of 11μg of Am-243 and Pu-242, corresponding capture cross sections were measured in the thermal neutron flux at 50 deg C. These are the results: 243 Am(n,γ) 244fond. Am = 4,72±1,42b; 243 Am(n,γ) 244total Am = 74,8±3,25b; 242 Pu (n,γ) 243 Pu = 22,7±1,09b. Uncertainties of the measurements are mostly due to the determination of the neutron flux, efficiency of the electronics and ambiguities related to the definition of the area under α-γ spectra. Although our measured cross sections deviate (by 10-30%) from the corresponding values widely used in evaluated data libraries such as ENDF, JEF and JENDL, in this work we have demonstrated the feasibility and principle of our experimental method. Furthermore, the value for the 243-americium capture cross-section is in very good agreement with the last two measurements done in 1975 and 1997. These facts allowed us to think of new experiments

  12. Application of a gamma spectroscopy system to the measurement of neutron cross sections necessary to the development of nuclear energy; Mise au point d'un systeme de spectroscopie pour mesurer des sections efficaces neutroniques applicables a un possible developpement du nucleaire comme source d'energie

    Energy Technology Data Exchange (ETDEWEB)

    Deruelle, O

    2002-09-01

    This work concerns the development of nuclear energy and nuclear waste management in particular. Two parts of this study can be distinguished. In the first part (theoretical), a thorium-plutonium fuel based on MOX and dedicated for PWR was investigated in order to transmute plutonium in a potentially low waste fuel cycle. It was shown that this type of fuel is not regenerative but could be used for a transition to the industrial thorium fuel cycle without building new reactors. Thanks to moderated neutron spectra and high loaded actinide mass in the core, U-233 is quickly created ({approx}300 kg/y) for a loss of about {approx}1200 kg of fissile plutonium. In the second part (experimental), we have developed and built a new reaction chamber to measure neutron cross sections of actinides by alpha-gamma spectroscopy. This experimental device (in principle transportable) was commissioned in the high flux reactor of ILL Grenoble. Neutron flux was measured by gamma spectroscopy of irradiated Al and Co samples and was found to be of the order of 6,0. 10{sup 14} n.cm{sup -2}.s{sup -1} (4%). By the irradiation of 11{mu}g of Am-243 and Pu-242, corresponding capture cross sections were measured in the thermal neutron flux at 50 deg C. These are the results: {sup 243}Am(n,{gamma}) {sup 244fond.}Am = 4,72{+-}1,42b; {sup 243}Am(n,{gamma}) {sup 244total}Am = 74,8{+-}3,25b; {sup 242}Pu (n,{gamma}){sup 243}Pu = 22,7{+-}1,09b. Uncertainties of the measurements are mostly due to the determination of the neutron flux, efficiency of the electronics and ambiguities related to the definition of the area under {alpha}-{gamma} spectra. Although our measured cross sections deviate (by 10-30%) from the corresponding values widely used in evaluated data libraries such as ENDF, JEF and JENDL, in this work we have demonstrated the feasibility and principle of our experimental method. Furthermore, the value for the 243-americium capture cross-section is in very good agreement with the last two

  13. Initial Assessment of β3-Adrenoceptor-Activated Brown Adipose Tissue in Streptozotocin-Induced Type 1 Diabetes Rodent Model Using [18F]Fluorodeoxyglucose Positron Emission Tomography/Computed Tomography

    Directory of Open Access Journals (Sweden)

    Aparna Baranwal

    2015-12-01

    Full Text Available Metabolic activity of brown adipose tissue (BAT is activated by β3-adrenoceptor agonists and norepinephrine transporter (NET blockers and is measurable using [18F]fluorodeoxyglucose ([18F]FDG positron emission tomography/computed tomography (PET/CT in rats. Using the streptozotocin (STZ-treated rat model of type 1 diabetes mellitus (T1DM, we investigated BAT activity in this rat model under fasting and nonfasting conditions using [18F]FDG PET/CT. Drugs that enhance BAT activity may have a potential for therapeutic development in lowering blood sugar in insulin-resistant diabetes. Rats were rendered diabetic by administration of STZand confirmed by glucose measures. [18F]FDG was injected in the rats (fasted or nonfasted pretreated with either saline or β3-adrenoceptor agonist CL316,243 or the NET blocker atomoxetine for PET/CT scans. [18F]FDG metabolic activity was computed as standard uptake values (SUVs in interscapular brown adipose tissue (IBAT and compared across the different drug treatment conditions. Blood glucose levels > 500 mg/dL were established for the STZ-treated diabetic rats. Under fasting conditions, average uptake of [18F]FDG in the IBAT of STZ-treated diabetic rats was approximately 70% lower compared to that of normal rats. Both CL316,243 and atomoxetine activated IBAT in normal rats had an SUV > 5, whereas activation in STZ-treated rats was significantly lower. The agonist CL316,243 activated IBAT up to threefold compared to saline in the fasted STZ-treated rat. In the nonfasted rat, the IBAT activation was up by twofold by CL316243. Atomoxetine had a greater effect on lowering blood sugar levels compared to CL316,243 in the nonfasted rats. A significant reduction in metabolic activity was observed in the STZ-treated diabetic rodent model. Increased IBAT activity in the STZ-treated diabetic rat under nonfasted conditions using the β3-adrenoceptor agonist CL316,243 suggests a potential role of BAT in modulating blood sugar

  14. Results of Am isotopic ratio analysis in irradiated MOX fuels

    Energy Technology Data Exchange (ETDEWEB)

    Koyama, Shin-ichi; Osaka, Masahiko; Mitsugashira, Toshiaki; Konno, Koichi [Power Reactor and Nuclear Fuel Development Corp., Oarai, Ibaraki (Japan). Oarai Engineering Center; Kajitani, Mikio

    1997-04-01

    For analysis of a small quantity of americium, it is necessary to separate from curium which has similar chemical property. As a chemical separation method for americium and curium, the oxidation of americium with pentavalent bismuth and subsequent co-precipitation of trivalent curium with BIP O{sub 4} were applied to analyze americium in irradiated MOX fuels which contained about 30wt% plutonium and 0.9wt% {sup 241}Am before irradiation and were irradiated up to 26.2GWd/t in the experimental fast reactor Joyo. The purpose of this study is to measure isotopic ratio of americium and to evaluate the change of isotopic ratio with irradiation. Following results are obtained in this study. (1) The isotopic ratio of americium ({sup 241}Am, {sup 242m}Am and {sup 243}Am) can be analyzed in the MOX fuels by isolating americium. The isotopic ratio of {sup 242m}Am and {sup 243}Am increases up to 0.62at% and 0.82at% at maximum burnup, respectively, (2) The results of isotopic analysis indicates that the contents of {sup 241}Am decreases, whereas {sup 242m}Am, {sup 243}Am increase linearly with increasing burnup. (author)

  15. Mechanical stability of individual austenite grains in TRIP steel studied by synchrotron X-ray diffraction during tensile loading

    Energy Technology Data Exchange (ETDEWEB)

    Blondé, R. [Fundamental Aspects of Materials and Energy, Faculty of Applied Sciences, Delft University of Technology, Mekelweg 15, 2629 JB Delft (Netherlands); Materials Innovation Institute, Mekelweg 2, 2628 CD Delft (Netherlands); Jimenez-Melero, E. [Dalton Cumbrian Facility, The University of Manchester, Westlakes Science and Technology Park, Moor Row, Cumbria, CA24 3HA (United Kingdom); Zhao, L. [Materials Innovation Institute, Mekelweg 2, 2628 CD Delft (Netherlands); Department of Materials Science and Engineering, Delft University of Technology, Mekelweg 2, 2628 CD Delft (Netherlands); Wright, J.P. [European Synchrotron Radiation Facility, 6 Rue Jules Horowitz, BP 220, 38043 Grenoble Cedex (France); Brück, E. [Fundamental Aspects of Materials and Energy, Faculty of Applied Sciences, Delft University of Technology, Mekelweg 15, 2629 JB Delft (Netherlands); Zwaag, S. van der [Novel Aerospace Materials Group, Faculty of Aerospace Engineering, Delft University of Technology, Kluyverweg 1, 2629 HS, Delft (Netherlands); Dijk, N.H. van, E-mail: N.H.vanDijk@tudelft.nl [Fundamental Aspects of Materials and Energy, Faculty of Applied Sciences, Delft University of Technology, Mekelweg 15, 2629 JB Delft (Netherlands)

    2014-11-17

    The stability of individual metastable austenite grains in low-alloyed TRIP steels has been studied during tensile loading using high-energy X-ray diffraction. The carbon concentration, grain volume and grain orientation with respect to the loading direction was monitored for a large number of individual grains in the bulk microstructure. Most austenite grains transform into martensite in a single transformation step once a critical load is reached. The orientation-dependent stability of austenite grains was found to depend on their Schmid factor with respect to the loading direction. Under the applied tensile stress the average Schmid factor decreased from an initial value of 0.44 to 0.41 at 243 MPa. The present study reveals the complex interplay of microstructural parameters on the mechanical stability of individual austenite grains, where the largest grains with the lowest carbon content tend to transform first. Under the applied tensile stress the average carbon concentration of the austenite grains increased from an initial value of 0.90 to 1.00 wt% C at 243 MPa, while the average grain volume of the austenite grains decreased from an initial value of 19 to 15 µm{sup 3} at 243 MPa.

  16. Description of two new plasmids isolated from Francisella philomiragia strains and construction of shuttle vectors for the study of Francisella tularensis.

    Science.gov (United States)

    Le Pihive, E; Blaha, D; Chenavas, S; Thibault, F; Vidal, D; Valade, E

    2009-11-01

    Francisella tularensis is the causative agent of tularemia, a zoonotic disease often transmitted to humans by infected animals. The lack of useful specific genetic tools has long hampered the study of F. tularensis subspecies. We identified and characterized two new plasmids, pF242 and pF243, isolated from Francisella philomiragia strains ATCC 25016 and ATCC 25017, respectively. Sequence analysis revealed that pF242 and pF243 are closely related to pC194 and pFNL10 plasmids, respectively. Two generations of pF242- and pF243-based shuttle vectors, harboring several antibiotic resistance markers, were developed. We used the first generation to compare transformation efficiencies in two virulent F. tularensis subspecies. We found that electroporation was more efficient than cryotransformation: almost all vectors tested were successfully introduced by electroporation into Francisella strains with a high level of efficiency. The second generation of shuttle vectors, containing a multiple cloning site and/or gfp gene downstream of Francisella groES promotor, was used for GFP production in F. tularensis. The development of new shuttle vectors offers new perspectives in the genetic manipulation of F. tularensis, helping to elucidate the mechanisms underlying its virulence.

  17. Photofissility of heavy nuclei at intermediate energies

    International Nuclear Information System (INIS)

    Deppman, A.; Arruda Neto, J.D.T.; Likhachev, V.P.; Goncalves, M.

    2002-10-01

    We use the recently developed MCMC/MCEF (Multi Collisional Monte Carlo plus Monte Carlo for Evaporation-Fission calculations) model to calculate the photo fissility and the photofission cross section at intermediate energies for the 243 Am and for 209 Bi, and compare them to results obtained for other actinides and to available experimental data. As expected, the results for 243 Am are close to those for 237 Np. The fissility for pre actinide nuclei is nearly one order of magnitude lower than that for the actinides. Both fissility and photofission cross section for 209 Bi are in good agreement with the experimental data. (author)

  18. Some notes on the butterflies (Lepidoptera: Papilionoidea of Tantirimale Archaeological Site, Anuradhapura District, Sri Lanka

    Directory of Open Access Journals (Sweden)

    M.D.C. Asela

    2009-07-01

    Full Text Available There are 243 species of butterflies which including 5 families in Sri Lanka and 20 of them are endemic. However out of the 243 species 37 butterfly species belonging to 4 families was discovered from Tanthirimale Archaeological Forest area. This forest is classified as a Tropical dry mixed evergreen forests and its situated dry zone in Anuradapura district of Sri Lanka. We select three habitat types such as: forests, Rock outcrops and scrublands for studding composition and structure of butterflies in Archaeological Forest area. However, this important forest is threatened by harmful human activities such as man made fire, illegal logging, chena cultivation and road kills.

  19. ORF Alignment: NC_006513 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available ding ... response regulator [Azoarcus sp. EbN1] ... Length = 243 ... Query: 139 GRSRAMQDLYQKVLRVAASEAN...VLITGESGVGKELVARALHDNSTRAKGPYVAVHCASLP 198 ... GRSRAMQDLYQKVLRVAASEAN...VLITGESGVGKELVARALHDNSTRAKGPYVAVHCASLP Sbjct: 1 ... GRSRAMQDLYQKVLRVAASEANVLITGESGVGKELVARALHDNSTRAKGPYVAVHCAS

  20. Radiochemical studies of neutron deficient actinide isotopes

    Energy Technology Data Exchange (ETDEWEB)

    Williams, K.E.

    1978-04-01

    The production of neutron deficient actinide isotopes in heavy ion reactions was studied using alpha, gamma, x-ray, and spontaneous fission detection systems. A new isotope of berkelium, /sup 242/Bk, was produced with a cross-section of approximately 10 ..mu..b in reactions of boron on uranium and nitrogen on thorium. It decays by electron capture with a half-life of 7.0 +- 1.3 minutes. The alpha-branching ratio for this isotope is less than 1% and the spontaneous fission ratio is less than 0.03%. Studies of (Heavy Ion, pxn) and (Heavy Ion, ..cap alpha..xn) transfer reactions in comparison with (Heavy ion, xn) compound nucleus reactions revealed transfer reaction cross-sections equal to or greater than the compound nucleus yields. The data show that in some cases the yield of an isotope produced via a (H.I.,pxn) or (H.I.,..cap alpha..xn) reaction may be higher than its production via an xn compound nucleus reaction. These results have dire consequences for proponents of the ''Z/sub 1/ + Z/sub 2/ = Z/sub 1+2/'' philosophy. It is no longer acceptable to assume that (H.I.,pxn) and (H.I.,..cap alpha..xn) product yields are of no consequence when studying compound nucleus reactions. No evidence for spontaneous fission decay of /sup 228/Pu, /sup 230/Pu, /sup 232/Cm, or /sup 238/Cf was observed indicating that strictly empirical extrapolations of spontaneous fission half-life data is inadequate for predictions of half-lives for unknown neutron deficient actinide isotopes.

  1. Paul Scherrer Institute Scientific Report 1999. Volume I: Particles and Matter

    International Nuclear Information System (INIS)

    Gobrecht, J.; Gaeggeler, H.; Herlach, D.; Junker, K.; Kettle, P.-R.; Kubik, P.; Zehnder, A.

    2000-01-01

    Although originally planned for fundamental research in nuclear physics, the particle beams of pions, muons, protons and neutrons are now used in a large variety of disciplines in both natural science and medicine. The beams at PSI have the world's highest intensities and therefore allow certain experiments to be performed, which would not be possible elsewhere. The highlight of research this year was the first-ever determination of the chemical properties of the superheavy element 107 Bohrium. This was undertaken, by an international team led by H. Gaeggeler of PSI's Laboratory for Radiochemistry. Bohrium was produced by bombarding a Berkelium target with Neon ions from the Injector I cyclotron and six atoms were detected after having passed through an online gas chromatography device. At the Laboratory for Particle Physics the focus has shifted from nuclear physics to elementary particle physics with about a fifty-fifty split between investigations of rare processes or particle decays using the high intensity muon, pion and recently also polarized neutron beams of PSI, and research at the highest energy frontier at CERN (Geneva) and DESY (Hamburg). Important space instrumentation has been contributed by the Laboratory for Astrophysics to the European Space Agency and NASA satellite programmes. The Laboratory for Micro and Nanotechnology continued to focus on research into molecular nanotechnology and SiGeC nanostructures, the latter with the aim of producing silicon based optoelectronics. Progress in 1999 in these topical areas is described in this report. A list of scientific publications in 1999 is also provided

  2. Paul Scherrer Institute Scientific Report 1999. Volume I: Particles and Matter

    Energy Technology Data Exchange (ETDEWEB)

    Gobrecht, J.; Gaeggeler, H.; Herlach, D.; Junker, K.; Kettle, P.-R.; Kubik, P.; Zehnder, A. [eds.

    2000-07-01

    lthough originally planned for fundamental research in nuclear physics, the particle beams of pions, muons, protons and neutrons are now used in a large variety of disciplines in both natural science and medicine. The beams at PSI have the world's highest intensities and therefore allow certain experiments to be performed, which would not be possible elsewhere. The highlight of research this year was the first-ever determination of the chemical properties of the superheavy element {sup 107} Bohrium. This was undertaken, by an international team led by H. Gaeggeler of PSI's Laboratory for Radiochemistry. Bohrium was produced by bombarding a Berkelium target with Neon ions from the Injector I cyclotron and six atoms were detected after having passed through an online gas chromatography device. At the Laboratory for Particle Physics the focus has shifted from nuclear physics to elementary particle physics with about a fifty-fifty split between investigations of rare processes or particle decays using the high intensity muon, pion and recently also polarized neutron beams of PSI, and research at the highest energy frontier at CERN (Geneva) and DESY (Hamburg). Important space instrumentation has been contributed by the Laboratory for Astrophysics to the European Space Agency and NASA satellite programmes. The Laboratory for Micro and Nanotechnology continued to focus on research into molecular nanotechnology and SiGeC nanostructures, the latter with the aim of producing silicon based optoelectronics. Progress in 1999 in these topical areas is described in this report. A list of scientific publications in 1999 is also provided.

  3. Paul Scherrer Institute Scientific Report 1999. Volume I: Particles and Matter

    Energy Technology Data Exchange (ETDEWEB)

    Gobrecht, J; Gaeggeler, H; Herlach, D; Junker, K; Kettle, P -R; Kubik, P; Zehnder, A [eds.

    2000-07-01

    lthough originally planned for fundamental research in nuclear physics, the particle beams of pions, muons, protons and neutrons are now used in a large variety of disciplines in both natural science and medicine. The beams at PSI have the world's highest intensities and therefore allow certain experiments to be performed, which would not be possible elsewhere. The highlight of research this year was the first-ever determination of the chemical properties of the superheavy element {sup 107} Bohrium. This was undertaken, by an international team led by H. Gaeggeler of PSI's Laboratory for Radiochemistry. Bohrium was produced by bombarding a Berkelium target with Neon ions from the Injector I cyclotron and six atoms were detected after having passed through an online gas chromatography device. At the Laboratory for Particle Physics the focus has shifted from nuclear physics to elementary particle physics with about a fifty-fifty split between investigations of rare processes or particle decays using the high intensity muon, pion and recently also polarized neutron beams of PSI, and research at the highest energy frontier at CERN (Geneva) and DESY (Hamburg). Important space instrumentation has been contributed by the Laboratory for Astrophysics to the European Space Agency and NASA satellite programmes. The Laboratory for Micro and Nanotechnology continued to focus on research into molecular nanotechnology and SiGeC nanostructures, the latter with the aim of producing silicon based optoelectronics. Progress in 1999 in these topical areas is described in this report. A list of scientific publications in 1999 is also provided.

  4. Nanoscale materials in chemistry

    National Research Council Canada - National Science Library

    Klabunde, Kenneth J; Richards, Ryan

    2009-01-01

    ...: Disordered, Porous Nanostructures Stephanie L. Brock 209 9 Ordered Microporous and Mesoporous Materials Freddy Kleitz 243 10 Applications of Microporous and Mesoporous Materials Anirban Ghosh,...

  5. Results of the experiment on chemical identification of Db as a decay product of element 115

    International Nuclear Information System (INIS)

    Dmitriev, S.N.; Oganesyan, Yu.Ts.; Utenkov, V.K.

    2004-01-01

    For the first time the chemical identification of Db as the terminal isotope of the decay element 115 produced via the 243 Am( 48 Ca, 3n) 288 115 reaction was realized. The experiment was performed on the U400 cyclotron of FLNR, JINR. The 243 Am target was bombarded with a beam dose of 3.4 · 10 18 48 Ca projectiles at an energy of 247 MeV in the center of the target. The reaction products were collected in the surface of a copper catcher block, which was removed with a lathe and then dissolved in concentrated HNO 3 . The group 5 elements were separated by sorption onto Dowex 50X8 cation-exchange resin with subsequent desorption using 1 M HF, which forms anionic fluoride complexes of group 5 elements. The eluant was evaporated onto 0.4 μm thick polyethylene foils which were placed between a pair of semiconductor detectors surrounded by 3 He neutron counters for measurement of α particles, fission fragments and neutrons. Over the course of the experiment, we observed 15 spontaneous fission events with T 1/2 = 32 -7 +11 h which we attribute to 268 Db. The production cross section for the 243 Am + 48 Ca reaction was 4.2 -1.2 + 1 .6 pb. These results agree with the original element 115 synthesis experiment where 268 Db was first observed as the terminal isotope following the five consecutive α decays from the 288 115 parent nucleus at the Dubna gas-filled separator. The data from the present experiment give independent evidence for the synthesis of element 115 as well as element 113 via the 243 Am + 48 Ca reaction

  6. Preoperative preparation of high-risk, specifically hyperimmunized canine renal allograft recipients with total-lymphoid irradiation and cyclosporine

    International Nuclear Information System (INIS)

    Rapaport, F.T.; Meek, A.G.; Arnold, A.N.; Miura, S.; Hayashi, R.; Strober, S.

    1987-01-01

    Hyperimmunized subjects are a particularly high-risk and rapidly growing group in the patient population awaiting renal transplantation. In a search for methods designed to ameliorate the prognosis in such cases, dogs of defined DLA genotype were sensitized with DLA incompatible skin allografts and injections of buffy coat. Each recipient was challenged with a renal allograft bearing the same DLA incompatibilities. Five dogs received kidney transplants, without any other treatment, and rejected their transplants at 2.5, 4, 5, 6, and 6.5 days, respectively. Another four dogs were given a 9-11-week course (1760 +/- 35 cGy) of total-lymphoid irradiation (TLI), followed by rabbit antithymocyte globulin (ATG); these animals rejected their renal allografts at 7, 8, 14, and 17 days, respectively. Five other dogs were treated with TLI and received cyclosporine (CsA) and methylprednisolone (MPd) daily until graft rejection. Their renal allografts survived for 7.5, 8.5, 20, 62, and 227 days, respectively. Renal allografts placed in normal recipients under the same conditions of donor-recipient DLA incompatibility had a mean survival time of 12.4 days (range: 10-18 days). At the time of transplantation, the specific anti-DLA antibody titers in the recipients were 81 to 243 in the untreated dogs; 27 to 81 in the TLI-ATG-treated group, and 3 to 243 in the TLI-CsA/MPd-treated group. The titers fell within 24-48 hr after renal transplantation, to 3 to 81 in the untreated sensitized dogs; they were 3 to 9 in the TLI-ATG-treated group, and were 9 to 243 in the TLI-CsA/MPd treated group. The cytotoxic antibody titers reached postoperative peaks of 6500 to 200,000 in the untreated dogs; 729 to 6500 in the TLI-ATG-treated dogs, and 243 to 6500 in the TLI-CsA/MPd-treated recipients

  7. Treatment of cancer with heavy charged particles

    International Nuclear Information System (INIS)

    Castro, J.R.

    1981-01-01

    The clinical radiotherapy trial has accured 243 patients irradiated with particles and 13 patients irradiated as controls in randomized studies. Of the 243 particle patients, 194 have been treated with helium ions, either solely or in combination with photon irradiation, and 49 have received all or part of their irradiation with one of the heavier particles, either carbon, neon, or argon ions. The project thus can be divided into two general phases: (1) evaluation of improved dose distribution without significant biologic advantage by use of helium ion irradiation; and (2) evaluation of improved dose distribution and enhanced biologic effect by irradiation with heavy charged particles such as carbon, neon, and argon ions

  8. Dealing with food allergies in babies and children

    National Research Council Canada - National Science Library

    Joneja, Janice M. Vickerstaff

    2007-01-01

    ... . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 231 CHAPTER 14 CornAllergy ...243 CHAPTER 15 SeafoodAllergy ...253 CHAPTER 16 The Top Ten Allergens: Avoidance of Milk, Egg, Wheat, Corn, Peanuts, Soy, Tree Nuts...

  9. Tagasi Pariisis / Karl Rumor

    Index Scriptorium Estoniae

    Rumor, Karl, pseud., 1886-1971

    2008-01-01

    Prantsusmaa sisepoliitilisest olustikust. Poliitilistest oludest 1937. aasta Euroopas, sõjameeleoludest Vahemerel, Nyloni konverentsist. Varem ilmunud: Uus Eesti 21. juuni 1937, nr. 166; 8., 13. sept. 1937, nr. 243, 248

  10. Arthroscopic subacromial decompression results in normal shoulder function after two years in less than 50% of patients

    DEFF Research Database (Denmark)

    Konradsen, Lars Aage Glud; Jensen, Claus Hjorth

    2015-01-01

    additional resection of the acromioclavicular joint. RESULTS: WORC scores improved significantly from preoperatively (median: 1,392) to three months (median: 204) and two years post-operatively (median: 243) (p

  11. Optická tloušťka atmosféry jako parametr pro stanovení obyvatelných zón exoplanet

    Czech Academy of Sciences Publication Activity Database

    Pintr, Pavel

    2013-01-01

    Roč. 58, č. 9 (2013), s. 243-246 ISSN 0447-6441 Institutional support: RVO:61389021 Keywords : Habitable zones * exoplanets * stellar spectral classes Subject RIV: JA - Electronics ; Optoelectronics, Electrical Engineering

  12. Synthesis and characterization of a pentadentate Schiff base N3O2 ligand and its neutral technetium(V) complex. X-ray structure of (N,N'-3-azapentane-1,5-diylbis(3-(1-iminoethyl)-6-methyl-2H-pyran-2,4(3H)-dionato)(3-)-O,O',N,N',N double-prime)oxotechnetium(V)

    International Nuclear Information System (INIS)

    Shuang Liu; Rettig, S.J.; Orvig, C.

    1991-01-01

    Preparations of a potentially pentadentate ligand, N,N'-3-azapentane-1,5-diylbis(3-(1-iminoethyl)-6-methyl-2H-pyran-2,4-(3H)-dione) (H 3 apa), and its neutral technetium(V) complex, [TcO(apa)], are described. The 13 C and 1 H NMR, infrared, optical, and mass spectra of the pentadentate ligand and its technetium(V) complex are reported. The X-ray structure of [TcO(apa)] has been determined. Crystals are orthorhombic, space group Pbca, with a = 12.833 (2) angstrom, b = 33.320 (5) angstrom, c = 9.942(4) angstrom, V = 4251 (2) angstrom, and Z = 8. The structure was solved by Patterson and Fourier methods and was refined by full-matrix least-squares procedures to R = 0.028 and R W = 0.032 for 4054 reflections with I ≥ 3σ(I). The technetium(V) complex has a highly distorted octahedral coordination geometry comprising a [TcO] 3+ core and the triply deprotonated pentadentate ligand wrapping around the metal center. One of the two oxygen donor atoms of the pentadentate ligand is located trans to the Tc double-bond O bond while the remaining four donor atoms, N 3 O, occupy the equatorial sites. The distance between the deprotonated N(1) atom to the Tc center is significantly shorter than a normal Tc-N single bond length of 2.10 angstroms, but longer than that for a Tc-N triple bond. 1 H NMR spectral data reveal a rigid solution structure for the complex, which undergoes no conformational and configurational exchange at temperatures up to 50C

  13. Fission cross section measurements of actinides at LANSCE

    Energy Technology Data Exchange (ETDEWEB)

    Tovesson, Fredrik [Los Alamos National Laboratory; Laptev, Alexander B [Los Alamos National Laboratory; Hill, Tony S [INL

    2010-01-01

    Fission cross sections of a range of actinides have been measured at the Los Alamos Neutron Science Center (LANSCE) in support of nuclear energy applications. By combining measurement at two LANSCE facilities, Lujan Center and the Weapons Neutron Research center (WNR), differential cross sections can be measured from sub-thermal energies up to 200 MeV. Incident neutron energies are determined using the time-of-flight method, and parallel-plate ionization chambers are used to measure fission cross sections relative to the {sup 235}U standard. Recent measurements include the {sup 233,238}U, {sup 239,242}Pu and {sup 243}Am neutron-induced fission cross sections. In this paper preliminary results for cross section data of {sup 243}Am and {sup 233}U will be presented.

  14. Calculational study for criticality safety data of fissionable actinides

    International Nuclear Information System (INIS)

    Nojiri, Ichiro; Fukasaku, Yasuhiro.

    1997-01-01

    This study has been carried out to obtain basic criticality safety characteristics of minor actinides nuclides. Criticality safety data of minor actinides nuclides have been surveyed through public literatures. Critical mass of seven nuclides, Np-237, Am-241, Am-242m, Am-243, Cm-243, Cm-244 and Cm-245, have been calculated by using two code systems of criticality safety analysis, SCALE-4 and MCNP4A, under some material and reflector conditions. Some applicable cross-section libraries have been used for each code systems. Calculated data have been compared with each other and with published data. The results of this comparison shows that there is no discrepancy within the computational codes and the calculated data is strongly depend on the cross-section library. (author)

  15. Fast radiochemical procedure to measure neptunium, plutonium, americium and curium in environmental samples for application in environmental monitoring and in radioecology research

    International Nuclear Information System (INIS)

    Pimpel, M.; Schuettelkopf, H.

    1984-01-01

    A radiochemical method is described by which Np, Pu, Am and Cm in environmental samples can be determined. The transuranium elements are dissolved with acids out of the ashed material. Np/Pu is separated from Am/Cm by sequential extraction using TOPO/cyclohexane. The two fractions are radiochemically purified. Np-237, Pu-239+240, Pu-238 and Pu-236 as well as Am-243, Am-241, Cm-244 and Cm-242 are measured by alpha spectrometery. Pu-236, Am-243 and Np-239 are used to determine the respective yields. A fast method of Np-239 preparation is described. The chemical yields range from 60 to 90%. The detection limit attained per nuclide is 10 fCi/sample. 20 reference, 1 table

  16. Analysis of recent post irradiation tests by Japanese and French burnup analysis code systems

    International Nuclear Information System (INIS)

    Iwasaki, Tomohiko; Hiraizumi, Hiroaki; Youinou, Gilles

    2002-01-01

    Benchmark problem based on Japanese Post Irradiation Experiment (PIE) data was analyzed by Japanese burnup analysis code and French one under the cooperative research program between the Japanese University Association (JUA) in Japan and Commissariat a l'Enegie Atomique (CEA) in France. Significant discrepancies over 10% were found between the Japanese and French results for 238 Pu, 243 Am, 244 Cm, 125 Sb, 154 Eu, 134 Cs and 144 Ce. It is supposed that the difference of C/E for 243 Am and 244 Cm between Japanese results and French ones is due to the (n,gamma) reaction of 242m Am. For 125 Sb and 154 Eu, the C/E values are improved by using new cross section and fission yield libraries. (author)

  17. PRESUMPTIVE DIAGNOSIS OF SCHISTOSOMA HAEMATOBIUM ...

    African Journals Online (AJOL)

    boaz

    AFRICAN JOURNAL OF CLINICAL AND EXPERIMENTAL MICROBIOLOGY .... study. Sample Collection and Processing. Two specimen containers were given to each subject and the ... false positive results and 24.3% true negative results.

  18. Enforcement and Effectiveness of Consumer Law in the Czech Republic

    Czech Academy of Sciences Publication Activity Database

    Pauknerová, Monika; Skalská, H.

    2017-01-01

    Roč. 7, č. 4 (2017), s. 243-254 ISSN 1805-8396 Institutional support: RVO:68378122 Keywords : consumer law * enforcement * alternative dispute resolution Subject RIV: AG - Legal Sciences OBOR OECD: Law

  19. Cyclotella hinziae sp. nov. – a small Cyclotella (Bacillariophyceae) from subalpine lake Schliersee (Bavaria, Germany)

    Czech Academy of Sciences Publication Activity Database

    Houk, Václav; König, C.; Klee, R.

    2015-01-01

    Roč. 15, č. 2 (2015), s. 235-243 ISSN 1802-5439 Institutional support: RVO:67985939 Keywords : halassiosiraceae * taxonomy * valve ultrastructure Subject RIV: EF - Botanics Impact factor: 2.026, year: 2015

  20. 46 CFR 391.0 - Statutory provisions; section 607, Merchant Marine Act, 1936, as amended.

    Science.gov (United States)

    2010-10-01

    ... under section 243 of the Internal Revenue Code of 1954, and (D) Interest income exempt from taxation... for research, development, and design expenses incident to new and advanced ship design, machinery and...

  1. S¯adhan¯a Vol. 32, 2007 Subject Index

    Indian Academy of Sciences (India)

    confined high strength concrete. 243. Control. Laminar separation bubbles: ... Hybrid LES-Review and assessment. 501 ... control. 103. Fatality risk. Prediction of traffic fatalities and prospects for ... treatment furnaces of steel casting industries.

  2. Integration of the information problem-solving skill in an educational programme: The effects of learning with authentic tasks.

    NARCIS (Netherlands)

    Brand-Gruwel, Saskia; Wopereis, Iwan

    2008-01-01

    Brand-Gruwel, S., & Wopereis, I. (2006). Integration of the information problem-solving skill in an educational programme: The effects of learning with authentic tasks. Technology, Instruction, Cognition, and Learning, 4, 243-263.

  3. Mineralogy of halloysites and their interaction with porphyrine

    Czech Academy of Sciences Publication Activity Database

    Vašutová, V.; Bezdička, Petr; Lang, Kamil; Hradil, David

    2013-01-01

    Roč. 57, č. 3 (2013), s. 243-250 ISSN 0862-5468 Institutional support: RVO:61388980 Keywords : organoclays * mineralogy * porphyrine * CEC Subject RIV: CA - Inorganic Chemistry Impact factor: 0.434, year: 2013

  4. Effect of low protein diets and lysine supplementation on growth ...

    African Journals Online (AJOL)

    Dr. Ajit

    2012-07-17

    Jul 17, 2012 ... 3Division of Livestock Product Technology, Indian Veterinary Research Institute, Izatnagar – 243 ... Key words: Carcass trait, low protein, lysine, meat quality, pigs. ... functional activities, reproduction and disease resistance.

  5. Mohelno-Plevovce: Lokalita osídlená v průběhu posledního glaciálního maxima a pozdního glaciálu

    Czech Academy of Sciences Publication Activity Database

    Škrdla, Petr; Rychtaříková, Tereza; Eigner, J.; Bartík, J.; Nikolajev, P.; Vokáč, M.; Nývltová Fišáková, Miriam; Čerevková, A.; Knotková, J.

    2014-01-01

    Roč. 66, č. 2 (2014), s. 243-270 ISSN 0323-1267 Institutional support: RVO:68081758 Keywords : Moravia * Mohelno * MIS-2 * LGM * dwelling * pavement * Epigravettian * Epiaurignacian Subject RIV: AC - Archeology, Anthropology, Ethnology

  6. The pink pigment prodigiosin: Vibrational spectroscopy and DFT calculations

    Czech Academy of Sciences Publication Activity Database

    Jehlička, J.; Němec, I.; Varnali, T.; Culka, A.; Svatoš, A.; Frank, Otakar; Oren, A.; Edwards, G.M.

    2016-01-01

    Roč. 134, NOV 2016 (2016), s. 234-243 ISSN 0143-7208 Institutional support: RVO:61388955 Keywords : prodigiosin * serratia marcescens * raman spectroscopy Subject RIV: CG - Electrochemistry Impact factor: 3.473, year: 2016

  7. Database Description - ClEST | LSDB Archive [Life Science Database Archive metadata

    Lifescience Database Archive (English)

    Full Text Available filiation: National Institute of Advanced Industrial Science and Technology Contact address Symbiotic Evolut...2012 Aug; 47(3):233-243. External Links: Original website information Database maintenance site Symbiotic Ev

  8. Type IIA on a compact Calabi-Yau and D=11 supergravity uplift of its orientifold

    International Nuclear Information System (INIS)

    Misra, A.

    2004-01-01

    Using the prescription of K. Hori and C. Vafa for defining period integrals in the Landau-Ginsburg theory for compact Calabi-Yau's, we obtain the Picard-Fuchs equation and the Meijer basis of solutions for the compact Calabi-Yau CY 3 (3,243) expressed as a degree-24 Fermat hypersurface after resolution of the orbifold singularities. The importance of the method lies in the ease with which one can consider the large and small complex structure limits, as well as the ability to get the ''ln''-terms in the periods without having to parametrically differentiate infinite series. We consider in detail the evaluation of the monodromy matrix in the large and small complex structure limits. We also consider the action of the freely acting antiholomorphic involution on D=11 supergravity compactified on CY 3 (3,243) x S 1 and obtain the Kaehler potential for the same in the limit of large volume of the Calabi-Yau. As a by-product, we also give a conjecture for the action of the orientation-reversing antiholomorphic involution on the periods, given its action on the cohomology, using a canonical (co)homology basis. Finally, we also consider showing a null superpotential on the orientifold of type IIA on CY 3 (3,243), having taken care of the orbifold singularities. (Abstract Copyright [2004], Wiley Periodicals, Inc.)

  9. Taxonomically Different Co-Microsymbionts of a Relict Legume, Oxytropis popoviana, Have Complementary Sets of Symbiotic Genes and Together Increase the Efficiency of Plant Nodulation.

    Science.gov (United States)

    Safronova, Vera I; Belimov, Andrey A; Sazanova, Anna L; Chirak, Elizaveta R; Verkhozina, Alla V; Kuznetsova, Irina G; Andronov, Evgeny E; Puhalsky, Jan V; Tikhonovich, Igor A

    2018-06-20

    Ten rhizobial strains were isolated from root nodules of a relict legume Oxytropis popoviana Peschkova. For identification of the isolates, sequencing of rrs, the internal transcribed spacer region, and housekeeping genes recA, glnII, and rpoB was used. Nine fast-growing isolates were Mesorhizobium-related; eight strains were identified as M. japonicum and one isolate belonged to M. kowhaii. The only slow-growing isolate was identified as a Bradyrhizobium sp. Two strains, M. japonicum Opo-242 and Bradyrhizobium sp. strain Opo-243, were isolated from the same nodule. Symbiotic genes of these isolates were searched throughout the whole-genome sequences. The common nodABC genes and other symbiotic genes required for plant nodulation and nitrogen fixation were present in the isolate Opo-242. Strain Opo-243 did not contain the principal nod, nif, and fix genes; however, five genes (nodP, nodQ, nifL, nolK, and noeL) affecting the specificity of plant-rhizobia interactions but absent in isolate Opo-242 were detected. Strain Opo-243 could not induce nodules but significantly accelerated the root nodule formation after coinoculation with isolate Opo-242. Thus, we demonstrated that taxonomically different strains of the archaic symbiotic system can be co-microsymbionts infecting the same nodule and promoting the nodulation process due to complementary sets of symbiotic genes.

  10. Measurement of MA fission cross sections at YAYOI

    Energy Technology Data Exchange (ETDEWEB)

    Ohkawachi, Yasushi; Ohki, Shigeo; Wakabayashi, Toshio [Power Reactor and Nuclear Fuel Development Corp., Oarai, Ibaraki (Japan). Oarai Engineering Center

    1998-03-01

    Fission cross section ratios of minor actinide nuclides (Am-241, Am-243) relative to U-235 in the fast neutron energy region have been measured using a back-to-back (BTB) fission chamber at YAYOI fast neutron source reactor. A small BTB fission chamber was developed to measure the fission cross section ratios in the center of the core at YAYOI reactor. Dependence of the fission cross section ratios on neutron spectra was investigated by changing the position of the detector in the reactor core. The measurement results were compared with the fission cross sections in the JENDL-3.2, ENDF/B-VI and JEF-2.2 libraries. It was found that calculated values of Am-241 using the JENDL-3.2, ENDF/B-VI and JEF-2.2 data are lower by about 15% than the measured value in the center of the core (the neutron average energy is 1.44E+6(eV)). And, good agreement can be seen the measured value and calculated value of Am-243 using the JENDL-3.2 data in the center of the core (the neutron average energy is 1.44E+6)(eV), but calculated values of Am-243 using the ENDF/B-VI and JEF-2.2 data are lower by 11% and 13% than the measured value. (author)

  11. K některým otázkám etnochoreologického studia: tanec, gender a politika

    Czech Academy of Sciences Publication Activity Database

    Stavělová, Daniela

    2010-01-01

    Roč. 20, č. 4 (2010), s. 239-243 ISSN 0862-8351 Institutional research plan: CEZ:AV0Z90580513 Keywords : dance * gender * politics * national movement * identity Subject RIV: AC - Archeology, Anthropology, Ethnology

  12. Nápěvy písní k tanci "do kolečka"– textová výstavba a deklamace

    Czech Academy of Sciences Publication Activity Database

    Vejvoda, Zdeněk

    2006-01-01

    Roč. 93, č. 3 (2006), s. 243-258 ISSN 0009-0794 Institutional research plan: CEZ:AV0Z90580513 Keywords : round and round * structural analysis * declamation Subject RIV: AC - Archeology, Anthropology, Ethnology

  13. Three new, seemingly-cryptic species in the lichen genus Caloplaca (Teloschistaceae) distinguished in two-phase phenotype evaluation

    Czech Academy of Sciences Publication Activity Database

    Frolov, I.; Vondrák, Jan; Fernández-Mendoza, F.; Wilk, K.; Khodosovtsev, A.; Halici, M.G.

    2016-01-01

    Roč. 53, 3-4 (2016), s. 243-262 ISSN 0003-3847 Institutional support: RVO:67985939 Keywords : phylogenetic analyses * partition schemes * forming ascomycota Subject RIV: EF - Botanics Impact factor: 0.600, year: 2016

  14. Large-scale evaluation of carnivore road mortality: the effect of landscape and local scale characteristics

    Czech Academy of Sciences Publication Activity Database

    Červinka, J.; Riegert, J.; Grill, S.; Šálek, Martin

    2015-01-01

    Roč. 60, č. 3 (2015), s. 233-243 ISSN 2199-2401 Institutional support: RVO:68081766 Keywords : Carnivores * Landscape characteristics * Linear structures * Local characteristics * Road mortality * Temporal pattern Subject RIV: EH - Ecology, Behaviour

  15. Potential emigration of Siberian cattle germplasm on Chirikof Island ...

    Indian Academy of Sciences (India)

    2USDA Agricultural Research Service, 243 Fort Keogh Road, Miles City, MT 59301, USA ... 4Department of Environmental and Biological Sciences, University of ..... Food and. Agriculture Organization of the United Nations, Rome, Italy.

  16. delta-Thiolactones as Prodrugs of Thiol-Based Glutamate Carboxypeptidase II (GCPII) Inhibitors

    Czech Academy of Sciences Publication Activity Database

    Ferraris, D. V.; Majer, Pavel; Ni, C.; Slusher, C. E.; Rais, R.; Wu, Y.; Wozniak, K. M.; Alt, J.; Rojas, C.; Slusher, B. S.; Tsukamoto, T.

    2014-01-01

    Roč. 57, č. 1 (2014), s. 243-247 ISSN 0022-2623 Institutional support: RVO:61388963 Keywords : pharmacokinetics * discovery * disorders * diagnosis * pain Subject RIV: CC - Organic Chemistry Impact factor: 5.447, year: 2014

  17. Ergot alkaloids as chiral selectors in capillary electrophoresis and other electromigration methods

    Czech Academy of Sciences Publication Activity Database

    Sinibaldi, M.; Messina, A.; Stodůlková, Eva; Flieger, Miroslav

    2010-01-01

    Roč. 1, č. 3 (2010), s. 233-243 ISSN 0976-5514 Institutional research plan: CEZ:AV0Z50200510 Keywords : capillary electrophoresis * capillary electrochromatography * chiral analysis Subject RIV: CB - Analytical Chemistry, Separation

  18. Transuranium Processing Plant semiannual report of production, status, and plans for period ending December 31, 1975

    International Nuclear Information System (INIS)

    King, L.J.; Bigelow, J.E.; Collins, E.D.

    1976-10-01

    Between July 1, 1975, and December 31, 1975, maintenance was conducted at TRU for a period of three months, 295 g of curium oxide (enough for approximately 26 HFIR targets) were prepared, 100 mg of high-purity 248 Cm, were separated from 252 Cf that had been purified during earlier periods, 11 HFIR targets were fabricated, and 28 product shipments were made. No changes were made in the chemical processing flowsheets normally used at TRU during this report period. However, three equipment racks were replaced (with two new racks) during this time. In Cubicle 6, the equipment replaced was that used to decontaminate the transplutonium elements from rare earth fission products and to separate curium from the heavier elements by means of the LiCl-based anion-exchange process. In Cubicle 5, the equipment used to separate the transcurium elements by high-pressure ion exchange and to purify berkelium by batch solvent extraction was replaced. Two neutron sources were fabricated, bringing the total fabricated to 79. One source that had been used in a completed project was returned to the TRU inventory and is available for reissue. Three sources, for which no further use was foreseen, were processed to isolate and recover the ingrown 248 Cm and the residual 252 Cf. Eight pellets, each containing 100 μg of high-purity 248 Cm were prepared for irradiation in HFIR to study the production of 250 Cm. The values currently being used for transuranium element decay data and for cross-section data in planning irradiation-processing cycles, calculating production forecasts, and assaying products are tabulated

  19. A new trivalent SnSAG surface antigen chimera for efficient detection of antibodies against Sarcocystis neurona and diagnosis of equine protozoal myeloencephalitis.

    Science.gov (United States)

    Yeargan, Michelle; de Assis Rocha, Izabela; Morrow, Jennifer; Graves, Amy; Reed, Stephen M; Howe, Daniel K

    2015-05-01

    Enzyme-linked immunosorbent assays (ELISAs) based on the SnSAG surface antigens of Sarcocystis neurona provide reliable detection of infection by the parasite. Moreover, accurate serodiagnosis of equine protozoal myeloencephalitis (EPM) is achieved with the SnSAG ELISAs by measuring antibodies in serum and cerebrospinal fluid (CSF) to reveal active infection in the central nervous system. Two independent ELISAs based on recombinant (r)SnSAG2 or a chimeric fusion of SnSAG3 and SnSAG4 (rSnSAG4/3) are currently used together for EPM serodiagnosis to overcome varied antibody responses in different horses. To achieve reliable antibody detection with a single ELISA instead of 2 separate ELISAs, rSnSAG2 was fused with rSnSAG4/3 into a single trivalent protein, designated rSnSAG2/4/3. Paired serum and CSF from 163 horses were tested with all 3 ELISAs. When the consensus antibody titers obtained with the rSnSAG2 and rSnSAG4/3 ELISAs were compared to the single SAG2/4/3 ELISA titers, Spearman rank correlation coefficients of ρ = 0.74 and ρ = 0.90 were obtained for serum and CSF, respectively, indicating strong agreement between the tests. When the rSnSAG2 and rSnSAG4/3 consensus serum-to-CSF titer ratio was compared to the rSnSAG2/4/3 serum-to-CSF titer ratio, the Spearman correlation coefficient was ρ = 0.87, again signifying strong agreement. Importantly, comparing the diagnostic interpretation of the serum-to-CSF titer ratios yielded a Cohen kappa value of 0.77. These findings suggest that the single ELISA based on the trivalent rSnSAG2/4/3 will provide serologic and diagnostic results that are highly comparable to the consensus of the 2 independent ELISAs based on rSnSAG2 and rSnSAG4/3. © 2015 The Author(s).

  20. Protein (Cyanobacteria): 661293060 [PGDBj - Ortholog DB

    Lifescience Database Archive (English)

    Full Text Available :535 ... 7-carboxy-7-deazaguanine synthase, partial Prochlorococcus sp. scB243_498G3 MTNFLPLVEQFHSLQGEGYHAGKSAFFVRLAGCKVGCSWCDTKNS ... WP_029986136.1 NZ_JFMQ01000246 1117:6374 ... 1212:1251 ... 1217:2126 1218:2126 1471492

  1. Improvement of the banana "Musa acuminata" reference sequence using NGS data and semi-automated bioinformatics methods

    Czech Academy of Sciences Publication Activity Database

    Martin, G.; Baurens, F.C.; Droc, G.; Rouard, M.; Cenci, A.; Kilian, A.; Hastie, A.; Doležel, Jaroslav; Aury, J. M.; Alberti, A.; Carreel, F.; D'Hont, A.

    2016-01-01

    Roč. 17, MAR 16 (2016), s. 243 ISSN 1471-2164 Institutional support: RVO:61389030 Keywords : Musa acuminata * Genome assembly * Bioinformatics tool Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 3.729, year: 2016

  2. Rozhovor s prof. RNDr. Pavlem Zemánkem, Ph.D., zástupcem ředitelky Ústavu přístrojové techniky Akademie věd ČR v Brně.

    Czech Academy of Sciences Publication Activity Database

    Číp, Ondřej

    2017-01-01

    Roč. 62, č. 10 (2017), s. 243-244 ISSN 0447-6441 Institutional support: RVO:68081731 Keywords : CAS ISI * optics Subject RIV: BH - Optics, Masers, Lasers OBOR OECD: Optics (including laser optics and quantum optics)

  3. Enhancement of the feeding value of wheat offal for broiler feeding ...

    African Journals Online (AJOL)

    Dr. &Mrs Tunde Lawal

    2012-08-14

    Aug 14, 2012 ... ... Ladoke Akintola University of Science and Technology, Ogbomosho, ... degraded the WTO, it was observed that there was improvement in crude protein value from 2.43 g/100 ..... Principles and Procedures of statistics.

  4. (obese) gene of mithun (Bos frontalis)

    African Journals Online (AJOL)

    Nishant-3

    2Division of Animal Genetics, Indian Veterinary Research Institute, Izatnagar, Bareilly-243 122, India. 3Department of Animal ... closely associated with social, cultural, religious and livelihood of the tribes .... Southeast Asia (Gupta et al., 1999).

  5. Dějiny sahelu pohledem genetické diverzity jeho obyvatel

    Czech Academy of Sciences Publication Activity Database

    Černý, Viktor

    2016-01-01

    Roč. 64, č. 5 (2016), s. 241-243 ISSN 0044-4812 R&D Projects: GA ČR GA13-37998S Institutional support: RVO:67985912 Keywords : genetic diversity * Sahel Subject RIV: AC - Archeology, Anthropology, Ethnology

  6. Arsenic mineralogy of near-neutral soils and mining waste at the Smolotely-Líšnice historical gold district, Czech Republic

    Czech Academy of Sciences Publication Activity Database

    Drahota, P.; Kulakowski, O.; Culka, A.; Knappová, M.; Rohovec, Jan; Veselovský, F.; Racek, M.

    2018-01-01

    Roč. 89, February (2018), s. 243-254 ISSN 0883-2927 Institutional support: RVO:67985831 Keywords : soil * mining waste * pharmacosiderite * yukonite * arseniosiderite Subject RIV: DB - Geology ; Mineralogy OBOR OECD: Mineralogy Impact factor: 2.581, year: 2016

  7. Liquid Phase Isomerisation of Dichlorobenzenes over H-Zeolites

    Czech Academy of Sciences Publication Activity Database

    Kaucký, Dalibor; Fajula, F.; Moreau, P.; Finiels, A.

    2003-01-01

    Roč. 243, - (2003), s. 301-307 ISSN 0926-860X Institutional research plan: CEZ:AV0Z4040901 Keywords : dichlorobenzenes * isomerisation * H-ZSM-5 Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 2.825, year: 2003

  8. 78 FR 3029 - Notice of Lodging of Proposed Amended Consent Decree Under the Comprehensive Environmental...

    Science.gov (United States)

    2013-01-15

    ... (represented by Kenneth Senser as the Executor the Estate of Saul Senser) will pay the United States $243,250... claim, the Estate of Saul Senser, together with Kenneth Senser in his capacity as Executor of the Estate...

  9. Progressive rod-cone degeneration (PRCD) in selected dog breeds and variability in its phenotypic expression

    Czech Academy of Sciences Publication Activity Database

    Dostál, Jaromír; Hrdlicová, Anna; Horák, Pavel

    2011-01-01

    Roč. 56, č. 5 (2011), s. 243-247 ISSN 0375-8427 Institutional research plan: CEZ:AV0Z50450515 Keywords : canine * retinitis pigmentosa * autosomal Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 0.748, year: 2011

  10. ORF Alignment: NC_006395 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_006395 gi|55376664 >1v7zA 1 249 5 243 8e-44 ... ref|YP_134515.1| creatinine amidoh...ydrolase [Haloarcula marismortui ATCC 43049] ... gb|AAV44809.1| creatinine amidohydrolase [Haloarcula

  11. Probing into the diversity of trypanosomatid flagellates parasitizing insect hosts in South-West China reveals both endemism and global dispersal

    Czech Academy of Sciences Publication Activity Database

    Votýpka, Jan; Maslov, D. A.; Yurchenko, V.; Jirků, Milan; Kment, P.; Lun, Z.-R.; Lukeš, Julius

    2010-01-01

    Roč. 54, č. 1 (2010), s. 243-253 ISSN 1055-7903 Institutional research plan: CEZ:AV0Z60220518 Keywords : trypanosomatids * phylogeny * diversity * insects Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 3.889, year: 2010

  12. Clean Hands Count

    Medline Plus

    Full Text Available ... Gorin 243,451 views 2:57 Hand Hygiene Dance - Duration: 3:15. mohd hafiz 34,146 views ... Language: English Location: United States Restricted Mode: Off History Help Loading... Loading... Loading... About Press Copyright Creators ...

  13. The Leucocytozoidae of South African birds. The Coliiformes and ...

    African Journals Online (AJOL)

    1991-12-03

    Dec 3, 1991 ... light staining parasite nucleus, typical of the apicomplexan parasites. In the ..... descriptions of blood parasites made by de Mello and others,. Bhatia took de Mello .... Newfoundland Occasional Papers in Biology No.5. 243 pp.

  14. Production of a square geometry Americium standard source for use with photodiodes

    Energy Technology Data Exchange (ETDEWEB)

    Costa, Priscila; Geraldo, Bianca; Raele, Marcus P.; Marumo, Júlio T.; Vicente, Roberto; Zahn, Guilherme S.; Genezini, Frederico A., E-mail: priscila3.costa@usp.br, E-mail: fredzini@ipen.br [Instituto de Pesquisas Energéticas e Nucleares (IPEN/CNEN-SP), São Paulo, SP (Brazil)

    2017-07-01

    In the development of a thermal neutron detector using a square photodiode and a thin boron film, a radioactive calibration source with the same geometry was needed. An americium-243 standard source was produced by electrodeposition aiming at the calibration of a PIN-type silicon photodiode with a detection area of 10 x 10 mm{sup 2}. To produce the samples two tests were performed. In the first test, a square stainless steel plate (10 x 10 mm{sup 2}) was fixed on the surface of the conventional plate, which was removed after deposition. To reduce the loss of activity of the source, in the second test nail polish was applied on the silver plate leaving only an area of 10 x 10 mm{sup 2} without varnish coating. Once the electrodeposition process was completed, the activity concentration measurement was performed by alpha particle spectrometry. The first method presented a lower activity when compared to the total activity of Am-243 added initially. For the second method, the total activity was concentrate in the exposed square region (without nail polish). The results showed that it is possible to obtain a square geometry source; furthermore, the surrounding nail polish was not contaminated by {sup 243}Am. The comparison of these two approaches indicated that the second method was more efficient as it was possible to concentrate all the americium activity in the delimited square area. (author)

  15. On (orientifold of) type IIA on a compact Calabi-Yau

    International Nuclear Information System (INIS)

    Misra, A.

    2004-01-01

    We study the gauged sigma model and its mirror Landau-Ginsburg model corresponding to type IIA on the Fermat degree-24 hypersurface in WCP 4 [1,1,2,8,12] (whose blow-up gives the smooth CY 3 (3,243)) away from the orbifold singularities, and its orientifold by a freely-acting antiholomorphic involution. We derive the Picard-Fuchs equation obeyed a period integral of a parent N=2 type IIA theory. We obtain the Meijer's basis of solutions to the equation in the large and small complex structure limits (on the mirror Landau-Ginsburg side) of the abovementioned Calabi-Yau, and make some remarks about the monodromy properties associated at the same and another MATHEMATICAlly interesting point. Based on a recently shown N=1 four-dimensional triality between Heterotic on the self-mirror Calabi-Yau CY 3 (11,11), M theory on CY 3 (3,243) x S 1 /(Z 2 ) and F-theory on an elliptically fibered CY 4 with the base given by CP 1 x Enriques surface, we first give a heuristic argument that there can be no superpotential generated in the orientifold of of CY 3 (3,243), and then explicitly verify the same using a mirror symmetry formulation for the abovementioned hypersurface away from its orbifold singularities. We then discuss briefly the sigma model and the mirror Landau-Ginsburg model corresponding to the resolved Calabi-Yau as well. (Abstract Copyright [2004], Wiley Periodicals, Inc.)

  16. The role of the brown adipose tissue in β3-adrenergic receptor activation-induced sleep, metabolic and feeding responses.

    Science.gov (United States)

    Szentirmai, Éva; Kapás, Levente

    2017-04-19

    Brown adipose tissue (BAT) is regulated by the sympathetic nervous system via β3-adrenergic receptors (β3-AR). Here we tested the hypothesis that pharmacological stimulation of β3-ARs leads to increased sleep in mice and if this change is BAT dependent. In wild-type (WT) animals, administration of CL-316,243, a selective β3-AR agonist, induced significant increases in non-rapid-eye movement sleep (NREMS) lasting for 4-10 h. Simultaneously, electroencephalographic slow-wave activity (SWA) was significantly decreased and body temperature was increased with a delay of 5-6 h. In uncoupling protein 1 (UCP-1) knockout mice, the middle and highest doses of the β3-AR agonist increased sleep and suppressed SWA, however, these effects were significantly attenuated and shorter-lasting as compared to WT animals. To determine if somnogenic signals arising from BAT in response to β3-AR stimulation are mediated by the sensory afferents of BAT, we tested the effects of CL-316,243 in mice with the chemical deafferentation of the intra-scapular BAT pads. Sleep responses to CL-316,243 were attenuated by ~50% in intra-BAT capsaicin-treated mice. Present findings indicate that the activation of BAT via β3-AR leads to increased sleep in mice and that this effect is dependent on the presence of UCP-1 protein and sleep responses require the intact sensory innervation of BAT.

  17. A study of thermal reactions of coal with polyamides

    Czech Academy of Sciences Publication Activity Database

    Straka, Pavel; Náhunková, Jana

    2004-01-01

    Roč. 1, č. 2 (2004), s. 239-243 ISSN 1211-1910 R&D Projects: GA AV ČR IAA2046902 Institutional research plan: CEZ:AV0Z3046908 Keywords : coal * kinetics * polyamides Subject RIV: CD - Macromolecular Chemistry

  18. Report on progress of researches by common utilization of JAERI nuclear facilities, for fiscal 1993

    International Nuclear Information System (INIS)

    1994-07-01

    The results of the joint researches by utilizing the facilities of JAERI in 1993 fiscal year were summarized. The number of research themes in 1993 was 228 cases. In this book, 243 reports are collected. (J.P.N.)

  19. How a Sphagnum fuscum-dominated bog changed into a calcareous fen: the unique Holocene history of a Slovak spring-fed mire

    Czech Academy of Sciences Publication Activity Database

    Hájková, Petra; Grootjans, A.B.; Lamentowicz, M.; Rybníčková, E.; Madaras, M.; Opravilová, V.; Michaelis, D.; Hájek, Michal; Joosten, H.; Wolejko, L.

    2012-01-01

    Roč. 27, č. 3 (2012), s. 233-243 ISSN 0267-8179 Institutional research plan: CEZ:AV0Z60050516 Institutional support: RVO:67985939 Keywords : Holocene * succession * mire Subject RIV: EF - Botanics Impact factor: 2.939, year: 2012

  20. Poslední bezručovská publikace Drahomíra Šajtara

    Czech Academy of Sciences Publication Activity Database

    Kosák, Michal; Flaišman, Jiří

    2010-01-01

    Roč. 58, č. 2 (2010), s. 239-243 ISSN 0009-0468 Institutional research plan: CEZ:AV0Z90560517 Keywords : Czech literature * Šajtar, Drahomír * Bezruč, Petr Subject RIV: AJ - Letters, Mass-media, Audiovision

  1. Gas hydrate contribution to Late Permian global warming

    Czech Academy of Sciences Publication Activity Database

    Majorowicz, J.; Grasby, S. E.; Šafanda, Jan; Beauchamp, B.

    2014-01-01

    Roč. 393, May (2014), s. 243-253 ISSN 0012-821X Institutional support: RVO:67985530 Keywords : Latest Permian extinction * gas hydrates * carbon isotope shift Subject RIV: DC - Siesmology, Volcanology, Earth Structure Impact factor: 4.734, year: 2014

  2. Hydrogenation properties and microstructure of Ti-Mn-based alloys for hybrid hydrogen storage vessel

    International Nuclear Information System (INIS)

    Shibuya, Masachika; Nakamura, Jin; Akiba, Etsuo

    2008-01-01

    Ti-Mn-based AB 2 -type alloys which are suitable for a hybrid hydrogen storage vessel have been synthesized and evaluated hydrogenation properties. As the third element V was added to Ti-Mn binary alloys. All the alloys synthesized in this work mainly consist of the C14 Laves and BCC phase. In the case of Ti0.5V0.5Mn alloy, the amounts of hydrogen absorption was 1.8 wt.% at 243 K under the atmosphere of 7 MPa H 2 , and the hydrogen desorption pressure was in the range of 0.2-0.4 MPa at 243 K. The hydrogen capacity of this alloy did not saturate under 7 MPa H 2 and seems to increase with hydrogen pressure up to 35 MPa that is estimated working pressure of the hybrid hydrogen storage vessel

  3. Cervical cancer in South Africa: An over- view of current status and ...

    African Journals Online (AJOL)

    Current estimates are that 493 243 women are diagnosed with cervical cancer per ... estimated that 78 897 women are diagnosed with cervical cancer annually and 61 671 ..... eye aided by a bright light source. ... References. 1. Ferly Bray F ...

  4. Socio-economic demands, ecological conditions and the power of tradition: past woodland management decisions in a Central European landscape

    Czech Academy of Sciences Publication Activity Database

    Szabó, Péter; Hédl, Radim

    2013-01-01

    Roč. 38, č. 2 (2013), s. 243-261 ISSN 0142-6397 R&D Projects: GA AV ČR IAA600050812 Institutional support: RVO:67985939 Keywords : forest * management * decisionmaking Subject RIV: EF - Botanics Impact factor: 0.943, year: 2013

  5. Removing the Historical Town of Most – Technocratic and Humanistic Thought in the Practice of State Socialism

    Czech Academy of Sciences Publication Activity Database

    Spurný, Matěj

    2014-01-01

    Roč. 2, č. 4 (2014), s. 235-243 ISSN 2328-2134 R&D Project s: GA ČR GPP410/12/P596 Institutional support: RVO:68378114 Keywords : environmental history * coal mining * Czech borderlands Subject RIV: AB - History

  6. SAMARU JOURNALx

    African Journals Online (AJOL)

    USER

    poor air circulation, accumulated dust, and insect infestations have all left their .... 14 Rivers State University of Science and Tech., Port Harcourt. 16. 11. 68.8 ... Unauthorized access to information on computer (hacking). 243. 63.1. 142. 36.9.

  7. Potential Navy Force Structure and Shipbuilding Plans: Background and Issues for Congress

    National Research Council Canada - National Science Library

    O'Rourke, Ronald

    2005-01-01

    In February 2005, the Navy testified that the Navy in future years may require a total of 260 to 325 ships, or possibly 243 to 302 ships, depending on how much the Navy uses new technologies and a new...

  8. Production of medically valuable stilbenes and emodin in knotweed

    Czech Academy of Sciences Publication Activity Database

    Frantík, Tomáš; Kovářová, M.; Koblihová, Helena; Bartůňková, Kristýna; Nývltová, Z.; Vosátka, Miroslav

    2013-01-01

    Roč. 50, oct.2013 (2013), s. 237-243 ISSN 0926-6690 R&D Projects: GA MŠk 1M0571 Institutional support: RVO:67985939 Keywords : knokweed * resveratrol * emodin Subject RIV: EF - Botanics Impact factor: 3.208, year: 2013

  9. 43 CFR 30.243 - How will the judge decide my petition for reopening?

    Science.gov (United States)

    2010-10-01

    ... 43 Public Lands: Interior 1 2010-10-01 2010-10-01 false How will the judge decide my petition for... the judge decide my petition for reopening? (a) If the judge finds that proper grounds are not shown, the judge will issue an order denying the petition for reopening and giving the reasons for the denial...

  10. 30 CFR 250.243 - What general information must accompany the DPP or DOCD?

    Science.gov (United States)

    2010-07-01

    ... characteristics of the produced oil (see definition under 30 CFR 254.6) that you will handle or store at the... definition under § 250.200) you will use to carry out your proposed development and production activities. In... that you expect will have the highest volume of liquid hydrocarbons. Include the estimated flow rate...

  11. Jazykový purismus v Čechách a v Lužici v poslední třetině 19. a v první třetině 20. století

    Czech Academy of Sciences Publication Activity Database

    Brankatschk, Katja; Martínek, František; Futtera, Ladislav

    2017-01-01

    Roč. 100, č. 4 (2017), s. 243-257 ISSN 0027-8203 R&D Projects: GA ČR GA16-10866S Institutional support: RVO:68378017 Keywords : Czech * Sorbian * national revival * purism * standardisation Subject RIV: AI - Linguistics OBOR OECD: Specific languages

  12. Attitude toward Christianity and premarital sex.

    Science.gov (United States)

    Francis, Leslie J

    2006-02-01

    A Pearson correlation of .55 was found for a sample of 243 female undergraduates in Wales (M age=20.9 yr., SD=4.6) between high scores on the Francis Scale of Attitude toward Christianity and rejection of premarital sex.

  13. Dicty_cDB: Contig-U10415-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ormation vector pOKE104, com... 243 9e-63 EF106972_17( EF106972 |pid:none) Uncultur...ecName: Full=3-methyl-2-oxobutanoate hydroxymethyltran... 244 4e-63 FJ599664_2( FJ599664 |pid:none) Transf

  14. Lead-free relaxor ferroelectric ceramics in NaNbO.sub.3./sub.-Sr.sub.0.5./sub.NbO.sub.3./sub.-LiNbO.sub.3./sub. solid solution system

    Czech Academy of Sciences Publication Activity Database

    Raevskaya, S. I.; Dellis, J.L.; Reznichenko, L.A.; Prosandeev, S. A.; Raevski, I. P.; Lisitsina, S.O.; Jastrabík, Lubomír

    2005-01-01

    Roč. 317, - (2005), s. 241-243 ISSN 0015-0193 Institutional research plan: CEZ:AV0Z10100522 Keywords : diffuse phase transition * lead-free relaxors * solid solutions Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 0.459, year: 2005

  15. Quantum helimagnetism of the frustrated spin-1/2 chain LiCuVO.sub.4./sub..

    Czech Academy of Sciences Publication Activity Database

    Enderle, M.; Mukherjee, C.; Fak, B.; Kremer, R. K.; Broto, J.-M.; Rosner, H.; Drechsler, S.-L.; Richter, J.; Málek, Jiří; Prokofiev, A.; Assmus, W.; Pujol, S.; Raggazzoni, J.-L.; Rakato, H.; Rheinstädter, M.; Ronnow, H.M.

    2005-01-01

    Roč. 70, č. 2 (2005), s. 237-243 ISSN 0295-5075 Institutional research plan: CEZ:AV0Z10100520 Keywords : inelastic neutron scattering * magnetic quantum helix Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 2.237, year: 2005

  16. Data of evolutionary structure change: 1A9WC-2ZLWD [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1A9WC-2ZLWD 1A9W 2ZLW C D -VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPT...R VQLSGEEKAAVLALWDKVN--EEEVGGEALGRLLVVYPWTQRFFDSFGDLSNPGAVMGNPKVKAHGKKVLHSFGEGVHHLDNLKGTFAALSEL...onfEVID> 1 2ZLW D 2ZLWD... CA 264 LYS CA 243 2ZLW D 2ZLWD DLSNPGAVMGNPKVK HHHH

  17. Shifts in Soil Chemical Properties and Bacterial Communities Responding to Biotransformed Dry Olive Residue Used as Organic Amendment

    Czech Academy of Sciences Publication Activity Database

    Siles, J. A.; Cajthaml, Tomáš; Hernandez, P.; Perez-Mendoza, D.; Garcia-Romera, I.; Sampedro, I.

    2015-01-01

    Roč. 70, č. 1 (2015), s. 231-243 ISSN 0095-3628 R&D Projects: GA TA ČR TE01020218 Institutional support: RVO:61388971 Keywords : Bioremediation * Biotransformation * Mediterranean soil Subject RIV: EE - Microbiology, Virology Impact factor: 3.232, year: 2015

  18. Osseointegration of loaded dental implant with KrF laser hydroxylapatite films on Ti6Al4V alloy by minipigs

    Czech Academy of Sciences Publication Activity Database

    Dostálová, T.; Jelínek, Miroslav; Grivas, C.

    2001-01-01

    Roč. 6, č. 2 (2001), s. 239-243 ISSN 1083-3668 Institutional research plan: CEZ:AV0Z1010914 Keywords : osseointegration * titanium alloy * KrF laser Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 2.292, year: 2001

  19. 'Magic' Configurations of Three-Qubit Observables and Geometric Hyperplanes of the Smallest Split Cayley Hexagon

    Czech Academy of Sciences Publication Activity Database

    Saniga, M.; Planat, M.; Pracna, Petr; Levay, P.

    2012-01-01

    Roč. 8, č. 2012 (2012), 083 ISSN 1815-0659 Institutional support: RVO:61388955 Keywords : 'magic' configurations of observables * three-qubit Pauli group * split Cayley hexagon of order two Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 1.243, year: 2012

  20. Příspěvek k sociální identifikaci středověkých obyvatel Chrudimi na příkladu hřbitova u kostela Nanebevzetí Panny Marie

    Czech Academy of Sciences Publication Activity Database

    Frolík, Jan; Musil, J.

    2016-01-01

    Roč. 41, č. 2 (2016), s. 243-262 ISSN 0231-5823 R&D Projects: GA ČR GB14-36938G Institutional support: RVO:67985912 Keywords : Middle Ages * graveyard * town * Chrudim * eastern Bohemia Subject RIV: AC - Archeology, Anthropology, Ethnology

  1. Doing Good, Feeling Good, and Having More: Resources Mediate the Health Benefits of Altruism Differently for Males and Females with Lumbar Spine Disorders

    NARCIS (Netherlands)

    Schwartz, Carolyn E.; Quaranto, Brian R.; Bode, Rita; Finkelstein, Joel A.; Glazer, Paul A.; Sprangers, Mirjam A. G.

    2012-01-01

    We evaluated whether resources mediate and/or moderate the relationship between altruism and health outcomes in adults with lumbar spine disorders. Hierarchical regression modeling on 243 persons with lumbar spine disorders evaluated gender differences and whether physical, emotional, and economic

  2. Challenges for extension service to render efficient post-transformer ...

    African Journals Online (AJOL)

    Ben Stevens

    (2). 2.4.3 Statistical analysis. Statistical analysis was carried out using the GenStat 14th version for the analysis of variance ..... has an intense interplay with ethylene in ripening peaches. Journal of ... Ornamentals, 5th edition. CAB International ...

  3. Přechylování jmen živočichů

    Czech Academy of Sciences Publication Activity Database

    Albrechtová, Barbora

    2016-01-01

    Roč. 99, č. 5 (2016), s. 243-255 ISSN 0027-8203 R&D Projects: GA MŠk(CZ) LM2010013 Institutional support: RVO:68378092 Keywords : animal names * derivation of gender opposite forms * markedness * word -formation Subject RIV: AI - Linguistics

  4. Novel Basic Mesoporous Catalysts for Friedländer Reaction from 2-Aminoaryl Ketones: Quinolin-2(1H)-ones vs. Quinolines

    Czech Academy of Sciences Publication Activity Database

    Domínguez-Fernández, F.; López-Sanz, J.; Pérez-Mayoral, E.; Bek, David; Martín-Aranda, R. M.; López-Peinado, A. J.; Čejka, Jiří

    2009-01-01

    Roč. 1, č. 2 (2009), s. 241-243 ISSN 1867-3880 R&D Projects: GA AV ČR KAN100400701 Institutional research plan: CEZ:AV0Z40400503 Keywords : quinolines * heterogeneous catalysis * basicity Subject RIV: CF - Physical ; Theoretical Chemistry

  5. Escherichia coli verotoxigênica: isolamento e prevalência em 60 propriedades de bovinos de leite da região de Pelotas, RS, Brasil Verotoxin-producing Escherichia coli: isolation and prevalence in 60 dairy cattle farms from Pelotas-RS, Brazil

    Directory of Open Access Journals (Sweden)

    Cecília Nunes Moreira Sandrini

    2007-02-01

    Full Text Available A produção de verotoxinas foi investigada em 1.127 isolamentos de Escherichia coli feitos a partir de 243 bovinos de leite, de água de consumo humano e animal e de amostras de leite de 60 propriedades da bacia leiteira de Pelotas, no período de dezembro de 1999 a dezembro de 2000, com o objetivo de determinar a prevalência de E. coli verotoxigênicas (VTEC nas propriedades e no rebanho, de detectar a presença de sorotipos ligados a infecções humanas e de identificar, nas propriedades e na região de Pelotas, potenciais fatores de risco de infecção para os animais. A detecção das toxinas em sobrenadante de culturas de E. coli isoladas foi realizada através do ensaio de citotoxicidade em células Vero. VTEC foi isolada em 95% (57/60 das propriedades estudadas, em 49% (119/243 dos animais testados, em 5% (3/60 das amostras de água de consumo humano, em 8,35% (5/60 das amostras de água de consumo animal e em 5% (3/60 das amostras de leite. A prevalência de bovinos infectados em cada propriedade variou de 0 a 100%. Em 2,9% (7/243 dos animais testados, foram isoladas VTEC pertencentes aos sorogrupos O157, O91 e O112, que incluem cepas responsáveis por casos de colite hemorrágica e síndrome urêmica hemolítica em humanos. Fatores de risco de contaminação, como a precipitação pluviométrica, a temperatura, o tamanho da propriedade e a concentração de animais, apresentaram evidências de influenciarem a prevalência de VTEC nos animais. Estes resultados sugerem que o grupo VTEC está amplamente distribuído na bacia leiteira de Pelotas e inclui organismos pertencentes a sorogrupos patogênicos para humanos.The production of verotoxin was investigated in 1127 Escherichia coli isolated from 243 dairy cattle, water for human and animal consumption, and milk samples from 60 dairy farms from Pelotas-Brazil, from December of 1999 to December of 2000, to determine the prevalence of verotoxigenic E. coli (VTEC in farms, to detect the

  6. Competição de clones de mandioquinha-salsa em quatro épocas de colheita Arracacha clones competition at four harvest times

    Directory of Open Access Journals (Sweden)

    Maria José Granate

    2009-12-01

    Full Text Available A redução do tempo de permanência no campo da mandioquinha-salsa é um dos principais objetivos do melhoramento. Foi avaliada a produção de 11 clones além de uma cultivar, colhidos aos 187, 243, 306 e 370 dias após o plantio, em Araponga-MG. Os tratamentos foram arranjados como fatorial 12 x 4, no delineamento de blocos casualizados, com três repetições. Avaliou-se a altura e diâmetro de planta, comprimento da maior raiz, diâmetro da raiz mais longa, diâmetro da raiz mais grossa, produtividade de rebentos, número de rebentos/planta, produtividade da coroa, produtividade da parte aérea e produtividade de raízes comercializáveis e não-comercializáveis. Estimou-se o tempo que cada clone necessita para atingir produtividade de raízes comercializáveis igual à média de Minas Gerais (11 t ha-1. O tempo variou de 243 a 344 dias, sendo que todos os clones tiveram tempo estimado inferior aos 365 dias necessários em campos tradicionais da região. O clone BGH 5742 atingiu 13,46 t ha-1 aos 243 DAP e o menor tempo estimado para atingir a produtividade média de Minas Gerais. Os clones BGH 4550, BGH 5742, BGH 5746, BGH 5747, BGH 6417, BGH 6507, BGH 6521 e BGH 7607 produziram acima da média de Minas Gerais, aos 306 DAP. As correlações genotípicas da característica produtividade de raízes comercializáveis com as outras características foram baixas ou nulas. As correlações ambientais superaram as genotípicas o que evidencia forte influência do ambiente sobre as plantas.A major objective of arracacha breeding programs is to reduce the crop permanence in field. The yield of 11 clones and one cultivar of arracacha was evaluated at 187, 243, 306 and 370 days after planting in Araponga, Minas Gerais State, Brazil. The treatments were arranged in a factorial 12 x 4 scheme in randomized blocks design with three replications. Plant height, plant diameter, length of the longest root, diameter of the longest root, diameter of the

  7. Browse Title Index

    African Journals Online (AJOL)

    Items 51 - 100 of 243 ... Vol 2, No 2 (2017): Series A, Afro-pessimism and globalization: the stakes of ... clay pots “inkono”and “ibibindi” used as food contact materials, Abstract PDF ... Vol 19 (2010): Series B: Social Sciences, Chinese external ...

  8. On the seismic response of instable rock slopes based on ambient vibration recordings

    Czech Academy of Sciences Publication Activity Database

    Kleinbrod, U.; Burjánek, Jan; Fäh, D.

    2017-01-01

    Roč. 69, September (2017), č. článku 126. ISSN 1880-5981 Institutional support: RVO:67985530 Keywords : ambient vibrations * instable rock slopes * site amplification Subject RIV: DC - Siesmology, Volcanology, Earth Structure OBOR OECD: Volcanology Impact factor: 2.243, year: 2016

  9. The Microclimate of a Tropical Evergreen Forest.

    Science.gov (United States)

    1980-08-01

    of Human Bioclimate - A Review. World Meteorological Organization Bulletin, Geneva, 56 pp. REFERENCES (con’t) Lee, R., 1978. Forest Micrometeorology...Geophysics, and Bioclimatology , Ser. B 24, 243-251. Pinker, R. (1980): The Microclimate of a dry tropical forest. (Accepted for publication in

  10. Objekt nejstarších zemědělců z Nových Dvorů 3 podruhé. Výpověď zvířecích kostí a prostorové distribuce artefaktů

    Czech Academy of Sciences Publication Activity Database

    Končelová, Markéta; Kovačiková, L.

    2016-01-01

    Roč. 33, 1-2 (2016), s. 235-243 ISSN 0231-5432 R&D Projects: GA ČR GA15-16963S Institutional support: RVO:67985912 Keywords : Linear Pottery culture (early stage) * animal remains * spatial distribution Subject RIV: AC - Archeology, Anthropology, Ethnology

  11. Analogues of a potent oxytocin antagonist having a ureido group in the amino acid side chain in position 4 or 5

    Czech Academy of Sciences Publication Activity Database

    Flouret, G.; Chaloin, O.; Slaninová, Jiřina

    2004-01-01

    Roč. 10, Supplement (2004), s. 243 ISSN 1075-2617. [International /3./ and European Peptide Symposium /28./. 05.09.2004-10.09.2004, Praha] Institutional research plan: CEZ:AV0Z4055905 Keywords : oxytocin * antagonist * uterus in vitro Subject RIV: CE - Biochemistry

  12. Standardized assessment to enhance the diagnostic value of prostate volume; Part II: Correlation with prostate-specific antigen levels

    NARCIS (Netherlands)

    Aarnink, R. G.; de la Rosette, J. J.; Huynen, A. L.; Giesen, R. J.; Debruyne, F. M.; Wijkstra, H.

    1996-01-01

    Standardized estimations of prostate volumes are used for interpretation of prostate specific antigen (PSA) levels. In 243 patients with clinically benign diagnosis, automated and reference prostate volumes and transition zone volumes are correlated to PSA levels. Besides, growth curves of PSA level

  13. Radiation hardness properties of full-3D active edge silicon sensors

    Czech Academy of Sciences Publication Activity Database

    Da Via, C.; Hasi, J.; Kenney, C.; Linhart, V.; Parker, S.; Slavíček, T.; Watts, S. J.; Bém, Pavel; Horažďovský, T.; Pospíšil, S.

    2008-01-01

    Roč. 587, 2-3 (2008), s. 243-249 ISSN 0168-9002 Institutional research plan: CEZ:AV0Z10480505 Keywords : silicon detectors * radiation hardness * 3D Subject RIV: BG - Nuclear, Atomic and Molecular Physics, Colliders Impact factor: 1.019, year: 2008

  14. On the rank 1 convexity of stored energy functions of physically linear stress-strain relations

    Czech Academy of Sciences Publication Activity Database

    Šilhavý, Miroslav; Bertram, A.; Böhlke, T.

    2007-01-01

    Roč. 86, č. 3 (2007), s. 235-243 ISSN 0374-3535 Institutional research plan: CEZ:AV0Z10190503 Keywords : generalized linear elastic law s * generalized strain measures * rank 1 convexity Subject RIV: BA - General Mathematics Impact factor: 0.743, year: 2007

  15. Binding forms of risk elements in root fractions of Leuzea carthamoides (Willd.)DC

    Czech Academy of Sciences Publication Activity Database

    Pavlík, Milan; Pavlíková, D.; Száková, J.; Vašíčková, Soňa; Tlustoš, P.

    2004-01-01

    Roč. 54, - (2004), s. 239-243 ISSN 0964-8305 R&D Projects: GA MZe QD1256 Institutional research plan: CEZ:AV0Z4055905 Keywords : heavy metals * plant metabolism * therapeutic compounds Subject RIV: CC - Organic Chemistry Impact factor: 0.835, year: 2004

  16. South African red data book - Terrestrial mammals

    CSIR Research Space (South Africa)

    Smithers, RHN

    1986-01-01

    Full Text Available Currently, 243 species of terrestrial wild mammals are known to occur in the Republic of South Africa. Using the well established IUCN definitions, 42 of these may be considered as exposed to some level of threat of extinction. Three species...

  17. Geochemical and palynological sea-level proxies in hemipelagic sediments: A critical assessment from the Upper Cretaceous of the Czech Republic

    Czech Academy of Sciences Publication Activity Database

    Olde, K.; Jarvis, I.; Uličný, David; Pearce, M. A.; Trabucho-Alexandre, J.; Čech, S.; Gröcke, D. R.; Laurin, Jiří; Švábenická, L.; Tocher, B. A.

    2015-01-01

    Roč. 435, October (2015), s. 222-243 ISSN 0031-0182 R&D Projects: GA ČR GAP210/10/1991 Institutional support: RVO:67985530 Keywords : sea - level change * Cretaceous * chemostratigraphy Subject RIV: DB - Geology ; Mineralogy Impact factor: 2.525, year: 2015

  18. Near-infrared spectroscopy used to predict soybean seed germination and vigor

    Science.gov (United States)

    The potential of using near-infrared (NIR) spectroscopy for differentiating levels in germination, vigor, and electrical conductivity of soybean seeds was investigated. For the 243 spectral data collected using the Perten DA7200, stratified sampling was used to obtain three calibration sets consisti...

  19. Decision-Making Styles and Problem-Solving Appraisal.

    Science.gov (United States)

    Phillips, Susan D.; And Others

    1984-01-01

    Compared decision-making style and problem-solving appraisal in 243 undergraduates. Results suggested that individuals who employ rational decision-making strategies approach problematic situations, while individuals who endorse dependent decisional strategies approach problematic situations without confidence in their problem-solving abilities.…

  20. Secondary queens in the parthenogenetic termite Cavitermes tuberosus develop through a transitional helper stage

    Czech Academy of Sciences Publication Activity Database

    Hellemans, S.; Fournier, D.; Hanus, Robert; Roisin, Y.

    2017-01-01

    Roč. 19, č. 6 (2017), s. 253-262 ISSN 1520-541X Institutional support: RVO:61388963 Keywords : facultative parthenogenesis * replacement queens * termites * asexual queen succession * ontogeny * Cavitermes Subject RIV: EG - Zoology OBOR OECD: Developmental biology Impact factor: 2.243, year: 2016

  1. Browse Title Index

    African Journals Online (AJOL)

    Items 1 - 50 of 243 ... Vol 1 (2016): Series D: Special Edition 2, Retracted: Innovative GIS technology ... Vol 2, No 1 (2018): Series D: Special Issue I, A literature review of mammalian ... Vol 22 (2011): Series B: Social Sciences, A socio economic ...

  2. The Implementation of IS on the Knowledge Management and Mental Models at the Decision-Making Process

    Science.gov (United States)

    2011-03-01

    results. Further attention to the use and refinement of fidelity criteria is important to the evaluation practice (Mowbray, Holter, Teague, & Bybee ...C., Teague, G. B., & Bybee , D. (2003). Fidelity Criteria: Development, Measurement, and Validation. American Journal of Evaluation, 24(3), 315–340

  3. Albinismo parcial em cutia Dasyprocta azarae (Lichtenstein, 1823 (Rodentia, Dasyproctidae, no sul do Brasil

    Directory of Open Access Journals (Sweden)

    Stefan Vilges de Oliveira

    2009-06-01

    Full Text Available http://dx.doi.org/10.5007/2175-7925.2009v22n4p243 O presente trabalho registra um caso de albinismo parcial em cutia, Dasyprocta azarae, observado no município de Caçapava do Sul, RS.

  4. 12038_2013_9322_Article_ESM 1..5

    Indian Academy of Sciences (India)

    VERA BUNESOVA, EVA VLKOVA, VOJTECH RADA, JIRI KILLER and VLADIMIR KMET. J. Biosci. 38(2), June 2013, 239-243, © Indian Academy of Sciences. Supplementary material. 1. B. adolescentis isolates: >07_JK1 sequence exported from 07_JK1_G03.ab1.

  5. Zwei Briefromane eines gewitzten böhmischen Frauenzimmers im Reprint: Maria Anna Sagers Beiträge zur frühen Frauenliteratur

    Czech Academy of Sciences Publication Activity Database

    Wögerbauer, Michael

    2015-01-01

    Roč. 39, č. 2 (2015), s. 240-243. ISBN 978-3-8353-16-97-3. ISSN 0722-740X Institutional support: RVO:68378068 Keywords : enlightenment * prose * Sager, Maria Anna * female writer * German literature * Czech literature Subject RIV: AJ - Letters, Mass-media, Audiovision

  6. Actinide production in the reaction of heavy ions with curium-248

    International Nuclear Information System (INIS)

    Moody, K.J.

    1983-07-01

    Chemical experiments were performed to examine the usefulness of heavy ion transfer reactions in producing new, neutron-rich actinide nuclides. A general quasi-elastic to deep-inelastic mechanism is proposed, and the utility of this method as opposed to other methods (e.g. complete fusion) is discussed. The relative merits of various techniques of actinide target synthesis are discussed. A description is given of a target system designed to remove the large amounts of heat generated by the passage of a heavy ion beam through matter, thereby maximizing the beam intensity which can be safely used in an experiment. Also described is a general separation scheme for the actinide elements from protactinium (Z=91) to mendelevium (Z=101), and fast specific procedures for plutonium, americium and berkelium. The cross sections for the production of several nuclides from the bombardment of 248 Cm with 18 O, 86 Kr and 136 Xe projectiles at several energies near and below the Coulomb barrier were determined. The results are compared with yields from 48 Ca and 238 U bombardments of 248 Cm. Simple extrapolation of the product yields into unknown regions of charge and mass indicates that the use of heavy ion transfer reactions to produce new, neutron-rich above-target species is limited. The substantial production of neutron-rich below-target species, however, indicates that with very heavy ions like 136 Xe and 238 U the new species 248 Am, 249 Am and 247 Pu should be produced with large cross sections from a 248 Cm target. A preliminary, unsuccessful attempt to isolate 247 Pu is outlined. The failure is probably due to the half life of the decay, which is calculated to be less than 3 minutes. The absolute gamma ray intensities from 251 Bk decay, necessary for calculating the 251 Bk cross section, are also determined

  7. Minor Actinides Recycling in PWRs

    International Nuclear Information System (INIS)

    Delpech, M.; Golfier, H.; Vasile, A.; Varaine, F.; Boucher, L.; Greneche, D.

    2006-01-01

    Recycling of minor actinides in current and near future PWR is considered as one of the options of the general waste management strategy. This paper presents the analysis of this option both from the core physics and fuel cycle point of view. A first indicator of the efficiency of different neutron spectra for transmutation purposes is the capture to fission cross sections ratio which is less favourable by a factor between 5 to 10 in PWRs compared to fast reactors. Another indicator presented is the production of high ranking isotopes like Curium, Berkelium or Californium in the thermal or epithermal spectrum conditions of PWR cores by successive neutron captures. The impact of the accumulation of this elements on the fabrication process of such PWR fuels strongly penalizes this option. The main constraint on minor actinides loadings in PWR (or fast reactors) fuels are related to their direct impact (or the impact of their transmutation products) on the reactivity coefficients, the reactivity control means and the core kinetics parameters. The main fuel cycle physical parameters like the neutron source, the alpha decay power, the gamma and neutrons dose rate and the criticality aspects are also affected. Recent neutronic calculations based on a reference core of the Evolutionary Pressurized Reactor (EPR), indicates typical maximum values of 1 % loadings. Different fuel design options for minor actinides transmutation purposes in PWRs are presented: UOX and MOX, homogeneous and heterogeneous assemblies. In this later case, Americium loading is concentrated in specific pins of a standard UOX assembly. Recycling of Neptunium in UOX and MOX fuels was also studied to improve the proliferation resistance of the fuel. The impact on the core physics and penalties on Uranium enrichment were underlined in this case. (authors)

  8. Computer aided planning of orthopaedic surgeries: the definition of generic planning steps for bone removal procedures.

    Science.gov (United States)

    Putzer, David; Moctezuma, Jose Luis; Nogler, Michael

    2017-11-01

    An increasing number of orthopaedic surgeons are using computer aided planning tools for bone removal applications. The aim of the study was to consolidate a set of generic functions to be used for a 3D computer assisted planning or simulation. A limited subset of 30 surgical procedures was analyzed and verified in 243 surgical procedures of a surgical atlas. Fourteen generic functions to be used in 3D computer assisted planning and simulations were extracted. Our results showed that the average procedure comprises 14 ± 10 (SD) steps with ten different generic planning steps and four generic bone removal steps. In conclusion, the study shows that with a limited number of 14 planning functions it is possible to perform 243 surgical procedures out of Campbell's Operative Orthopedics atlas. The results may be used as a basis for versatile generic intraoperative planning software.

  9. Simulation benchmark based on THAI-experiment on dissolution of a steam stratification by natural convection

    Energy Technology Data Exchange (ETDEWEB)

    Freitag, M., E-mail: freitag@becker-technologies.com; Schmidt, E.; Gupta, S.; Poss, G.

    2016-04-01

    Highlights: . • We studied the generation and dissolution of steam stratification in natural convection. • We performed a computer code benchmark including blind and open phases. • The dissolution of stratification predicted only qualitatively by LP and CFD models during the blind simulation phase. - Abstract: Locally enriched hydrogen as in stratification may contribute to early containment failure in the course of severe nuclear reactor accidents. During accident sequences steam might accumulate as well to stratifications which can directly influence the distribution and ignitability of hydrogen mixtures in containments. An international code benchmark including Computational Fluid Dynamics (CFD) and Lumped Parameter (LP) codes was conducted in the frame of the German THAI program. Basis for the benchmark was experiment TH24.3 which investigates the dissolution of a steam layer subject to natural convection in the steam-air atmosphere of the THAI vessel. The test provides validation data for the development of CFD and LP models to simulate the atmosphere in the containment of a nuclear reactor installation. In test TH24.3 saturated steam is injected into the upper third of the vessel forming a stratification layer which is then mixed by a superposed thermal convection. In this paper the simulation benchmark will be evaluated in addition to the general discussion about the experimental transient of test TH24.3. Concerning the steam stratification build-up and dilution of the stratification, the numerical programs showed very different results during the blind evaluation phase, but improved noticeable during open simulation phase.

  10. The human dopamine transporter forms a tetramer in the plasma membrane: cross-linking of a cysteine in the fourth transmembrane segment is sensitive to cocaine analogs.

    Science.gov (United States)

    Hastrup, Hanne; Sen, Namita; Javitch, Jonathan A

    2003-11-14

    Using cysteine cross-linking, we demonstrated previously that the dopamine transporter (DAT) is at least a homodimer, with the extracellular end of transmembrane segment (TM) 6 at a symmetrical dimer interface. We have now explored the possibility that DAT exists as a higher order oligomer in the plasma membrane. Cysteine cross-linking of wild type DAT resulted in bands on SDS-PAGE consistent with dimer, trimer, and tetramer, suggesting that DAT forms a tetramer in the plasma membrane. A cysteine-depleted DAT (CD-DAT) into which only Cys243 or Cys306 was reintroduced was cross-linked to dimer, suggesting that these endogenous cysteines in TM4 and TM6, respectively, were cross-linked at a symmetrical dimer interface. Reintroduction of both Cys243 and Cys306 into CD-DAT led to a pattern of cross-linking indistinguishable from that of wild type, with dimer, trimer, and tetramer bands. This indicated that the TM4 interface and the TM6 interface are distinct and further suggested that DAT may exist in the plasma membrane as a dimer of dimers, with two symmetrical homodimer interfaces. The cocaine analog MFZ 2-12 and other DAT inhibitors, including benztropine and mazindol, protected Cys243 against cross-linking. In contrast, two substrates of DAT, dopamine and tyramine, did not significantly impact cross-linking. We propose that the impairment of cross-linking produced by the inhibitors results from a conformational change at the TM4 interface, further demonstrating that these compounds are not neutral blockers but by themselves have effects on the structure of the transporter.

  11. Prevalence and pathogenicity of Cryptosporidium suis in pre- and post-weaned pigs

    Czech Academy of Sciences Publication Activity Database

    Vítovec, J.; Hamadejová, K.; Landová, L.; Kváč, Martin; Květoňová, Dana; Sak, Bohumil

    2006-01-01

    Roč. 53, č. 5 (2006), s. 239-243 ISSN 0931-1793 R&D Projects: GA ČR GA524/05/0992 Institutional research plan: CEZ:AV0Z60220518 Keywords : Cryptosporidium suis * piglets * pathogenicity Subject RIV: EG - Zoology Impact factor: 1.356, year: 2006

  12. Temporal effects on host-parasite associations in four naturalized goby species living in sympatry

    Czech Academy of Sciences Publication Activity Database

    Ondračková, Markéta; Valová, Zdenka; Hudcová, Iveta; Michálková, Veronika; Šimková, A.; Borcherding, J.; Jurajda, Pavel

    2015-01-01

    Roč. 746, č. 1 (2015), s. 233-243 ISSN 0018-8158 R&D Projects: GA ČR(CZ) GAP505/12/2569 Institutional support: RVO:68081766 Keywords : Fish * Gobiidae * Non-native species * Parasite * Rhine Subject RIV: EG - Zoology Impact factor: 2.051, year: 2015

  13. Nigerian Journal of Paediatrics - Vol 41, No 3 (2014)

    African Journals Online (AJOL)

    Mothers' recognition of newborn danger signs and health seeking behaviour · EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. BA Alex-Hart, DA ... DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. AE Amuabunos, CO Eregie, AI Omoigberale, V Effiong, 239-243.

  14. Adsorption of pentane isomers on metal-organic frameworks Cu-BTC and Fe-BTC

    Czech Academy of Sciences Publication Activity Database

    Zukal, Arnošt; Opanasenko, Maksym; Rubeš, M.; Nachtigall, P.; Jagiello, J.

    2015-01-01

    Roč. 243, APR 2014 (2015), s. 69-75 ISSN 0920-5861 R&D Projects: GA ČR GA14-07101S Institutional support: RVO:61388955 Keywords : Cu-BTC * Fe-BTC * adsorption Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 4.312, year: 2015

  15. Curvature-induced bound states in Robin waveguides and their asymptotical properties

    Czech Academy of Sciences Publication Activity Database

    Exner, Pavel; Minakov, A.

    2014-01-01

    Roč. 55, č. 12 (2014), s. 122101 ISSN 0022-2488 R&D Projects: GA ČR(CZ) GA14-06818S Institutional support: RVO:61389005 Keywords : strong delta-interaction * Schrodinger operator * large parameter Subject RIV: BE - Theoretical Physics Impact factor: 1.243, year: 2014

  16. Target acquisition: Human observer performance studies and TARGAC model validation (Final Report)

    NARCIS (Netherlands)

    Valeton, J.M.; Bijl, P.; Gillespie, P.

    1995-01-01

    Human target acquisition performance was studied using the thermal imagery that was collected during Battlefield Emissives Sources Trials under the European Theater Weather and Obscurants, (BEST TWO), organized by NATO AC243/Panel4/RSG.l5 in 1990. Recognition and identification probabilities were

  17. Experimental study on pathogenic potential of six Acanthamoeba strains isolated from fish

    Czech Academy of Sciences Publication Activity Database

    Veverková, Marie; Dyková, Iva; Pecková, Hana

    2002-01-01

    Roč. 49, č. 3 (2002), s. 243-245 ISSN 0015-5683 R&D Projects: GA AV ČR KSK6005114 Institutional research plan: CEZ:AV0Z6022909 Keywords : amoeba * fish * pathology Subject RIV: EA - Cell Biology Impact factor: 0.515, year: 2002

  18. Creating Rich Portraits: A Mixed-Methods Approach to Understanding Profiles of Intrinsic and Extrinsic Motivations

    Science.gov (United States)

    Corpus, Jennifer Henderlong; Wormington, Stephanie V.; Haimovitz, Kyla

    2016-01-01

    A person-centered, mixed-methods approach (self-report surveys, semistructured interviews, school records) was used to characterize and evaluate profiles of intrinsic and extrinsic motivations among 243 third- through eighth-grade students. Cluster analysis suggested four distinct profiles: high quantity (high intrinsic, high extrinsic), primarily…

  19. 76 FR 61057 - Revisions to the California State Implementation Plan, Sacramento Metropolitan Air Quality...

    Science.gov (United States)

    2011-10-03

    ... compound (VOC) emissions from organic chemical manufacturing, soil decontamination, and polyester resin... 74.29 Soil Decontamination Operations 04/08/08 01/10/10 PCAPCD 243 Polyester Resin Operations..... 04....29 establishes procedures for the treatment of soil contaminated with gasoline, diesel fuel or jet...

  20. Bulletin of Materials Science | News

    Indian Academy of Sciences (India)

    pp 235-241 Polymers. Synthesis, mechanical, thermal and chemical properties of ... pp 243-249 Polymers. Terpolymerization of 2-ethoxy ethylmethacrylate, styrene ... showed reduction in g value. pp 251-262 Polymers. Analysis of surface degradation of high density polyethylene (HDPE) insulation material due to tracking.

  1. Technological diffusion in the Ramsey model

    Czech Academy of Sciences Publication Activity Database

    Duczynski, Petr

    2002-01-01

    Roč. 1, č. 3 (2002), s. 243-250 ISSN 1607-0704 Institutional research plan: CEZ:AV0Z7085904 Keywords : neoclassical growth model * technological diffusion Subject RIV: AH - Economics http://www.ijbe.org/table%20of%20content/pdf/vol1-3/06.pdf

  2. Catalytic behavior of metal-organic frameworks and zeolites: Rationalization and comparative analysis

    Czech Academy of Sciences Publication Activity Database

    Opanasenko, Maksym

    2015-01-01

    Roč. 243, APR 2015 (2015), s. 2-9 ISSN 0920-5861 R&D Projects: GA ČR GA14-07101S Institutional support: RVO:61388955 Keywords : Metal -organic frameworks * Zeolites * heterogeneous catalysis Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 4.312, year: 2015

  3. 281 Igbo Symbols: Developing Aesthetic Values on the Igbo Child ...

    African Journals Online (AJOL)

    child has lost the grip of the meaning and value of these symbols. It is difficult for .... language has equally reduced the use of indigenous language (Igbo as the case may .... body of Christ on July22, 1999 as quoted by Nwaorgu (200 1:243).

  4. 78 FR 57156 - General Services Administration Acquisition Regulation; Submission for OMB Review; Modifications...

    Science.gov (United States)

    2013-09-17

    ... GENERAL SERVICES ADMINISTRATION [OMB Control No. 3090-0302; Docket No. 2013-0001; Sequence 9... (GSAR) to add clause 552.243-81 Modifications (Federal Supply Schedule) and an Alternate I version of..., Modifications (Federal Supply Schedule). The alternate version of the clause implements and mandates electronic...

  5. Historické povodně a jejich dokumentace

    Czech Academy of Sciences Publication Activity Database

    Munzar, Jan; Ondráček, Stanislav

    2012-01-01

    Roč. 21, č. 5 (2012), s. 30-32 ISSN 1210-3004 Institutional support: RVO:68145535 Keywords : historical floods * Czech lands * flood documentation Subject RIV: AB - History http:// geography .cz/geograficke-rozhledy/obsah-215-udolni-niva-243/gr-2011-2012-21-5-udolni-niva/

  6. Presence of the KPC carbapenemase gene in Enterobacteriaceae causing bacteremia, and the correlation with in vitro carbapenem susceptibility

    Science.gov (United States)

    During six months, we obtained Enterobacteriaceae isolates from patients with Gram-negative bacteremia at a 1250-bed teaching hospital in St. Louis, Missouri, and compared carbapenem susceptibility with the presence of blaKPC, a transferable carbapenemase gene. Three (1.2%) out of 243 isolates were ...

  7. Enamel paint techniques in archaeology and their identification using XRF and micro-XRF

    Czech Academy of Sciences Publication Activity Database

    Hložek, M.; Trojek, T.; Komoróczy, Balázs; Prokeš, R.

    2017-01-01

    Roč. 137, August (2017), s. 243-247 ISSN 0969-806X R&D Projects: GA ČR(CZ) GA15-20700S Keywords : X-ray fluorescence * Scanning * Enamel * Microanalysis Subject RIV: AC - Archeology, Anthropology, Ethnology OBOR OECD: Archaeology Impact factor: 1.315, year: 2016

  8. Pregnancy Specific Glycoprotein 17 Binds to the Extracellular Loop 2 of its Receptor, CD9, and Induces the Secretion of IL-lO, IL-6, PGE2 and TGFbeta1 in Murine Macrophages

    Science.gov (United States)

    2004-07-09

    produced in CHO cells using standard methodology (Southern Biotec, Birmingham, AL). For immunoblot analysis, the following Abs were employed: anti-myc...Experimental Cell Reserach . 1999. p. 243- 249. 5. Rudert, F., W. Zimmermann, and J.A. Thompson, Intra- and interspecies analyses of the carcinoembryonic

  9. Reactive oxygen species produced by irradiation of some phthalocyanine derivatives

    Czech Academy of Sciences Publication Activity Database

    Černý, J.; Karásková, M.; Rakušan, J.; Nešpůrek, Stanislav

    2010-01-01

    Roč. 210, č. 1 (2010), s. 82-88 ISSN 1010-6030 R&D Projects: GA AV ČR KAN400720701 Institutional research plan: CEZ:AV0Z40500505 Keywords : singlet oxygen * photosensitizer * phthalocyanine Subject RIV: CG - Electrochemistry Impact factor: 2.243, year: 2010

  10. Management of semi-natural grasslands benefiting both planbt and insect diversity: The importance of heterogeneity and tradition

    Czech Academy of Sciences Publication Activity Database

    Bonari, G.; Fajmon, K.; Malenovský, I.; Zelený, D.; Holuša, J.; Jongepierová, I.; Kočárek, P.; Konvička, Ondřej; Uřičář, J.; Chytrý, M.

    2017-01-01

    Roč. 246, AUG 01 (2017), s. 243-252 ISSN 0167-8809 Institutional support: RVO:60077344 Keywords : Carabidae * conservation management * Lepidoptera Subject RIV: EH - Ecology, Behaviour OBOR OECD: Ecology Impact factor: 4.099, year: 2016 http://www.sciencedirect.com/science/article/pii/S0167880917302530

  11. File list: Oth.Dig.05.TEAD4.AllCell [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available Oth.Dig.05.TEAD4.AllCell hg19 TFs and others TEAD4 Digestive tract SRX190228,SRX243...627,SRX243629,SRX360042 http://dbarchive.biosciencedbc.jp/kyushu-u/hg19/assembled/Oth.Dig.05.TEAD4.AllCell.bed ...

  12. Assessment of surface water resources availability using catchment modeling and the results of tracer studies in the meso-scale Migina Catchment, Rwanda

    NARCIS (Netherlands)

    Munyaneza, O.; Mukubwa, A.; Maskey, S.; Wenninger, J.W.; Uhlenbrook, S.

    2013-01-01

    In the last couple of years, different hydrological research projects were undertaken in the Migina catchment (243.2 km2), a tributary of the Kagera river in Southern Rwanda. These projects were aimed to understand hydrological processes of the catchment using analytical and experimental approaches

  13. Sodium and potassium concentrations in floral nectars in relation to ...

    African Journals Online (AJOL)

    1989-08-03

    Aug 3, 1989 ... techniques (Instrumentation Laboratory Model IL 243). In order to examine ... mmol. Potassium and sugar concentrations were very poorly ... cations that the error in calculating its energy content would be .... mellifica adults (subspecies not named). .... consumption, and thoracic temperature during flight in a.

  14. Fulltext PDF

    Indian Academy of Sciences (India)

    4Sfax University, National School of Engineers, 3038 Sfax, Tunisia. MS received 20 ... The magnetic entropy change (| Smax|) takes values 2.46, 2.43, 1.88 and 1.78 J kg−1 K−1 for ..... the tolerance factor of the perovskite, thus implying a more.

  15. The ADOR synthesis of new zeolites: In silico investigation

    Czech Academy of Sciences Publication Activity Database

    Trachta, Michal; Nachtigal, P.; Bludský, Ota

    2015-01-01

    Roč. 243, Apr (2015), s. 32-38 ISSN 0920-5861 R&D Projects: GA ČR GBP106/12/G015 Institutional support: RVO:61388963 Keywords : ADOR * DFT calculations * zeolites * synthesis Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 4.312, year: 2015

  16. Magnetic beads-based electrochemical immunosensor for monitoring allergenic food proteins

    Czech Academy of Sciences Publication Activity Database

    Čadková, M.; Metelka, R.; Holubová, L.; Horák, Daniel; Dvořáková, V.; Bílková, Z.; Korecká, L.

    2015-01-01

    Roč. 484, 1 September (2015), s. 4-8 ISSN 0003-2697 R&D Projects: GA ČR GAP206/12/0381 Institutional support: RVO:61389013 Keywords : electrochemical immunosensor * magnetic particles * ovalbumin Subject RIV: CB - Analytical Chemistry, Separation Impact factor: 2.243, year: 2015

  17. Anharmonic solution of Schrödinger time-independent equation

    Indian Academy of Sciences (India)

    243–261. Anharmonic solution of Schrödinger time-independent equation. MOHAMMED ASHRAFUL ISLAM1,2,∗ and JAMAL NAZRUL ISLAM1. 1Research Centre for Mathematical and Physical Sciences, University of Chittagong, Chittagong,. Bangladesh. 2Department of Mathematics, University of Chittagong, Chittagong, ...

  18. A Longitudinal Study of Total Quality Management Processes in Business Colleges.

    Science.gov (United States)

    Vazzana, Gary; Elfrink, John; Bachmann, Duane P.

    2000-01-01

    Surveys of business school deans in 1995 (n=243) and 1998 (n=151) regarding total quality management (TQM) practices revealed increases in mission and strategy development, goal setting, and use of advisory boards and cross-functional teams. Few are using TQM to manage core learning processes. (SK)

  19. Foreign Ownership of U.S. Financial Assets: Implications of a Withdrawal

    Science.gov (United States)

    2008-01-14

    interest rate derivatives, which are the most widely used hedges against movements in currencies, were valued at $243 trillion in 2006, nearly 60% larger... arbitrage and investment opportunities to acquire assets that investors likely would deem to be temporarily undervalued. As a result, investors likely would

  20. complexes as sensitizers for dye sensitized solar cells

    Indian Academy of Sciences (India)

    Compared to N719, H112 sensitizer showed enhanced molar extinction coefficient and relatively better monochromatic incident photon-to-current conversion efficiency (IPCE) across the spectral range of 400 to 800 nm with solar energy-to-electrical conversion efficiency () of 2.43% [open circuit photovoltage (VOC) ...

  1. An Examination of Multiple Intelligence Domains and Learning Styles of Pre-Service Mathematics Teachers: Their Reflections on Mathematics Education

    Science.gov (United States)

    Ozgen, Kemal; Tataroglu, Berna; Alkan, Huseyin

    2011-01-01

    The present study aims to identify pre-service mathematics teachers' multiple intelligence domains and learning style profiles, and to establish relationships between them. Employing the survey model, the study was conducted with the participation of 243 pre-service mathematics teachers. The study used the "multiple intelligence domains…

  2. Toward understanding of the role of Lewis acidity in aldol condensation of acetone and furfural using MOF and zeolite catalysts

    Czech Academy of Sciences Publication Activity Database

    Kikhtyanin, O.; Kubička, D.; Čejka, Jiří

    2015-01-01

    Roč. 243, APR 2015 (2015), s. 158-162 ISSN 0920-5861 R&D Projects: GA ČR GBP106/12/G015 Institutional support: RVO:61388955 Keywords : metal organic framework * aldol condensation * acidic catalysis Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 4.312, year: 2015

  3. Organic carbon in the sediments of Mandovi estuary, Goa

    Digital Repository Service at National Institute of Oceanography (India)

    Alagarsamy, R.

    Total organic carbon (TOC) in surficial sediments in Mandovi Estuary, Goa, India varies widely from 0.1 to 3% (av. 1.05%). Highest values of TOC (2.4-3%) lie close to the mouth region and indicate no definite trend in its variation in the estuarine...

  4. The Use of Models: experience and prospects,

    NARCIS (Netherlands)

    J. Tinbergen (Jan)

    1981-01-01

    textabstractLecture to the Memory of Alfred Nobel, Oslo, December 12, 1969. Originally published in: Les Prix Nobel en 1969, The Nobel Foundation, Stockholm, 1970, pp. 243-252. Also published in: Assar Lindbeck (Ed.), Nobel Lectures in Economic Sciences 1969-1980 Vol. 1, World Scientific, Singapore,

  5. Scattering through a straight quantum waveguide with combined boundary conditions

    Czech Academy of Sciences Publication Activity Database

    Briet, Ph.; Dittrich, Jaroslav; Soccorsi, E.

    2014-01-01

    Roč. 55, č. 11 (2014), s. 112104 ISSN 0022-2488 R&D Projects: GA ČR(CZ) GA14-06818S Institutional support: RVO:61389005 Keywords : quantum waveguide * scattering * Dirichlet boundary condition * Neumann boundary condition Subject RIV: BE - Theoretical Physics Impact factor: 1.243, year: 2014

  6. Some Empirical Dimensions of Countertrade

    OpenAIRE

    Jean-Francois Hennart

    1990-01-01

    This paper discusses some of the recent theories of why countries impose countertrade obligations and compares some of the implications of these theories with data obtained from a comprehensive database of countertrade transactions.© 1990 JIBS. Journal of International Business Studies (1990) 21, 243–270

  7. Crosstalk-Managed Heterogeneous Single-Mode 32-Core Fibre

    DEFF Research Database (Denmark)

    Sasaki, Y.; Fukumoto, Ryohei; Takenaga, Katsuhiro

    2016-01-01

    A heterogeneous single-mode 32-core fibre with a cladding diameter of 243 micrometer is designed and fabricated. The highest core count in single-mode multi-core fibres and low worst-case crosstalk of less than -24 dB/1000 km in C-band are achieved simultaneously....

  8. Pramana – Journal of Physics | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Volume 82 Issue 2 February 2014 pp 243-248 Contributed Papers. Versatile laser microfabrication techniques for lab-on-chip devices in general and uranium analysis in particular ... 82 Issue 2 February 2014 pp 433-437 Contributed Papers. Manipulation of microparticles and red blood cells using optoelectronic tweezers.

  9. New cytotoxic butyltin complexes with 2-sulfobenzoic acid: Molecular interaction with lipid bilayers and DNA as well as in vitro anticancer activity

    Czech Academy of Sciences Publication Activity Database

    Pruchnik, H.; Kral, Teresa; Poradowski, D.; Drynda, A.; Obmińska-Mrukowicz, B.; Hof, Martin

    2016-01-01

    Roč. 243, JAN 2016 (2016), s. 107-118 ISSN 0009-2797 R&D Projects: GA ČR GBP208/12/G016 Institutional support: RVO:61388955 Keywords : Butyltin 2-sulfobenzoates * Antitumor activity * Lipid bilayer Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 3.143, year: 2016

  10. Journal of Chemical Sciences | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    ... interactions, leading to the supramolecular organisation of the rings into a spiral-like of chain. Volume 119 Issue 3 May 2007 pp 243-252. Synthesis, spectroscopy and supramolecular structures of two magnesium 4-nitrobenzoate complexes · Bikshandarkoil R Srinivasan Jyoti V Sawant Christian Näther Wolfgang Bensch.

  11. Self-consistent simulation of plasma scenarios for ITER using a combination of 1.5D transport codes and free-boundary equilibrium codes

    Czech Academy of Sciences Publication Activity Database

    Parail, V.; Albanese, R.; Ambrosino, R.; Artaud, J.F.; Besseghir, K.; Cavinato, M.; Corrigan, G.; Garcia, J.; Garzotti, L.; Gribov, Y.; Imbeaux, F.; Koechl, F.; Labate, C.V.; Lister, J.; Litaudon, X.; Loarte, A.; Maget, P.; Mattei, M.; McDonald, D.; Nardon, E.; Saibene, G.; Sartori, R.; Urban, Jakub

    2013-01-01

    Roč. 53, č. 11 (2013), s. 113002-113002 ISSN 0029-5515 Institutional support: RVO:61389021 Keywords : operation * regimes * model * JET * ITER * plasma Subject RIV: BL - Plasma and Gas Discharge Physics Impact factor: 3.243, year: 2013 http://iopscience.iop.org/0029-5515/53/11/113002/

  12. Electronic structure and optical properties of thorium monopnictides

    Indian Academy of Sciences (India)

    Unknown

    Indian Academy of Sciences. 165. Electronic structure and optical properties of thorium monopnictides. S KUMAR* and S AULUCK†. Physics Department, Institute of Engineering and Technology, M.J.P. Rohilkhand University, Bareilly 243 006,. India. †Department of Physics, Indian Institute of Technology, Roorkee 247 667, ...

  13. 75 FR 11834 - Submission for OMB Review; Comment Request

    Science.gov (United States)

    2010-03-12

    ... for animal disease spread models. Without this type of data, the ability to detect trends in..., veterinary, and industry reference; (2) Predict or detect national trends in disease emergence and movement.... Description of Respondents: Business or other for-profit. Number of Respondents: 22,243. Frequency of...

  14. Does information about patients who are intellectually disabled translate into better cooperation during dental visits?

    NARCIS (Netherlands)

    Meurs, D.; Rutten, M.; de Jongh, A.

    2010-01-01

    The objective of this study was to investigate whether having background information about a patient with an intellectual disability (ID) would have a positive effect on the level of cooperation during a first dental visit. Study participants were 57 consecutive dental patients (mean age = 24.3

  15. Epoxidation of bulky organic molecules over pillared titanosilicates

    Czech Academy of Sciences Publication Activity Database

    Přech, Jan; Eliášová, Pavla; Aldhayan, D.; Kubů, Martin

    2015-01-01

    Roč. 243, APR 2014 (2015), s. 134-140 ISSN 0920-5861 R&D Projects: GA ČR GBP106/12/G015 Institutional support: RVO:61388955 Keywords : Cyclooctene * Epoxidation * Layered TS-1 zeolite Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 4.312, year: 2015

  16. Remarkable catalytic properties of hierarchical zeolite-Beta in epoxide rearrangement reactions

    Czech Academy of Sciences Publication Activity Database

    García-Munoz, J.L.; Serrano, D. P.; Vicente, G.; Linares, M.; Vitvarová, Dana; Čejka, Jiří

    2015-01-01

    Roč. 243, APR 2015 (2015), s. 141-152 ISSN 0920-5861 R&D Projects: GA ČR GBP106/12/G015 Institutional support: RVO:61388955 Keywords : hierarchical zeolites * zeolite beta * hybridzeolitic - mesostructured materials Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 4.312, year: 2015

  17. Genome-wide association analysis identifies 13 new risk loci for schizophrenia

    NARCIS (Netherlands)

    Ripke, S.; O'Dushlaine, C.; Chambert, K.; Moran, J.L.; Kähler, A.K.; Akterin, S.; Bergen, S.E.; Collins, A.L.; Crowley, J.J.; Fromer, M.; Kim, Y.; Lee, S.H.; Magnusson, P.K.; Sanchez, N.; Stahl, E.A.; Williams, S.; Wray, N.R.; Xia, K.; Bettella, F.; Borglum, A. D.; Bulik-Sullivan, B.K.; Cormican, P.; Craddock, N.; de Leeuw, C.A.; Durmishi, N.; Gill, M.; Golimbet, V.; Hamshere, M.L.; Holmans, P.; Hougaard, D. M.; Kendler, K.S.; Lin, K.; Morris, D. W.; Mors, O.; Mortensen, P.B.; Neale, B. M.; O'Neill, F. A.; Owen, M.J.; Milovancevic, M.P.; Posthuma, D.; Powell, J.; Richards, A.L.; Riley, B.P.; Ruderfer, D.; Rujescu, D.; Sigurdsson, E.; Silagadze, T.; Smit, A.B.; Stefansson, H.; Steinberg, S.; Suvisaari, J.; Tosato, S.; Verhage, M.; Walters, T.J.; Levinson, D.F.; Gejman, P.V.; Laurent, C.; Mowry, B. J.; O'Donovan, M.C.; Pulver, A. E.; Schwab, S.G.; Wildenauer, D. B.; Dudbridge, F.; Shi, J.; Albus, M.; Alexander, M.; Campion, D.; Cohen, D.; Dikeos, D.; Duan, J.; Eichhammer, P.; Godard, S.; Hansen, M.; Lerer, F.B.; Liang, K.Y.; Maier, W.; Mallet, J.; Nertney, D. A.; Nestadt, G.; Norton, N.; O'Neill, F.A.; Papadimitriou, G.N.; Ribble, R.; Sanders, A.R.; Silverman, J.M.; Wormley, B.; Arranz, M.J.; Bakker, S.; Bender, S.; Bramon, E.; Collier, D.; Crespo-Facorro, B.; Hall, J.; Iyegbe, C.; Jablensky, A.; Kahn, R.S.; Kalaydjieva, L.; Lawrie, S.M.; Lewis, C.M.; Linszen, D.H.; Mata, I.; McIntosh, A.; Murray, R.M.; Ophoff, R.A.; van Os, J.; Walshe, M.; Weisbrod, M.; Wiersma, D.; Donnely, P.; Barasso, I.; Blackwell, J.M.; Brown, M.A.; Casas, J.P.; Corvin, A.P.; Deloukas, P.; Duncanson, A.; Jankowski, J.; Markus, H.S.; Mathew, C.G.; Palmer, C.N.; Plomin, R.; Rautanen, A.; Sawcer, S.J.; Trembath, R.C.; Viswanathan, A.C.; Wood, N.W.; Spencer, C. C.; Band, G.; Bellenguez, C.; Freeman, C.; Hellenthal, G.; Giannoulatou, E.; Pirinen, M.; Pearson, R.D.; Strange, A.; Su, Z.; Vukcevic, D.; Langford, C.; Hunt, S.E.; Edkins, S.; Gwilliam, R.; Blackburn, H.; Bumpstead, S.; Dronov, S.; Gillman, M.; Gray, E.; Hammond, N.; Jayakumar, A.; McCann, O.T.; Liddle, J.; Potter, S.C.; Ravindrarajah, R.; Ricketts, M.; Tashakkori-Ghanbaria, A.; Waller, M.J.; Weston, P.; Widaa, S.; Whittaker, P.; Barrroso, I.; McCarthy, M.I.; Spencer, C.C.; Stefansson, K.; Scolnick, E.; Purcell, S.; McCarroll, S.A.; Sklar, P.; Hultman, C. M.; Sullivan, P.F.

    2013-01-01

    Schizophrenia is an idiopathic mental disorder with a heritable component and a substantial public health impact. We conducted a multi-stage genome-wide association study (GWAS) for schizophrenia beginning with a Swedish national sample (5,001 cases and 6,243 controls) followed by meta-Analysis with

  18. Journal of Astrophysics and Astronomy | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    2016-01-27

    Jan 27, 2016 ... Home; Journals; Journal of Astrophysics and Astronomy. NAGENDRA KUMAR. Articles written in Journal of Astrophysics and Astronomy. Volume 29 Issue 1-2 March-June 2008 pp 243-248. Damping of Slow Magnetoacoustic Waves in an Inhomogeneous Coronal Plasma · Nagendra Kumar Pradeep ...

  19. Corrosion properties of plasma deposited high-alloy steel

    Czech Academy of Sciences Publication Activity Database

    Voleník, Karel; Pražák, M.; Kalabisová, E.; Kreislová, K.; Neufuss, Karel

    2002-01-01

    Roč. 47, - (2002), s. 243-254 ISSN 0001-7043 R&D Projects: GA ČR GA106/99/0298 Institutional research plan: CEZ:AV0Z2043910 Keywords : plasma deposits, high-alloy steel, polarization curves, corrosion test Subject RIV: BL - Plasma and Gas Discharge Physics

  20. Elemental mapping in fossil tooth root section of Ursus arctos by laser ablation inductively coupled plasma mass spectrometry (LA-ICP-MS)

    Czech Academy of Sciences Publication Activity Database

    Vašinová Galiová, M.; Nývltová Fišáková, Miriam; Kynický, J.; Prokeš, L.; Neff, H.; Mason, A. Z.; Gadas, P.; Košler, J.; Kanický, V.

    2013-01-01

    Roč. 105, 15 February 2013 (2013), s. 235-243 ISSN 0039-9140 Institutional research plan: CEZ:AV0Z80010507 Institutional support: RVO:68081758 Keywords : Diagenesis * Diet * Geochemical analysis * Laser ablation ICP-MS * Migration Subject RIV: AC - Archeology, Anthropology, Ethnology Impact factor: 3.511, year: 2013

  1. Identification of bifidobacteria isolated from Asian elephant (Elephas maximus)

    Czech Academy of Sciences Publication Activity Database

    Bunešová, V.; Vlková, E.; Rada, V.; Killer, Jiří; Kmeť, V.

    2013-01-01

    Roč. 38, č. 2 (2013), s. 239-243 ISSN 0250-5991 R&D Projects: GA ČR GA523/08/1091 Institutional support: RVO:67985904 Keywords : 16S rRNA genes sequencing * bifidobacteria * Elephas maximus Subject RIV: EE - Microbiology, Virology Impact factor: 1.939, year: 2013

  2. Categorizing moving objects into film genres: The effect of animacy attribution, emotional response, and the deviation from non-fiction

    NARCIS (Netherlands)

    Visch, V.T.; Tan, E.S.

    2009-01-01

    The reported study follows the footsteps of Heider, and Simmel (1944) [Heider, F., & Simmel, M. (1944). An experimental study of apparent behavior. American Journal of Psychology, 57, 243-249] and Michotte (1946/1963) [Michotte, A. (1963). The perception of causality (T.R. Miles & E. Miles, Trans.).

  3. Understanding Tobacco-Related Attitudes among College and Noncollege Young Adult Hookah and Cigarette Users

    Science.gov (United States)

    Lee, Youn Ok; Bahreinifar, Sareh; Ling, Pamela M.

    2014-01-01

    Objective: To examine differences in tobacco-related attitudes and hookah and cigarette use among college and noncollege young adults. Participants: Time-location samples of young adult bar patrons in San Diego, California ("N" = 2,243), Tulsa ("N" = 2,095) and Oklahoma City ("N" = 2,200), Oklahoma, Albuquerque…

  4. Two new hexacoordinated coordination polymers of cadmium(II ...

    Indian Academy of Sciences (India)

    cadmium(II) in 2 in a non-ended fashion affording a 3D network structure. In the crystalline state, each ..... Light brown DMF solutions of free bnzd, 1 and 2 show strong absorption at 253, ... 972; (b) Steel P J 2005 Acc. Chem. Res. 38 243; (c).

  5. Genome-wide association analysis identifies 13 new risk loci for schizophrenia

    NARCIS (Netherlands)

    Ripke, Stephan; O'Dushlaine, Colm; Chambert, Kimberly; Moran, Jennifer L.; Kähler, Anna K.; Akterin, Susanne; Bergen, Sarah E.; Collins, Ann L.; Crowley, James J.; Fromer, Menachem; Kim, Yunjung; Lee, Sang Hong; Magnusson, Patrik K. E.; Sanchez, Nick; Stahl, Eli A.; Williams, Stephanie; Wray, Naomi R.; Xia, Kai; Bettella, Francesco; Borglum, Anders D.; Bulik-Sullivan, Brendan K.; Cormican, Paul; Craddock, Nick; de Leeuw, Christiaan; Durmishi, Naser; Gill, Michael; Golimbet, Vera; Hamshere, Marian L.; Holmans, Peter; Hougaard, David M.; Kendler, Kenneth S.; Lin, Kuang; Morris, Derek W.; Mors, Ole; Mortensen, Preben B.; Neale, Benjamin M.; O'Neill, Francis A.; Owen, Michael J.; Milovancevic, Milica Pejovic; Posthuma, Danielle; Powell, John; Richards, Alexander L.; Riley, Brien P.; Ruderfer, Douglas; Rujescu, Dan; Sigurdsson, Engilbert; Silagadze, Teimuraz; Smit, August B.; Stefansson, Hreinn; Steinberg, Stacy; Suvisaari, Jaana; Tosato, Sarah; Verhage, Matthijs; Walters, James T.; Levinson, Douglas F.; Gejman, Pablo V.; Laurent, Claudine; Mowry, Bryan J.; O'Donovan, Michael C.; Pulver, Ann E.; Schwab, Sibylle G.; Wildenauer, Dieter B.; Dudbridge, Frank; Shi, Jianxin; Albus, Margot; Alexander, Madeline; Campion, Dominique; Cohen, David; Dikeos, Dimitris; Duan, Jubao; Eichhammer, Peter; Godard, Stephanie; Hansen, Mark; Lerer, F. Bernard; Liang, Kung-Yee; Maier, Wolfgang; Mallet, Jacques; Nertney, Deborah A.; Nestadt, Gerald; Norton, Nadine; Papadimitriou, George N.; Ribble, Robert; Sanders, Alan R.; Silverman, Jeremy M.; Walsh, Dermot; Williams, Nigel M.; Wormley, Brandon; Arranz, Maria J.; Bakker, Steven; Bender, Stephan; Bramon, Elvira; Collier, David; Crespo-Facorro, Benedicto; Hall, Jeremy; Iyegbe, Conrad; Jablensky, Assen; Kahn, Rene S.; Kalaydjieva, Luba; Lawrie, Stephen; Lewis, Cathryn M.; Linszen, Don H.; Mata, Ignacio; McIntosh, Andrew; Murray, Robin M.; Ophoff, Roel A.; van Os, Jim; Walshe, Muriel; Weisbrod, Matthias; Wiersma, Durk; Donnelly, Peter; Barroso, Ines; Blackwell, Jenefer M.; Brown, Matthew A.; Casas, Juan P.; Corvin, Aiden P.; Deloukas, Panos; Duncanson, Audrey; Jankowski, Janusz; Markus, Hugh S.; Mathew, Christopher G.; Palmer, Colin N. A.; Plomin, Robert; Rautanen, Anna; Sawcer, Stephen J.; Trembath, Richard C.; Viswanathan, Ananth C.; Wood, Nicholas W.; Spencer, Chris C. A.; Band, Gavin; Bellenguez, Céline; Freeman, Colin; Hellenthal, Garrett; Giannoulatou, Eleni; Pirinen, Matti; Pearson, Richard D.; Strange, Amy; Su, Zhan; Vukcevic, Damjan; Langford, Cordelia; Hunt, Sarah E.; Edkins, Sarah; Gwilliam, Rhian; Blackburn, Hannah; Bumpstead, Suzannah J.; Dronov, Serge; Gillman, Matthew; Gray, Emma; Hammond, Naomi; Jayakumar, Alagurevathi; McCann, Owen T.; Liddle, Jennifer; Potter, Simon C.; Ravindrarajah, Radhi; Ricketts, Michelle; Tashakkori-Ghanbaria, Avazeh; Waller, Matthew J.; Weston, Paul; Widaa, Sara; Whittaker, Pamela; McCarthy, Mark I.; Stefansson, Kari; Scolnick, Edward; Purcell, Shaun; McCarroll, Steven A.; Sklar, Pamela; Hultman, Christina M.; Sullivan, Patrick F.

    2013-01-01

    Schizophrenia is an idiopathic mental disorder with a heritable component and a substantial public health impact. We conducted a multi-stage genome-wide association study (GWAS) for schizophrenia beginning with a Swedish national sample (5,001 cases and 6,243 controls) followed by meta-analysis with

  6. Data of evolutionary structure change: 1PVDA-1ZPDB [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1PVDA-1ZPDB 1PVD 1ZPD A B SEITLGKYLFERLKQVNVNTVFGLPGDFNLSLLDKIYEV...>GLU CA 220 ALA CA 223 SER CA 273 1PVD... A 1PVDA AKLLQTPIDMSLKPN ...A 187 GLU CA 243 LEU CA 296 LYS CA 223 1PVD... A 1PVDA AKGYKPVAV

  7. Spirituality of American and Czech students – a cross-cultural comparison

    Czech Academy of Sciences Publication Activity Database

    Říčan, Pavel; Lukavský, Jiří; Janošová, Pavlína; Štochl, J.

    2010-01-01

    Roč. 52, č. 3 (2010), s. 243-251 ISSN 0039-3320 R&D Projects: GA AV ČR IAA700250801 Institutional research plan: CEZ:AV0Z70250504 Keywords : spirituality * measurement * factor analysis * cross - cultural differences Subject RIV: AN - Psychology Impact factor: 0.254, year: 2010

  8. Comparison of soil nematode communities in three forest types on sand and clay coal-mining dumps in Germany and Czech Republic

    Czech Academy of Sciences Publication Activity Database

    Háněl, Ladislav

    2003-01-01

    Roč. 40, č. 4 (2003), s. 237-243 ISSN 0440-6605 R&D Projects: GA ČR GA526/01/1055 Institutional research plan: CEZ:AV0Z6066911 Keywords : Nematoda * diversity * trophic groups Subject RIV: EH - Ecology, Behaviour Impact factor: 0.474, year: 2003

  9. 75 FR 1041 - Office of Safe and Drug-Free Schools; Overview Information; Grants for the Integration of Schools...

    Science.gov (United States)

    2010-01-08

    ... Infrastructure Grants (MHTSIG) program (CFDA 93.243), if a grantee's State receives a MHTSIG award. If a... an award are the equitable distribution of grants among the geographical regions of the United States... prevention, diagnosis, and treatment services to students. (2) Enhancing the availability of crisis...

  10. Using Paraffin PCM, Cryogel and TEC to Maintain Comet Surface Sample Cold from Earth Approach Through Retrieval

    Science.gov (United States)

    Choi, Michael K.

    2017-01-01

    An innovative thermal design concept to maintain comet surface samples cold (for example, 263 degrees Kelvin, 243 degrees Kelvin or 223 degrees Kelvin) from Earth approach through retrieval is presented. It uses paraffin phase change material (PCM), Cryogel insulation and thermoelectric cooler (TEC), which are commercially available.

  11. Learning Environments as Basis for Cognitive Achievements of Students in Basic Science Classrooms in Nigeria

    Science.gov (United States)

    Atomatofa, Rachel; Okoye, Nnamdi; Igwebuike, Thomas

    2016-01-01

    The nature of classroom learning environments created by teachers had been considered very important for learning to take place effectively. This study investigated the effect of creating constructivist and transmissive learning environments on achievements of science students of different ability levels. 243 students formed the entire study…

  12. Thrombophilia prevalence among women with placenta-mediated pregnancy complications

    DEFF Research Database (Denmark)

    Gils, Charlotte; Nybo, Mads

    2016-01-01

    in the present retrospective study. Data collected from patient medical records included the type of PMPC, history of previous thrombosis, and arterial thrombosis risk factors. RESULTS: A total of 103 patients were included in the study; 25 (24.3%) were diagnosed with thrombophilia. Among the study population...

  13. Redescription of Parapharyngodon micipsae (Seurat 1917) (Nematoda Pharyngodonidae) from the new host Tarentola parvicarinata Joger 1980 (Squamata Gekkonidae)

    Czech Academy of Sciences Publication Activity Database

    Mašová, Š.; Baruš, Vlastimil; Hodová, I.; Koubek, Petr; Koubková, B.

    2009-01-01

    Roč. 22, č. 2 (2009), s. 243-255 ISSN 0394-6975 R&D Projects: GA AV ČR IAA6093404 Institutional research plan: CEZ:AV0Z60930519 Keywords : parasite * Nematoda * gecko * Senegal * West Africa Subject RIV: EG - Zoology Impact factor: 0.706, year: 2009

  14. Alcohol consumption in the rural population of Misungwi subdistrict in Mwanza Region, Tanzania

    NARCIS (Netherlands)

    Rijken, T; Velema, JP; Dijkstra, R

    Objective: This study was undertaken to investigate the frequency and quantity of alcohol consumption in four villages on the southern shores of Lake Victoria, Tanzania. Method: Study participants were 148 men and 162 women selected by cluster sampling from the population (N = 9,243) of four

  15. Associations of alcohol consumption with clinical and MRI measures in multiple sclerosis

    NARCIS (Netherlands)

    D'hooghe, Marie B.; De Keyser, Jacques

    Evaluation of: Foster M, Zivadinov R, Weinstock-Guttman B et al. Associations of alcohol consumption with clinical and MRI measures in multiple sclerosis. J. Neuroimmunol. 243(1-2), 61-68 (2012). While the harmful effects of alcohol abuse are well documented, experimental and clinical data support a

  16. Investigation of neutron resonances of 247Cm in the 0.5-20 eV energy range

    International Nuclear Information System (INIS)

    Belanova, T.S.; Kolesov, A.G.; Klinov, A.V.; Nikol'skij, S.N.; Poruchikov, V.A.; Nefedov, V.N.; Artamonov, V.S.; Ivanov, R.N.; Kalebin, S.M.

    1979-01-01

    The neutron resonance parameters of 247 Cm were calculated from the transmission of a curium sample measured by the time-of-flight method. The neutron resonance parameters were calculated by the shape method using the single-level Breit-Wigner formula. Since the neutron resonance parameters of 244 Cm, 245 Cm, 246 Cm, 248 Cm, 243 Am and 240 Pu are well known, it was possible to identify the neutron resonances of 247 Cm from the measured transmission and calculate their parameters. We identified only five neutron resonances of 247 Cm with high values of 2gGAMMAsub(n). This is due to the fact that the 247 Cm content of the sample is low (1.7mg) and the resonances of this isotope are identified against the background of a large number of resonances of 244 Cm, 245 Cm, 246 Cm, 248 Cm, 243 Am and 240 Pu situated in the energy range in question

  17. Isolation, characterization, and mapping of gene encoding dihydrolipoyl succinyltransferase (E2k) of human [alpha]-ketoglutarate dehydrogenase complex

    Energy Technology Data Exchange (ETDEWEB)

    Ali, G.; Cai, Xingang; Sheu, Kwan-Fu R.; Blass, J.P. (Cornell Univ. Medical College, White Plains, NY (United States)); Wasco, W.; Gaston, S.M.; Tanzi, R.E.; Cooper, A.J.L.; Gusella, J.F. (Massachusetts General Hospital, Charleston, MA (United States)); Szabo, P. (Cornell Univ. Medical College, New York, NY (United States))

    1994-03-01

    The authors have isolated and sequenced cDNAs representing the full-length (2987-bp) gene for dihydrolipoyl succinyltransferase (E2k component) of the human [alpha]-ketoglutarate dehydrogenase complex (KHDHC) from a human fetal brain cDNA library. The E2k cDNA was mapped to human chromosome 14 using a somatic cell hybrid panel, and more precisely to band 14q24.3 by in situ hybridization. This cDNA also cross-hybridized to an apparent E2k pseudogene on chromosome 1p31. Northern analysis revealed the E2k gene to be ubiquitously expressed in peripheral tissues and brain. Interestingly, chromosome 14q24.3 has recently been reported to contain gene defects for an early-onset form of familial Alzheimer's disease and for Machado-Joseph disease. Future studies will be necessary to determine whether the E2K gene plays a role in either of these two disorders.

  18. Gamma ray dosage and mutation breeding in St. Augustinegrass

    International Nuclear Information System (INIS)

    Busey, P.

    1980-01-01

    Stolon pieces of St. Augustinegrass [Stenotaphrum secundatum (Walt.) Kuntze] were irradiated with gamma rays in an attempt to cause mutations. A practical dosage for most genotypes was 4,500 rads. This dosage caused considerable (50%) growth retardation and a mean survival of about 40% of single-node cuttings. However, Bitterblue and another accession were entirely killed at 4,000 rads. At 4,500 rads, up to 7% recognizable mutants of accession FA-243 were obtained. This proportion resulted when irradiated cuttings were propagated clonally and observed for 1.5 years in replicated microplots. In addition to morphological variants, a chimeral anthocyanin change was noticed. From this chimera arose a stable genotype with green stolons and white stigmas, whereas the source genotype (FA-243) had red stolons and purple stigmas. Associated reduction in fertility from 56 to 0.6% suggested that the mutation arose as a small chromosome deletion. Mutation breeding is effective in improving St. Augustinegrass when easily recognizable variants are needed

  19. Role of plasma neuropeptide Y in patients with different thyroid functional status

    International Nuclear Information System (INIS)

    Zhong Chongming

    2004-01-01

    Objective: To investigate the plasma neuropeptide Y levels in patients with different thyroid functional status (hypo, hyperthyroidism as well as euthyroid status). Methods: Plasma neuropeptide Y levels in 55 hyperthyroid patients, 47 hypothyroid patients and 57 euthyroid controls were measured with radioimmunoassay. Results: Plasma neuropeptide Y levels in hyperthyroid patients (71.5 ± 14.7) ng/L, were significantly higher than those in controls (71.5 ± 14.7) ng/L, (0.001< P<0.05). Plasma neuropeptide Y levels in hypothyroid patients (42.2 ± 24.3) ng/L were lower than those in controls (71.5 ± 14.7) ng/L, were significantly higher than those in hypothyroid patients (42.2 ± 24.3) ng/L; Plasma neuropeptide Y levels were negatively correlated with leptin levels in all samples (r=-0.58, P=0.015). Conclusion: Both neuropeptide Y and thyroid hormones were important factors of energy metabolism and they might work together to maintain encrgy balance. (authors)

  20. Thermophysical properties of lignocellulose: a cell-scale study down to 41 K.

    Science.gov (United States)

    Cheng, Zhe; Xu, Zaoli; Zhang, Lei; Wang, Xinwei

    2014-01-01

    Thermal energy transport is of great importance in lignocellulose pyrolysis for biofuels. The thermophysical properties of lignocellulose significantly affect the overall properties of bio-composites and the related thermal transport. In this work, cell-scale lignocellulose (mono-layer plant cells) is prepared to characterize their thermal properties from room temperature down to ∼ 40 K. The thermal conductivities of cell-scale lignocellulose along different directions show a little anisotropy due to the cell structure anisotropy. It is found that with temperature going down, the volumetric specific heat of the lignocellulose shows a slower decreasing trend against temperature than microcrystalline cellulose, and its value is always higher than that of microcrystalline cellulose. The thermal conductivity of lignocellulose decreases with temperature from 243 K to 317 K due to increasing phonon-phonon scatterings. From 41 K to 243 K, the thermal conductivity rises with temperature and its change mainly depends on the heat capacity's change.

  1. Thermophysical properties of lignocellulose: a cell-scale study down to 41 K.

    Directory of Open Access Journals (Sweden)

    Zhe Cheng

    Full Text Available Thermal energy transport is of great importance in lignocellulose pyrolysis for biofuels. The thermophysical properties of lignocellulose significantly affect the overall properties of bio-composites and the related thermal transport. In this work, cell-scale lignocellulose (mono-layer plant cells is prepared to characterize their thermal properties from room temperature down to ∼ 40 K. The thermal conductivities of cell-scale lignocellulose along different directions show a little anisotropy due to the cell structure anisotropy. It is found that with temperature going down, the volumetric specific heat of the lignocellulose shows a slower decreasing trend against temperature than microcrystalline cellulose, and its value is always higher than that of microcrystalline cellulose. The thermal conductivity of lignocellulose decreases with temperature from 243 K to 317 K due to increasing phonon-phonon scatterings. From 41 K to 243 K, the thermal conductivity rises with temperature and its change mainly depends on the heat capacity's change.

  2. A preliminary X-ray study of d,d-heptose-1,7-bisphosphate phosphatase from Burkholderia thailandensis E264

    International Nuclear Information System (INIS)

    Kim, Mi-Sun; Shin, Dong Hae

    2010-01-01

    In this study, d,d-heptose-1,7-bisphosphate phosphatase has been cloned, expressed, purified and crystallized. d,d-Heptose-1,7-bisphosphate phosphatase (GmhB), which is involved in the third step of the NDP-heptose biosynthesis pathway, converts d,d-heptose-1,7-bisphosphate to d,d-heptose-1-phosphate. This biosynthesis pathway is a target for new antibiotics or antibiotic adjuvants for Gram-negative pathogens. Burkholderia thailandensis is a useful surrogate organism for studying the pathogenicity of melioidosis owing to its extensive genomic similarity to B. pseudomallei. Melioidosis caused by B. pseudomallei is a serious invasive disease of animals and humans in tropical and subtropical areas. In this study, GmhB has been cloned, expressed, purified and crystallized. X-ray data have also been collected to 2.50 Å resolution using synchrotron radiation. The crystal belonged to space group P6, with unit-cell parameters a = 243.2, b = 243.2, c = 41.1 Å

  3. Electrochemical oxidation of 243Am(III) in nitric acid by a terpyridyl-derivatized electrode

    Energy Technology Data Exchange (ETDEWEB)

    Dares, C. J.; Lapides, A. M.; Mincher, B. J.; Meyer, T. J.

    2015-11-05

    A high surface area, tin-doped indium oxide electrode surface-derivatized with a terpyridine ligand has been applied to the oxidation of trivalent americium to Am(V) and Am(VI) in nitric acid. Potentials as low as 1.8 V vs. the saturated calomel electrode are used, 0.7 V lower than the 2.6 V potential for one-electron oxidation of Am(III) to Am(IV) in 1 M acid. This simple electrochemical procedure provides, for the first time, a method for accessing the higher oxidation states of Am in non-complexing media for developing the coordination chemistries of Am(V) and Am(VI) and, more importantly, for separation of americium from nuclear waste streams.

  4. Time-dependent mechanical characteristics measured through the use of a microindentation technique

    Czech Academy of Sciences Publication Activity Database

    Minster, Jiří; Bláhová, O.; Lukeš, J.; Němeček, J.

    2010-01-01

    Roč. 14, č. 3 (2010), s. 243-251 ISSN 1385-2000 R&D Projects: GA AV ČR(CZ) IAA200710801 Institutional research plan: CEZ:AV0Z20710524 Keywords : materials testing * microindentation * viscoelastic compliance * relaxation modulus Subject RIV: JI - Composite Materials Impact factor: 0.955, year: 2010

  5. 76 FR 72225 - Proposed Collection; Comment Request

    Science.gov (United States)

    2011-11-22

    .... Independent public accountants must verify the fund's assets at least three times a year and two of the... independent public accountants when they perform verifications of fund assets.\\4\\ Approximately 243 funds rely... hours per fund) x $165 (fund senior accountant's hourly rate) = $82.50. \\3\\ Respondents estimated that...

  6. Journal of Chemical Sciences | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    ... conversion of 2-pyrido[1,2-]pyrimidine-2,4(3)-dione (1) to chalcones (2) and their 1,3-dipolar cycloaddition with appropriate aldoximes to give spiro compounds and heterocyclization using amines to yield isoxazolines and pyrazolines. All the compounds were screened for their antimicrobial and antitubercular activity.

  7. Untitled

    Indian Academy of Sciences (India)

    . Steudel H. 1977 Ann, Phys. 34 188 1971 - . Zakharov V E and Shabat A B 1971 Z. Exsp. Thor, Fiz. 61 118. Zakharov V E and Manakov S W 1973 Soy. Phys. JETP Lett. 18 243. Zakharov V E and Manakov S W 1976 Soy. Phys, JETP 42 842.

  8. 76 FR 40118 - Spring 2011 Regulatory Agenda

    Science.gov (United States)

    2011-07-07

    ... way the economy, a sector of the economy, productivity, competition, jobs, the environment, [email protected] . Steve Fruh, Environmental Protection Agency, Air and Radiation, D243-02, RTP, NC 27711, Phone: 919 541-2837, Fax: 919 541-3207, E-mail: fruh.steve@epa.gov . RIN: 2060-AP69 271...

  9. 77 FR 8004 - Fall 2011 Regulatory Agenda

    Science.gov (United States)

    2012-02-13

    ... economy, a sector of the economy, productivity, competition, jobs, the environment, public health or... . Steve Fruh, Environmental Protection Agency, Air and Radiation, D243-02, Research Triangle Park, NC 27711, Phone: 919 541-2837, Fax: 919 541-4991, Email: fruh.steve@epa.gov . RIN: 2060-AP69 ENVIRONMENTAL...

  10. Estimating trematode prevalence in snail hosts using a single-step duplex PCR: how badly does cercarial shedding underestimate infection rates?

    Czech Academy of Sciences Publication Activity Database

    Born-Torrijos, A.; Poulin, R.; Raga, J. A.; Holzer, Astrid S.

    2014-01-01

    Roč. 7, MAY 2014 (2014), s. 243 ISSN 1756-3305 R&D Projects: GA ČR GBP505/12/G112 Institutional support: RVO:60077344 Keywords : prevalence * detection * snail host * double infection * single-steo duplex PCR Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 3.430, year: 2014

  11. Druhé vydání náměšťské mluvnice (1543) znovu nalezeno: podnět k úvahám o hláskosloví, typografii a ediční technice

    Czech Academy of Sciences Publication Activity Database

    Koupil, Ondřej

    2016-01-01

    Roč. 64, č. 2 (2016), s. 243-266 ISSN 0009-0468 R&D Projects: GA MK(CZ) DF12P01OVV028 Keywords : Czech grammar * 16th century * Beneš Optát * Petr Gzell * Václav Philomathes * Jan Blahoslav Subject RIV: AI - Linguistics OBOR OECD: Linguistics

  12. Ce(III) and Lu(III) metal-organic frameworks with Lewis acid metal sites: Preparation, sorption properties and catalytic activity in Knoevenagel condensation

    Czech Academy of Sciences Publication Activity Database

    Almáši, M.; Zeleňák, V.; Opanasenko, Maksym; Císařová, I.

    2015-01-01

    Roč. 243, APR 2015 (2015), s. 184-194 ISSN 0920-5861 R&D Projects: GA ČR GA14-07101S Institutional support: RVO:61388955 Keywords : cerium(III) * lutetium(III) * Benzene-1,3,5-tricarboxylate Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 4.312, year: 2015

  13. Naturally irradiated fluorite as a historic violet pigment: Raman spectroscopic and X-ray diffraction study

    Czech Academy of Sciences Publication Activity Database

    Čermáková, Zdeňka; Bezdička, Petr; Němec, I.; Hradilová, J.; Šrein, V.; Blažek, Jan; Hradil, David

    2015-01-01

    Roč. 46, č. 2 (2015), s. 236-243 ISSN 0377-0486 R&D Projects: GA ČR GAP103/12/2211 Institutional support: RVO:61388980 ; RVO:67985556 Keywords : fluorite * pigment * fluorescence bands * diffraction lines broadening * irradiation Subject RIV: CA - Inorganic Chemistry Impact factor: 2.395, year: 2015

  14. Investigating the phenology of seaward migration of juvenile brown trout (Salmo trutta) in two European populations

    DEFF Research Database (Denmark)

    Winter, E R.; Tummers, J. S.; Aarestrup, Kim

    2016-01-01

    , evidence that spring migrants were of better condition, travelled faster (autumn: 11.0 km day-1; spring: 24.3 km day-1) and were more likely to leave the Deerness suggests that autumn and spring migrant conspecifics respond to different behavioural motivations. Further investigation into the sex of autumn...

  15. 75 FR 71677 - Reimbursement for Costs of Remedial Action at Active Uranium and Thorium Processing Sites

    Science.gov (United States)

    2010-11-24

    ... DEPARTMENT OF ENERGY Reimbursement for Costs of Remedial Action at Active Uranium and Thorium... in FY 2011 from eligible active uranium and thorium processing site licensees for reimbursement under... approximately $24.3 million of Recovery Act funds available for reimbursement in FY 2011, as well as the $10...

  16. 26 CFR 1.535-3 - Accumulated earnings credit.

    Science.gov (United States)

    2010-04-01

    ....535-3 Internal Revenue INTERNAL REVENUE SERVICE, DEPARTMENT OF THE TREASURY (CONTINUED) INCOME TAX (CONTINUED) INCOME TAXES (CONTINUED) Corporations Used to Avoid Income Tax on Shareholders § 1.535-3... section 243(b)) and sections 1561, 1562, and 1564 (relating to limitations on certain tax benefits in the...

  17. Consequences of Parental Divorce and Marital Unhappiness for Adult Well-Being.

    Science.gov (United States)

    Amato, Paul R.; Booth, Alan

    1991-01-01

    Among 1,243 adults nationwide, individuals who experienced parental divorce as children scored lower than those from happily intact families of origin on measures of psychological, social, and marital well-being. Multiple parental divorces and divorces involving deterioration of parent-child relations appeared particularly problematic. Contains 39…

  18. An introductory study of subterranean communities of invertebrates in forested talus habitats in southern Slovakia

    Czech Academy of Sciences Publication Activity Database

    Mock, A.; Šašková, T.; Raschmanová, N.; Jászay, T.; Luptáčik, P.; Rendoš, M.; Tajovský, Karel; Jászayová, A.

    2015-01-01

    Roč. 79, č. 3 (2015), s. 243-256 ISSN 1211-376X R&D Projects: GA MŠk(CZ) 7AMB12SK189 Institutional support: RVO:60077344 Keywords : invertebrates * forested talus * vertical distribution * Cerová vrchovina Mts * Revúcka vrchovina Mts Subject RIV: EH - Ecology, Behaviour

  19. Efficacy of nebulized furosemide in children with moderate attack of ...

    African Journals Online (AJOL)

    Efficacy of nebulized furosemide in children with moderate attack of asthma. M Alshehri, T Almegamesi, A Alfrayh. Abstract. No Abstract. West African Journal of Medicine Vol. 24(3) 2005: 246-251. Full Text: EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT · DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT.

  20. Spindle trees (Euonymus japonica Thunb.) growing in a polluted environment are less sensitive to gamma irradiation

    Czech Academy of Sciences Publication Activity Database

    Kim, J. K.; Cha, M.; Mukherjee, A.; Wilhelmová, Naděžda

    2013-01-01

    Roč. 11, č. 4 (2013), s. 233-243 ISSN 2322-3243 Institutional research plan: CEZ:AV0Z50380511 Keywords : Spindle tree * oxidative stress * ionizing radiation Subject RIV: EF - Botanics http://www.ijrr.com/browse.php?a_code=A-10-1-478&slc_lang=en&sid=1

  1. Correction: Whiley, H., et al. Detection of Legionella, L. pneumophila and Mycobacterium Avium Complex (MAC along Potable Water Distribution Pipelines. Int. J. Environ. Res. Public Health 2014, 11, 7393–7405

    Directory of Open Access Journals (Sweden)

    Harriet Whiley

    2014-11-01

    Full Text Available The authors wish to add the following amendments and corrections to their paper published in IJERPH [1].Page 7398, Table 1: The average water temperature measured in summer is 24.3 °C not 4.3 °C. The correct Table 1 should therefore be: [...

  2. 78 FR 23763 - Sunshine Act Meeting; Open Commission Meeting; Thursday, April 18, 2013

    Science.gov (United States)

    2013-04-22

    ... Providers (WC Docket No. 07-243); Telephone Number Portability (CC Docket No. 95- 116); Development a...); Numbering Resource Optimization (CC Docket No. 99-200); Petition of Vonage Holdings Corp. for Limited Waiver of Section 52.15(g)(2)(i) of the Commission's Rules Regarding Access to Numbering Resources; Petition...

  3. 78 FR 14764 - Agency Information Collection Activities; Proposed Collection; Comment Request: Report of...

    Science.gov (United States)

    2013-03-07

    ... DEPARTMENT OF AGRICULTURE Food and Nutrition Service Agency Information Collection Activities..., Food and Nutrition Service, U.S. Department of Agriculture, 3101 Park Center Drive, Room 640... Nutrition Act of 1966, as amended (42 U.S.C. 1771, et seq.). Section 243(c) of Public Law 106-224, the...

  4. Effect of the growth retardant Cycocel® in controlling the growth of ...

    African Journals Online (AJOL)

    STORAGESEVER

    2010-07-19

    Jul 19, 2010 ... Hydroponic culture of Gladiolus tristis: Application of paclobutrazol for flowering and height control. Afr. J. Biotechnol. 7(3): 239-243. Ninnemann H, Zeevaart JAD, Kende H, Lang A (1964). The plant growth retardant CCC as an inhibitor of gibberellin biosynthesis in. Fusarium moniliforme. Planta (Bert.) ...

  5. Soldier Decision-Making for Allocation of Intelligence, Surveillance, and Reconnaissance Assets

    Science.gov (United States)

    2014-06-01

    Judgments; also called Algoritmic or Statistical Judgements Computer Science , Psychology, and Statistics Actuarial or algorithmic...Jan. 2011. [17] R. M. Dawes, D. Faust, and P. E. Meehl, “Clinical versus Actuarial Judgment,” Science , vol. 243, no. 4899, pp. 1668–1674, 1989. [18...School of Computer Science

  6. Search for WZ resonances in the fully leptonic channel using pp collisions at √s = 8 TeV with the ATLAS detector

    Czech Academy of Sciences Publication Activity Database

    Aad, G.; Abbott, B.; Abdallah, J.; Böhm, Jan; Chudoba, Jiří; Havránek, Miroslav; Hejbal, Jiří; Jakoubek, Tomáš; Kepka, Oldřich; Kupčo, Alexander; Kůs, Vlastimil; Lokajíček, Miloš; Lysák, Roman; Marčišovský, Michal; Mikeštíková, Marcela; Myška, Miroslav; Němeček, Stanislav; Šícho, Petr; Staroba, Pavel; Svatoš, Michal; Taševský, Marek; Vrba, Václav

    2014-01-01

    Roč. 737, Oct (2014), s. 223-243 ISSN 0370-2693 R&D Projects: GA MŠk(CZ) LG13009 Institutional support: RVO:68378271 Keywords : scattering * W' * model * ATLAS * CERN LHC Coll * triplet Subject RIV: BF - Elementary Particles and High Energy Physics Impact factor: 6.131, year: 2014

  7. Reference: 163 [Arabidopsis Phenome Database[Archive

    Lifescience Database Archive (English)

    Full Text Available 163 http://metadb.riken.jp/db/SciNetS_ria224i/cria224u4ria224u15660207i Kanter Ulr...saccharides. 2 243-54 15660207 2005 May Planta Guerineau Fran巽ois|Kanter Ulrike|Li Yong|Pauly Markus|Tenhaken Raimund|Usadel Bj旦rn

  8. 75 FR 76987 - Agency Information Collection Activities: Submission for OMB Review; Comment Request

    Science.gov (United States)

    2010-12-10

    ... office or Medicare carrier. Frequency: Reporting--On occasion; Affected Public: State, Local, or Tribal Government, Business or other-for-profit, Not-for-profit institutions; Number of Respondents: 1,048,243... Strategic Operations and Regulatory Affairs. [FR Doc. 2010-31075 Filed 12-9-10; 8:45 am] BILLING CODE 4120...

  9. Hoeffding’s Inequality for Sums of Dependent Random Variables

    Czech Academy of Sciences Publication Activity Database

    Pelekis, Christos; Ramon, J.

    2017-01-01

    Roč. 14, č. 6 (2017), č. článku 243. ISSN 1660-5446 Institutional support: RVO:67985807 Keywords : dependent random variables * Hoeffding’s inequality * k-wise independent random variables * martingale differences Subject RIV: BA - General Mathematics OBOR OECD: Pure mathematics Impact factor: 0.868, year: 2016

  10. Non-cirrhotic portal hypertension entity in South Africa? anew

    African Journals Online (AJOL)

    1991-03-02

    Mar 2, 1991 ... SCT, 0. 19. Patent s = splenomegaly and/or hepatosplenomegaly; SCT = splenectomy; ova ~ oesophageal variceal bleeding;. P = pancytopaenia; 0 = other (diabetes. chronic pancreat~is). 94 - 400. GGT. 0-50. 36 - 130. 128 - 243. 47 - 218 000. 1,2 - 1,9. TABLE 11. COAGULATION AND LIVER FUNCTION ...

  11. C S Sanmathi

    Indian Academy of Sciences (India)

    Home; Journals; Bulletin of Materials Science. C S Sanmathi. Articles written in Bulletin of Materials Science. Volume 27 Issue 3 June 2004 pp 243-249 Polymers. Terpolymerization of 2-ethoxy ethylmethacrylate, styrene and maleic anhydride: determination of the reactivity ratios · C S Sanmathi S Prasannakumar B S ...

  12. Downscaling of humidity variables: a search for suitable predictors and predictands

    Czech Academy of Sciences Publication Activity Database

    Huth, Radan

    2005-01-01

    Roč. 25, č. 2 (2005), s. 243-250 ISSN 0899-8418 R&D Projects: GA ČR GA205/02/0871 Institutional research plan: CEZ:AV0Z30420517 Keywords : statistical downscaling * atmospheric humidity * Czech Republic Subject RIV: DG - Athmosphere Sciences, Meteorology Impact factor: 1.622, year: 2005

  13. Estimated Effects of Retirement Revision on Retention of Navy Tactical Pilots.

    Science.gov (United States)

    1986-12-01

    detailed explanation of the procedure and proofs can be found in Hanushek and Jackson [Ref. 441. S511 ,V. 󈧈 VI. RESULTS AND ANALYSIS A. DESCRIPTIVE...Introduction to Econometrics, pp. 242-243, Prentice-Hall, 1978. 44. Hanushek Eric ard Jackson, John, Statistical .Mlethods for Social Scientists, p. S188

  14. Country Image and Brand Perception of Hybrid Products from Emerging Economies

    DEFF Research Database (Denmark)

    Iacob, Andrea Ioana

    in the evaluation of unknown brand. Data were collected using a questionnaire that was administered to 243 students at Aalborg University. The results show that the student respondents do find the country of origins important when forming their brand perception or assessing the product; and they also ranked...

  15. Behavioural lateralization and shoaling cohesion of fish larvae altered under ocean acidification

    Czech Academy of Sciences Publication Activity Database

    Lopes, A. F.; Morais, Pedro Miguel; Pimentel, M.; Rosa, R.

    2016-01-01

    Roč. 163, č. 12 (2016), č. článku 243. ISSN 0025-3162 Institutional support: RVO:68081766 Keywords : tropical marine fish * elevated CO2 * Coryphaena hippurus * schooling behavior * Carbonic acid * reef fishes * brain * performance * asymmetry * water Subject RIV: EG - Zoology Impact factor: 2.136, year: 2016

  16. Data of evolutionary structure change: 1BS5A-3CPMA [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1BS5A-3CPMA 1BS5 3CPM A A -----SVLQVLHIPDERLRKVAKPVEEVNAEIQRIVDDM...line> 3CPM A 3CPMA THR CA 218 GLY CA 252 ILE CA 234 3CPM... A 3CPMA IKKYSDKLVPFILE CA 320 ARG CA 317 GLN CA 243 3CPM

  17. Occurrence of refeeding syndrome in adults started on artificial nutrition support: prospective cohort study.

    Science.gov (United States)

    Rio, Alan; Whelan, Kevin; Goff, Louise; Reidlinger, Dianne Patricia; Smeeton, Nigel

    2013-01-11

    Refeeding syndrome is a potentially life-threatening condition characterised by severe intracellular electrolyte shifts, acute circulatory fluid overload and organ failure. The initial symptoms are non-specific but early clinical features are severely low-serum electrolyte concentrations of potassium, phosphate or magnesium. Risk factors for the syndrome include starvation, chronic alcoholism, anorexia nervosa and surgical interventions that require lengthy periods of fasting. The causes of the refeeding syndrome are excess or unbalanced enteral, parenteral or oral nutritional intake. Prevention of the syndrome includes identification of individuals at risk, controlled hypocaloric nutritional intake and supplementary electrolyte replacement. To determine the occurrence of refeeding syndrome in adults commenced on artificial nutrition support. Prospective cohort study. Large, single site university teaching hospital. Recruitment period 2007-2009. 243 adults started on artificial nutrition support for the first time during that admission recruited from wards and intensive care. occurrence of the refeeding syndrome. Secondary outcome: analysis of the risk factors which predict the refeeding syndrome. Tertiary outcome: mortality due to refeeding syndrome and all-cause mortality. 133 participants had one or more of the following risk factors: body mass index 15% in the preceding 3-6 months, very little or no nutritional intake >10 days, history of alcohol or drug abuse and low baseline levels of serum potassium, phosphate or magnesium prior to recruitment. Poor nutritional intake for more than 10 days, weight loss >15% prior to recruitment and low-serum magnesium level at baseline predicted the refeeding syndrome with a sensitivity of 66.7%: specificity was >80% apart from weight loss of >15% which was 59.1%. Baseline low-serum magnesium was an independent predictor of the refeeding syndrome (p=0.021). Three participants (2% 3/243) developed severe electrolyte shifts

  18. Relationships among Shyness, Social Competence, Peer Relations, and Theory of Mind among Pre-Adolescents

    Science.gov (United States)

    Kokkinos, Constantinos M.; Kakarani, Styliani; Kolovou, Demetra

    2016-01-01

    The present study examined the relationships between shyness, a number of personal and interpersonal variables (i.e. social skills, self-esteem, attachment style, advanced Theory of Mind skills and peer relations) in a sample of 243 Greek pre-adolescents. Participants completed self-reports of the variables. Results indicated that females scored…

  19. Use of the "Intervention Selection Profile-Social Skills" to Identify Social Skill Acquisition Deficits: A Preliminary Validation Study

    Science.gov (United States)

    Kilgus, Stephen P.; von der Embse, Nathaniel P.; Scott, Katherine; Paxton, Sara

    2015-01-01

    The purpose of this investigation was to develop and initially validate the "Intervention Selection Profile-Social Skills" (ISP-SS), a novel brief social skills assessment method intended for use at Tier 2. Participants included 54 elementary school teachers and their 243 randomly selected students. Teachers rated students on two rating…

  20. Nové termoresponsivní polymery pro kombinovanou lokální chemoradioterapii

    Czech Academy of Sciences Publication Activity Database

    Hrubý, Martin; Kučka, Jan; Kozempel, Ján; Lebeda, Ondřej; Koňák, Čestmír; Ulbrich, Karel

    2007-01-01

    Roč. 61, č. 1 (2007), s. 243-244 ISSN 1336-7242. [Zjazd chemikov /59./. 02.09.2007-06.09.2007, Tatranské Matliare] R&D Projects: GA AV ČR IAA400480616 Institutional research plan: CEZ:AV0Z40500505 Keywords : thermoresponsive * local * radiotherapy Subject RIV: CD - Macromolecular Chemistry

  1. analysis of the influence of agricultural and non-agricultural sectors ...

    African Journals Online (AJOL)

    INIAMA

    agricultural GDP led to a 0.243% and 0.743% change in the economy respectively. It means that the economy is inelastic with respect to agricultural and non-agricultural sector performance. The economy is more inelastic with respect to agricultural production than non-agricultural production. In countries where economies ...

  2. Molecular Defects in Cardiac Myofilament Ca2+-Regulation Due to Cardiomyopathy-Linked Mutations Can Be Reversed by Small Molecules Binding to Troponin

    Czech Academy of Sciences Publication Activity Database

    Sheehan, A.; Messer, A.E.; Papadaki, M.; Choudhry, A.; Křen, Vladimír; Biedermann, David; Blagg, B.; Khandelwal, A.; Marston, S.B.

    2018-01-01

    Roč. 9, MAR 27 2018 (2018), č. článku 243. ISSN 1664-042X R&D Projects: GA MZd(CZ) NV16-27317A Institutional support: RVO:61388971 Keywords : cardiomyopathy * sarcomeric protein mutations * troponin I phosphorylation OBOR OECD: Cardiac and Cardiovascular systems Impact factor: 4.134, year: 2016

  3. A Microbial Survey of the Gastrointestinal Flora of Pigs in Dschang ...

    African Journals Online (AJOL)

    The 243 pigs examined for microbial infection harboured one ... animals cau be infected by these organisms if faeces are dumped or washed into ..... to E. co/z'. Hurnans can also come down with diseases like candidiasis and ... I. 13s' ed. English Language Book. Society (ELBS). Longman Group Ltd. Churchill, Livingstone,.

  4. The effect of a fluoride dentifrice containing an anticalculus agent on dental caries in children.

    Science.gov (United States)

    Lu, K H; Yen, D J; Zacherl, W A; Ruhlman, C D; Sturzenberger, O P; Lehnhoff, R W

    1985-01-01

    In this double-blind caries study, 1160 Taiwanese children (ages 8-15) completed a program using a test dentifrice containing 1.243 percent sodium fluoride and soluble pyrophosphates, or a control dentifrice without these agents. The average reduction of new carious tooth surfaces was 39 percent with the sodium fluoride dentifrice.

  5. Prevalence of Ascariasis among the Students of Jooro Grammar ...

    African Journals Online (AJOL)

    Study to know the prevalence of ascariasis among the students and teachers of Jooro Grammar School, Ibule-Soro, Ondo State, was undertaken. A total of 243 subjects examined. Stool sample was collected from each subject and examined for the presence of the parasite, using wet preparation and concentration methods ...

  6. Association between changes in fat distribution and biomarkers for breast cancer

    NARCIS (Netherlands)

    van Gemert, Willemijn A.M.; Monninkhof, Evelyn M.; May, Anne M.; Elias, Sjoerd G.; Van Der Palen, Job; Veldhuis, Wouter B.; Stapper, Maaike; Stellato, Rebecca K.; Schuit, Jantine A.; Peeters, Petra H.

    2017-01-01

    We assessed the associations between changes in total and abdominal fat and changes in biomarkers for breast cancer risk using data of the SHAPE-2 trial. In the SHAPE-2 trial, 243 postmenopausal overweight women were included. The intervention in this trial consisted of 5-6 kg weight loss either by

  7. Pramana – Journal of Physics | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Home; Journals; Pramana – Journal of Physics. K V Ramanathan. Articles written in Pramana – Journal of Physics. Volume 59 Issue 2 August 2002 pp 243-254. Developments in quantum information processing by nuclear magnetic resonance: Use of quadrupolar and dipolar couplings · Anil Kumar K V Ramanathan T S ...

  8. Embracing epiphytes in sustainable forest management: a pilot study from the Highlands of Chiapas, Mexico

    NARCIS (Netherlands)

    Wolf, J.H.D.; Bruijnzeel, L.A.; Scatena, F.N.; Hamilton, L.S.

    2010-01-01

    Vascular epiphyte biomass and species richness were investigated in 16 anthropogenically disturbed pine-oak forests within an area of ~400 km2 in the Highlands of Chiapas, southern Mexico. Epiphyte biomass on 35 host oak trees in six diameter classes varied from 0.8 to 243 kg dry-weight and

  9. Two-Photon Processor and SeNeCA: a freely available software package to process data from two-photon calcium imaging at speeds down to several milliseconds per frame

    Czech Academy of Sciences Publication Activity Database

    Tomek, J.; Novák, Ondřej; Syka, Josef

    2013-01-01

    Roč. 110, č. 1 (2013), s. 243-256 ISSN 0022-3077 R&D Projects: GA ČR(CZ) GAP303/12/1347; GA ČR(CZ) GBP304/12/G069 Institutional support: RVO:68378041 Keywords : algorithm * segmentation * calcium imaging Subject RIV: FH - Neurology Impact factor: 3.041, year: 2013

  10. Scale insects, mealybugs, whiteflies and psyllids (Hemiptera, Sternorrhyncha) as prey of ladybirds. (Review)

    Czech Academy of Sciences Publication Activity Database

    Hodek, Ivo; Honěk, A.

    2009-01-01

    Roč. 51, č. 2 (2009), s. 232-243 ISSN 1049-9644 Grant - others:MzeČR(CZ) 002700604; GA ČR(CZ) GA522/08/1300 Institutional research plan: CEZ:AV0Z50070508 Keywords : scale insects * mealybugs * whiteflies Subject RIV: EH - Ecology, Behaviour Impact factor: 1.612, year: 2009

  11. The relation between 25-hydroxyvitamin D with peak bone mineral density and body composition in healthy young adults

    NARCIS (Netherlands)

    Boot, Annemieke M.; Krenning, Eric P.; Keizer-Schrama, Sabine M. P. F. de Muinck

    Objective: The associations between peak bone mineral density (BMD) and body composition with 25 hydroxyvitamin D (25OHD) levels in healthy young adults were evaluated. Methods: The number of participants was 464; 347 women and 117 men. The mean age was 24.3 years (range 17-31 years). BMD of the

  12. Women Apprentices in Hawaii: Characteristics of Females Registered with Pearl Harbor Naval Shipyard and the Hawaii Department of Labor and Industrial Relations.

    Science.gov (United States)

    White, Barbara

    A study examined the characteristics, educational training, and background experiences of women who entered apprenticeship in Hawaii during the period from July 1, 1974, through June 30, 1982. Survey instruments were completed by 118 of 243 female apprentices originally contacted--58 women registered with Pearl Harbor Naval Shipyard and 60 women…

  13. 77 FR 41436 - Announcement of Funding Awards; Fair Housing Initiatives Program Fiscal Year 2012

    Science.gov (United States)

    2012-07-13

    ...-6170.. 3 125,000.00 Cherry Ave., Washington, PA 15301. United Neighborhood Centers of Northeastern... Brenner, 724-225-6170.. 3 125,000.00 Cherry Avenue, Washington, PA 15301. St. Martin Center, Inc., 1701... Neighborhoods, Inc., 2217 St. Paul Street, Elijah Etheridge, 410-243-4468 3 324,411.00 Baltimore, MD 21218...

  14. determination of head for small hydropower development

    African Journals Online (AJOL)

    eobe

    volumetric flow of 31.73 m3/s, the power potential of the River Ethiope was placed at 2.43 MW. It ca. /s, the power potential ... water projects such as water supply, irrigation and ..... f is the friction factor (unit-less), L is the length of the pipe (m), D ...

  15. A Study of Social Cognitive Theory: The Relationship between Professional Learning Communities and Collective Teacher Efficacy in International School Settings

    Science.gov (United States)

    Hardin, James

    2010-01-01

    In "Self-Efficacy: The Exercise of Control" (1997), Albert Bandura writes, "Teachers operate collectively within an interactive social system rather than as isolates" (p. 243). Bandura's attention to the existence of the communal systems that exist in schools is an appreciation shared by many educational reformers, especially those who advocate…

  16. On the weak solutions to the equations of a compressible heat conducting gas

    Czech Academy of Sciences Publication Activity Database

    Chiodaroli, E.; Feireisl, Eduard; Kreml, O.

    2015-01-01

    Roč. 32, č. 1 (2015), s. 225-243 ISSN 0294-1449 EU Projects: European Commission(XE) 320078 - MATHEF Institutional support: RVO:67985840 Keywords : Euler-Fourier system * convex integration * weak solution Subject RIV: BA - General Mathematics Impact factor: 2.066, year: 2015 http://www.sciencedirect.com/science/article/pii/S0294144913001339

  17. Categorizing Moving Objects into Film Genres: The Effect of Animacy Attribution, Emotional Response, and the Deviation from Non-Fiction

    Science.gov (United States)

    Visch, Valentijn T.; Tan, Ed S.

    2009-01-01

    The reported study follows the footsteps of Heider, and Simmel (1944) [Heider, F., & Simmel, M. (1944). An experimental study of apparent behavior. "American Journal of Psychology," 57, 243-249] and Michotte (1946/1963) [Michotte, A. (1963). "The perception of causality" (T.R. Miles & E. Miles, Trans.). London: Methuen (Original work published…

  18. The epidemiology and socio-economic impact of rift valley fever in ...

    African Journals Online (AJOL)

    Tanzania is amongst the countries of the sub-Saharan Africa that have encoutered ... were confined to mainly livestock and mostly affecting northern parts of Tanzania. ... RVF epidemics in Tanzania included farming systems, climatic factors, vector ... was 4,243,250USD whereas that of goats and sheep was 2,202,467 USD.

  19. Spring weights of some Palaearctic passer- ines in Ethiopia and ...

    African Journals Online (AJOL)

    1970, Wood 1982), and require extensive pre-migratory fattening. Some high spring weights have been noted in Ethiopia (Ash 1993, 1994, Yohannes et al. ..... northeast and east tropical Africa: A review. Proceedings of the 6th Pan-African. Ornithological Congress: 243–262. Pennycuick, C.J. 1975. Mechanics of flight.

  20. ORIGINAL ARTICLE 79

    African Journals Online (AJOL)

    User

    1991: Human IgE, IgG4 and resistance to reinfection with Schistosoma mansoni. Nature,. 349; 243-245. 23. Andrews, P., (1986): Prazequantel: mechanisms of anti-schistosomal activity. Phamacology Theory, 29,129-156. 24. Gazzinelli G. Katz, N., Nocha, R.S., et al. 1985 Immune responses during human schistosomiasis ...

  1. Living Green: Examining Sustainable Dorms and Identities

    Science.gov (United States)

    Watson, Lesley; Johnson, Cathryn; Hegtvedt, Karen A.; Parris, Christie L.

    2015-01-01

    Purpose: The purpose of this study was to examine the effects of living in "green" dorms on students' environmentally responsible behaviors (ERBs), in concert with other factors, including individual identity and social context in the form of behavior modeling by peers. Design/methodology/approach: The sample of 243 consists of students…

  2. International Conference of Defects in Semiconductors (19th), ICDS, Held in Aveiro, Portugal on July 21-25, 1997, Pt. 3

    Science.gov (United States)

    1998-01-23

    Morinosato Wakamiya, Atsugi-shi, Kanagawa, 243-01, Japan. t present address: University of Tokyo, Institute for Industrial Science, 7-22-1 Roppongi...Lluis Sole i Sabaris 1-3, E-08028 Barcelona, Spain. 3CNM, "Instituto de Microelectrönica de Madrid", Isaac Newton 8, Parque Tecnologico de Madrid, E

  3. Biocatalytic application of nitrilases from Fusarium solani O1 and Aspergillus niger K10

    Czech Academy of Sciences Publication Activity Database

    Winkler, M.; Kaplan, Ondřej; Vejvoda, Vojtěch; Klempier, N.; Martínková, Ludmila

    2009-01-01

    Roč. 59, č. 4 (2009), s. 243-247 ISSN 1381-1177 R&D Projects: GA AV ČR IAA500200708; GA MŠk(CZ) LC06010 Institutional research plan: CEZ:AV0Z50200510 Keywords : Amino nitriles * Nitrilase * Substrate specificity Subject RIV: CE - Biochemistry Impact factor: 2.400, year: 2009

  4. A Confirmatory Factor Analysis of Preservice Teachers' Responses to the Attitudes and Beliefs on Classroom Control Inventory.

    Science.gov (United States)

    Henson, Robin K.; Roberts, J. Kyle

    This study examined the factorial invariance of scores from the Attitudes and Beliefs on Classroom Control Inventory (ABCC) (Martin and others, 1998) for 243 undergraduate preservice teachers. Although the original ABCC was developed with inservice teachers, use of the instrument to study the classroom beliefs of preservice teachers had not been…

  5. The study of spallation reactions, neutron production, and transport in a thick lead target and a uranium blanket during 1.5 GeV proton irradiation

    Czech Academy of Sciences Publication Activity Database

    Křížek, Filip; Wagner, Vladimír; Adam, Jindřich; Čaloun, Pavel; Henzl, Vladimír; Henzlová, Daniela; Krása, Antonín; Kugler, Andrej; Majerle, Mitja

    2006-01-01

    Roč. 56, č. 3 (2006), s. 243-252 ISSN 0011-4626 R&D Projects: GA MŠk 1P04LA213 Institutional research plan: CEZ:AV0Z10480505 Keywords : ADS * MCNPX * spallation Subject RIV: BG - Nuclear , Atomic and Molecular Physics, Colliders Impact factor: 0.568, year: 2006

  6. 77 FR 9303 - National Emission Standards for Hazardous Air Pollutants From Coal- and Oil-Fired Electric...

    Science.gov (United States)

    2012-02-16

    ... impacts? B. What are the energy impacts? C. What are the cost impacts? D. What are the economic impacts? E... homogeneous waste * * * for the production of electric energy or in the case of qualifying cogeneration... action: Mr. William Maxwell, Energy Strategies Group, Sector Policies and Programs Division, (D243-01...

  7. 75 FR 24571 - Designation of New Grantee

    Science.gov (United States)

    2010-05-05

    ...) has considered the application (filed 03/17/2010) submitted by the Southern California Logistics... the City of Victorville, which has accepted such reissuance subject to approval by the FTZ Board. Upon... recognizes the City of Victorville as the new grantee of Foreign-Trade Zone 243, subject to the FTZ Act and...

  8. Muretseme elu pärast maal

    Index Scriptorium Estoniae

    2005-01-01

    Ilmunud ka: Nädaline 14. juuni lk. 8. Avalik pöördumine Eesti Vabariigi valitsuse, majandus- ja kommunikatsiooniministeeriumi, siseministeeriumi ja kõigi maavalitsuste poole seoses maakondade sotsiaalse infrastruktuuri planeeringute väljatöötamise ning riigipoolse rahastamisega. Alla kirjutanud Türi vallavolikogu liige Ülo Ormus 243 kodaniku nimel

  9. Polymer hydrogels usable for nervous tissue repair

    Czech Academy of Sciences Publication Activity Database

    Lesný, Petr; DeCroos, Jane; Přádný, Martin; Vacík, Jiří; Michálek, Jiří; Woerly, S.; Syková, Eva

    2002-01-01

    Roč. 23, - (2002), s. 243-247 ISSN 0891-0618 R&D Projects: GA MŠk LN00A065; GA ČR GV307/96/K226 Institutional research plan: CEZ:AV0Z5039906 Keywords : Extracellular space * Astrocytes Subject RIV: FH - Neurology Impact factor: 2.696, year: 2002

  10. The origin of the early-time optical emission of Swift GRB 080310

    NARCIS (Netherlands)

    Littlejohns, O.M.; Willingale, R.; O'Brien, P.T.; Beardmore, A.P.; Covino, S.; Perley, D.A.; Tanvir, N.R.; Rol, E.; Yuan, F.; Akerlof, C.; D'Avanzo, P.; Bersier, D.F.; Castro-Tirado, A.J.; Christian, P.; Cobb, B.E.; Evans, P.A.; Filippenko, A.V.; Flewelling, H.; Fugazza, D.; Hoversten, E.A.; Kamble, A.P.; Kobayashi, S.; Li, W.; Morgan, A.N.; Mundell, C.G.; Page, K.; Palazzi, E.; Quimby, R.M.; Schulze, S.; Steele, I.A.; de Ugarte Postigo, A.

    2012-01-01

    We present broad-band multiwavelength observations of GRB 080310 at redshift z= 2.43. This burst was bright and long-lived, and unusual in having extensive optical and near-infrared (IR) follow-up during the prompt phase. Using these data we attempt to simultaneously model the gamma-ray, X-ray,

  11. WO.sub.3./sub.-doped zinc borophosphate glasses

    Czech Academy of Sciences Publication Activity Database

    Šubčík, J.; Koudelka, L.; Mošner, P.; Gregora, Ivan; Montagne, L.; Revel, B.

    2009-01-01

    Roč. 50, č. 4 (2009), 243-248 ISSN 1753-3562 R&D Projects: GA AV ČR KAN301370701 Institutional research plan: CEZ:AV0Z10100520 Keywords : tungstate zinc borophosphate glasses * Raman spectroscopy * temperature * NMR Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 0.553, year: 2009

  12. 77 FR 71323 - Reconsideration of Certain New Source and Startup/Shutdown Issues: National Emission Standards...

    Science.gov (United States)

    2012-11-30

    ... INFORMATION CONTACT: For the NESHAP action: Mr. William Maxwell, Energy Strategies Group, Sector Policies and... Strategies Group, Sector Policies and Programs Division, (D243-01), Office of Air Quality Planning and... revisions to the Hg limit applicable to low rank virgin coal-fired EGUs based on additional data in the...

  13. Browse Title Index

    African Journals Online (AJOL)

    Items 151 - 200 of 243 ... Vol 20 (2011): Series C: Mathematical Sciences, Engineering and Technology, Monthly Wind Characteristics and Wind Energy in Rwanda, Abstract PDF. B Sarari, J Gasore. Vol 1, No 1 (2016): Special Issue: Series D, Morphological and photometric properties of active and non-active galaxies in the ...

  14. Antipsychotics and Associated Risk of Out-of-Hospital Cardiac Arrest

    DEFF Research Database (Denmark)

    Weeke, Peter; Jensen, Aksel; Folke, Fredrik

    2014-01-01

    % confidence interval [CI]:1.23-1.89) as was use with typical antipsychotics (OR= 1.66, CI: 1.27-2.17). By contrast, overall atypical antipsychotics drug use was not (OR= 1.29, CI: 0.90-1.85). Two individual typical antipsychotic drugs were associated with OHCA, haloperidol (OR= 2.43, CI: 1...

  15. Jurors' Reactions to Satanic Ritual Abuse Allegations.

    Science.gov (United States)

    Bottoms, Bette L.; Diviak, Kathleen R.; Davis, Suzanne L.

    1997-01-01

    Mock jurors (N=243) rendered judgment about a case involving childhood sexual abuse allegations made with or without allegations of satanic ritual abuse. Although jurors, especially nonreligious jurors, were less likely to believe the satanic ritual allegations than other case details, they were as likely to vote guilty and believe the victim in…

  16. Morphology and mechanical properties of polypropylene/polystyrene blends compatibilized with styrene-butadiene block copolymers

    Czech Academy of Sciences Publication Activity Database

    Fortelný, Ivan; Minkova, L. I.; Kotek, Jiří; Lapčíková, Monika; Michálková, Danuše

    2012-01-01

    Roč. 52, č. 1 (2012), s. 191-204 ISSN 0032-3888 R&D Projects: GA ČR GA106/06/0729; GA AV ČR IAA200500903 Institutional research plan: CEZ:AV0Z40500505 Keywords : polymer blends * compatibilization * morphology Subject RIV: JI - Composite Materials Impact factor: 1.243, year: 2012

  17. An Exploratory Study of the Relationship between Collaboration and Mathematics and Game Outcomes. CRESST Report 797

    Science.gov (United States)

    Buschang, Rebecca E.; Chung, Gregory K. W. K.; Kim, Jinok

    2011-01-01

    This study is an exploratory study of the relationship between collaboration and mathematics and game outcomes in a video game aimed at teaching concepts related to rational numbers. The sample included 243 middle school students who played the video game either with one partner or individually for 40 minutes. Results suggest that participants…

  18. High-field magnetization study of R.sub.2./sub.Fe.sub.17./sub.N.sub.2./sub. (R = Ho and Er) nitrides

    Czech Academy of Sciences Publication Activity Database

    Tereshina, I. S.; Tereshina, Evgeniya; Pelevin, I.A.; Doerr, M.; Law, J.M.; Verbetski, V.N.; Salamova, A.A.

    2018-01-01

    Roč. 190, č. 5-6 (2018), s. 236-243 ISSN 0022-2291 Institutional support: RVO:68378271 Keywords : rare earth intermetallics * high magnetic fields * permanent magnet materials * nitrides Subject RIV: BM - Solid Matter Physics ; Magnetism OBOR OECD: Condensed matter physics (including formerly solid state physics , supercond.) Impact factor: 1.300, year: 2016

  19. A M Umarji

    Indian Academy of Sciences (India)

    Home; Journals; Bulletin of Materials Science. A M Umarji. Articles written in Bulletin of Materials Science. Volume 23 Issue 4 August 2000 pp 243-248 Refractory Cements. Ceramic joining through reactive wetting of alumina with calcium aluminate refractory cements · K Geetha A M Umarji T R N Kutty · More Details ...

  20. Association between changes in fat distribution and biomarkers for breast cancer.

    NARCIS (Netherlands)

    van Gemert, Willemijn A; Monninkhof, Evelyn M; May, Anne M; Elias, Sjoerd G; van der Palen, Job; Veldhuis, Wouter; Stapper, Maaike; Stellato, Rebecca K; Schuit, Jantine A; Peeters, Petra H

    We assessed the associations between changes in total and abdominal fat and changes in biomarkers for breast cancer risk using data of the SHAPE-2 trial. In the SHAPE-2 trial, 243 postmenopausal overweight women were included. The intervention in this trial consisted of 5-6 kg weight loss either by