WorldWideScience

Sample records for berkelium 243

  1. New berkelium isotope: 242Bk

    International Nuclear Information System (INIS)

    A new isotope of berkelium, 242Bk, was produced with a cross section of approx. 10 μb in reactions of boron on uranium and nitrogen on thorium. It decays by electron capture with a half-life of 7 +- 1.3 minutes. The branching ratio for this isotope for alpha decay is less than 1% and that for spontaneous fission is less than 0.03%. 2 figures, 2 tables

  2. Characterization of berkelium(III) dipicolinate and borate compounds in solution and the solid state.

    Science.gov (United States)

    Silver, Mark A; Cary, Samantha K; Johnson, Jason A; Baumbach, Ryan E; Arico, Alexandra A; Luckey, Morgan; Urban, Matthew; Wang, Jamie C; Polinski, Matthew J; Chemey, Alexander; Liu, Guokui; Chen, Kuan-Wen; Van Cleve, Shelley M; Marsh, Matthew L; Eaton, Teresa M; van de Burgt, Lambertus J; Gray, Ashley L; Hobart, David E; Hanson, Kenneth; Maron, Laurent; Gendron, Frédéric; Autschbach, Jochen; Speldrich, Manfred; Kögerler, Paul; Yang, Ping; Braley, Jenifer; Albrecht-Schmitt, Thomas E

    2016-08-26

    Berkelium is positioned at a crucial location in the actinide series between the inherently stable half-filled 5f(7) configuration of curium and the abrupt transition in chemical behavior created by the onset of a metastable divalent state that starts at californium. However, the mere 320-day half-life of berkelium's only available isotope, (249)Bk, has hindered in-depth studies of the element's coordination chemistry. Herein, we report the synthesis and detailed solid-state and solution-phase characterization of a berkelium coordination complex, Bk(III)tris(dipicolinate), as well as a chemically distinct Bk(III) borate material for comparison. We demonstrate that berkelium's complexation is analogous to that of californium. However, from a range of spectroscopic techniques and quantum mechanical calculations, it is clear that spin-orbit coupling contributes significantly to berkelium's multiconfigurational ground state. PMID:27563098

  3. Extraction of tetravalent berkelium and cerium by aliquate-336-S-NO3 quaternary ammonium salt

    International Nuclear Information System (INIS)

    Extraction of tetravalent berkelium and cerium by aliquate-336-S-NO3 quaternary ammonium salt from nitric acid solutions is investigated. The effect of concentrations of nitric acid and extracting agent, nature of an oxidant (potassium bromate, potassium bichromate, mixture of AgNO3 and (NH4)2S2O8) and solvent on the distribution coefficient of berkelium(4) and cerium(4) is studied. It is established that solutions of aliquate-336-S-NO3 in carbon tetrachloride and dichloroethane extract quantitatively tetravalent berkelium from 10-12 M nitric acid solutions and cerium - from 1-10 M nitric acid solutions containing potassium bichromate as an oxidant. It is shown that the value of distribution coefficient for berkelium and cerium depends on the nature of an oxidant and extracting agent concentration. It is established that in the case of extraction by quaternary ammonium salt with one berkelium(4) mole four aliquate-336-SNO3 moles are associated and 1.5-1.6 mole of extracting agent are associated with one cerium(4) mole. It permits to make a conclusion that stoichiometry of extraction reactions by quaternary ammonium salt is not the same for tetravalent berkelium and cerium. It is shown that trivalent transplutonium and rare earth elements are not practically extracted by aliquate-336-S-NO3 from nitric acid solutions

  4. 48 CFR 243.204 - Administration.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Administration. 243.204... OF DEFENSE CONTRACT MANAGEMENT CONTRACT MODIFICATIONS Change Orders 243.204 Administration. Follow the procedures at PGI 243.204 for administration of change orders....

  5. 40 CFR 243.204 - Collection management.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 24 2010-07-01 2010-07-01 false Collection management. 243.204 Section 243.204 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) SOLID WASTES GUIDELINES... and Recommended Procedures § 243.204 Collection management....

  6. 7 CFR 58.243 - Checking quality.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 3 2010-01-01 2010-01-01 false Checking quality. 58.243 Section 58.243 Agriculture... Procedures § 58.243 Checking quality. All milk, milk products and dry milk products shall be subject to inspection and analysis by the dairy plant for quality and condition throughout each processing...

  7. 40 CFR 243.201 - Safety.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 24 2010-07-01 2010-07-01 false Safety. 243.201 Section 243.201 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) SOLID WASTES GUIDELINES FOR THE STORAGE... Procedures § 243.201 Safety....

  8. 46 CFR 169.243 - Electrical.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 7 2010-10-01 2010-10-01 false Electrical. 169.243 Section 169.243 Shipping COAST GUARD... Certification Inspections § 169.243 Electrical. At each inspection for certification and periodic inspection... that they are in proper operating condition, in safe electrical condition, and fit for the service...

  9. 33 CFR 117.243 - Nanticoke River.

    Science.gov (United States)

    2010-07-01

    ... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Nanticoke River. 117.243 Section 117.243 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY BRIDGES DRAWBRIDGE OPERATION REGULATIONS Specific Requirements Delaware § 117.243 Nanticoke River. (a) The draw...

  10. 27 CFR 24.243 - Filtering aids.

    Science.gov (United States)

    2010-04-01

    ... 27 Alcohol, Tobacco Products and Firearms 1 2010-04-01 2010-04-01 false Filtering aids. 24.243... OF THE TREASURY LIQUORS WINE Storage, Treatment and Finishing of Wine § 24.243 Filtering aids. Inert fibers, pulps, earths, or similar materials, may be used as filtering aids in the cellar treatment...

  11. 37 CFR 2.43 - Service mark.

    Science.gov (United States)

    2010-07-01

    ... 37 Patents, Trademarks, and Copyrights 1 2010-07-01 2010-07-01 false Service mark. 2.43 Section 2... COMMERCE RULES OF PRACTICE IN TRADEMARK CASES The Written Application § 2.43 Service mark. In an application to register a service mark, the application shall specify and contain all the elements required...

  12. 7 CFR 1220.243 - Confidential treatment.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 10 2010-01-01 2010-01-01 false Confidential treatment. 1220.243 Section 1220.243 Agriculture Regulations of the Department of Agriculture (Continued) AGRICULTURAL MARKETING SERVICE (MARKETING... Confidential treatment. Except as otherwise provided in the Act, financial or commercial information that...

  13. Dicty_cDB: SLA243 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SL (Link to library) SLA243 (Link to dictyBase) - G22368 DDB0187482 Contig-U03776-1 SLA...243Z (Link to Original site) - - SLA243Z 336 - - - - Show SLA243 Library SL (Link to library) Clone ID SLA...riginal site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/SL/SLA2-B/SLA243Q.Seq.d/ ...Representative seq. ID SLA243Z (Link to Original site) Representative DNA sequence >SLA243 (SLA243Q) /CSM/SL/SLA2-B/SLA...AGTTATTGGTGATACTTATATTGAAATTAA TTAAAAATTAATAATAAAAAAAAAAAAAAAAATTTTGTACAAATAA sequence update 1997. 5. 7 Transla

  14. Gas Well Blowout Kills 243 People

    Institute of Scientific and Technical Information of China (English)

    2003-01-01

    @@ At least 243 people have been killed and scores of others poisoned in a devastating blowout at a natural gas field in Southwest China's Chongqing municipality on December 24. The accident happened at the Chuandongbei gas field in Kaixian county of Chongqing municipality.

  15. Käibemaksu maksmine maksab 243 miljonit

    Index Scriptorium Estoniae

    2005-01-01

    Poliitikauuringute keskuse PRAXIS uurimus näitas, et Eesti ettevõtetel kulub käibemaksu administreerimisele ja seadustega kursis hoidmisele aastas kokku 243 miljonit krooni, mis võrdub 0,25% SKP-st. Tabel: Suurim kulu ettevõtetele on enda kursishoidmine käibemaksuküsimustes. Vt. samas: Kuidas PRAXIS halduskoormust hindas

  16. 28 CFR 2.43 - Early termination.

    Science.gov (United States)

    2010-07-01

    ..., YOUTH OFFENDERS, AND JUVENILE DELINQUENTS United States Code Prisoners and Parolees § 2.43 Early... score in the very good risk category and has completed two continuous years of supervision free from an incident of new criminal behavior or serious parole violation; or (ii) Has a salient factor score in a...

  17. Dicty_cDB: CFH243 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CF (Link to library) CFH243 (Link to dictyBase) - - - Contig-U16392-1 CFH243P (Link to Original ... V LFEQKDYETLSVPWKFQKKLKEIQGSGVVDNPGSTPNPSPNPSPNPVPGNTS NAPTSTGR ESLETQRDIIQMKSKIDLLSNSLLQLVEQMKVTKPPTNNFSN ... V LFEQKDYETLSVPWKFQKKLKEIQGSGVVDNPGSTPNPSPNPSPNPVPGNTS NAPTSTGR ESLETQRDIIQMKSKIDLLSNSLLQLVEQMKVTKPPTNNFSN ...

  18. 12 CFR 24.3 - Public welfare investments.

    Science.gov (United States)

    2010-01-01

    ... investment would receive consideration under 12 CFR 25.23 as a “qualified investment.” ... 12 Banks and Banking 1 2010-01-01 2010-01-01 false Public welfare investments. 24.3 Section 24.3... DEVELOPMENT ENTITIES, COMMUNITY DEVELOPMENT PROJECTS, AND OTHER PUBLIC WELFARE INVESTMENTS § 24.3...

  19. 26 CFR 1.243-5 - Effect of election.

    Science.gov (United States)

    2010-04-01

    ... 26 Internal Revenue 3 2010-04-01 2010-04-01 false Effect of election. 1.243-5 Section 1.243-5...) INCOME TAXES Special Deductions for Corporations § 1.243-5 Effect of election. (a) General—(1) Corporations subject to restrictions and limitations. If an election by an affiliated group under section...

  20. 20 CFR 243.4 - Taxation of benefits.

    Science.gov (United States)

    2010-04-01

    ... 20 Employees' Benefits 1 2010-04-01 2010-04-01 false Taxation of benefits. 243.4 Section 243.4 Employees' Benefits RAILROAD RETIREMENT BOARD REGULATIONS UNDER THE RAILROAD RETIREMENT ACT TRANSFER, ASSIGNMENT, OR WAIVER OF PAYMENTS § 243.4 Taxation of benefits. (a) Annuities paid by the Board are...

  1. Evaluation of neutron data for curium-243

    International Nuclear Information System (INIS)

    The evaluation of neutron data for 243Cm is made in the energy region from 10-5 eV up to 20 MeV. The results of the evaluation are compiled in the ENDF/B-VI format. This work is performed under the Project Agreement CIS-03-95 with the International Science and Technology Center (Moscow). The Financing Party for the Project is Japan. The evaluation was requested by Y. Kikuchi (JAERI). (author). 36 refs, figs and tabs

  2. Dicty_cDB: VHP243 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHP243 (Link to dictyBase) - - - Contig-U16236-1 - (Link to Or...iginal site) VHP243F 134 - - - - - - Show VHP243 Library VH (Link to library) Clone ID VHP243 (Link to dicty...Base) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16236-1 Original site URL http://dictycdb.b...AXXXXXXXXXX sequence update 2002.10.25 Translated Amino Acid sequence CWPTGIXKTTICT...kilsif*ynfkyyqqpkkk--- Frame B: llaywyxqnnnlyqyyyyfyl*kyflsfniilniinnpkk--- Frame C: CWPTGIXKTTICTNTTIISICKN

  3. 14 CFR 243.15 - Conflict with foreign laws.

    Science.gov (United States)

    2010-01-01

    ... 14 Aeronautics and Space 4 2010-01-01 2010-01-01 false Conflict with foreign laws. 243.15 Section... PROCEEDINGS) ECONOMIC REGULATIONS PASSENGER MANIFEST INFORMATION § 243.15 Conflict with foreign laws. (a) If a... portion of this part is not required because of a conflict with applicable foreign law....

  4. 5 CFR 531.243 - Promotion of a GM employee.

    Science.gov (United States)

    2010-01-01

    ... 5 Administrative Personnel 1 2010-01-01 2010-01-01 false Promotion of a GM employee. 531.243... UNDER THE GENERAL SCHEDULE Determining Rate of Basic Pay Special Rules for Gm Employees § 531.243 Promotion of a GM employee. (a) Upon promotion, an employee's status as a GM employee ends, as provided...

  5. 47 CFR 24.243 - The cost-sharing formula.

    Science.gov (United States)

    2010-10-01

    ... 47 Telecommunication 2 2010-10-01 2010-10-01 false The cost-sharing formula. 24.243 Section 24.243... cost-sharing formula. A PCS relocator who relocates an interfering microwave link, i.e. one that is in... microwave incumbent, is entitled to pro rata reimbursement based on the following formula: er12jn96.001...

  6. Dicty_cDB: SFL243 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SF (Link to library) SFL243 (Link to dictyBase) - - - Contig-U08029-1 SFL243Z (Link to Original ... 152123_6( AC152123 |pid:none) Genomic sequence for broccoli ... [Bra... 136 4e-31 CR954204_278( CR954204 |pid:none ...

  7. 7 CFR 2.43 - Administrator, Foreign Agricultural Service.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 1 2010-01-01 2010-01-01 false Administrator, Foreign Agricultural Service. 2.43... for Farm and Foreign Agricultural Services § 2.43 Administrator, Foreign Agricultural Service. (a... Administrator, Foreign Agricultural Service: (1) Coordinate the carrying out by Department agencies of...

  8. Dicty_cDB: SHC243 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SH (Link to library) SHC243 (Link to dictyBase) - - - Contig-U16405-1 SHC243P (Link to Original ... ikyc*glyi*cfgfsilsksiqfei**ktkniw*ryshywl ifkiiwws*fpy *fh*ck*tfcc*r*fl*sif*l--- ---KEFKVNVKSNNKNTTVFAQDEK ...

  9. Dicty_cDB: SFD243 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SF (Link to library) SFD243 (Link to dictyBase) - - - Contig-U16243-1 SFD243P (Link to Original ... (bits) Value X75329_1( X75329 |pid:none) M.indica (Manila ) THMF5 mRNA for 3-ket... 237 e-115 AM474896_9( AM4 ...

  10. Dicty_cDB: SSB243 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CTTTATTAAAACAAGCTGTTGAATTTAAAACAA TGGTTAGATATT Length of 3' end seq. 542 Connected seq. ID SSB243P Connect...PALLKQAVEFKTM VRY Frame C: *fffftsivkyfittiiiilfsennnyyinnnklsln*skik*ifxndctiistnnilcr vlcy*vlhl--- ---gspg...TTTAATAAGTCTTG GAAAATATTCTGCTATCTTTGTTTATAAAGATTACTCAATAACTGGTTTCTTACCAGCTT TATTAAAACAAGCTGTTGAATTTAAAACAATGGTTAGATATT Length of conn...SS (Link to library) SSB243 (Link to dictyBase) - G02063 DDB0186878 Contig-U16443-1... ID SSB243 (Link to dictyBase) Atlas ID - NBRP ID G02063 dictyBase ID DDB0186878 Link to Contig Conti

  11. 48 CFR 3452.243-70 - Key personnel.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 7 2010-10-01 2010-10-01 false Key personnel. 3452.243-70... Key personnel. As prescribed in 3443.106(b), insert the following clause in all solicitations and resultant cost-reimbursement contracts: Key Personnel (AUG 1987) The personnel designated as key...

  12. Preparation of tracer 239Np from 243Am

    International Nuclear Information System (INIS)

    The aim of this work is the preparation of tracer 239Np from 243Am by extraction chromatography as a separation method that can be used as a tracer to determine the radiochemical yield of 237Np in the analysis of environmental samples. (authors)

  13. 48 CFR 52.243-6 - Change Order Accounting.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 2 2010-10-01 2010-10-01 false Change Order Accounting....243-6 Change Order Accounting. As prescribed in 43.205(f), the contracting officer may insert a clause, substantially the same as follows: Change Order Accounting (APR 1984) The Contracting Officer may require...

  14. 49 CFR 372.243 - Controlling distances and population data.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 5 2010-10-01 2010-10-01 false Controlling distances and population data. 372.243... population data. In the application of § 372.241: (a) Air-line distances or mileages about corporate limits of municipalities shall be used. (b) The population of any municipality shall be deemed to be...

  15. Dicty_cDB: VHL243 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHL243 (Link to dictyBase) - - - Contig-U16441-1 - (Link to Original site) ... pic herpesvirus 2... 33 6.3 (Q8TS91) RecName: Full=Imidazole ... glycerol phosphate synthase sub... 33 6.3 CP000091 ...

  16. 40 CFR 180.243 - Propazine; tolerances for residues.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 23 2010-07-01 2010-07-01 false Propazine; tolerances for residues...) PESTICIDE PROGRAMS TOLERANCES AND EXEMPTIONS FOR PESTICIDE CHEMICAL RESIDUES IN FOOD Specific Tolerances § 180.243 Propazine; tolerances for residues. Tolerances are established for negligible residues (N)...

  17. 30 CFR 243.2 - What leases are subject to this part?

    Science.gov (United States)

    2010-07-01

    ... 30 Mineral Resources 2 2010-07-01 2010-07-01 false What leases are subject to this part? 243.2 Section 243.2 Mineral Resources MINERALS MANAGEMENT SERVICE, DEPARTMENT OF THE INTERIOR MINERALS REVENUE MANAGEMENT SUSPENSIONS PENDING APPEAL AND BONDING-MINERALS REVENUE MANAGEMENT General Provisions § 243.2...

  18. Dicty_cDB: SHL243 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SH (Link to library) SHL243 (Link to dictyBase) - G23225 DDB0219989 Contig-U13301-1 | Contig-U16 ... .1 Influenza A virus (swine/Cotes d'Armor/1515/99 (H1N1 )) partial N1NA gene for Neuraminidase, genomic RNA ... .1 Influenza A virus (swine/Cotes d'Armor/1482/99 (H1N1 )) partial N1NA gene for Neuraminidase, genomic RNA ...

  19. Review of fission product yields and delayed neutron data for the actinides NP-237, PU-242, AM-242M, AM-243, CM-243 and CM-245

    International Nuclear Information System (INIS)

    A review of fission product yields and delayed neutron data for Np-237, Pu-242, Am-242m, Am-243, Cm-243 and Cm-245 has been undertaken. Gaps in understanding and inconsistencies in existing data were identified and priority areas for further experimental, theoretical and evaluation investigation detailed

  20. Fission dynamics study in 243Am and 254Fm

    Science.gov (United States)

    Banerjee, K.; Ghosh, T. K.; Roy, P.; Bhattacharya, S.; Chaudhuri, A.; Bhattacharya, C.; Pandey, R.; Kundu, S.; Mukherjee, G.; Rana, T. K.; Meena, J. K.; Mohanto, G.; Dubey, R.; Saneesh, N.; Sugathan, P.; Guin, R.; Das, S.; Bhattacharya, P.

    2016-06-01

    Fission fragment mass distributions in the reactions 11B + 232Th and 11B + 243Am were measured in an energy range around the barrier. No sudden change in the width of the mass distribution as a function of center-of-mass energy was observed at near-barrier energies, indicating no quasifission transition in the near-barrier energies. Interestingly, the previous measurements of fission fragment angular anisotropies for the same systems showed significant departure from the statistical saddle-point model predictions at near-barrier energies, indicating the presence of nonequilibrium fission processes.

  1. 30 CFR 243.8 - When will MMS suspend my obligation to comply with an order?

    Science.gov (United States)

    2010-07-01

    ... with an order? 243.8 Section 243.8 Mineral Resources MINERALS MANAGEMENT SERVICE, DEPARTMENT OF THE INTERIOR MINERALS REVENUE MANAGEMENT SUSPENSIONS PENDING APPEAL AND BONDING-MINERALS REVENUE MANAGEMENT... with the Bureau of Land Management for onshore leases, and MMS for OCS leases, as collateral for...

  2. 30 CFR 243.4 - How do I suspend compliance with an order?

    Science.gov (United States)

    2010-07-01

    ... 30 Mineral Resources 2 2010-07-01 2010-07-01 false How do I suspend compliance with an order? 243.4 Section 243.4 Mineral Resources MINERALS MANAGEMENT SERVICE, DEPARTMENT OF THE INTERIOR MINERALS REVENUE MANAGEMENT SUSPENSIONS PENDING APPEAL AND BONDING-MINERALS REVENUE MANAGEMENT General...

  3. 30 CFR 243.201 - How will MMS determine if I am financially solvent?

    Science.gov (United States)

    2010-07-01

    ... solvent? 243.201 Section 243.201 Mineral Resources MINERALS MANAGEMENT SERVICE, DEPARTMENT OF THE INTERIOR MINERALS REVENUE MANAGEMENT SUSPENSIONS PENDING APPEAL AND BONDING-MINERALS REVENUE MANAGEMENT Financial... making payments found in 30 CFR 218.51. You are not required to use Electronic Funds Transfer (EFT)...

  4. 30 CFR 243.200 - How do I demonstrate financial solvency?

    Science.gov (United States)

    2010-07-01

    ... 30 Mineral Resources 2 2010-07-01 2010-07-01 false How do I demonstrate financial solvency? 243.200 Section 243.200 Mineral Resources MINERALS MANAGEMENT SERVICE, DEPARTMENT OF THE INTERIOR MINERALS REVENUE MANAGEMENT SUSPENSIONS PENDING APPEAL AND BONDING-MINERALS REVENUE MANAGEMENT Financial...

  5. 30 CFR 243.202 - When will MMS monitor my financial solvency?

    Science.gov (United States)

    2010-07-01

    ... 30 Mineral Resources 2 2010-07-01 2010-07-01 false When will MMS monitor my financial solvency? 243.202 Section 243.202 Mineral Resources MINERALS MANAGEMENT SERVICE, DEPARTMENT OF THE INTERIOR MINERALS REVENUE MANAGEMENT SUSPENSIONS PENDING APPEAL AND BONDING-MINERALS REVENUE MANAGEMENT...

  6. 30 CFR 243.1 - What is the purpose of this part?

    Science.gov (United States)

    2010-07-01

    ... 243.1 Mineral Resources MINERALS MANAGEMENT SERVICE, DEPARTMENT OF THE INTERIOR MINERALS REVENUE MANAGEMENT SUSPENSIONS PENDING APPEAL AND BONDING-MINERALS REVENUE MANAGEMENT General Provisions § 243.1 What... are a lessee) have appealed under 30 CFR part 290 in effect prior to May 13, 1999 and contained in...

  7. 30 CFR 243.3 - What definitions apply to this part?

    Science.gov (United States)

    2010-07-01

    ... Section 243.3 Mineral Resources MINERALS MANAGEMENT SERVICE, DEPARTMENT OF THE INTERIOR MINERALS REVENUE MANAGEMENT SUSPENSIONS PENDING APPEAL AND BONDING-MINERALS REVENUE MANAGEMENT General Provisions § 243.3 What... assigned. MMS bond-approving officer means the Associate Director for Minerals Revenue Management or...

  8. 14 CFR 243.11 - Transmission of information after an aviation disaster.

    Science.gov (United States)

    2010-01-01

    ... aviation disaster. 243.11 Section 243.11 Aeronautics and Space OFFICE OF THE SECRETARY, DEPARTMENT OF... of information after an aviation disaster. (a) Each covered airline shall inform the Managing... upon learning of an aviation disaster involving a covered flight segment operated by that carrier....

  9. 30 CFR 243.101 - How will MMS determine the amount of my bond or other surety instrument?

    Science.gov (United States)

    2010-07-01

    ... other surety instrument? 243.101 Section 243.101 Mineral Resources MINERALS MANAGEMENT SERVICE, DEPARTMENT OF THE INTERIOR MINERALS REVENUE MANAGEMENT SUSPENSIONS PENDING APPEAL AND BONDING-MINERALS REVENUE MANAGEMENT Bonding Requirements § 243.101 How will MMS determine the amount of my bond or...

  10. 30 CFR 243.12 - May I substitute a demonstration of financial solvency for a bond posted before the effective...

    Science.gov (United States)

    2010-07-01

    ... MINERALS MANAGEMENT SERVICE, DEPARTMENT OF THE INTERIOR MINERALS REVENUE MANAGEMENT SUSPENSIONS PENDING APPEAL AND BONDING-MINERALS REVENUE MANAGEMENT General Provisions § 243.12 May I substitute...

  11. Molecular Cloning and Production of Recombinant Phytase from Bacillus subtilis ASUIA243 in Pichia pastoris

    Directory of Open Access Journals (Sweden)

    Nor Soleha Mohd Dali

    2011-12-01

    Full Text Available Phytase gene obtained from Bacillus subtilis ASUIA243 was cloned into a medium vector and transformed into E. coli. Restriction enzyme digestion was conducted to get blunt-ended phytase gene and ligated into the Pichia expression vector, pPICZαA. The recombinant vector, pPICZαA-243HPp was then linearized with PmeI and transformed into P. pastoris strain X33. Screening for multi copy gene number of transformants was done by re-plating the selected colonies on increasing concentration of zeocin. One positive clone, X243HPp#2 was then grown in BMGY media as the starting culture, followed by induction in BMMY media for protein expression study. The supernatant was then analysed by SDS-PAGE and Western blot method to check the protein expression.ABSTRAK: Gen fitase yang didapati daripada Bacillus subtilis ASUIA243 diklonkan sebagai vektor perantara dan berubah menjadi E. coli. Sekatan pencernaan enzim dijalankan untuk mendapatkan gen fitase berhujung tumpul dan diligatkan dengan vektor ekspresi Pichia, pPICZαA. Vektor rekombinan, pPICZαA-243HPp kemudian dilinearkan dengan PmeI dan berubah menjadi P. pastoris strain X33. Penyaringan untuk nombor gen berbilang salinan yang menjalani transformasi genetik dijalankan dengan menyalur semula koloni terpilih dengan penambahan kepekatan zeocin. Satu klon positif, X243HPp#2 kemudian dibiarkan hidup dalam perantara BMGY sebagai kultur permulaan, diikuti dengan aruhan dalam perantara BMMY untuk kajian penglahiran protein. Supernatan kemudian dikaji dengan SDS-PAGE dan kaedah sap Western untuk menyemak penglahiran protein.KEYWORDS:  phytase, Bacillus subtilis, Pichia pastoris, gene cloning.

  12. Molecular Cloning and Production of Recombinant Phytase from Bacillus subtilis ASUIA243 in Pichia pastoris

    OpenAIRE

    Nor Soleha Mohd Dali; Tamrin Nuge; Mohd Hafidz Mahamad Maifiah; Faridah Yusof; Anis Shobirin Meor Hussin; Abd-Elaziem Farouk; and Hamzah Mohd. Salleh

    2011-01-01

    Phytase gene obtained from Bacillus subtilis ASUIA243 was cloned into a medium vector and transformed into E. coli. Restriction enzyme digestion was conducted to get blunt-ended phytase gene and ligated into the Pichia expression vector, pPICZαA. The recombinant vector, pPICZαA-243HPp was then linearized with PmeI and transformed into P. pastoris strain X33. Screening for multi copy gene number of transformants was done by re-plating the selected colonies on increasing concentrati...

  13. Preparation and high intensity heavy ion irradiation tests of intermetallic 243Am/Pd targets

    International Nuclear Information System (INIS)

    Previously reported preparation method for Pd-based intermetallic targets (Usoltsev, et al., 2012) [1] has been successfully applied for producing two stationary 243Am/Pd targets. Both targets have been irradiated at the U-400 cyclotron at Flerov Laboratory of Nuclear Reactions Dubna (Russian Federation) using high intensity beams (up to 0.83 μApart) of 48Ca18+. Alpha-particle spectroscopy and light microscopy allowed for a comprehensive characterization of the intermetallic targets before and after irradiation. A natNd/Pd intermetallic target and a solely electroplated 243Am/Ti target were similarly investigated for comparison

  14. Spectroscopic monitoring of the luminous blue variable Westerlund1-243 from 2002 to 2009

    OpenAIRE

    Ritchie, B.; Clark, J. S.; Negueruela,, I.; Najarro, F

    2009-01-01

    Context. The massive post-main sequence star W243 in the galactic starburst cluster Westerlund 1 has undergone a spectral transformation from a B2Ia supergiant devoid of emission features in 1981 to an A-type supergiant with a rich emission-line spectrum by 2002/03.Aims. We examine the continued evolution of W243 from 2002 to 2009 to understand its evolutionary state, current physical properties and the origin of its peculiar emission line spectrum.Methods. We used VLT/UVES and VLT/FLAMES to ...

  15. 40 CFR 761.243 - Standard wipe sample method and size.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 30 2010-07-01 2010-07-01 false Standard wipe sample method and size... Natural Gas Pipeline: Selecting Sample Sites, Collecting Surface Samples, and Analyzing Standard PCB Wipe Samples § 761.243 Standard wipe sample method and size. (a) Collect a surface sample from a natural...

  16. Pesticides: Benefaction or Pandora's Box? A synopsis of the environmental aspects of 243 pesticides

    NARCIS (Netherlands)

    Linders JBHJ; Jansma JW; Mensink BJWG; Otermann K; ACT

    1994-01-01

    The report provides an overview of physical, chemical and environmental data of 243 pesticides. The data mentioned are based on confidential information supplied by the manufacturers of the pesticides. For all pesticides mentioned a Final Environmental File, which is public, is derived. Tables with

  17. 17 CFR 243.103 - No effect on Exchange Act reporting status.

    Science.gov (United States)

    2010-04-01

    ... filings in a timely manner; or (b) There is adequate current public information about the issuer for... a public disclosure required solely by § 243.100 shall not affect whether: (a) For purposes of Forms S-2 (17 CFR 239.12), S-3 (17 CFR 239.13) and S-8 (17 CFR 239.16b) under the Securities Act,...

  18. 30 CFR 243.10 - When will MMS collect against a bond or other surety instrument or a person demonstrating...

    Science.gov (United States)

    2010-07-01

    ... surety instrument or a person demonstrating financial solvency? 243.10 Section 243.10 Mineral Resources... a bond or other surety instrument or a person demonstrating financial solvency? (a) This section... surety instrument on your own behalf or for another person; or (2) Have demonstrated financial...

  19. 20 CFR 404.243 - Computation where you are eligible for a pension based on noncovered employment.

    Science.gov (United States)

    2010-04-01

    ... pension based on noncovered employment. 404.243 Section 404.243 Employees' Benefits SOCIAL SECURITY... for a pension based on noncovered employment. The provisions of § 404.213 are applicable to... of living amount), minus one-half the portion of your monthly pension which is due to noncovered...

  20. Effect of arginine on stability of GST-ZNF191(243-368)

    Institute of Scientific and Technical Information of China (English)

    Dong Xin Zhao; Zhong Xian Huang

    2007-01-01

    For better understanding the chemical or biological information of ZNF191 (243-368), we expressed the fusion protein of GST and ZNF191(243-368), and used it to obtain the binding DNA sequence of this zinc finger protein. But in the process of expression and purification, we found this fusion protein slowly degradated. For resolving this problem, we simultaneously added charged amino acids L-Arg and L-Glu to the solution of fusion protein, and demonstrated that this method can dramatically increase the stability of this fusion protein. This method can make the fusion protein suitable for the continuous works, especially for situations where high protein concentration and long-term stability without precipitate and degradation of protein are required.

  1. Two photon dissociation of benzene, phenylacetylene, and benzaldehyde at 243 nm: translational energy releases in the H atom channel

    International Nuclear Information System (INIS)

    Hydrogen atom production channels from photodissociation of benzene, phenylacetylene, and benzaldehyde at 243 nm have been investigated by detecting H atoms using two photon absorption at 243.2 nm and induced fluorescence at 121.6 nm. Translational energies of the H atoms were measured by Doppler broadened H atom spectra. By absorption of two photons at 243 nm, the H atoms are statistically produced from benzene and phenylacetylene whereas the H atoms from the aldehyde group in benzaldehyde are produced from different pathways. The possible dissociation mechanisms are discussed from the measured translational energy releases

  2. Yb fiber amplifier at 972.5 nm with frequency quadrupling to 243.1 nm

    CERN Document Server

    Burkley, Z; Cooper, S F; Brandt, A D; Yost, D C

    2016-01-01

    We demonstrate a continuous-wave ytterbium-doped fiber amplifier which produces 6.3 W at a wavelength of 972.5 nm. We frequency quadruple this source in two resonant doubling stages to produce 530 mW at 243.1 nm. Radiation at this wavelength is required to excite the 1S-2S transition in atomic hydrogen and could therefore find application in experimental studies of hydrogen and anti-hydrogen.

  3. Spectroscopic monitoring of the luminous blue variable Westerlund1-243 from 2002 to 2009

    CERN Document Server

    Ritchie, B W; Negueruela, I; Najarro, F

    2009-01-01

    The massive post-Main Sequence star W243 in the galactic starburst cluster Westerlund 1 has undergone a spectral transformation from a B2Ia supergiant devoid of emission features in 1981 to an A-type supergiant with a rich emission-line spectrum by 2002/03. We used VLT/UVES and VLT/FLAMES to obtain high-resolution spectra on six epochs in 2003/04 (UVES) and ten epochs in 2008/09 (FLAMES). These spectra are used alongside other VLT/FLAMES and NTT/EMMI spectra to follow the evolution of W243 from 2002 to 2009. W243 displays a complex, time-varying spectrum with emission lines of Hydrogen, Helium and Lyman-pumped metals, forbidden lines of Nitrogen and Iron, and a large number of absorption lines from neutral and singly-ionized metals. Many lines are complex emission/absorption blends. The LBV has a current temperature of ~8500K (spectral type A3Ia+), and displays signs of photospheric pulsations and weak episodic mass loss. Nitrogen is highly overabundant, with Carbon and Oxygen depleted, indicative of surface ...

  4. Measurements of neutron cross section of the {sup 243}Am(n,{gamma}){sup 244}Am reaction

    Energy Technology Data Exchange (ETDEWEB)

    Hatsukawa, Yuichi; Shinohara, Nobuo; Hata, Kentaro [Japan Atomic Energy Research Inst., Tokai, Ibaraki (Japan). Tokai Research Establishment

    1998-03-01

    The effective thermal neutron cross section of {sup 243}Am(n,{gamma}){sup 244}Am reaction was measured by the activation method. Highly-purified {sup 243}Am target was irradiated in an aluminum capsule by using a research reactor JRR-3M. The tentative effective thermal neutron cross sections are 3.92 b, and 84.44 b for the production of {sup 244g}Am and {sup 244m}Am, respectively. (author)

  5. ESO 243-49 HLX-1: scaling of X-ray spectral properties and black hole mass determination

    CERN Document Server

    Titarchuk, Lev

    2016-01-01

    We report the results of Swift/XRT observations (2008-2015) of a hyper-luminous X-ray source, ESO 243-49 HLX-1. We found a strong observational evidence that ESO 243-49 HLX-1 underwent spectral transitions from the low/hard state to the high/soft state during these observations. The spectra of ESO 243-49 HLX-1 are well fitted by the so-{called} bulk motion Comptonization model for all spectral states. We have established the photon index Gamma saturation level, Gamma_{sat}$=3.0+/-0.1, in the correlation of Gamma versus mass accretion rate dot M. This Gamma-dot M correlation allows us to estimate the black hole (BH) mass in ESO 243-49 HLX-1 to be M_{BH}~ 7x 10^4 solar masses, assuming the distance to ESO 243-49 of 95 Mpc. For the BH mass estimate we used the scaling method, taking Galactic BHs XTE~J1550-564, H~1743-322 and 4U~1630-472, and an extragalactic BH source, M101 ULX-1 as reference sources. The Gamma-dot M correlation revealed in ESO 243-49 HLX-1 is similar to those in a number of Galactic and extraga...

  6. Quality control of the sheep bacterial artificial chromosome library, CHORI-243

    Directory of Open Access Journals (Sweden)

    Kirkness Ewen F

    2010-12-01

    Full Text Available Abstract Background The sheep CHORI-243 bacterial artificial chromosome (BAC library is being used in the construction of the virtual sheep genome, the sequencing and construction of the actual sheep genome assembly and as a source of DNA for regions of the genome of biological interest. The objective of our study is to assess the integrity of the clones and plates which make up the CHORI-243 library using the virtual sheep genome. Findings A series of analyses were undertaken based on the mapping the sheep BAC-end sequences (BESs to the virtual sheep genome. Overall, very few plate specific biases were identified, with only three of the 528 plates in the library significantly affected. The analysis of the number of tail-to-tail (concordant BACs on the plates identified a number of plates with lower than average numbers of such BACs. For plates 198 and 213 a partial swap of the BESs determined with one of the two primers appear to have occurred. A third plate, 341, also with a significant deficit in tail-to-tail BACs, appeared to contain a substantial number of sequences determined from contaminating eubacterial 16 S rRNA DNA. Additionally a small number of eubacterial 16 S rRNA DNA sequences were present on two other plates, 111 and 338, in the library. Conclusions The comparative genomic approach can be used to assess BAC library integrity in the absence of fingerprinting. The sequences of the sheep CHORI-243 library BACs have high integrity, especially with the corrections detailed above. The library represents a high quality resource for use by the sheep genomics community.

  7. A monolithic collapse origin for the thin/thick disc structure of ESO~243-49

    CERN Document Server

    Comerón, S; Peletier, R F; Mentz, J

    2016-01-01

    ESO 243-49 is a high-mass (circular velocity $v_{\\rm c}\\approx200\\,{\\rm km\\,s^{-1}}$) edge-on S0 galaxy in the Abell 2877 cluster at a distance of $\\sim95\\,{\\rm Mpc}$. To elucidate the origin of its thick disc, we use MUSE science verification data to study its kinematics and stellar populations. The thick disc emits $\\sim80\\%$ of the light at heights in excess of $3.5^{\\prime\\prime}$ ($1.6\\,{\\rm kpc}$). The rotation velocities of its stars lag by $30-40\\,{\\rm km\\,s^{-1}}$ compared to those in the thin disc, which is compatible with the asymmetric drift. The thick disc is found to be more metal-poor than the thin disc, but both discs have old ages. We suggest an internal origin for the thick disc stars in high-mass galaxies. We propose that the thick disc formed either ${\\rm a)}$ first in a turbulent phase with a high star formation rate and that a thin disc formed shortly afterwards, or ${\\rm b)}$ because of the dynamical heating of a thin pre-existing component. Either way, the star formation in ESO 243-49 ...

  8. Partial monosomy 8q and partial trisomy 9q due to the maternal translocation t(8;9(q24.3;q34.1)

    DEFF Research Database (Denmark)

    Tos, T; Alp, M Y; Eker, H K;

    2014-01-01

    Partial trisomy 9q34-qter and partial monosomy 8q24.3-qter are very rare chromosomal abnormalities. Characteristic features of partial trisomy 9q34-qter are hypotonia, developmental delay, mild intellectual disability, dolichocephaly, distinct facial phenotype, long and thin fingers, and cardiac...... anomalies. Unlike the partial trisomy 9q34-qter, partial monosomy 8q24.3-qter has no distinct phenotype. Here we report a four years old female patient with partial trisomy 9q34-qter and partial monosomy 8q24.3-qter due to the maternal translocation t(8;9)(q24.3;q34. I). She has developmental delay...

  9. Function of conserved histidine-243 in phosphatase activity of EnvZ, the sensor for porin osmoregulation in Escherichia coli.

    OpenAIRE

    Hsing, W; Silhavy, T J

    1997-01-01

    EnvZ and OmpR are the sensor and response regulator proteins of a two-component system that controls the porin regulon of Escherichia coli in response to osmolarity. Three enzymatic activities are associated with EnvZ: autokinase, OmpR kinase, and OmpR-phosphate (OmpR-P) phosphatase. Conserved histidine-243 is critical for both autokinase and OmpR kinase activities. To investigate its involvement in OmpR-P phosphatase activity, histidine-243 was mutated to several other amino acids and the ph...

  10. Measurement of fission cross section with pure Am-243 sample using lead slowing-down spectrometer

    Energy Technology Data Exchange (ETDEWEB)

    Kobayashi, Katsuhei; Yamamoto, Shuji; Kai, T.; Fujita, Yoshiaki; Yamamoto, Hideki; Kimura, Itsuro [Kyoto Univ. (Japan); Shinohara, Nobuo

    1997-03-01

    By making use of back-to-back type double fission chambers and a lead slowing-down spectrometer coupled to an electron linear accelerator, the fission cross section for the {sup 243}Am(n,f) reaction has been measured relative to that for the {sup 235}U(n,f) reaction in the energy range from 0.1 eV to 10 keV. The measured result was compared with the evaluated nuclear data appeared in ENDF/B-VI and JENDL-3.2, whose evaluated data were broadened by the energy resolution function of the spectrometer. General agreement was seen between the evaluated data and the measurement except that the ENDF/B-VI data were lower in the range from 15 to 60 eV and that the JENDL-3.2 data seemed to be lower above 100 eV. (author)

  11. 49 CFR 173.243 - Bulk packaging for certain high hazard liquids and dual hazard materials which pose a moderate...

    Science.gov (United States)

    2010-10-01

    ... conforming to 46 CFR part 64 with design pressure of at least 172.4 kPa (25 psig) are authorized. Unless... 49 Transportation 2 2010-10-01 2010-10-01 false Bulk packaging for certain high hazard liquids and... Packaging for Hazardous Materials Other Than Class 1 and Class 7 § 173.243 Bulk packaging for certain...

  12. Measurement and analysis of the $^{243}$Am neutron capture cross section at the n_TOF facility at CERN

    CERN Document Server

    Mendoza, E; Guerrero, C; Berthoumieux, E; Abbondanno, U; Aerts, G; Alvarez-Velarde, F; Andriamonje, S; Andrzejewski, J; Assimakopoulos, P; Audouin, L; Badurek, G; Balibrea, J; Baumann, P; Becvar, F; Belloni, F; Calvino, F; Calviani, M; Capote, R; Carrapico, C; Carrillo de Albornoz, A; Cennini, P; Chepel, V; Chiaveri, E; Colonna, N; Cortes, G; Couture, A; Cox, J; Dahlfors, M; David, S; Dillmann, I; Dolfini, R; Domingo-Pardo, C; Dridi, W; Duran, I; Eleftheriadis, C; Ferrant†, L; Ferrari, A; Ferreira-Marques, R; Fitzpatrick, L; Frais-Koelbl, H; Fujii, K; Furman, W; Goncalves, I; Gonz alez-Romero, E; Goverdovski, A; Gramegna, F; Griesmayer, E; Gunsing, F; Haas, B; Haight, R; Heil, M; Herrera-Martinez, A; Igashira, M; Isaev, S; Jericha, E; Kappeler, F; Kadi, Y; Karadimos, D; Karamanis, D; Ketlerov, V; Kerveno, M; Koehler, P; Konovalov, V; Kossionides, E; Krticka, M; Lampoudis, C; Leeb, H; Lindote, A; Lopes, I; Lossito, R; Lozano, M; Lukic, S; Marganiec, J; Marques, L; Marrone, S; Martınez, T; Massimi, C; Mastinu, P; Mengoni, A; Milazzo, P M; Moreau, C; Mosconi, M; Neves, F; Oberhummer, H; O’Brien, S; Oshima, M; Pancin, J; Papachristodoulou, C; Papadopoulos, C; Paradela, C; Patronis, N; Pavlik, A; Pavlopoulos, P; Perrot, L; Pigni, M T; Plag, R; Plompen, A; Plukis, A; Poch, A; Praena, J; Pretel, C; Quesada, J; Rauscher, T; Reifarth, R; Rosetti, M; Rubbia, C; Rudolf, G; Rullhusen, P; Salgado, J; Santos, C; Sarchiapone, L; Savvidis, I; Stephan, C; Tagliente, G; Tain, J L; Tassan-Got, L; Tavora, L; Terlizzi, R; Vannini, G; Vaz, P; Ventura, A; Villamarin, D; Vicente, M C; Vlachoudis, V; Vlastou, R; Voss, F; Walter, S; Wendler, H; Wiescher, M; Wisshak, K

    2014-01-01

    Background:The design of new nuclear reactors and transmutation devices requires to reduce the present neutron cross section uncertainties of minor actinides. Purpose: Reduce the $^{243}$Am(n,$\\gamma$) cross section uncertainty. Method: The $^{243}$Am(n,$\\gamma$) cross section has been measured at the n_TOF facility at CERN with a BaF$_{2}$ Total Absorption Calorimeter, in the energy range between 0.7 eV and 2.5 keV. Results: The $^{243}$Am(n,$\\gamma$) cross section has been successfully measured in the mentioned energy range. The resolved resonance region has been extended from 250 eV up to 400 eV. In the unresolved resonance region our results are compatible with one of the two incompatible capture data sets available below 2.5 keV. The data available in EXFOR and in the literature has been used to perform a simple analysis above 2.5 keV. Conclusions: The results of this measurement contribute to reduce the $^{243}$Am(n,$\\gamma$) cross section uncertainty and suggest that this cross section is underestimate...

  13. 30 CFR 243.5 - May another person post a bond or other surety instrument or demonstrate financial solvency on my...

    Science.gov (United States)

    2010-07-01

    ... instrument or demonstrate financial solvency on my behalf? 243.5 Section 243.5 Mineral Resources MINERALS... surety instrument or demonstrate financial solvency on my behalf? Any other person, including a designee, payor, or affiliate, may post a bond or other surety instrument or demonstrate financial solvency...

  14. Phosphorylation of HPV-16 E2 at serine 243 enables binding to Brd4 and mitotic chromosomes.

    Directory of Open Access Journals (Sweden)

    Szu-Wei Chang

    Full Text Available The papillomavirus E2 protein is involved in the maintenance of persistent infection and known to bind either to cellular factors or directly to mitotic chromosomes in order to partition the viral genome into the daughter cells. However, how the HPV-16 E2 protein acts to facilitate partitioning of the viral genome remains unclear. In this study, we found that serine 243 of HPV-16 E2, located in the hinge region, is crucial for chromosome binding during mitosis. Bromodomain protein 4 (Brd4 has been identified as a cellular binding target through which the E2 protein of bovine papillomavirus type 1 (BPV-1 tethers the viral genome to mitotic chromosomes. Mutation analysis showed that, when the residue serine 243 was substituted by glutamic acid or aspartic acid, whose negative charges mimic the effect of constitutive phosphorylation, the protein still can interact with Brd4 and colocalize with Brd4 in condensed metaphase and anaphase chromosomes. However, substitution by the polar uncharged residues asparagine or glutamine abrogated Brd4 and mitotic chromosome binding. Moreover, following treatment with the inhibitor JQ1 to release Brd4 from the chromosomes, Brd4 and E2 formed punctate foci separate from the chromosomes, further supporting the hypothesis that the association of the HPV-16 E2 protein with the chromosomes is Brd4-dependent. In addition, the S243A E2 protein has a shorter half-life than the wild type, indicating that phosphorylation of the HPV-16 E2 protein at serine 243 also increases its half-life. Thus, phosphorylation of serine 243 in the hinge region of HPV-16 E2 is essential for interaction with Brd4 and required for host chromosome binding.

  15. Haploinsufficiency of ANKRD11 (16q24.3) Is Not Obligatorily Associated with Cognitive Impairment but Shows a Clinical Overlap with Silver-Russell Syndrome

    Science.gov (United States)

    Spengler, S.; Oehl-Jaschkowitz, B.; Begemann, M.; Hennes, P.; Zerres, K.; Eggermann, T.

    2013-01-01

    Microdeletions in 16q24.3 are associated with intellectual disability and a specific phenotype, e.g. short stature and a prominent forehead. The 16q24.3 microdeletion syndrome shows a broad phenotypic overlap with the KBG syndrome, which is caused by mutations within the ANKRD11 gene. Furthermore, both KBG and the 16q24.3 microdeletion syndromes show clinical findings reminiscent of Silver-Russell syndrome (SRS), an imprinting disorder characterized by severe primordial growth retardation. In a cohort of patients referred as SRS, we previously identified a 16q24.3 deletion, but at that time, only patients with larger imbalances in 16q24.3 and intellectual disability had been published. Considering the recent description of the ANKRD11 gene as the causative factor for the 2 16q24.3-associated disorders, we now classified our patient as a 16q24.3 microdeletion syndrome patient exhibiting some characteristic features but normal intelligence. Our case illustrates the broad clinical spectrum associated with microdeletions, and we confirm that the 16q24.3 microdeletion syndrome is a further microdeletion syndrome with very variable expressivity. Indeed, our case is the first 16q24.3 patient of normal intelligence, but we assume that this variant is present in further mentally healthy probands which have not yet been tested. In conclusion, the detection of the 16q24.3 deletion in a proband of unremarkable intellectual capacities once again illustrates the need to perform molecular karyotyping in dysmorphic patients with normal intelligence. PMID:23885231

  16. 243 244Cm studies in C57BL/Do mice

    International Nuclear Information System (INIS)

    Three groups of C57BL/Do mice were injected with different activities of 243244Cm so that the long-term biological effects could be evaluated. Effective skeletal retention equations were used to calculate the cumulative mean skeletal dose in rad at 140 days before death in each group of mice. The primary objective of this study was to determine the relative biological effectiveness (RBE) of 243244Cm compared to 226Ra, using bone sarcoma induction at the end point. Combined data for male and female mice permitted the RBE value +/- SD for 243244Cm to be calculated as 4.4 +/- 1.8 compared to 1.0 for 226Ra. A comparison of RBE values from a previous study in this mouse strain and the value for 243244Cm from this study suggest that the trivalent actinides 241Am, /sup 243,244/Cm, and 249Cf are about three times less effective for bone sarcoma induction than 239Pu

  17. 优质花生新品种龙花243示范表现与高产栽培技术%Demonstration performance and high-yielding cultivation technique of high-quailty new variety Longhua243

    Institute of Scientific and Technical Information of China (English)

    李培德

    2011-01-01

    New peanut variety Longhua243 was bred by Longyan Agricultural Science Institute,Fujian Province and demonstrated in Shishi City.This cultivar displayed traits of high yield,good quality,uniformity of population and strong vitality.This paper concluded high-yield cultivation techniques including selection of seeds,optimization of sowing technology,fertilizer and water management,disease and pest control,etc.%龙花243系龙岩市农业科学研究所育成的优质花生新品种,在石狮市引进龙花243进行示范种植,表现丰产性和稳产性较好,植株整齐、长势较好等特点。总结出精选种子、优化播种技术、科学施肥、科学管水、加强病虫害防治等高产配套技术。

  18. Competence of alpha spectrometry analysis algorithms used to resolve the 241Am and 243Am alpha peak overlap

    International Nuclear Information System (INIS)

    Five alpha spectrometry analysis algorithms were evaluated for their ability to resolve the 241Am and 243Am peak overlap present under typical low-level counting conditions. The major factors affecting the performance of the algorithms were identified using design-of-experiment combined with statistical analysis of the results. The study showed that the accuracy of the 241Am/243Am ratios calculated by the algorithms depends greatly on the degree of peak deformation and tailing. Despite the improved data quality obtained using an algorithm that may include peak addition and tail estimation, the accurate determination of 241Am by alpha spectrometry relies primarily on reduction of peak overlap rather than on algorithm selection

  19. Re-evaluation of neutron nuclear data for 242mAm, 243Am, 99Tc and140Ce

    International Nuclear Information System (INIS)

    The evaluated nuclear data given in JENDL-3.2 were compared with other evaluated data sets and available experimental data, for important minor actinides of 242mAm and 243Am, and fission product nuclides of 99Tc and 140Ce. Since problems were found as a result of the comparison, the data of JENDL-3.2 were improved for these nuclides. It was found that the evaluated data of Maslov et al. were superior to the others. They were adopted for 242mAm and 243Am after further improvements. For 99Tc and 140Ce, resonance parameters and optical model parameters were improved. The cross sections of these two nuclides in the smooth part were re-calculated. The present results were given in the neutron energy range from 10-5 eV to 20 MeV in the ENDF-6 format, and adopted to JENDL-3.3. (author)

  20. The influence of impurities for cross section measurement of {sup 241,243}Am(n,f) reactions

    Energy Technology Data Exchange (ETDEWEB)

    Kai, Tetsuya; Kobayashi, Katsuhei; Yamamoto, Shuji; Fujita, Yoshiaki; Kimura, Itsuro; Miyoshi, Mitsuharu; Yamamoto, Hideki [Kyoto Univ. (Japan); Shinohara, Nobuo

    1997-03-01

    The influence of the impurities on the fission cross section measurements for {sup 241}Am and {sup 243}Am has been investigated with the practical results. Following cases have been considered as the influence of impurities; (a) experiments with the {sup 241}Am sample that contains impurities originally, and (b) experiments with the {sup 243}Am sample that contains impurities produced by {alpha}, {beta} decays after the chemical purification. The present study has demonstrated the usefulness of pure samples by the comparison of the experiments using the sample on the market with those using the pure sample processed by the authors. Particularly on the case (b), the correction of the impurity through the periodical measurements was experimentally performed (about 18% around 0.3 eV in 4 weeks after the chemical purification). (author)

  1. Reaction mechanisms in 24.3 MeV/nucleon 238U induced reactions through a comprehensive study of fission

    International Nuclear Information System (INIS)

    Nuclear reaction mechanisms for system characterized by very different asymmetries (U+C, Si, Ni, Au) have been investigated at 24.3 MeV/nucleon, using as observables both the fission products and the neutron multiplicity. It is clearly observed that the fusion process-whatever its completeness- can only occur with rather light target nuclei, indicating the persistence of potential energy effects much above the interaction barrier. (authors). 22 refs., 1 fig

  2. Overview of NATO/AC 243/Panel 3 activities concerning radiowave propagation in coastal environments

    Science.gov (United States)

    Christophe, F.; Douchin, N.; Hurtaud, Y.; Dion, D.; Makaruschka, R.; Heemskerk, H.; Anderson, K.

    1995-02-01

    The performances of most systems operating at RF and millimeter waves can be seriously affected by propagation effects. That is the reason why NATO established the Research Study group No. 8 (RSG8) within Panel 3 (physics and electronics) of Defense Research Group (AC 243), with its Propagation Subgroup (PSG) responsible for the propagation aspects. Comparison of mm and other wavelengths was to be considered. In maritime and coastal environments, the use of such wavelengths for various military applications like anti-ship seekers, fire control radars, ship to ship communications or Electronic Support Measurements (ESM) led to the setting up of specific measurement campaigns; the last three are reported hereafter. The first two experiments used facilities close to Lorient, on the Atlantic coast, and Toulon, on the Mediterranean coast of France, with the purpose of documenting the refractive effects for medium range over the horizon paths. These experiments where are referred to as Lorient 89 and Toulon 90 campaigns, are described in this paper, and some typical results are presented. The latest cooperative work of RSG8/PSG took place recently (fall 1993) near Lorient, on a line-of-sight 10 km path over seawater. This experiment, referred to as Lorient 93 campaign, was devoted to the analysis of phase-front distortions due to multipath along with refractive effects, and to the assessment of performances for naval systems like short range tracking radars. Analysis of the data, either on a statistical base or as specific case studies, is being performed presently, but some early typical results will be given in this paper after a detailed description of the experiment.

  3. 30 CFR 243.6 - When must I or another person meet the bonding or financial solvency requirements under this part?

    Science.gov (United States)

    2010-07-01

    ... MANAGEMENT SERVICE, DEPARTMENT OF THE INTERIOR MINERALS REVENUE MANAGEMENT SUSPENSIONS PENDING APPEAL AND BONDING-MINERALS REVENUE MANAGEMENT General Provisions § 243.6 When must I or another person meet...

  4. 30 CFR 243.9 - Will MMS continue to suspend my obligation to comply with an order if I seek judicial review in a...

    Science.gov (United States)

    2010-07-01

    ... MINERALS MANAGEMENT SERVICE, DEPARTMENT OF THE INTERIOR MINERALS REVENUE MANAGEMENT SUSPENSIONS PENDING APPEAL AND BONDING-MINERALS REVENUE MANAGEMENT General Provisions § 243.9 Will MMS continue to suspend...

  5. The chiral transition on a 243 x 10 lattice with Nf = 2 clover sea quarks studied by overlap valence quarks

    International Nuclear Information System (INIS)

    Overlap fermions are particularly well suited to study the finite temperature dynamics of the chiral symmetry restoration transition of QCD, which might be just an analytic crossover. Using gauge field configurations on a 243 x 10 lattice with Nf=2 flavours of dynamical Wilson-clover quarks generated by the DIK collaboration, we compute the lowest 50 eigenmodes of the overlap Dirac operator and try to locate the transition by fermionic means. We analyse the spectral density, local chirality and localisation properties of the low-lying modes and illustrate the changing topological and (anti-) selfdual structure of the underlying gauge fields across the transition. (orig.)

  6. On the radio properties of the intermediate-mass black hole candidate ESO 243-49 HLX-1

    OpenAIRE

    Cseh, D.; Webb, N. A.; Godet, O.; D. Barret(IRAP, Toulouse, France); Corbel, S.; Coriat, M.; Falcke, H.; Farrell, S. A.; Körding, E.; Lenc, E.; Wrobel, J. M.

    2014-01-01

    We present follow-up radio observations of ESO 243-49 HLX-1 from 2012 using the Australia Telescope Compact Array (ATCA) and the Karl G. Jansky Very Large Array (VLA). We report the detection of radio emission at the location of HLX-1 during its hard X-ray state using the ATCA. Assuming that the `Fundamental Plane' of accreting black holes is applicable, we provide an independent estimate of the black hole mass of $M_{\\rm{BH}}\\leq2.8^{+7.5}_{-2.1} \\times 10^{6}$ M$_{\\odot}$ at 90% confidence....

  7. Discovery of an optical counterpart to the hyperluminous X-ray source in ESO 243-49

    CERN Document Server

    Soria, Roberto; Graham, Alister W; Kong, Albert K H; Kuin, N Paul M; Li, I-Hui; Liu, Ji-Feng; Wu, Kinwah

    2009-01-01

    The existence of black holes of masses ~ 10^3-10^4 Msun has important implications for the formation and evolution of star clusters and galaxies. The strongest candidate so far is the hyperluminous X-ray source HLX1, apparently located in the S0-a galaxy ESO 243-49, but the lack of an identifiable optical counterpart had hampered its interpretation. Using the Magellan telescope, we discovered an unresolved optical source with R = (24.6 +/- 0.2) mag and V = (25.4 +/- 0.3) mag within the X-ray error circle. This implies an X-ray/optical flux ratio ~ 1000. Taking the same distance as ESO 243-49, we obtain an intrinsic brightness M_R = (-10.2 +/- 0.3) mag. With the combined optical and X-ray measurements, we put constraints on the nature of HLX1. We rule out a foreground star and a background AGN. A foreground accreting neutron star is unlikely but cannot be completely ruled out. We also examined the properties of the host galaxy by combining Swift/UVOT observations with stellar population modelling. We found tha...

  8. Recoil-alpha-fission and recoil-alpha-alpha-fission events observed in the reaction Ca-48 + Am-243

    CERN Document Server

    Forsberg, U; Andersson, L -L; Di Nitto, A; Düllmann, Ch E; Gates, J M; Golubev, P; Gregorich, K E; Gross, C J; Herzberg, R -D; Hessberger, F P; Khuyagbaatar, J; Kratz, J V; Rykaczewski, K; Sarmiento, L G; Schädel, M; Yakushev, A; Åberg, S; Ackermann, D; Block, M; Brand, H; Carlsson, B G; Cox, D; Derkx, X; Dobaczewski, J; Eberhardt, K; Even, J; Fahlander, C; Gerl, J; Jäger, E; Kindler, B; Krier, J; Kojouharov, I; Kurz, N; Lommel, B; Mistry, A; Mokry, C; Nazarewicz, W; Nitsche, H; Omtvedt, J P; Papadakis, P; Ragnarsson, I; Runke, J; Schaffner, H; Schausten, B; Shi, Y; Thörle-Pospiech, P; Torres, T; Traut, T; Trautmann, N; Türler, A; Ward, A; Ward, D E; Wiehl, N

    2015-01-01

    Products of the fusion-evaporation reaction Ca-48 + Am-243 were studied with the TASISpec set-up at the gas-filled separator TASCA at the GSI Helmholtzzentrum f\\"ur Schwerionenforschung. Amongst the detected thirty correlated alpha-decay chains associated with the production of element Z=115, two recoil-alpha-fission and five recoil-alpha-alpha-fission events were observed. The latter are similar to four such events reported from experiments performed at the Dubna gas-filled separator. Contrary to their interpretation, we propose an alternative view, namely to assign eight of these eleven decay chains of recoil-alpha(-alpha)-fission type to start from the 3n-evaporation channel 115-288. The other three decay chains remain viable candidates for the 2n-evaporation channel 115-289.

  9. New data from the 243Am + 48Ca reaction give cross-bombardment verification of elements 113, 115 and 117

    International Nuclear Information System (INIS)

    The reaction 243Am + 48Ca has been reinvestigated to provide new evidence for the discovery of elements 113, 115. Twenty eight new 288115 decay chains were detected in this reaction to increase from three to 31 the number of 288115 atoms observed. In addition, four new decay chains were observed for the first time and assigned to the decay of 289115. These new 289115 events have the same properties for their decay chains as those observed for 289115 populated in the alpha decay of 293117 produced in the 249Bk + 48Ca reaction to provide cross-bombardment evidence. These new high statistics data sets and the cross-bombardment agreement provide definitive evidence for the discoveries of the new elements with Z = 113, 115, 117.

  10. Viscosity Measurements of Ethyl Fluoride (R161) from 243 K to 363 K at Pressures up to 30 MPa

    Science.gov (United States)

    Meng, Xianyang; Gu, Xiaoyun; Wu, Jiangtao; Bi, Shengshan

    2015-11-01

    The Montreal Protocol and its subsequent amendments have created a schedule to replace ozone depletion substances, such as chlorofluorocarbons and hydrochlorofluorocarbons, with chlorine-free molecules in several industrial applications. Ethyl fluoride (R161, C2H5F, 353-36-6) was found to be a potential alternative refrigerant for the replacement of controlled substances, such as R22 with excellent cycle performance. In this work, the viscosity of ethyl fluoride is reported at temperatures from 243 K to 363 K and at pressures from saturation pressure to 30 MPa. The experiment was performed with a calibrated vibrating-wire viscometer, which exhibited a combined expanded uncertainty of 2.5 % with a level of confidence of 0.95 (k = 2) for such a fluid. A scheme based on a hard-spheres model was used to correlate the experimental results. The average absolute deviation of the experimental results from the correlations for R161 is 0.88 %.

  11. 30 CFR 243.7 - What must a person do when posting a bond or other surety instrument or demonstrating financial...

    Science.gov (United States)

    2010-07-01

    ....7 Mineral Resources MINERALS MANAGEMENT SERVICE, DEPARTMENT OF THE INTERIOR MINERALS REVENUE MANAGEMENT SUSPENSIONS PENDING APPEAL AND BONDING-MINERALS REVENUE MANAGEMENT General Provisions § 243.7 What...(a), or any other theory, as a defense if MMS calls your bond or requires you to pay based on...

  12. Coulomb fission of 238U in the interaction of 24.3 MeV/nucleon 238U with 197Au

    International Nuclear Information System (INIS)

    Coulomb fission of 238U has been studied in the interaction of a 24.3 MeV/nucleon U beam with an Au target. A novel experimental approach is followed, allowing to isolate the Coulomb fission from the nuclear fission on an event by event basis. The Z distribution of the fragments is studied for both fission processes. (author)

  13. Synthesis of 24S and 24R-hydroxy-[24-3H] vitamin D3 and their metabolism in rachitic rats

    International Nuclear Information System (INIS)

    An epimeric mixture of 24-hydroxy-[24-3H] vitamin D3 was synthesized by the reduction of 24-ketovitamin D3 by sodium borotritide. The epimeric mixture was converted to the trimethylsilylether derivatives and subjected to high-pressure liquid chromatography using silica gel columns to separate the 24-hydroxy-[24-3H] vitamin D3 isomers. The 24R-hydroxy-[24-3H]vitamin D3 induced calcification in rachitic rats while the 24S-hydroxy-[24-3H]vitamin D3 had little or no such activity. As both isomers of 24-hydroxy-vitamin D3 are metabolized to 24,25-dihydroxyvitamin D3, it appears that the 24-hydroxyvitamin D3-25-hydroxylase does not discriminate between the isomers. Only the R-isomer of 24-hydroxyvitamin D3 is metabolized to 1,24-dihydroxyvitamin D3, although only trace amounts of this compound were found 2 days after the administration of 24-hydroxyvitamin D3. The striking difference in the metabolism of the isomers is the high selectivity of the 1-hydroxylase for the R-isomer. It is suggested that the high specificity of biological activity for the R-isomer of 24-hydroxyvitamin D3 is because of the specificity of the 1-hydroxylation of 24,25-dihydroxyvitamin D3 for the R configuration

  14. 243例双J管内引流的并发症和处置%Complications and treatment for internal drainage with double-J tube in 243 cases

    Institute of Scientific and Technical Information of China (English)

    鄢俊安; 杨超; 张恒; 沈文浩; 李龙坤; 陈志文; 周占松; 李为兵

    2011-01-01

    Objective To anatyze the comptications of internat drainage with doubte-J tube and to discuss ihe disposat programs. Methods The comptications of 243 patients who underwent internat drainage with doubte-J tube from 2008 to 2010 in our institute were ret-rospectivety anatyzed and the disposat programs were discussed. Resutts There were seven kinds of comptications inctuding discomfort of tocation (72 cases,29. 6% ) , bteeding (34 cases, 14. 0% ) , catcutus in tube watt( 19 cases,7. 8% ) , reftux ( 32 cases, 13. 2% ) , infection (47 cases,19. 3% ) ,painfutness (36 cases, 14. 8% ) ,doubte-J tube rupture (3 cases, 1. 2% ) , etc. Att of them were given symptomatic treatment. Conctusion The tocations shoutd be adjusted according to the conditions in the ptacement of doubte-J tube. The doubte-J tube shoutd be removed immediatety if comptications of severe infection,urinary reftux and hematuria occurred.%目的 分析双J管内引流的并发症,探讨其处置方案.方法 对2008年至2010年在我院诊治置入双J管的部分病例所发的并发症进行回顾性分析,探讨和总结处置方式.结果 243例双J管内引流所致的并发症主要有7种,包括位置不适(72例,29.6%)、出血(34例,14.0%)、管壁伴发结石(19例,7.8%)、返流(32例,13.2%)、感染(47例,19.3%)、疼痛(36例,14.8%)、双J管断裂(3例,1.2%)等,分别给予了对症处理.结论 在双J管留置体内过程中根据情况调整双J管的位置,若产生严重的感染、尿液返流、血尿等并发症时,宜尽早拔除双J管.

  15. Hidrocefalia derivada na infância: um estudo clínico-epidemiológico de 243 observações consecutivas Shunted hydrocephalus in childhood: an epidemiological study of 243 consecutive observations

    Directory of Open Access Journals (Sweden)

    Susana Ely Kliemann

    2005-06-01

    Full Text Available Os objetivos deste estudo foram analisar as características epidemiológicas e clínicas de 243 crianças com hidrocefalia derivada, acompanhadas durante 1 a 27 anos, assim como identificar os fatores relacionados aos distúrbios psicomotores, epilepsia e ao óbito. A meningite pós-derivação e os distúrbios mecânicos do sistema foram as complicações mais freqüentes (22,3% e 30,7%, respectivamente. A média de derivação por paciente foi 1,47. Distúrbios motores graves ocorreram em 34,3%, déficit cognitivo em 58,5% e epilepsia em 43,6% dos pacientes. Os distúrbios motores correlacionaram-se positivamente com o grau da hidrocefalia. Houve maior incidência de déficit cognitivo e epilepsia nos casos de hidrocefalia pós-meningite. O óbito ocorreu em 52 pacientes e estes apresentaram um percentual maior de neoplasia do sistema nervoso central e de distúrbios motores na última avaliação, assim como de retirada da primeira derivação por meningite precoce, ocorrida até 2 meses após a derivação.This study aimed to evaluate the epidemiological and clinical data of 243 children with shunted hydrocephalus, followed-up during 1 to 27 years, as well as to identify the risk factors for psychomotor disturbances, epilepsy and death. Postoperative meningitis and mechanical problems were the most frequent complications (22.3% and 30.7%, respectively. There was an average of 1.47 shunt per patient. Severe motor disturbances occurred in 34.3%, cognitive deficits in 58.5% and epilepsy in 43.6%. Motor disturbances correlated positively with the degree of hydrocephalus. The majority of patients with hydrocephalus due to meningitis presented cognitive deficits and a significant incidence of epilepsy. Death occurred in 52 patients and there was a higher percentage of brain tumours in this group, as well as the replacement of the first shunt device due to precocious postoperative meningitis.

  16. 243例乳腺癌患者配偶照顾负担及影响因素研究%The level and influencing factors of caregiver burden among 243 spouses of women with breast cancer

    Institute of Scientific and Technical Information of China (English)

    邾萍; 付菊芳; 王波; 林静; 凌瑞; 郭丝锦; 房宁宁; 王丹丹

    2013-01-01

    Objective To investigate the level and influencing factors of spouse caregiver burden of women with breast cancer.Methods Totally 243 spouses of women with breast cancer were investigated with Zarit Burden Interview (ZBI)and Social Support Rating Scale (SSRS).The patients were investigated with M.D.Anderson Symptom Inventory(MDASI-C).Results The spouse caregiver burden was in the middle level with a total score of 33.99±14.28.The influencing factors were life stress events,subjective support,daily sleep time of spouses,the symptom severity and cancer stage of patients and monthly family income.Conclusion The spouse caregivers of women with breast cancer suffer from middle level of burden.Nurses should assess the caregiver burden and provide targeted interventions to relieve spouse caregiver burden and promote their quality of life.%目的 了解乳腺癌患者配偶照顾负担现状及影响因素.方法 对243例乳腺癌患者配偶照顾者采用照顾负担量表(ZBI)、社会支持量表(SSRS)进行调查,对患者采用安德森症状量表(MDSAI-C)进行调查.结果 配偶照顾负担总分为(33.99±14.28)分,为中度负担水平.影响因素为配偶生活应激事件、主观支持、睡眠时间、患者症状严重程度和肿瘤分期、家庭人均月收入.结论 乳腺癌患者配偶存在中度照顾负担,护理人员应通过同步评估患者与配偶,了解配偶的照顾负担,主动给予配偶照顾者针对性的护理服务,从而减轻其照顾负担,提高其生活质量.

  17. Experimental and theoretical study of the photodissociation reaction of thiophenol at 243 nm: Intramolecular orbital alignment of the phenylthiyl radical

    Science.gov (United States)

    Lim, Ivan S.; Lim, Jeong Sik; Lee, Yoon Sup; Kim, Sang Kyu

    2007-01-01

    The photoinduced hydrogen (or deuterium) detachment reaction of thiophenol (C6H5SH) or thiophenol-d1 (C6H5SD) pumped at 243nm has been investigated using the H (D) ion velocity map imaging technique. Photodissociation products, corresponding to the two distinct and anisotropic rings observed in the H (or D) ion images, are identified as the two lowest electronic states of phenylthiyl radical (C6H5S•). Ab initio calculations show that the singly occupied molecular orbital of the phenylthiyl radical is localized on the sulfur atom and it is oriented either perpendicular or parallel to the molecular plane for the ground (B1) and the first excited state (B2) species, respectively. The experimental energy separation between these two states is 2600±200cm-1 in excellent agreement with the authors' theoretical prediction of 2674cm-1 at the CASPT2 level. The experimental anisotropy parameter (β) of -1.0±0.05 at the large translational energy of D from the C6H5SD dissociation indicates that the transition dipole moment associated with this optical transition at 243nm is perpendicular to the dissociating S-D bond, which in turn suggests an ultrafast D +C6H5S•(B1) dissociation channel on a repulsive potential energy surface. The reduced anisotropy parameter of -0.76±0.04 observed at the smaller translational energy of D suggests that the D +C6H5S•(B2) channel may proceed on adiabatic reaction paths resulting from the coupling of the initially excited state to other low-lying electronic states encountered along the reaction coordinate. Detailed high level ab initio calculations adopting multireference wave functions reveal that the C6H5S•(B1) channel may be directly accessed via a (nπ,σ*)1 photoexcitation at 243nm while the key feature of the photodissociation dynamics of the C6H5S•(B2) channel is the involvement of the (nπ,π*)3→(nσ,σ*)3 profile as well as the spin-orbit induced avoided crossing between the ground and the (nπ,σ*)3 state. The S-D bond

  18. Experimental and theoretical study of the photodissociation reaction of thiophenol at 243 nm: Intramolecular orbital alignment of the phenylthiyl radical

    International Nuclear Information System (INIS)

    The photoinduced hydrogen (or deuterium) detachment reaction of thiophenol (C6H5SH) or thiophenol-d1 (C6H5SD) pumped at 243 nm has been investigated using the H (D) ion velocity map imaging technique. Photodissociation products, corresponding to the two distinct and anisotropic rings observed in the H (or D) ion images, are identified as the two lowest electronic states of phenylthiyl radical (C6H5S·). Ab initio calculations show that the singly occupied molecular orbital of the phenylthiyl radical is localized on the sulfur atom and it is oriented either perpendicular or parallel to the molecular plane for the ground (B1) and the first excited state (B2) species, respectively. The experimental energy separation between these two states is 2600±200 cm-1 in excellent agreement with the authors' theoretical prediction of 2674 cm-1 at the CASPT2 level. The experimental anisotropy parameter (β) of -1.0±0.05 at the large translational energy of D from the C6H5SD dissociation indicates that the transition dipole moment associated with this optical transition at 243 nm is perpendicular to the dissociating S-D bond, which in turn suggests an ultrafast D+C6H5S·(B1) dissociation channel on a repulsive potential energy surface. The reduced anisotropy parameter of -0.76±0.04 observed at the smaller translational energy of D suggests that the D+C6H5S·(B2) channel may proceed on adiabatic reaction paths resulting from the coupling of the initially excited state to other low-lying electronic states encountered along the reaction coordinate. Detailed high level ab initio calculations adopting multireference wave functions reveal that the C6H5S·(B1) channel may be directly accessed via a 1(nπ,σ*) photoexcitation at 243 nm while the key feature of the photodissociation dynamics of the C6H5S·(B2) channel is the involvement of the 3(nπ,π*)→3(nσ,σ*) profile as well as the spin-orbit induced avoided crossing between the ground and the 3(nπ,σ*) state. The S-D bond

  19. On the radio properties of the intermediate-mass black hole candidate ESO 243-49 HLX-1

    CERN Document Server

    Cseh, D; Godet, O; Barret, D; Corbel, S; Coriat, M; Falcke, H; Farrell, S A; Koerding, E; Lenc, E; Wrobel, J M

    2014-01-01

    We present follow-up radio observations of ESO 243-49 HLX-1 from 2012 using the Australia Telescope Compact Array (ATCA) and the Karl G. Jansky Very Large Array (VLA). We report the detection of radio emission at the location of HLX-1 during its hard X-ray state using the ATCA. Assuming that the `Fundamental Plane' of accreting black holes is applicable, we provide an independent estimate of the black hole mass of $M_{\\rm{BH}}\\leq2.8^{+7.5}_{-2.1} \\times 10^{6}$ M$_{\\odot}$ at 90% confidence. However, we argue that the detected radio emission is likely to be Doppler-boosted and our mass estimate is an upper limit. We discuss other possible origins of the radio emission such as being due to a radio nebula, star formation, or later interaction of the flares with the large-scale environment. None of these were found adequate. The VLA observations were carried out during the X-ray outburst. However, no new radio flare was detected, possibly due to a sparse time sampling. The deepest, combined VLA data suggests a ...

  20. Neutron capture cross section measurements of $^{238}$U, $^{241}$Am and $^{243}$Am at n_TOF

    CERN Document Server

    Koehler, P E; Plag, R

    The increase of the world energy demand and the need of low carbon energy sources have triggered the renaissance and/or enhancement of nuclear energy in many countries. Fundamental nuclear physics can contribute in a practical way to the sustainability and safety of the nuclear energy production and the management of the nuclear waste. There exists a series of recent studies which address the most relevant isotopes, decay data, nuclear reaction channels and energy ranges which have to be investigated in more detail for improving the design of different advanced nuclear systems [1] and nuclear fuel cycles [2]. In this proposal, we aim at the measurement of the neutron capture cross sections of $^{238}$U, $^{241}$Am and $^{243}$Am. All three isotopes are listed in the NEA High Priority Request List [37], are recommended for measurements [1] and play an important role in the nuclear energy production and fuel cycle scenarios. The measurements will provide as well valuable nuclear structure data necessary for the...

  1. A large early-onset Alzheimer`s disease pedigree linked to chromosome 14q24.3

    Energy Technology Data Exchange (ETDEWEB)

    Hannequin, D. [CHU de Rouen (France); Campion, D. [INSERM, U155 Paris (France); Brice, A. [INSERM U289, Paris (France)] [and others

    1994-09-01

    A large French pedigree including 34 subjects with early-onset progressive dementia was identified. In patients, the mean age-at-onset was 46 {plus_minus} 3.5 (SD) years and the mean age at death 52.6 {plus_minus} 5.7 (SD) years. No evidence for anticipation or genetic imprinting was found. Twelve patients were clinically diagnosed as probable Alzheimer`s disease (AD) according to the NINCDS-ADRDA criteria. Myoclonus and extrapyramidal signs were common and seizures were found in all affected subjects. At autopsy, neuropathological changes typical of AD were present in two brains. A significant lod score of 5.38 was observed at a recombination fraction of {theta} = 0.0 with the genetic marker D14S43, thereby establishing that the responsible gene was located on chromosome 14q24.3. Furthermore, no obligate recombinant was observed with markers D14S77 and D14S71. Typing other genetic markers in this region will allow us to localize more precisely the pathological gene.

  2. Gender Difference in Prevalence of Signs and Symptoms of Temporomandibular Joint Disorders: A Retrospective Study on 243 Consecutive Patients

    Directory of Open Access Journals (Sweden)

    Bora Bagis, Elif Aydogan Ayaz, Sedanur Turgut, Rukiye Durkan, Mutlu Özcan

    2012-01-01

    Full Text Available Background: This study evaluated the prevalence of the signs and symptoms of temporomandibular joint disorder (TMD among patients with TMD symptoms. Methods: Between September 2011 and December 2011, 243 consecutive patients (171 females, 72 males, mean age 41 years who were referred to the Department of Prosthodontics, Faculty of Dentistry, Karadeniz Technical University, Trabzon were examined physically and completed a questionnaire regarding age, gender, social status, general health, antidepressant drug usage, dental status, limited mouth opening, temporomandibular joint (TMJ sounds, and parafunctions (bruxism, clenching. The data were analyzed using the chi-square test and binary logistic regression model (alpha = 0.05. Results: With a frequency of 92%, pain in the temporal muscle was the most common symptom, followed by pain during mouth opening (89% in both genders. TMJ pain at rest, pain in the masseter muscle, clicking, grinding, and anti-depressant use were significantly more frequent in females than males. Age (p=0.006; odds ratio 0.954; 95% CI 0.922-0.987 and missing teeth (p=0.003; odds ratio 3.753; 95% CI 1.589-8.863 had significant effects on the prevalence of TMD. Conclusion: Females had TMD signs and symptoms more frequently than males in the study population. The most common problem in both genders was pain.

  3. Fission-product yields for thermal-neutron fission of 243Cm determined from measurements with a high-resolution low-energy germanium gamma-ray detector

    International Nuclear Information System (INIS)

    Cumulative fission-product yields have been determined for 13 gamma rays emitted during the decay of 12 fission products created by thermal-neutron fission of 243Cm. A high-resolution low-energy germanium detector was used to measure the pulse-height spectra of gamma rays emitted from a 77-nanogram sample of 243Cm after the sample had been irradiated by thermal neutrons. Analysis of the data resulted in the identification and matching of gamma-ray energies and half-lives to individual radioisotopes. From these results, 12 cumulative fission product yields were deduced for radionuclides with half-lives between 4.2 min and 84.2 min. 7 references

  4. Novel heterozygous C243Y A20/TNFAIP3 gene mutation is responsible for chronic inflammation in autosomal-dominant Behçet's disease

    Science.gov (United States)

    Shigemura, Tomonari; Kaneko, Naoe; Kobayashi, Norimoto; Kobayashi, Keiko; Takeuchi, Yusuke; Nakano, Naoko; Masumoto, Junya; Agematsu, Kazunaga

    2016-01-01

    Objective Although Behçet's disease (BD) is a chronic inflammatory disorder of uncertain aetiology, the existence of familial BD with autosomal-dominant traits suggests that a responsibility gene (or genes) exists. We investigated a Japanese family with a history of BD to search for pathogenic mutations underlying the biological mechanisms of BD. Methods 6 patients over 4 generations who had suffered from frequent oral ulcers, genital ulcers and erythaema nodosum-like lesions in the skin were assessed. Whole-exome sequencing was performed on genomic DNA, and cytokine production was determined from stimulated mononuclear cells. Inflammatory cytokine secretion and Nod2-mediated NF-κB activation were analysed using the transfected cells. Results By whole-exome sequencing, we identified a common heterozygous missense mutation in A20/TNFAIP3, a gene known to regulate NF-κB signalling, for which all affected family members carried a heterozygous C243Y mutation in the ovarian tumour domain. Mononuclear cells obtained from the proband and his mother produced large amounts of interleukin 1β, IL-6 and tumour necrosis factor α (TNF-a) on stimulation as compared with those from normal controls. Although inflammatory cytokine secretion was suppressed by wild-type transfected cells, it was suppressed to a much lesser extent by mutated C243Y A20/TNFAIP3-transfected cells. In addition, impaired suppression of Nod2-mediated NF-κB activation by C243Y A20/TNFAIP3 was observed. Conclusions A C243Y mutation in A20/TNFAIP3 was likely responsible for increased production of human inflammatory cytokines by reduced suppression of NF-κB activation, and may have accounted for the autosomal-dominant Mendelian mode of BD transmission in this family. PMID:27175295

  5. Molecular cloning of t(2;7)(p24.3;p14.2), a novel chromosomal translocation in myelodysplastic syndrome-derived acute myeloid leukemia.

    Science.gov (United States)

    Fujita, Kazuhiro; Sanada, Masashi; Harada, Hiroshi; Mori, Hiraku; Niikura, Haruo; Omine, Mitsuhiro; Inazawa, Johji; Imoto, Issei

    2009-06-01

    In this study, we report the molecular structure of the breakpoint region in a new chromosomal translocation, t(2;7)(p24.3;p14.2), in a case of acute myeloid leukemia transformed from myelodysplastic syndrome (MDS). An extensive fluorescence in situ hybridization (FISH) analysis showed that NAG (2p24.3) and ELMO1 (7p14.2) were involved at the breakpoints of t(2;7)(p24.3;p14.2). Furthermore, we detected a novel chimeric transcript consisting of NAG and ELMO1. Interestingly, this transcript encoded a truncated molecular form of 3'ELMO1 as the result of a frameshift caused by the chromosomal translocation. Although this study does not provide direct evidence that a defect in NAG-ELMO1 plays a role in the pathogenesis or the leukemic change in MDS, it does suggest that defects in NAG-ELMO1 potentially contributed to the leukemic progression in this case. PMID:19407829

  6. Ceftaroline versus isolates from animal bite wounds: comparative in vitro activities against 243 isolates, including 156 Pasteurella species isolates.

    Science.gov (United States)

    Goldstein, Ellie J C; Citron, Diane M; Merriam, C Vreni; Tyrrell, Kerin L

    2012-12-01

    More than 5 million Americans are bitten by animals, usually dogs, annually. Bite patients comprise ∼1% of all patients who visit emergency departments (300,000/year), and approximately 10,000 require hospitalization and intravenous antibiotics. Ceftaroline is the bioactive component of the prodrug ceftaroline fosamil, which is FDA approved for the treatment of acute bacterial skin and skin structure infections (ABSSSIs), including those containing methicillin-resistant Staphylococcus aureus (MRSA). There are no in vitro data about the activity of ceftaroline against Pasteurella multocida subsp. multocida and Pasteurella multocida subsp. septica, other Pasteurella spp., or other bite wound isolates. We therefore studied the in vitro activity of ceftaroline against 243 animal bite isolates. MICs were determined using the broth microdilution method according to CLSI guidelines. Comparator drugs included cefazolin, ceftriaxone, ertapenem, ampicillin-sulbactam, azithromycin, doxycycline, and sulfamethoxazole-trimethoprim (SMX-TMP). Ceftaroline was the most active agent against all 5 Pasteurella species, including P. multocida subsp. multocida and P. multocida subsp. septica, with a maximum MIC of ≤0.008 μg/ml; more active than ceftriaxone and ertapenem (MIC(90)s, ≤0.015 μg/ml); and more active than cefazolin (MIC(90), 0.5 μg/ml) doxycycline (MIC(90), 0.125 μg/ml), azithromycin (MIC(90), 0.5 μg/ml), ampicillin-sulbactam (MIC(90), 0.125 μg/ml), and SMX-TMP (MIC(90), 0.125 μg/ml). Ceftaroline was also very active against all S. aureus isolates (MIC(90), 0.125 μg/ml) and other Staphylococcus and Streptococcus species, with a maximum MIC of 0.125 μg/ml against all bite isolates tested. Ceftaroline has potential clinical utility against infections involving P. multocida, other Pasteurella species, and aerobic Gram-positive isolates, including S. aureus. PMID:23027193

  7. Measurement of the neutron-induced fission cross-section of 243Am relative to 235U from 0.5 to 20 MeV

    International Nuclear Information System (INIS)

    The ratio of the neutron-induced fission cross-sections of 243Am and 235U was measured in the energy range from 0.5 to 20 MeV with uncertainties of ∼ 4%. The experiment was performed at the CERN nTOF facility using a fast ionization chamber. With the good counting statistics that could be achieved thanks to the high instantaneous flux and the low backgrounds, the present results are useful for resolving discrepancies in previous data sets and are important for future reactors with improved fuel burn-up. (orig.)

  8. Measurement of the neutron-induced fission cross-section of {sup 243}Am relative to {sup 235}U from 0.5 to 20 MeV

    Energy Technology Data Exchange (ETDEWEB)

    Belloni, F.; Milazzo, P.M.; Abbondanno, U.; Fujii, K.; Moreau, C. [Istituto Nazionale di Fisica Nucleare, Trieste (Italy); Calviani, M. [Laboratori Nazionali di Legnaro, Istituto Nazionale di Fisica Nucleare, Legnaro (Italy); CERN, Geneva (Switzerland); Colonna, N.; Barbagallo, M.; Marrone, S.; Meaze, M.H.; Tagliente, G.; Terlizzi, R. [Istituto Nazionale di Fisica Nucleare, Bari (Italy); Mastinu, P.; Gramegna, F. [Lab. Nazionali di Legnaro, Istituto Nazionale di Fisica Nucleare, Legnaro (Italy); Aerts, G.; Andriamonje, S.; Berthoumieux, E.; Dridi, W.; Gunsing, F.; Pancin, J.; Perrot, L.; Plukis, A. [Irfu, CEA, Gif-sur-Yvette (France); Alvarez, H.; Cano-Ott, D.; Duran, I.; Embid-Segura, M.; Gonzalez-Romero, E.; Paradela, C.; Tarrio, D. [Univ. de Santiago de Compostela, Galicia (Spain); Alvarez-Velarde, F.; Guerrero, C.; Martinez, T.; Villamarin, D.; Vincente, M.C. [Centro de Investigaciones Energeticas Medioambientales y Technologicas, Madrid (Spain); Andrzejewski, J.; Marganiec, J. [Univ. of Lodz (Poland); Audouin, L.; Dillmann, I.; Heil, M.; Kaeppeler, F.; Mosconi, M.; Plag, R.; Voss, F.; Walter, S.; Wisshak, K. [Karlsruhe Inst. of Technology, Eggenstein-Leopoldshafen (Germany). Inst. fuer Kernphysik; Badurek, G.; Jericha, E.; Leeb, H.; Oberhummer, H. [Technische Univ. Wien, Atominstitut der Oesterreichischen Universitaeten, Wien (Austria); Baumann, P.; David, S.; Kerveno, M.; Lukic, S.; Rudolf, G. [IReS, Centre National de la Recherche Scientifique/IN2P3, Strasbourg (France); Becvar, F.; Krticka, M. [Charles Univ., Faculty of Mathematics and Physics, Prague (Czech Republic); Calvino, F.; Cortes, G.; Poch, A.; Pretel, C. [Univ. Politecnica de Catalunya, Barcelona (Spain); Capote, R. [NAPC/Nuclear Data Section, International Atomic Energy Agency, Vienna (Austria); Univ. de Sevilla (Spain); Carrapico, C.; Goncalves, I.; Salgado, J.; Santos, C.; Tavora, L.; Vaz, P. [Inst. Tecnologico e Nuclear, Lisbon (Portugal)] [and others

    2011-12-15

    The ratio of the neutron-induced fission cross-sections of {sup 243}Am and {sup 235}U was measured in the energy range from 0.5 to 20 MeV with uncertainties of {approx} 4%. The experiment was performed at the CERN n{sub T}OF facility using a fast ionization chamber. With the good counting statistics that could be achieved thanks to the high instantaneous flux and the low backgrounds, the present results are useful for resolving discrepancies in previous data sets and are important for future reactors with improved fuel burn-up. (orig.)

  9. Neutron-induced fission cross sections of 233U and 243Am in the energy range 0.5 Mev En 20 MeV @ n_TOF

    CERN Document Server

    Belloni, F; Milazzo, P M; Calviani, M; Colonna, N; Mastinu, P; Abbondanno, U; Aerts, G; Álvarez, H; Álvarez-Velarde, F; Andriamonje, S; Andrzejewski, J; Assimakopoulos, P; Audouin, L; Badurek, G; Baumann, P; Becvár, F; Berthoumieux, E; Calviño, F; Cano-Ott, D; Capote, R; Carrapiço, C; Cennini, P; Chepel, V; Chiaveri, E; Cortes, G; Couture, A; Cox, J; Dahlfors, M; David, S; Dillmann, I; Domingo-Pardo, C; Dridi, W; Duran, I; Eleftheriadis, C; Embid-Segura, M; Ferrant, L; Ferrari, A; Ferreira-Marques, R; Fujii, K; Furman, W; Goncalves, I; González-Romero, E; Gramegna, F; Guerrero, C; Gunsing, F; Haas, B; Haight, R; Heil, M; Herrera-Martinez, A; Igashira, M; Jericha, E; Käppeler, F; Kadi, Y; Karadimos, D; Karamanis, D; Kerveno, M; Koehler, P; Kossionides, E; Krticka, M; Lampoudis, C; Leeb, H; Lindote, A; Lopes, I; Lozano, M; Lukic, S; Marganiec, J; Marrone, S; Martínez, T; Massimi, C; Mengoni, A; Moreau, C; Mosconi, M; Neves, F; Oberhummer, H; O'Brien, S; Pancin, J; Papachristodoulou, C; Papadopoulos, C; Paradela, C; Patronis, N; Pavlik, A; Pavlopoulos, P; Perrot, L; Pigni, M T; Plag, R; Plompen, A; Plukis, A; Poch, A; Praena, J; Pretel, C; Quesada, J; Rauscher, T; Reifarth, R; Rubbia, C; Rudolf, G; Rullhusen, P; Salgado, J; Santos, C; Sarchiapone, L; Savvidis, I; Stephan, C; Tagliente, G; Tain, J L; Tassan-Got, L; Tavora, L; Terlizzi, R; Vannini, G; Vazl, P; Ventura, A; Villamarin, D; Vincente, M C; Vlachoudis, V; Vlastou, R; Voss, F; Walter, S; Wiescher, M; Wisshak, K

    2011-01-01

    Neutron-induced fission cross-sections of actinides have been recently measured at the neutron time of flight facility n_TOF at CERN in the frame of a research project involving isotopes relevant for nuclear astrophysics and nuclear technologies. Fission fragments are detected by a gas counter with good discrimination between nuclear fission products and background events. Neutron-induced fission cross-sections of 233U and 243Am were determined relative to 235U. The present paper reports the results obtained at neutron energies between 0.5 and 20 MeV.

  10. The use of isotopic correlation technique for determination of sup(241)Am and sup(243)Am concentration in nuclear irradiated fuels

    International Nuclear Information System (INIS)

    In the last years the isotopic correlation technique is emerging as a powerful tool for the determination of concentration and isotopic composition of heavy nuclides in the nuclear fuel cycle. Accordingly, this technique has gained significant importance for the safeguard of the nuclear materials as well as for the accounting and build up of actinides elements in the irradiated nuclear fuels. In this work 42 isotopic correlations between the nuclides sup(241)Am and sup(243)Am and post irradiation isotopic data of 7 samples from fuel element BE-124 and 1 sample from fuel element BE-120 from the Obrigheim pressurized water nuclear power reactor, Federal Republic of Germany, were proposed. These isotopic correlations allowed to estimate the isotopic concentrations of sup(241)Am and sup(243)Am with an average deviation, relative to the experimental data obtained from isotopic dilution mass spectrometry technique, of 10%. These results are more precise than those found using the computer code ORIGEN 2 demonstrating the great potential of this technique for the determination of isotopic concentration and build up of those nuclides in irradiated nuclear fuels. The analytical and other experimental aspects of the post irradiation isotopic analysis of nuclear fuels are also discussed. (author)

  11. De novo 14q24.2q24.3 microdeletion including IFT43 is associated with intellectual disability, skeletal anomalies, cardiac anomalies, and myopia.

    Science.gov (United States)

    Stokman, Marijn F; Oud, Machteld M; van Binsbergen, Ellen; Slaats, Gisela G; Nicolaou, Nayia; Renkema, Kirsten Y; Nijman, Isaac J; Roepman, Ronald; Giles, Rachel H; Arts, Heleen H; Knoers, Nine V A M; van Haelst, Mieke M

    2016-06-01

    We report an 11-year-old girl with mild intellectual disability, skeletal anomalies, congenital heart defect, myopia, and facial dysmorphisms including an extra incisor, cup-shaped ears, and a preauricular skin tag. Array comparative genomic hybridization analysis identified a de novo 4.5-Mb microdeletion on chromosome 14q24.2q24.3. The deleted region and phenotype partially overlap with previously reported patients. Here, we provide an overview of the literature on 14q24 microdeletions and further delineate the associated phenotype. We performed exome sequencing to examine other causes for the phenotype and queried genes present in the 14q24.2q24.3 microdeletion that are associated with recessive disease for variants in the non-deleted allele. The deleted region contains 65 protein-coding genes, including the ciliary gene IFT43. Although Sanger and exome sequencing did not identify variants in the second IFT43 allele or in other IFT complex A-protein-encoding genes, immunocytochemistry showed increased accumulation of IFT-B proteins at the ciliary tip in patient-derived fibroblasts compared to control cells, demonstrating defective retrograde ciliary transport. This could suggest a ciliary defect in the pathogenesis of this disorder. © 2016 Wiley Periodicals, Inc. PMID:26892345

  12. Thermal neutron capture cross-section measurements of 243Am and 242Pu using the new mini-INCA α- and γ-spectroscopy station

    International Nuclear Information System (INIS)

    In the framework of the Mini-INCA project, dedicated to the study of Minor Actinide transmutation process in high neutron fluxes, an α- and γ-spectroscopy station has been developed and installed at the High Flux Reactor of the Laue-Langevin Institut. This set-up allows short irradiations as well as long irradiations in a high quasi-thermal neutron flux and post-irradiation spectroscopy analysis. It is well suited to measure precisely, in reference to 59Co cross-section, neutron capture cross-sections, for all the actinides, in the thermal energy region. The first measurements using this set-up were done on 243Am and 242Pu isotopes. Cross-section values, at En=0.025eV, were found to be (81.8+/-3.6)b for 243Am and (22.5+/-1.1)b for 242Pu. These values differ from evaluated data libraries by a factor of 9% and 17%, respectively, but are compatible with the most recent measurements, validating by the way the experimental apparatus

  13. Fission Cross-section Measurements of (233)U, (245)Cm and (241,243)Am at CERN n_TOF Facility

    CERN Document Server

    Calviani, M; Andriamonje, S; Chiaveri, E; Vlachoudis, V; Colonna, N; Meaze, M H; Marrone, S; Tagliente, G; Terlizzi, R; Belloni, F; Abbondanno, U; Fujii, K; Milazzo, P M; Moreau, C; Aerts, G; Berthoumieux, E; Dridi, W; Gunsing, F; Pancin, J; Perrot, L; Plukis, A; Alvarez, H; Duran, I; Paradela, C; Alvarez-Velarde, F; Cano-Ott, D; Gonzalez-Romero, E; Guerrero, C; Martinez, T; Villamarin, D; Vicente, M C; Andrzejewski, J; Marganiec, J; Assimakopoulos, P; Karadimos, D; Karamanis, D; Papachristodoulou, C; Patronis, N; Audouin, L; David, S; Ferrant, L; Isaev, S; Stephan, C; Tassan-Got, L; Badurek, G; Jericha, E; Leeb, H; Oberhummer, H; Pigni, M T; Baumann, P; Kerveno, M; Lukic, S; Rudolf, G; Becvar, F; Krticka, M; Calvino, F; Capote, R; Carrillo De Albornoz, A; Marques, L; Salgado, J; Tavora, L; Vaz, P; Cennini, P; Dahlfors, M; Ferrari, A; Gramegna, F; Herrera-Martinez, A; Kadi, Y; Mastinu, P; Praena, J; Sarchiapone, L; Wendler, H; Chepel, V; Ferreira-Marques, R; Goncalves, I; Lindote, A; Lopes, I; Neves, F; Cortes, G; Poch, A; Pretel, C; Couture, A; Cox, J; O'brien, S; Wiescher, M; Dillman, I; Heil, M; Kappeler, F; Mosconi, M; Plag, R; Voss, F; Walter, S; Wisshak, K; Dolfini, R; Rubbia, C; Domingo-Pardo, C; Tain, J L; Eleftheriadis, C; Savvidis, I; Frais-Koelbl, H; Griesmayer, E; Furman, W; Konovalov, V; Goverdovski, A; Ketlerov, V; Haas, B; Haight, R; Reifarth, R; Igashira, M; Koehler, P; Kossionides, E; Lampoudis, C; Lozano, M; Quesada, J; Massimi, C; Vannini, G; Mengoni, A; Oshima, M; Papadopoulos, C; Vlastou, R; Pavlik, A; Pavlopoulos, P; Plompen, A; Rullhusen, P; Rauscher, T; Rosetti, M; Ventura, A

    2011-01-01

    Neutron-induced fission cross-sections of minor actinides have been measured using the n_TOF white neutron source at CERN, Geneva, as part of a large experimental program aiming at collecting new data relevant for nuclear astrophysics and for the design of advanced reactor systems. The measurements at n_TOF take advantage of the innovative features of the n_TOF facility, namely the wide energy range, high instantaneous neutron flux and good energy resolution. Final results on the fission cross-section of 233U, 245Cm and 243Am from thermal to 20 MeV are here reported, together with preliminary results for 241Am. The measurement have been performed with a dedicated Fast Ionization Chamber (FIC), a fission fragment detector with a very high efficiency, relative to the very well known cross-section of 235U, measured simultaneously with the same detector.

  14. Synthesis, characterization and biological activity of new cyclization products of 3-(4-substituted benzylidene)-2-pyrido[1,2-]pyrimidine 2,4-(3)-diones

    Indian Academy of Sciences (India)

    Abha Bishnoi; Suruchi Singh; Anil K Tiwari; Krishna Srivastava; Ram Raghuvir; Chandrakant M Tripathi

    2013-03-01

    A method is presented for the synthesis of 4-(substituted phenyl)-3-(3-substituted phenyl)4-spiro[isoxazole-5,3'-pyrido[1,2-]pyrimidine]-2',4'-dione (3), 3-(4-substituted phenyl)-3-isoxazole[3, 4-]pyrido[1,2-]pyrimidin-4-(3a)-one (4) and 3-(4-substituted phenyl) 3,3a-dihydropyrazolo[3,4-]pyrido[1,2-]pyrimidin-4-(2)-one (5) which consists of the conversion of 2-pyrido[1,2-]pyrimidine-2,4(3)-dione (1) to chalcones (2) and their 1,3-dipolar cycloaddition with appropriate aldoximes to give spiro compounds and heterocyclization using amines to yield isoxazolines and pyrazolines. All the compounds were screened for their antimicrobial and antitubercular activity.

  15. Study of the Beta-delayed multiple particle break-up of the 2.43 MeV state in Be-9

    Science.gov (United States)

    Madurga Flores, Miguel; Borge, M. J. G.; Fynbo, H. O. U.; Jonson, B.; Nyman, G.; Prezado, Y.; Riisager, K.

    The aim of this work is to study the β -delayed multiparticle break-up of the 5/2- state in 9 Be at 2.43 MeV excitation energy. This process is relevant as it has been proposed recently that this level plays a role in the α(αn,γ)9 Be reaction. This state breaks-up in 2α+n, and sequential as well as direct ("democratic") decay have previously been considered. In our work energy and direction of the two emitted α particles has been measured, while those of the neutron have been reconstructed. The sequential decay is considered using the R-matrix formalism. For the democratic decay the hyper-spherical harmonics functions are used. The different decay processes are compared with the data using the Monte-Carlo method. Our preliminary results indicate that the data is better described when democratic decay is assumed.

  16. Monozygotic twins with a de novo 0.32 Mb 16q24.3 deletion, including TUBB3 presenting with developmental delay and mild facial dysmorphism but without overt brain malformation

    DEFF Research Database (Denmark)

    Grønborg, Sabine; Kjaergaard, Susanne; Hove, Hanne;

    2015-01-01

    been associated with missense mutations in this group of genes. Here, we report two patients, monozygotic twins, carrying a de novo 0.32 Mb deletion of chromosome 16q24.3 including the TUBB3 gene. The patients presented with global developmental delay, mild facial dysmorphism, secondary microcephaly...

  17. Human glutamate pyruvate transaminase (GPT): Localization to 8q24.3, cDNA and genomic sequences, and polymorphic sites

    Energy Technology Data Exchange (ETDEWEB)

    Sohocki, M.M.; Sullivan, L.S.; Daiger, S.P. [Univ. of Texas Health Science Center, Houston, TX (United States)] [and others

    1997-03-01

    Two frequent protein variants of glutamate pyruvate transaminase (GPT) (E.C.2.6.1.2) have been used as genetic markers in humans for more than two decades, although chromosomal mapping of the GPT locus in the 1980s produced conflicting results. To resolve this conflict and develop useful DNA markers for this gene, we isolated and characterized cDNA and genomic clones of GPT. We have definitively mapped human GPT to the terminus of 8q using several methods. First, two cosmids shown to contain the GPT sequence were derived from a chromosome 8-specific library. Second, by fluorescence in situ hybridization, we mapped the cosmid containing the human GPT gene to chromosome band 8q24.3. Third, we mapped the rat gpt cDNA to the syntenic region of rat chromosome 7. Finally, PCR primers specific to human GPT amplify sequences contained within a {open_quotes}half-YAC{close_quotes} from the long arm of chromosome 8, that is, a YAC containing the 8q telomere. The human GPT genomic sequence spans 2.7 kb and consists of 11 exons, ranging in size from 79 to 243 bp. The exonic sequence encodes a protein of 495 amino acids that is nearly identical to the previously reported protein sequence of human GPT-1. The two polymorphic GPT isozymes are the result of a nucleotide substitution in codon 14. In addition, a cosmid containing the GPT sequence also contains a previously unmapped, polymorphic microsatellite sequence, D8S421. The cloned GPT gene and associated polymorphisms will be useful for linkage and physical mapping of disease loci that map to the terminus of 8q, including atypical vitelliform macular dystrophy (VMD1) and epidermolysis bullosa simplex, type Ogna (EBS1). In addition, this will be a useful system for characterizing the telomeric region of 8q. Finally, determination of the molecular basis of the GPT isozyme variants will permit PCR-based detection of this world-wide polymorphism. 22 refs., 3 figs.

  18. Deletions in 14q24.1q24.3 are associated with congenital heart defects, brachydactyly, and mild intellectual disability.

    Science.gov (United States)

    Oehl-Jaschkowitz, Barbara; Vanakker, Olivier M; De Paepe, Anne; Menten, Björn; Martin, Thomas; Weber, Georg; Christmann, Alexander; Krier, Romain; Scheid, Simone; McNerlan, Susan E; McKee, Shane; Tzschach, Andreas

    2014-03-01

    Interstitial deletions of chromosome band 14q24.1q24.3 are apparently very rare. We report on three unrelated patients with overlapping de novo deletions of sizes 5.4, 2.8, and 2.3 Mb in this region. While some clinical problems such as intestinal malrotation, cryptorchidism, and ectopic kidney were only observed in single patients, all three patients had mild intellectual disability, congenital heart defects (truncus arteriosus, pulmonary atresia, atrial septal defect, and/or ventricular septal defect), brachydactyly, hypertelorism, broad nasal bridge, and thin upper lips. Likely haploinsufficiency of one or several of the 19 genes in the common deleted interval (ACTN1, DCAF5, EXD2, GALNTL1, ERH, SLC39A9, PLEKHD1, CCDC177, KIAA0247, LOC100289511, SRSF5, SLC10A1, SMOC1, SLC8A3, ADAM21P1, COX16, SYNJ2BP, SYNJ2BP-COX16, ADAM21) was responsible for these manifestations, but apart from SMOC1, mutations in which cause autosomal recessive Waardenburg anophthalmia syndrome, and ACTN1, mutations in which are associated with congenital macrothrombocytopenia, no disease associations have so far been reported for the other genes. Functional studies and a systematic search for mutations or chromosome aberrations in this region will elucidate the role of individual genes in the clinical manifestations and will provide insight into the underlying biological mechanisms. PMID:24357125

  19. Low-Redshift Damped Lyman Alpha Galaxies Towards the Quasars B2 0827+243, PKS 0952+179, PKS 1127-145, and PKS 1629+120

    CERN Document Server

    Rao, S M; Turnshek, D A; Lane, W M; Monier, E M; Bergeron, J; Rao, Sandhya M.; Nestor, Daniel B.; Turnshek, David A.; Lane, Wendy M.; Monier, Eric M.; Bergeron, Jacqueline

    2003-01-01

    We present optical and near-infrared ground-based imaging results on four low-redshift damped Lyman alpha (DLA) galaxies. The corresponding DLA systems were discovered in our Hubble Space Telescope spectroscopic surveys for DLAs in known strong MgII absorption-line systems towards the quasars B2 0827+243 (z{DLA}=0.525), PKS 0952+179 (z{DLA}=0.239), PKS 1127-145 (z_{DLA}=0.313), and PKS 1629+120 (z{DLA}=0.532). The DLA galaxies span a mixture of morphological types from patchy, irregular, and low-surface-brightness to spiral galaxies. The luminosities range from 0.02L_K^* to 1.2L_K^*. We also discovered several extremely red objects (EROs) in two of these fields and discuss the possibility that they are associated with the DLA galaxies. These observations add to the small but growing list of DLA galaxies at low redshift. At the present time, 14 DLA galaxies in the redshift range $0.05 \\lesssim z \\lesssim 1$ have been studied. The distributions of DLA galaxy properties for these 14 cases are discussed and some ...

  20. Susceptibility to insulin-dependent diabetes mellitus maps to a locus (IDDM11) on human chromosome 14q24.3-q31

    Energy Technology Data Exchange (ETDEWEB)

    Field, L.L.; Tobias, R. [Univ. of Calgary, Alberta (Canada); Thomson, G. [Univ. of California, Berkeley, CA (United States)] [and others

    1996-04-01

    To locate genes predisposing to insulin-dependent diabetes mellitus (IDDM), an autoimmune disorder resulting from destruction of the insulin-producing pancreatic cells, we are testing linkage of IDDM susceptibility to polymorphic markers across the genome using families with two or more IDDM children. A new susceptibility locus (IDDM11) has been localized to chromosome 14q24.3-q31 by detection of significant linkage to microsatellite D14S67, using both maximum likelihood methods D14S67, using both maximum likelihood methods (LOD{sub max} = 4.0 at {theta} = 0.20) and affected sib pair (ASP) methods (P = 1 x 10{sup -5}). This represents the strongest reported evidence for linkage to any IDDM locus outside the HLA region. The subset of families in which affected children did not show increased sharing of HLA genes (HLA sharing {le}50%) provided most of the support for D14S67 linkage (LOD{sub max}4.6 at {theta} = 0.12;ASP P < 5 x 10{sup -6}). There was significant linkage heterogeneity between the HLA-defined subsets of families (P = 0.009), suggesting that IDDM11 may be an important susceptibility locus in families lacking strong HLA region predisposition. 52 refs., 2 figs., 3 tabs.

  1. Expression and purification of a novel ZNF191 zinc finger protein——ZNF191 protein and its truncated zinc finger region ZNF191 (243—368)

    Institute of Scientific and Technical Information of China (English)

    刘玉奇; 余龙; 余文浩; 施少林; 孙炳耘; 吴国俊; 黄仲贤

    1999-01-01

    ZNF191 is a new zine finger gene whieh has a 1107 bp open reading frame (ORF) and eneodes a 368 amino avid protein including a putative DNA-binding domain of four Cys2 His2 zine finger motifs at its C-terminal region. The ZNF191 cDNA is loeated in the chromosome 18q12.1 region where it is known that a variety of hereditary diseases are related to. Probably, this protein has potential function of stimulating the gene franscription. In order to examine the function and structure of ZNF191 protein, the ORF of ZNF191 and its zine finger region ZNF191(243--368) genes were inserted into PTSA-18 expression vector by PCR amplification, then the constructed genes were expressed in the PTSA-18/B121 (DE3) system. The two proteins were purified by DEAE-52, CM-23 and Heparin-Sepharose 4B columns. The pooled proteins showed a single band as assayed by Coomasie Brillian Blue Staining of an SDS/polyacryamide gel.

  2. Discovery of very high energy gamma-ray emission from the BL Lac object PKS 0301-243 with H.E.S.S

    CERN Document Server

    Abramowski, A; Aharonian, F; Ait, F; Akhperjanian, A G; Angüner, E; Anton, G; Balenderan, S; Balzer, A; Barnacka, A; Becherini, Y; Becker, J; Bernlöhr, K; Birsin, E; Bissaldi, E; Biteau, J; Böttcher, M; Boisson, C; Bolmont, J; Bordas, P; Brucker, J; Brun, F; Brun, P; Bulik, T; Carrigan, S; Casanova, S; Cerruti, M; Chadwick, P M; Chalme-Calvet, R; Chaves, R C G; Cheesebrough, A; Chrétien, M; Colafrancesco, S; Cologna, G; Conrad, J; Couturier, C; Dalton, M; Daniel, M K; Davids, I D; Degrange, B; Deil, C; deWilt, P; Dickinson, H J; Djannati-Ataï, A; Domainko, W; Drury, L O'C; Dubus, G; Dutson, K; Dyks, J; Dyrda, M; Edwards, T; Egberts, K; Eger, P; Espigat, P; Farnier, C; Fegan, S; Feinstein, F; Fernandes, M V; Fernandez, D; Fiasson, A; Fontaine, G; Förster, A; Füssling, M; Gajdus, M; Gallant, Y A; Garrigoux, T; Giebels, B; Glicenstein, J F; Grondin, M -H; Grudzìnska, M; Häffner, S; Hague, J D; Hahn, J; Harris, J; Heinzelmann, G; Henri, G; Hermann, G; Hervet, O; Hillert, A; Hinton, J A; Hofmann, W; Hofverberg, P; Holler, M; Horns, D; Jacholkowska, A; Jahn, C; Jamrozy, M; Janiak, M; Jankowsky, F; Jung, I; Kastendieck, M A; Katarzyński, K; Katz, U; Kaufmann, S; Khélifi, B; Kieffer, M; Klepser, S; Klochkov, D; Kluźniak, W; Kneiske, T; Kolitzus, D; Komin, Nu; Kosack, K; Krakau, S; Krayzel, F; Krüger, P P; Laffon, H; Lamanna, G; Lefaucheur, J; Lemoine-Goumard, M; Lenain, J -P; Lennarz, D; Lohse, T; Lopatin, A; Lu, C -C; Marandon, V; Marcowith, A; Marx, R; Maurin, G; Maxted, N; Mayer, M; McComb, T J L; Medina, M C; Méhault, J; Menzler, U; Meyer, M; Moderski, R; Mohamed, M; Moulin, E; Murach, T; Naumann, C L; de Naurois, M; Nedbal, D; Niemiec, J; Nolan, S J; Oakes, L; Ohm, S; Wilhelmi, E de Oña; Opitz, B; Ostrowski, M; Oya, I; Panter, M; Parsons, R D; Arribas, M Paz; Pekeur, N W; Pelletier, G; Perez, J; Petrucci, P -O; Peyaud, B; Pita, S; Poon, H; Pühlhofer, G; Punch, M; Quirrenbach, A; Raab, S; Raue, M; Reimer, A; Reimer, O; Renaud, M; Reyes, R de los; Rieger, F; Rob, L; Rosier-Lees, S; Rowell, G; Rudak, B; Rulten, C B; Sahakian, V; Sanchez, D A; Santangelo, A; Schlickeiser, R; Schüssler, F; Schulz, A; Schwanke, U; Schwarzburg, S; Schwemmer, S; Sol, H; Spengler, G; Spies, F; Stawarz, L; Steenkamp, R; Stegmann, C; Stinzing, F; Stycz, K; Sushch, I; Szostek, A; Tavernet, J -P; Terrier, R; Tluczykont, M; Trichard, C; Valerius, K; van Eldik, C; Vasileiadis, G; Venter, C; Viana, A; Vincent, P; Völk, H J; Volpe, F; Vorster, M; Wagner, S J; Wagner, P; Ward, M; Weidinger, M; Weitzel, Q; White, R; Wierzcholska, A; Willmann, P; Wörnlein, A; Wouters, D; Zacharias, M; Zajczyk, A; Zdziarski, A A; Zech, A; Zechlin, H -S

    2013-01-01

    The active galactic nucleus PKS 0301-243 (z=0.266) is a high-synchrotron-peaked BL Lac object that is detected at high energies (HE, 100 MeV 100 GeV) by the High Energy Stereoscopic System (H.E.S.S.) from observations between September 2009 and December 2011 for a total live time of 34.9 hours. Gamma rays above 200 GeV are detected at a significance of 9.4{\\sigma}. A hint of variability at the 2.5{\\sigma} level is found. An integral flux I(E > 200 GeV) = (3.3 +/- 1.1_stat +/- 0.7_syst)e-12 ph cm^-2s^-1 and a photon index {\\Gamma} = 4.6 +/- 0.7_stat +/- 0.2_syst are measured. Multi-wavelength light curves in HE, X-ray and optical bands show strong variability, and a minimal variability timescale of eight days is estimated from the optical light curve. A single-zone leptonic synchrotron self-Compton scenario satisfactorily reproduces the multi-wavelength data. In this model, the emitting region is out of equipartition and the jet is particle dominated. Because of its high redshift compared to other sources obse...

  3. A unique de novo interstitial deletion of chromosome 17, del(17)(q23.2q24.3) in a female newborn with multiple congenital anomalies

    Energy Technology Data Exchange (ETDEWEB)

    Levin, M.L.; Shaffer, L.G.; Lewis, R.A. [Baylor College of Medicine, Houston, TX (United States)] [and others

    1994-09-01

    Contiguous gene or microdeletion syndromes occurring on chromosome 17p include the Smith-Magenis and Miller-Dieker syndromes associated with interstitial deletions of 17p11.2 and 17p13.3, respectively. Other cytogenetically visible interstitial deletions on chromosome 17 are quite rare or unique. We describe a newborn with a novel interstitial deletion of the long arm of chromosome 17 [del(17)(q23.2q24.3)] who died on day of life 17 during a recurrent apneic episode. We have compared our patient`s phenotype and karyotype to two reported patients with deletion 17q with minor clinical overlap. The most striking clinical features of this patient were severe intrauterine growth retardation, widespread skeletal malformations (split sutures, hypoplastic acetabulae and scapulae, vertebral anomalies, and digital hypoplasia), cutis verticis gyrata, dysmorphic facial features, and oropharyngeal malformations (absent uvula and submucous cleft palate). Mild congenital heart disease and anomalous optic nerves were also present. Parental karyotyps were normal. DNA from parents and patient has been collected and cell lines established on both parents. Genes which have been previously mapped to the region that is apparently deleted in this patient include: chorionic somatomammotropin A, growth hormone (normal), acid alpha-glucosidase, apolipoprotein H, and the alpha peptide of type 4 voltage gated sodium channel. As in other clinical cytogenetic syndromes, further descriptions of patients with similar or overlapping rearrangements in this region will be necessary to delineate genotype/phenotype correlations for chromosome 17.

  4. Experimental study of the neutron induced fission cross-section of 234U, 237Np and 243Am with time-of-flight spectrometry technics

    International Nuclear Information System (INIS)

    The current work concentrates on the measurements of the nuclear data needed for solving the problem of transmutation of radiotoxic waste. It includes fission cross-section of 234U in the energy range from thermal to 1 MeV, 237Np and 243Am in the resonance region and average group capture cross-section of 234U and 236U. Almost all of these data are recommended by IAEA as a first priority needs for transmutation problem. Another objective is to obtain the high resolution data of the fission cross-section of the 234U on the fission barrier to confirm the existence of the fine structure, attributed to the vibrational resonances in the third well of the fission barrier. The Dissertation summarizes more, than 10 years of the experiments, performed on the pulsed neutron sources IBR-2 and IBR-30 of Frank Laboratory of Neutron Physics of the Joint Institute for Nuclear Research (FLNP JINR) in Dubna, Russia; 'Fakel' of Russian Scientific Center 'Kurchatov's Institute' and n-TOF of CERN. The TOF technique was used for neutron energy spectrometry and various kinds of detectors to mark the fission events. The independent measurements of the same isotopes done on different neutron sources and sometimes with different techniques gives strong, self-consistent set of data. (author)

  5. X-ray outbursts of ESO 243-49 HLX-1: comparison with Galactic low-mass X-ray binary transients

    CERN Document Server

    Yan, Zhen; Soria, Roberto; Altamirano, Diego; Yu, Wenfei

    2015-01-01

    We studied the outburst properties of the hyper-luminous X-ray source ESO 243-49 HLX-1, using the full set of Swift monitoring observations. We quantified the increase in the waiting time, recurrence time and e-folding rise timescale along the outburst sequence, and the corresponding decrease in outburst duration, total radiated energy, and e-folding decay timescale, which confirms previous findings. HLX-1 spends less and less time in outburst and more and more time in quiescence, but its peak luminosity remains approximately constant. We compared the HLX-1 outburst properties with those of bright Galactic low-mass X-ray binary transients (LMXBTs). Our spectral analysis strengthens the similarity between state transitions in HLX-1 and those in Galactic LMXBTs. We also found that HLX-1 follows the nearly linear correlations between the hard-to-soft state transition luminosity and the peak luminosity, and between the rate of change of X-ray luminosity during the rise phase and the peak luminosity, which indicat...

  6. A novel autosomal recessive non-syndromic hearing impairment locus (DFNB47) maps to chromosome 2p25.1-p24.3.

    Science.gov (United States)

    Hassan, Muhammad Jawad; Santos, Regie Lyn P; Rafiq, Muhammad Arshad; Chahrour, Maria H; Pham, Thanh L; Wajid, Muhammad; Hijab, Nadine; Wambangco, Michael; Lee, Kwanghyuk; Ansar, Muhammad; Yan, Kai; Ahmad, Wasim; Leal, Suzanne M

    2006-01-01

    Hereditary hearing impairment (HI) displays extensive genetic heterogeneity. Autosomal recessive (AR) forms of prelingual HI account for approximately 75% of cases with a genetic etiology. A novel AR non-syndromic HI locus (DFNB47) was mapped to chromosome 2p25.1-p24.3, in two distantly related Pakistani kindreds. Genome scan and fine mapping were carried out using microsatellite markers. Multipoint linkage analysis resulted in a maximum LOD score of 4.7 at markers D2S1400 and D2S262. The three-unit support interval was bounded by D2S330 and D2S131. The region of homozygosity was found within the three-unit support interval and flanked by markers D2S2952 and D2S131, which corresponds to 13.2 cM according to the Rutgers combined linkage-physical map. This region contains 5.3 Mb according to the sequence-based physical map. Three candidate genes, KCNF1, ID2 and ATP6V1C2 were sequenced, and were found to be negative for functional sequence variants. PMID:16261342

  7. The orbits of subdwarf B + main-sequence binaries. I: The sdB+G0 system PG 1104+243

    CERN Document Server

    Vos, J; Degroote, P; De Smedt, K; Green, E M; Heber, U; Van Winckel, H; Acke, B; Bloemen, S; De Cat, P; Exter, K; Lampens, P; Lombaert, R; Masseron, T; Menu, J; Neyskens, P; Raskin, G; Smolders, K; Tkachenko, A; Ringat, E; Rauch, T

    2012-01-01

    The predicted orbital period histogram of an sdB population is bimodal with a peak at short ( 250 days) periods. Observationally, there are many short-period sdB systems known, but only very few long-period sdB binaries are identified. As these predictions are based on poorly understood binary interaction processes, it is of prime importance to confront the predictions to observational data. In this contribution we aim to determine the absolute dimensions of the long-period sdB+MS binary system PG1104+243. High-resolution spectroscopy time-series were obtained with HERMES at the Mercator telescope at La Palma, and analyzed to obtain radial velocities of both components. Photometry from the literature was used to construct the spectral energy distribution (SED) of the binary. Atmosphere models were used to fit this SED and determine the surface gravity and temperature of both components. The gravitational redshift provided an independent confirmation of the surface gravity of the sdB component. An orbital peri...

  8. Association of the −243A>G, +61450C>A Polymorphisms of the Glutamate Decarboxylase 2 (GAD2) Gene with Obesity and Insulin Level in North Indian Population

    Science.gov (United States)

    PRAKASH, Jai; MITTAL, Balraj; AWASTHI, Shally; SRIVASTAVA, Neena

    2016-01-01

    Background: Obesity associated with type 2 diabetes, and hypertension increased mortality and morbidity. Glutamate decarboxylase 2 (GAD2) gene is associated with obesity and it regulate food intake and insulin level. We investigated the association of GAD-2gene −243A>G (rs2236418) and +61450C>A (rs992990) polymorphisms with obesity and related phenotypes. Methods: Insulin, glucose and lipid levels were estimated using standard protocols. All subjects were genotyped (PCR-RFLP) method. Results: The −243A>G polymorphism of the GAD-2 gene was significantly associated with higher risk of obesity (Pobesity and related phenotype in complex manner, probably by regulating the food intake, insulin and body weight.

  9. Discovery of a Neuroprotective Chemical, (S)-N-(3-(3,6-Dibromo-9H-carbazol-9-yl)-2-fluoropropyl)-6-methoxypyridin-2-amine [(−)-P7C3-S243], with Improved Druglike Properties

    OpenAIRE

    Naidoo, Jacinth; De Jesus-Cortes, Hector; Huntington, Paula; Estill, Sandi; Morlock, Lorraine K.; Starwalt, Ruth; Mangano, Thomas J.; Williams, Noelle S.; Pieper, Andrew A.; Ready, Joseph M.

    2014-01-01

    (−)-P7C3-S243 is a neuroprotective aminopropyl carbazole with improved druglike properties compared with previously reported compounds in the P7C3 class. It protects developing neurons in a mouse model of hippocampal neurogenesis and protects mature neurons within the substantia nigra in a mouse model of Parkinson’s disease. A short, enantioselective synthesis provides the neuroprotective agent in optically pure form. It is nontoxic, orally bioavailable, metabolically stable, and able to cros...

  10. Measurements of energy dependence of average number of prompt neutrons from neutron-induced fission of 235U, 241Am and 243Am from 0.5 to 12 MeV

    International Nuclear Information System (INIS)

    The energy dependence measurements results of average number of prompt neutrons from neutron-induced fission of 235U, 241Am, 243Am and total gamma-rays energy for 235U and 243Am from 0.5 to 12 MeV are presented. The measurements were carried out with neutron beam from uranium target of electron linac of All-Union Scientific Research Institute of Experimental Physics using time-of-flight technique on 28.5 m flight-path. The neutrons and gamma-rays from fission were detected by a big liquid scintillator detector (BLSD) loaded with gadolinium, events of fission - by parallel plate avalanche detector for fission fragments. Measurement of energy dependence of anti νp, Eγtot and determination of BLSD efficiency (relative to anti νp and Eγtot for 252Cf) were carried out simultaneously. Least squares fitting results give anti νp=3.05+0.14degEn for 241Am and anti νp=3.20+.15degEn for 243Am. (orig.)

  11. Comment on "John's stone: A possible fragment of the 1908 Tunguska meteorite" (Anfinogenov et al., 2014, Icarus 243, 139-147)

    Science.gov (United States)

    Haack, Henning; Greenwood, Richard C.; Busemann, Henner

    2016-02-01

    Anfinogenov et al. (Anfinogenov et al. [2014]. Icarus 243, 139-147) argue that a highly silicified gravelite sandstone referred to as "John's stone" could be a fragment of the long-sought-after impactor from the 1908 Tunguska event. We have analyzed the oxygen isotopic composition of two distinct samples of John's stone both kindly provided by Dr Yana Anfingenova. Both samples had very similar isotopic compositions, such that the average of the two was as follows: δ17O = 6.67 ± 0.15‰; δ18O = 12.78 ± 0.28‰; Δ17O = -0.01 ± 0.01 (errors 1SD). This value is well within the range for samples of terrestrial quartz-bearing sedimentary and metamorphic rocks. John's stone has an oxygen isotope composition and mineralogy that is unlike any known group of meteorites. If John's stone is extraterrestrial this would imply that it represents a previously unknown type of meteorite, as suggested by Anfinogenov et al. However, since sandstones can only form on a parent body with liquid water and by inference, also an atmosphere, we argue that there are only two possible parent bodies in the Solar System: the Earth and Mars. Mars can be ruled out for several reasons, including the oxygen isotopic and noble gas composition of John's stone, which is clearly distinct from martian meteorites. Consistent with the O study, the noble gases do not provide any evidence for an extraterrestrial origin of the samples. The lack of any cosmogenic noble gases (particularly striking in 3He, 21Ne, 38Ar) is consistent with a terrestrial origin or an extraterrestrial origin under large shielding. Based on the combined evidence obtained in this study we infer that John's stone is a terrestrial rock unrelated to the Tunguska impactor.

  12. Viscosity of n-hexadecane, n-octadecane and n-eicosane at pressures up to 243 MPa and temperatures up to 534 K

    International Nuclear Information System (INIS)

    Highlights: • A novel windowed Inconel rolling-ball viscometer is designed and used by our team. • Viscosity data are reported for n-hexadecane, n-octadecane, and n-eicosane at high temperatures and pressures. • The viscosity results are compared with the available literature data. • The viscosity results are modeled with the free volume theory model. - Abstract: Viscosity data are reported for n-hexadecane (C16), n-octadecane (C18), and n-eicosane (C20) at pressures between (3 and 243) MPa and temperatures between (304 and 534) K. These extreme conditions are representative of those encountered in ultra-deep petroleum formations beneath the deepwaters of the Gulf of Mexico. The measurements are taken with a novel windowed Inconel rolling-ball viscometer designed by our team that is calibrated with n-decane. A comparison of the reported viscosity values with the available literature data that cover limited pressure and temperature ranges, shows that the mean absolute percentage deviation, δ, ranges between 1.1% and 4.8%. The reported data extend the database of viscosity to the high-temperature, high-pressure region where most gaps occur in the literature data for n-hexadecane and n-octadecane. To the best of our knowledge, the results for n-eicosane are the first reported viscosity values at pressures above 2 MPa over the entire temperature range. The viscosity results are modeled with the free volume theory model in conjunction with density values obtained using the Peng–Robinson equation of state (EoS) and the PC-SAFT EoS. The δ values obtained with this model range from 2.0% to 3.5%. The data are also correlated by a non-linear surface fit as a simultaneous function of temperature and pressure that yields δ values of 0.40%, 0.43%, and 0.38% for C16, C18, and C20, respectively

  13. A DETAILED GRAVITATIONAL LENS MODEL BASED ON SUBMILLIMETER ARRAY AND KECK ADAPTIVE OPTICS IMAGING OF A HERSCHEL-ATLAS SUBMILLIMETER GALAXY AT z = 4.243 {sup ,} {sup ,}

    Energy Technology Data Exchange (ETDEWEB)

    Bussmann, R. S.; Gurwell, M. A. [Harvard-Smithsonian Center for Astrophysics, 60 Garden Street, Cambridge, MA 02138 (United States); Fu Hai; Cooray, A. [Department of Physics and Astronomy, University of California, Irvine, CA 92697 (United States); Smith, D. J. B.; Bonfield, D.; Dunne, L. [Centre for Astrophysics, Science and Technology Research Institute, University of Hertfordshire, Hatfield, Herts AL10 9AB (United Kingdom); Dye, S.; Eales, S. [School of Physics and Astronomy, University of Nottingham, University Park, Nottingham NG7 2RD (United Kingdom); Auld, R. [Cardiff University, School of Physics and Astronomy, Queens Buildings, The Parade, Cardiff CF24 3AA (United Kingdom); Baes, M.; Fritz, J. [Sterrenkundig Observatorium, Universiteit Gent, Krijgslaan 281 S9, B-9000 Gent (Belgium); Baker, A. J. [Department of Physics and Astronomy, Rutgers, the State University of New Jersey, 136 Frelinghuysen Road, Piscataway, NJ 08854-8019 (United States); Cava, A. [Departamento de Astrofisica, Facultad de CC. Fisicas, Universidad Complutense de Madrid, E-28040 Madrid (Spain); Clements, D. L.; Dariush, A. [Imperial College London, Blackett Laboratory, Prince Consort Road, London SW7 2AZ (United Kingdom); Coppin, K. [Department of Physics, McGill University, Ernest Rutherford Building, 3600 Rue University, Montreal, Quebec, H3A 2T8 (Canada); Dannerbauer, H. [Universitaet Wien, Institut fuer Astronomie, Tuerkenschanzstrasse 17, 1180 Wien, Oesterreich (Austria); De Zotti, G. [Universita di Padova, Dipto di Astronomia, Vicolo dell' Osservatorio 2, IT 35122, Padova (Italy); Hopwood, R., E-mail: rbussmann@cfa.harvard.edu [Department of Physics and Astronomy, Open University, Walton Hall, Milton Keynes, MK7 6AA (United Kingdom); and others

    2012-09-10

    We present high-spatial resolution imaging obtained with the Submillimeter Array (SMA) at 880 {mu}m and the Keck adaptive optics (AO) system at the K{sub S}-band of a gravitationally lensed submillimeter galaxy (SMG) at z = 4.243 discovered in the Herschel Astrophysical Terahertz Large Area Survey. The SMA data (angular resolution Almost-Equal-To 0.''6) resolve the dust emission into multiple lensed images, while the Keck AO K{sub S}-band data (angular resolution Almost-Equal-To 0.''1) resolve the lens into a pair of galaxies separated by 0.''3. We present an optical spectrum of the foreground lens obtained with the Gemini-South telescope that provides a lens redshift of z{sub lens} = 0.595 {+-} 0.005. We develop and apply a new lens modeling technique in the visibility plane that shows that the SMG is magnified by a factor of {mu} = 4.1 {+-} 0.2 and has an intrinsic infrared (IR) luminosity of L{sub IR} = (2.1 {+-} 0.2) Multiplication-Sign 10{sup 13} L{sub Sun }. We measure a half-light radius of the background source of r{sub s} = 4.4 {+-} 0.5 kpc which implies an IR luminosity surface density of {Sigma}{sub IR} (3.4 {+-} 0.9) Multiplication-Sign 10{sup 11} L{sub Sun} kpc{sup -2}, a value that is typical of z > 2 SMGs but significantly lower than IR luminous galaxies at z {approx} 0. The two lens galaxies are compact (r{sub lens} Almost-Equal-To 0.9 kpc) early-types with Einstein radii of {theta}{sub E1} 0.57 {+-} 0.01 and {theta}{sub E2} = 0.40 {+-} 0.01 that imply masses of M{sub lens1} = (7.4 {+-} 0.5) Multiplication-Sign 10{sup 10} M{sub Sun} and M{sub lens2} = (3.7 {+-} 0.3) Multiplication-Sign 10{sup 10} M{sub Sun }. The two lensing galaxies are likely about to undergo a dissipationless merger, and the mass and size of the resultant system should be similar to other early-type galaxies at z {approx} 0.6. This work highlights the importance of high spatial resolution imaging in developing models of strongly lensed galaxies

  14. Oxidation-reduction properties of americium, curium, berkelium, californium, einsteinium and fermium, and thermodynamic consequences for the 5f series

    International Nuclear Information System (INIS)

    The amalgamation of 5f elements from Am to Fm has been studied by using 241Am, 244Cm, 249Bk, 249Cf, 252Cf, 253Es, 254Es, 252Fm and 255Fm with two electrochemical methods, radiocoulometry and radiopolarography, perfectly adapted to investigate extremely diluted solutions when the concentration of electroactive species is as low as 10-16M. The theory of radiocoulometry has been developed in the general cases of reversible and irreversible electrode process. It has been used to interpret the experimental data on the kinetic curves of amalgamation, and to estimate the standard rate constant of the electrode process in complexing medium (citric). On the other hand the radiopolarographic method has been applied to study the mechanism of reduction at the dropping mercury electrode of cations M3+ in aqueous medium to the metal M with formation of amalgam. The results are exploited into two directions: 1- Acquisition of some data concerning the oxidation-reduction properties of elements from Am to Fm. Therefore the standard electrode E0 [M(III-0)] potentials for Bk, Cf and Es, and the standard electrode E0 [M(II-0)] potential for Fm are estimated and the relative stability of each oxidation state (from II to VII) of 5f elements is discussed; 2- Acquisition of unknown thermodynamic data on transcalifornium elements. Correlations between 4f and 5f elements are precised and some divergences appear for the second half of 4f and 5f series (i.e. for 65<=Z<=71 and 97<=Z<=103)

  15. Evaluation of thermal neutron cross-sections and resonance integrals of protactinium, americium, curium, and berkelium isotopes

    International Nuclear Information System (INIS)

    Data on the thermal neutron fission and capture cross-sections as well as their corresponding resonance integrals are reviewed and analysed. The data are classified according to the form of neutron spectra under investigation. The weighted mean values of the cross-sections and resonance integrals for every type of neutron spectra were adopted as evaluated data. (author). 87 refs, 2 tabs

  16. The ancient mammalian KRAB zinc finger gene cluster on human chromosome 8q24.3 illustrates principles of C2H2 zinc finger evolution associated with unique expression profiles in human tissues

    Science.gov (United States)

    2010-01-01

    Background Expansion of multi-C2H2 domain zinc finger (ZNF) genes, including the Krüppel-associated box (KRAB) subfamily, paralleled the evolution of tetrapodes, particularly in mammalian lineages. Advances in their cataloging and characterization suggest that the functions of the KRAB-ZNF gene family contributed to mammalian speciation. Results Here, we characterized the human 8q24.3 ZNF cluster on the genomic, the phylogenetic, the structural and the transcriptome level. Six (ZNF7, ZNF34, ZNF250, ZNF251, ZNF252, ZNF517) of the seven locus members contain exons encoding KRAB domains, one (ZNF16) does not. They form a paralog group in which the encoded KRAB and ZNF protein domains generally share more similarities with each other than with other members of the human ZNF superfamily. The closest relatives with respect to their DNA-binding domain were ZNF7 and ZNF251. The analysis of orthologs in therian mammalian species revealed strong conservation and purifying selection of the KRAB-A and zinc finger domains. These findings underscore structural/functional constraints during evolution. Gene losses in the murine lineage (ZNF16, ZNF34, ZNF252, ZNF517) and potential protein truncations in primates (ZNF252) illustrate ongoing speciation processes. Tissue expression profiling by quantitative real-time PCR showed similar but distinct patterns for all tested ZNF genes with the most prominent expression in fetal brain. Based on accompanying expression signatures in twenty-six other human tissues ZNF34 and ZNF250 revealed the closest expression profiles. Together, the 8q24.3 ZNF genes can be assigned to a cerebellum, a testis or a prostate/thyroid subgroup. These results are consistent with potential functions of the ZNF genes in morphogenesis and differentiation. Promoter regions of the seven 8q24.3 ZNF genes display common characteristics like missing TATA-box, CpG island-association and transcription factor binding site (TFBS) modules. Common TFBS modules partly

  17. The ancient mammalian KRAB zinc finger gene cluster on human chromosome 8q24.3 illustrates principles of C2H2 zinc finger evolution associated with unique expression profiles in human tissues

    Directory of Open Access Journals (Sweden)

    Ding Guohui

    2010-03-01

    Full Text Available Abstract Background Expansion of multi-C2H2 domain zinc finger (ZNF genes, including the Krüppel-associated box (KRAB subfamily, paralleled the evolution of tetrapodes, particularly in mammalian lineages. Advances in their cataloging and characterization suggest that the functions of the KRAB-ZNF gene family contributed to mammalian speciation. Results Here, we characterized the human 8q24.3 ZNF cluster on the genomic, the phylogenetic, the structural and the transcriptome level. Six (ZNF7, ZNF34, ZNF250, ZNF251, ZNF252, ZNF517 of the seven locus members contain exons encoding KRAB domains, one (ZNF16 does not. They form a paralog group in which the encoded KRAB and ZNF protein domains generally share more similarities with each other than with other members of the human ZNF superfamily. The closest relatives with respect to their DNA-binding domain were ZNF7 and ZNF251. The analysis of orthologs in therian mammalian species revealed strong conservation and purifying selection of the KRAB-A and zinc finger domains. These findings underscore structural/functional constraints during evolution. Gene losses in the murine lineage (ZNF16, ZNF34, ZNF252, ZNF517 and potential protein truncations in primates (ZNF252 illustrate ongoing speciation processes. Tissue expression profiling by quantitative real-time PCR showed similar but distinct patterns for all tested ZNF genes with the most prominent expression in fetal brain. Based on accompanying expression signatures in twenty-six other human tissues ZNF34 and ZNF250 revealed the closest expression profiles. Together, the 8q24.3 ZNF genes can be assigned to a cerebellum, a testis or a prostate/thyroid subgroup. These results are consistent with potential functions of the ZNF genes in morphogenesis and differentiation. Promoter regions of the seven 8q24.3 ZNF genes display common characteristics like missing TATA-box, CpG island-association and transcription factor binding site (TFBS modules. Common TFBS

  18. The real part of the forward elastic scattering amplitude for pp and /ovr/p//p at √s = 24.3 GeV from experiment UA6

    International Nuclear Information System (INIS)

    Preliminary results for the ratio of the real part to the imaginary part of the forward elastic scattering amplitude are presented for both pp and /ovr/p/p scattering at √s = 24.3 GeVc. The elastic differential cross section was measured in the four-momentum transfer range 0.001 2 using a position sensitive silicon detector to detect the recoil proton. The values found are /rho/(pp) = 0.014 +- 0.007 +- 0.007 and /rho/(/ovr/p//p) = 0.045 +- 0.007 +- 0.007

  19. Impaction grafting in the femur in cementless modular revision total hip arthroplasty: a descriptive outcome analysis of 243 cases with the MRP-TITAN revision implant

    Directory of Open Access Journals (Sweden)

    Wimmer Matthias D

    2013-01-01

    Full Text Available Abstract Background We present a descriptive and retrospective analysis of revision total hip arthroplasties (THA using the MRP-TITAN stem (Peter Brehm, Weisendorf, GER with distal diaphyseal fixation and metaphyseal defect augmentation. Our hypothesis was that the metaphyseal defect augmentation (Impaction Bone Grafting improves the stem survival. Methods We retrospectively analyzed the aggregated and anonymized data of 243 femoral stem revisions. 68 patients with 70 implants (28.8% received an allograft augmentation for metaphyseal defects; 165 patients with 173 implants (71.2% did not, and served as controls. The mean follow-up was 4.4 ± 1.8 years (range, 2.1–9.6 years. There were no significant differences (p > 0.05 between the study and control group regarding age, body mass index (BMI, femoral defects (types I-III as described by Paprosky, and preoperative Harris Hip Score (HHS. Postoperative clinical function was evaluated using the HHS. Postoperative radiologic examination evaluated implant stability, axial implant migration, signs of implant loosening, periprosthetic radiolucencies, as well as bone regeneration and resorption. Results There were comparable rates of intraoperative and postoperative complications in the study and control groups (p > 0.05. Clinical function, expressed as the increase in the postoperative HHS over the preoperative score, showed significantly greater improvement in the group with Impaction Bone Grafting (35.6 ± 14.3 vs. 30.8 ± 15.8; p ≤ 0.05. The study group showed better outcome especially for larger defects (types II C and III as described by Paprosky and stem diameters ≥ 17 mm. The two groups did not show significant differences in the rate of aseptic loosening (1.4% vs. 2.9% and the rate of revisions (8.6% vs. 11%. The Kaplan-Meier survival for the MRP-TITAN stem in both groups together was 93.8% after 8.8 years. [Study group 95.7% after 8.54 years ; control group 93

  20. Soja transgênica BRS 243 RR: determinação de macronutrientes e das isoflavonas daidzeína e genisteína por Cromatografia Líquida de Alta Eficiência (CLAE Transgenic soybean BRS 243 RR: determination of macronutrients and isoflavones daidzein and genistein by High Performance Liquid Chromatography (HPLC

    Directory of Open Access Journals (Sweden)

    Marcela Roquim Alezandro

    2008-09-01

    Full Text Available Este trabalho teve por objetivo determinar a composição centesimal e o conteúdo de Daidzeína (D e Genisteína (G da cultivar BRS 243 RR por CLAE. O preparo da amostra para cromatografia envolveu a remoção da gordura com hexano . Os analitos foram extraídos com etanol 70% acrescido de 0,1% de ácido acético. As condições cromatográficas otimizadas foram: coluna C18, fase móvel metanol: ácido acético 5% (1:1 v/v, vazão 0,5 mL/minuto, temperatura da coluna 30 °C, volume de injeção 40 µL e leitura em 254 nm. Os parâmetros de validação avaliados foram: linearidade y = 11242 x -37433, r = 0,9976 (D e y = 18510 x -66761, r = 0,9980 (G; coeficientes de variação dos estudos de precisão intradia CV = 5,3% (D, CV = 6,7% (G e interdias CV = 8,7% (D, CV = 9,7% (G; limite de quantificação 10 µg.g-1; limite de detecção 5 µg.g-1 e recuperação 95,7%. Portanto, o método desenvolvido foi adequado para a determinação de daidzeína e genisteína em soja. Os níveis de carboidratos (31,4%, proteínas (35,9%, lipídios (20,9%, umidade (6,9%, cinzas (4,9%, daidzeína (44,1 µg.g-1 e genisteína (37,4 µg.g-1 determinados na soja transgênica foram similares aos de outros estudos com soja convencional.The objective of this work was to evaluate the proximate composition, as well as Daidzein (D and Genistein (G contents by HPLC, of BRS 243 RR soybean. Sample preparation for the chromatographic analysis involved the use of hexane to remove lipids. Isoflavones were extracted with 70% ethanol containing 0.1% acetic acid. The optimized chromatographic conditions were: C18 column, mobile phase methanol:5% acetic acid (1:1 v/v, flow rate 0.5 mL/minute, column temperature 30 °C, UV absorbance at 254 nm and volume injected 40 µL. The validation parameters were: linearity of daidzein (y = 11242 x -37433, r = 0.9976 and genistein (y = 18510 x -66761, r = 0.9980; variation coefficients obtained in intra-day precision assays [CV = 5.3% (D, CV = 6

  1. Measurement of the Neutron Capture Cross Sections of $^{233}$U, $^{237}$Np, $^{240,242}$Pu, $^{241,243}$Am and $^{245}$Cm with a Total Absorption Calorimeter at n_TOF

    CERN Multimedia

    Beer, H; Wiescher, M; Cox, J; Rapp, W; Embid, M; Dababneh, S

    2002-01-01

    Accurate and reliable neutron capture cross section data for actinides are necessary for the poper design, safety regulation and precise performance assessment of transmutation devices such as Fast Critical Reactors or Accelerator Driven Systems (ADS). The goal of this proposal is the measurement of the neutron capture cross sections of $^{233}$U, $^{237}$Np, $^{240,242}$Pu, $^{241,243}$Am and $^{245}$Cm at n_TOF with an accuracy of 5~\\%. $^{233}$U plays an essential role in the Th fuel cycle, which has been proposed as a safer and cleaner alternative to the U fuel cycle. The capture cross sections of $^{237}$Np,$^{240,242}$Pu, $^{241,243}$Am and $^{245}$Cm play a key role in the design and optimization of a strategy for the Nuclear Waste Transmutation. A high accuracy can be achieved at n_TOF in such measurements due to a combination of features unique in the world: high instantaneous neutron fluence and excellent energy resolution of the facility, innovative Data Acquisition System based on flash ADCs and t...

  2. Thermomechanical behavior and microstructural evolution of a Ni(Pd)-rich Ni{sub 24.3}Ti{sub 49.7}Pd{sub 26} high temperature shape memory alloy

    Energy Technology Data Exchange (ETDEWEB)

    Benafan, O., E-mail: othmane.benafan@nasa.gov [NASA Glenn Research Center, Structures and Materials Division, Cleveland, OH 44135 (United States); Garg, A. [University of Toledo, Toledo, OH 43606 (United States); NASA Glenn Research Center, Structures and Materials Division, Cleveland, OH 44135 (United States); Noebe, R.D.; Bigelow, G.S.; Padula, S.A. [NASA Glenn Research Center, Structures and Materials Division, Cleveland, OH 44135 (United States); Gaydosh, D.J. [Ohio Aerospace Institute, Cleveland, OH 44142 (United States); NASA Glenn Research Center, Structures and Materials Division, Cleveland, OH 44135 (United States); Vaidyanathan, R. [Advanced Materials Processing and Analysis Center, Materials Science and Engineering Department, University of Central Florida, Orlando, FL 32816 (United States); Clausen, B.; Vogel, S.C. [Materials Science and Technology Division, Los Alamos National Laboratory, Los Alamos, NM 87545 (United States)

    2015-09-15

    Highlights: • A Ni(Pd)-rich Ni{sub 24.3}Ti{sub 49.7}Pd{sub 26} high temperature shape memory alloy was characterized. • Aging resulted in fine dispersion of nano-sized precipitates. • Thermomechanical cycling resulted in dimensional instabilities due to lattice defects. • A two-way shape memory effect strain of 2% strain was obtained after cycling. - Abstract: The effect of thermomechanical cycling on a slightly Ni(Pd)-rich Ni{sub 24.3}Ti{sub 49.7}Pd{sub 26} (near stochiometric Ni–Ti basis with Pd replacing Ni) high temperature shape memory alloy was investigated. Aged tensile specimens (400 °C/24 h/furnace cooled) were subjected to constant-stress thermal cycling in conjunction with microstructural assessment via in situ neutron diffraction and transmission electron microscopy (TEM), before and after testing. It was shown that in spite of the slightly Ni(Pd)-rich composition and heat treatment used to precipitation harden the alloy, the material exhibited dimensional instabilities with residual strain accumulation reaching 1.5% over 10 thermomechanical cycles. This was attributed to insufficient strengthening of the material (insufficient volume fraction of precipitate phase) to prevent plasticity from occurring concomitant with the martensitic transformation. In situ neutron diffraction revealed the presence of retained martensite while cycling under 300 MPa stress, which was also confirmed by transmission electron microscopy of post-cycled samples. Neutron diffraction analysis of the post-thermally-cycled samples under no-load revealed residual lattice strains in the martensite and austenite phases, remnant texture in the martensite phase, and peak broadening of the austenite phase. Texture developed in the martensite phase was composed mainly of those martensitic tensile variants observed during thermomechanical cycling. Presence of a high density of dislocations, deformation twins, and retained martensite was revealed in the austenite state via in

  3. Identification of ZCCHC8 as fusion partner of ROS1 in a case of congenital glioblastoma multiforme with a t(6;12)(q21;q24.3).

    Science.gov (United States)

    Coccé, Mariela C; Mardin, Balca R; Bens, Susanne; Stütz, Adrian M; Lubieniecki, Fabiana; Vater, Inga; Korbel, Jan O; Siebert, Reiner; Alonso, Cristina N; Gallego, Marta S

    2016-09-01

    Congenital gliobastoma multiforme (GBM) is rare and little is known about the molecular defects underlying the initiation and progression of this tumor type. We present a case of congenital GBM analyzed by conventional cytogenetics, fluorescence in situ hybridization, array comparative genomic hybridization and next generation sequencing. On cytogenetic analysis we detected a reciprocal translocation t(6;12)(q21;q24.3). By sequencing, the translocation was shown to form a fusion between the 5' region of ZCCHC8 and the 3' region of ROS1. RT-PCR analyses confirmed the existence of an in-frame fusion transcript with ZCCHC8 exons 1-3 joined to ROS1 exons 36-43. In addition to the ZCCHC8-ROS1 fusion, we detected a deletion in the short arm of chromosome 9, including homozygous loss of the CDKN2A/2B locus in 9p21.3 and heterozygous deletion of the HAUS6 gene in 9p22.1. The latter encodes a protein involved in faithful chromosome segregation by regulating microtubule nucleation and its deletion might be associated with the marked subclonal changes of ploidy observed in the tumor. This report adds the ZCCHC8-ROS1 fusion as oncogenic driver in GBM and supports the role of ROS1 activation in the pathogenesis of a subset of GBM. © 2016 Wiley Periodicals, Inc. PMID:27121553

  4. Neutron-induced fission cross section measurement of 233U, 241Am and 243Am in the energy range 0.5 MeV En 20 MeV at nTOF at CERN

    Energy Technology Data Exchange (ETDEWEB)

    Belloni, F. [Instituto Nazionale de Fisica Nucleare-Italy and CEA-France; Milazzo, P. M. [Instituto Nazionale de Fisica Nucleare, Trieste, Italy; Calviani, M. [Laboratori Nazionali di Legnaro, Italy and CERN, Geneva, Switzerland; Colonna, N. [Instituto Nazionale di Fisica Nucleare, Bari, Italy; Mastinu, P. F. [INFN, Laboratori Nazionali di Legnaro, Italy; Abbondanno, U. [Instituto Nazionale de Fisica Nucleare, Trieste, Italy; Aerts, G. [French Atomic Energy Commission (CEA), Centre de Saclay, Gif sur Yvette; Alvarez, H. [University of Santiago de Compostela, Spain; Alvarez-Velarde, F. [Centro de Investigaciones Energeticas Medioambientales y Technol., Madrid, Spain; Andriamonje, S. [French Atomic Energy Commission (CEA), Centre de Saclay, Gif sur Yvette; Andrzejewski, J. [University of Lodz, Lodz, Poland; Assimakopoulos, P. A. [University of Ioannina, Greece; Audouin, L. [Centre National de la Recherche Scidntifique/IN2P3-IPN, Orsay, France; Badurek, G. [Vienna University of Technology, Austria; Barbagallo, M. [Instituto Nazionale di Fisica Nucleare, Bari, Italy; Baumann, P. [CNRS, Strasbourg, France; Becvar, F. [Charles University, Prague, Czech Republic; Berthoumieux, E. [French Atomic Energy Commission (CEA), Centre de Saclay, Gif sur Yvette; Calvino, F. [Universidad Politecnica de Madrid, Spain; Cerutti, F. [CERN, Geneva, Switzerland; Cano-Ott, D. [CIEMAT, Spain; Capote, R. [IAEA-Vienna, Austria and Universidad de Sevilla, Spain; Carrapico, C. [Instituto Tecnológico e Nuclear (ITN), Lisbon, Portugal; Carrillo de Albornoz, A. [Instituto Tecnológico e Nuclear (ITN), Lisbon, Portugal; Cennini, P. [CERN, Geneva, Switzerland; Chepel, V. [University of Ciombra, Portugal; Chiaveri, E. [CERN, Geneva, Switzerland; Cortes, G. [Universitat Politecnica de Catalunya, Barcelona, Spain; Couture, A. [University of Notre Dame, IN; Cox, J. [University of Notre Dame, IN; Dahlfors, M. [CERN, Geneva, Switzerland; David, S. [CNRS, Orsay, France; Dillmann, I. [Institut fur Kernphysik, Karlsruhe, Germany; Dolfini, R. [Universita di Pavia, Italy; Domingo-Pardo, C. [CSIC-Universidad de Valencia; Koehler, Paul [ORNL; The n_TOF Collaboration, [CERN, Geneva, Switzerland

    2012-01-01

    Neutron-induced fission cross section measurements of 233U, 243Am and 241Am relative to 235U have been carried out at the neutron time-of-flight facility n TOF at CERN. A fast ionization chamber has been employed. All samples were located in the same detector; therefore the studied elements and the reference 235U target are subject to the same neutron beam.

  5. The gene for spinal cerebellar ataxia 3 (SCA3) is located in a region of {approximately} 3 cM on chromosome 14q24.3-q32.2

    Energy Technology Data Exchange (ETDEWEB)

    Stevanin, G.; Cancel, G.; Duerr, A.; Dubourg, O.; Agid, Y.; Brice, A. [Hopital de la Salpetriere, Paris (France); Chneiweiss, H.; Weissenbach, J.; Cann, H.M.

    1995-01-01

    SCA3, the gene for spinal cerebellar ataxia 3, was recently mapped to a 15-cM interval between D14S67 and D14S81 on chromosome 14q, by linkage analysis in two families of French ancestry. The SCA3 candidate region has now been refined by linkage analysis with four new microsatellite markers (D14S256, D14S291, D14S280, and AFM343vf1) in the same two families, in which 19 additional individuals were genotyped, and in a third French family. Combined two-point linkage analyses show that the new markers, D14S280 and AFM343vf1, are tightly linked to the SCA3 locus, with maximal lod scores, at recombination fraction, ({theta}) = .00, of 7.05 and 13.70, respectively. Combined multipoint and recombinant haplotype analyses localize the SCA3 locus to a 3-cM interval flanked by D14S291 and D14S81. The same allele for D14S280 segregates with the disease locus in the three kindreds. This allele is frequent in the French population, however, and linkage disequilibrium is not clearly established. The SCA3 locus remains within the 29-cM region on 14q24.3-q32.2 containing the gene for the Machado-Joseph disease, which is clinically related to the phenotype determined by SCA3, but it cannot yet be concluded that both diseases result from alterations of the same gene. 30 refs., 3 figs., 3 tabs.

  6. 17 CFR 243.101 - Definitions.

    Science.gov (United States)

    2010-04-01

    ..., or agent of an issuer who discloses material nonpublic information in breach of a duty of trust or confidence to the issuer shall not be considered to be acting on behalf of the issuer. (d) Promptly... or filing with the Commission a Form 8-K (17 CFR 249.308) disclosing that information. (2) An...

  7. 15 CFR 24.3 - Definitions.

    Science.gov (United States)

    2010-01-01

    ... Commerce and Foreign Trade Office of the Secretary of Commerce UNIFORM ADMINISTRATIVE REQUIREMENTS FOR... price of the property including the cost of modifications, attachments, accessories, or auxiliary... under the United States Housing Act of 1937) school district, special district, intrastate...

  8. 40 CFR 243.101 - Definitions.

    Science.gov (United States)

    2010-07-01

    ... provided in a given period of time. (g) Commercial solid waste means all types of solid wastes generated by... Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) SOLID WASTES GUIDELINES FOR THE STORAGE AND COLLECTION OF RESIDENTIAL, COMMERCIAL, AND INSTITUTIONAL SOLID WASTE General Provisions §...

  9. 14 CFR 243.3 - Definitions.

    Science.gov (United States)

    2010-01-01

    ... intimidation, and with wrongful intent. Aviation disaster means: (1) An occurrence associated with the... an aviation disaster. The contact need not have any particular relationship to a passenger. Covered..., the District of Columbia, and the territories and possessions of the United States, including...

  10. Galileo photometry of asteroid 243 Ida

    Science.gov (United States)

    Helfenstein, P.; Veverka, J.; Thomas, P.C.; Simonelli, D.P.; Klaasen, K.; Johnson, T.V.; Fanale, F.; Granahan, J.; McEwen, A.S.; Belton, M.; Chapman, C.

    1996-01-01

    Galileo imaging observations over phase angles 19.5?? to 109.8?? are combined with near-opposition Earth-based data to derive the photometric properties of Ida. To first order these properties are uniform over the surface and well modeled at ?? = 0.55 ??m by Hapke parameters ????0 = 0.22, h = 0.020, B0 = 1.5, g = -0.33, and ?? = 18?? with corresponding geometric albedo p = 0.21??0.030.01 and Bond albedo AB = 0.081??0.0170.008. Ida's photometric properties are more similar to those of "average S-asteroids" (P. Helfenstein and J. Veverka 1989, Asteroids II, Univ. of Arizona Press, Tucson) than are those of 951 Gaspra. Two primary color units are identified on Ida: Terrain A exhibits a spectrum with relatively shallower 1-??m absorption and a relatively steeper red spectral slope than average Ida, while Terrain B has a deeper 1-??m absorption and a less steep red slope. The average photometric properties of Ida and Terrain A are similar while those of Terrain B differ mostly in having a slightly higher value of ????0 (0.22 versus 0.21), suggesting that Terrain B consists of slightly brighter, more transparent regolith particles. Galileo observations of Ida's satellite Dactyl over phase angles 19.5?? to 47.6?? suggest photometric characteristics similar to those of Ida, the major difference being Dactyl's slightly lower albedo (0.20 compared to 0.21). ?? 1990 Academic Press, Inc.

  11. 17 CFR 243.100 - General rule regarding selective disclosure.

    Science.gov (United States)

    2010-04-01

    ... a disclosure made: (i) To a person who owes a duty of trust or confidence to the issuer (such as an...(f)(5)), that filed a report on Form 13F (17 CFR 249.325) with the Commission for the most recent... disclosed information in confidence; (iii) To the following entities solely for the purpose of...

  12. 29 CFR 1910.243 - Guarding of portable powered tools.

    Science.gov (United States)

    2010-07-01

    ... shall be guarded in accordance with the machine guarding requirements in 29 CFR 1910.212, General... propel a stud, pin, fastener, or other object for the purpose of affixing it by penetration to any other..., plaster, tar, dry wallboard, and the like, or to stud-welding equipment. (ii) Operators and...

  13. Dicty_cDB: CHE243 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ae genes during infection and propagation_sML Phytophthora sojae cDNA clone sML00...jae genes during infection and propagation_sZG Phytophthora sojae cDNA clone sZG001H24 5, mRNA sequence. 64 ...ojae genes during infection and propagation_sZS Phytophthora sojae cDNA clone sZS009J21 5, mRNA sequence. 64

  14. 19 CFR 10.243 - Articles eligible for preferential treatment.

    Science.gov (United States)

    2010-04-01

    ... Promotion and Drug Eradication Act Apparel and Other Textile Articles Under the Andean Trade Promotion and...; (ii) Did not enter into the commerce of the intermediate country except for the purpose of sale...

  15. Dicty_cDB: CHS243 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FM992695_70( FM992695 |pid:none) Candida dubliniensis CD36 chromos... 35 1.5 EU361927_1( EU361927 |pid:none)... Daniellia klainei tRNA-Lys (trnK) ... 34 1.9 FM992689_882( FM992689 |pid:none) Candida dubli

  16. Editorial: phys. stat. sol. (b) 243/1

    Science.gov (United States)

    Stutzmann, Martin

    2006-01-01

    Dear Colleagues and Friends,on behalf of the Publishers, the Editorial Office, and the Editors of physica status solidi we wish you all the best for the coming year 2006! It is our sincere hope that your personal and professional experience with our journal has been a positive one and that you will continue to choose physica status solidi for the publication of your scientific findings in solid state physics also in the future.In doing so, you will be in increasingly good company! As a matter of fact, 2005 has been a year of exceptional growth in the number of manuscripts submitted to physica status solidi . Thus, the number of Original Papers which have reached our Editorial Office in Berlin has increased by as much as 30% compared to the long term average over the last ten years. For the Rapid Research Letter section, the corresponding increase has been even more impressive: more than +100% just in the last two years. We view this development as a confirmation of our longstanding efforts to ensure a timely publication service of high scientific quality. One relevant indicator for the high scientific standards expected from articles which are submitted for publication in physica status solidi is the average acceptance rate, which currently is less than 40%. This rate has continuously decreased from a value of about 60% ten years ago and bears witness to our efforts to strive for quality rather than quantity.Also, physica status solidi has been able to continue its long tradition as a truly international journal, despite of the strong competition in an established field such as solid state physics. In 2005, submitted papers have originated almost equally from the Americas, Europe, and Asia, with a clearly growing contribution from China, India, and Japan. We are actively working together with our international Editorial Boards and the Regional Editors to maintain a reasonable balance among papers from different parts of the world. The increasing international visibility of physica status solidi is impressively documented by the ever rising numbers of article downloads via the internet: on the average, each of the 2000 articles published annually in physica status solidi is presently accessed about 100 times via the www.Finally, let me mention some other recent developments, which are not so directly visible from the outside. Thus, a new all electronic publishing system has become operative in our Berlin Editorial Office in 2005, which allows a more efficient and timely handling of manuscripts from submission to publication (www.manuscriptXpress.com) and is particularly valuable for the editing of conference proceedings (conferences.wiley-vch.de). In addition, the functionality of the journal within the Wiley InterScience website has been enhanced by new features such as Citation Tracking. Together with the ongoing digitization of all physica status solidi issues since the 1960s, which is expected to be complete in 2006, this makes the physica status solidi homepage at Wiley InterScience a very valuable tool for literature search in solid state physics, past and present. Try it out at www.interscience.wiley.com!All of us from physica status solidi would like to convey to you our very best wishes for good health and success in the coming year 2006!

  17. Dicty_cDB: SHB243 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available R103667 |CR103667.1 Forward strand read from insert in 3'HPRT insertion targeting and chromosome engineering... in 3'HPRT insertion targeting and chromosome engineering clone MHPP186g09. 50 0.13 1 dna update 2005.12.21

  18. 1935 15' Quad #243 Aerial Photo Mosaic Index

    Data.gov (United States)

    Earth Data Analysis Center, University of New Mexico — Aerial Photo Reference Mosaics contain aerial photographs that are retrievable on a frame by frame basis. The inventory contains imagery from various sources that...

  19. 48 CFR 1852.243-70 - Engineering change proposals.

    Science.gov (United States)

    2010-10-01

    ... SPACE ADMINISTRATION CLAUSES AND FORMS SOLICITATION PROVISIONS AND CONTRACT CLAUSES Texts of Provisions... following clause, modified to suit contract type: Engineering Change Proposals (FEB 1998) (a) Definitions... 1997). As prescribed in 1843.205-70(a)(2), add the following paragraph (f), modified to suit...

  20. 48 CFR 1852.243-71 - Shared savings.

    Science.gov (United States)

    2010-10-01

    ... organizational support of a contract or group of contracts. These alternatives must result in a net reduction of..., submitting, and negotiating a CRP, as well as those costs the Contractor will incur on covered contracts to make any structural or organizational changes in order to implement an approved CRP. (5)...

  1. 48 CFR 52.243-1 - Changes-Fixed-Price.

    Science.gov (United States)

    2010-10-01

    ... of the following: (1) Specifications. (2) Work or services. (3) Place of origin. (4) Place of... cost of, or the time required for, performance of any part of the work under this contract, whether or... right to an adjustment under this clause within 30 days from the date of receipt of the written...

  2. 19 CFR 24.3 - Bills and accounts; receipts.

    Science.gov (United States)

    2010-04-01

    ... account for money due the United States shall be rendered by an authorized Customs officer or employee on... constitute evidence of such payment to Customs. Should a payer desire evidence of receipt, both the...

  3. 9 CFR 354.243 - Operations and procedures.

    Science.gov (United States)

    2010-01-01

    ... AGENCY ORGANIZATION AND TERMINOLOGY; MANDATORY MEAT AND POULTRY PRODUCTS INSPECTION AND VOLUNTARY... eviscerating operation shall be removed as often as necessary to prevent the development of a nuisance....

  4. Motivation for New Measurements on 241, 242, 243Am Isotopes

    International Nuclear Information System (INIS)

    The initial objective of this work was an updated review on the Am isotopes data since the next official release (3.1) of the JEFF3 evaluated data file is foreseen around June 2005. Alternatively, this work searches for the possible reasons of the observed discrepancies between differential and integral measurement results. In particular, strong differences are encountered on σγth values and epithermal branching ratio values for the 241Am. Although the JEF2.2 validation is used as guide in parallel with a systematic study of all differential and integral results available, the need for new measurements clearly shows up. This paper finally draws up a list of desired and feasible new differential and integral measurements on the Am isotopes

  5. Use of trioctylphosphine oxide for transplutonium element extraction and purification

    International Nuclear Information System (INIS)

    Investigated was extraction of tri-valent curium, berkelium, californium, einsteinium as well as cerium and europium with trioctylphosphin oxide from lactic acid solutions, containing DTPA and aluminium nitrate depending on the aluminium nitrate and TOPO concentrations and nitric acid solutions of variable concentration as well. Under optimum conditions of extraction chromatography of berkelium studied was the distribution of cobalt, nickel, chromium, iron, aluminium, titanium, zirconium and niobium ions, and the coefficients of berkelium purification from cations investigated were determined. The effect of weight quantities of cation impurities on extraction chromatographic yield of berkelium has been investigated. Examples of practice application of the extraction chromatography with the use of TOPO are given

  6. Curium-243,4 in the tissues of the adult baboon

    International Nuclear Information System (INIS)

    The curium content of the soft tissues and skeletons of six baboons (serially sacrificed at 3, 7, and 26 months post exposure) was determined in order to define the changing distribution of 2434Cm with time post intravenous injection. The efficacy of a DTPA treatment regimen was also investigated as a function of time of initiation of decorporation post injection of curium. Administration of DTPA treatment was begun at either 0.6, 1.5, or 8 months post exposure

  7. 25 CFR 243.4 - Who can own or possess Alaskan reindeer?

    Science.gov (United States)

    2010-04-01

    ... reindeer must, by the last day of September each year: (1) Provide us a copy of the contract with the Native reindeer owner; and (2) Provide us a written report of all Alaskan reindeer kept, born, died or...). (3) The permit-holder must report to us in writing by the last day of September each year on...

  8. 19 CFR 24.3a - CBP bills; interest assessment; delinquency; notice to principal and surety.

    Science.gov (United States)

    2010-04-01

    ..., DEPARTMENT OF HOMELAND SECURITY; DEPARTMENT OF THE TREASURY CUSTOMS FINANCIAL AND ACCOUNTING PROCEDURE § 24... obtained from the IRS or the CBP Office of Finance, Indianapolis, Indiana. For the convenience of...

  9. Electrochemical oxidation of 243Am(III) in nitric acid by a terpyridyl-derivatized electrode

    Energy Technology Data Exchange (ETDEWEB)

    Dares, C. J.; Lapides, A. M.; Mincher, B. J.; Meyer, T. J.

    2015-11-05

    A high surface area, tin-doped indium oxide electrode surface-derivatized with a terpyridine ligand has been applied to the oxidation of trivalent americium to Am(V) and Am(VI) in nitric acid. Potentials as low as 1.8 V vs. the saturated calomel electrode are used, 0.7 V lower than the 2.6 V potential for one-electron oxidation of Am(III) to Am(IV) in 1 M acid. This simple electrochemical procedure provides, for the first time, a method for accessing the higher oxidation states of Am in non-complexing media for developing the coordination chemistries of Am(V) and Am(VI) and, more importantly, for separation of americium from nuclear waste streams.

  10. Sor/88-243, 21 April 1988, uranium and thorium mining regulations

    International Nuclear Information System (INIS)

    These Regulations deal with radiological health and safety in uranium mining facilities and in effect, they formalise previous requirements imposed on such facilities through licence conditions. Licences are required for removing or excavating uranium or thorium; siting, constructing or operating a mine or a mill; and for decommissioning a mining facility. Applications for licences include technical conditions relevant to each type of activity concerned, the common condition being detailed descriptions of the activity, the radiation protection and environmental protection measures as well as the radiation monitoring programme

  11. 30 CFR 250.243 - What general information must accompany the DPP or DOCD?

    Science.gov (United States)

    2010-07-01

    ... INTERIOR OFFSHORE OIL AND GAS AND SULPHUR OPERATIONS IN THE OUTER CONTINENTAL SHELF Plans and Information... characteristics of the produced oil (see definition under 30 CFR 254.6) that you will handle or store at the... information. If you will not use any new or unusual technology to carry out your proposed development...

  12. 42 CFR 456.243 - Content of medical care evaluation studies.

    Science.gov (United States)

    2010-10-01

    ... SERVICES (CONTINUED) MEDICAL ASSISTANCE PROGRAMS UTILIZATION CONTROL Utilization Control: Mental Hospitals... the mental hospital's patient care; (b) Include analysis of at least the following: (1) Admissions....

  13. 40 CFR 158.243 - Experimental use permit data requirements for terrestrial and aquatic nontarget organisms.

    Science.gov (United States)

    2010-07-01

    ... residential outdoor use. (b) Key. CR=Conditionally required; NR=Not required; R=Required; TEP=Typical end-use product; TGAI=Technical grade of the active ingredient; commas between the test substances (e.g. TGAI, TEP) indicate that data may be required on the TGAI or TEP depending on the conditions set forth in the...

  14. Geologic interpretation of seismic data relocation Route 2, Littleton Road grade separation stations 243-252 in Harvard, Mass.

    Science.gov (United States)

    May, James E.; Linehan, Rev. Daniel

    1950-01-01

    During parts of June and July 1949 nine seismic traverses were made at this site. Upon preliminary office development, the velocity data for some of these traverses were though to be inadequate and it was recommended that these lines be re-surveyed. Later surveys (March 1950), however, of nearby sites indicated that the original data were reliable and that a re-survey was unnecessary. The work was done as part of a cooperative program of the Massachusetts Department of Public Works and the United States Geological Survey.

  15. Protective efficacy of P7C3-S243 in the 6-hydroxydopamine model of Parkinson’s disease

    OpenAIRE

    De Jesús-Cortés, Héctor; Miller, Adam D.; Jeremiah K Britt; DeMarco, Anthony J; De Jesús-Cortés, Mayralis; Stuebing, Emily; Naidoo, Jacinth; Vázquez-Rosa, Edwin; Morlock, Lorraine; Williams, Noelle S.; Ready, Joseph M.; Narayanan, Nandakumar S.; Pieper, Andrew A.

    2015-01-01

    BACKGROUND There are currently no therapeutic options for patients with Parkinson’s disease that prevent or slow the death of dopaminergic neurons. We have recently identified the novel P7C3 class of neuroprotective molecules that blocks neuron cell death. AIMS The aim of this study was to determine whether treatment with highly active members of the P7C3 series blocks dopaminergic neuron cell death and associated behavioral and neurochemical deficits in the rat 6-hydroxydopamine (6-OHDA) mod...

  16. Ceftaroline versus Isolates from Animal Bite Wounds: Comparative In Vitro Activities against 243 Isolates, Including 156 Pasteurella Species Isolates

    OpenAIRE

    Goldstein, Ellie J. C.; Citron, Diane M.; Merriam, C. Vreni; Tyrrell, Kerin L.

    2012-01-01

    More than 5 million Americans are bitten by animals, usually dogs, annually. Bite patients comprise ∼1% of all patients who visit emergency departments (300,000/year), and approximately 10,000 require hospitalization and intravenous antibiotics. Ceftaroline is the bioactive component of the prodrug ceftaroline fosamil, which is FDA approved for the treatment of acute bacterial skin and skin structure infections (ABSSSIs), including those containing methicillin-resistant Staphylococcus aureus ...

  17. 75 FR 4477 - Airworthiness Directives; Airbus Model A330-201, -202, -203, -223, -243, -301, -302, -303, -321...

    Science.gov (United States)

    2010-01-28

    ..., 2009 (74 FR 45781). That NPRM proposed to correct an unsafe condition for the specified products. The... Procedures (44 FR 11034, February 26, 1979); and 3. Will not have a significant economic impact, positive or...], the bogie stop pad was found deformed and cracked. Upon removal of the bogie stop pad for...

  18. Beliefs and opinions in caregiving of elderly with AIDS: an exploratory study - doi:10.5020/18061230.2010.p243

    Directory of Open Access Journals (Sweden)

    Raquel Farias Diniz

    2012-01-01

    Full Text Available Objective: To explore what informal caregivers of elderly with AIDS think about the disease itself, the infection in elderly people, and about being a caregiver. Methods: A qualitative study in which the thematic content analysis of interviews resulted in the emergence of three categories: “conceptions about AIDS”, “AIDS in old age” and “being a caregiver”. Results: We observed the emergence of issues related to the three aspects, which must be considered in a broader analysis within the patient-caregiver relationship. Such questions involve information about the disease, living with the patient, gender differences and the specificities resulting from the infection at this stage of life. Conclusion: From this study, it is expected that greater attention be given to relationships of care provided by informal network of support to elderly people living with AIDS, in order to foster researches on social, affective, motivational and behavior aspects of caregivers.

  19. Association of bta-miR-24-3p with serum antibody response to Mycoplasma spp. in beef cattle

    Science.gov (United States)

    The objective of this study was to identify microRNAs associated with a serum antibody response to Mycoplasma spp. in beef cattle. Serum from sixteen beef calves was collected at three points: summer of 2013, after calves were born; fall of the same year at weaning; and spring, 2014. All sera collec...

  20. Homeopathy and Isopathy in the periodontal maintenance therapy of aggressive periodontitis patients - doi:10.5020/18061230.2007.p243

    Directory of Open Access Journals (Sweden)

    Edivaldo Barbosa da Silva

    2012-01-01

    Full Text Available Periodontal maintenance care is an essential part of periodontal therapy for patients diagnosed with Aggressive Periodontitis, being, however, hard to instruct and to motivate these patients to follow a careful and effective program of maintenance for all their lives. A literature review was done, by means of relevant papers published on the last four decades, pointing out the importance of individual susceptibility for the appearance of aggressive periodontitis and to discuss the importance of a maintenance therapy on its treatment, applying Homeopathy and Isopathy. Homeopathy consists on a complex therapeutic system mainly based on the “Law of Similarity”, that is, the illness may be healed by drugs that produce similar symptoms in a healthy organism and, in this conception, the disease is understood as an energetic unbalance, in which internal and external factors acting on the subject’s susceptibility are considered and can be expressed by an individual symptomathology that goes from the rational sphere to the somatic sphere. On the other hand, Isopathy is the method of treatment with therapeutic agent, which actions on a healthy subject consist on pharmacodynamic manifestations similar to those observed in a sick person. Based on these concepts, the authors establish a hypothesis of the effectiveness of Homeopathy and Isopathy, the latter through auto-medications or auto-biotherapies, that are products which the active principal is obtained from the patient himself (gingival tissue and secretions, and that may be used as auxiliary treatments in the maintenance therapy of Aggressive Periodontitis.

  1. Chromosome 12q24.3 controls sensitization to cat allergen in patients with asthma from Siberia, Russia

    Czech Academy of Sciences Publication Activity Database

    Gusareva, Elena; Bragina, E.J.; Buinova, S.N.; Chernyak, B.A.; Puzyrev, V.P.; Ogorodova, L.M.; Lipoldová, Marie

    2009-01-01

    Roč. 125, č. 1 (2009), s. 1-6. ISSN 0165-2478 R&D Projects: GA ČR GA310/06/1745; GA MŠk(CZ) LC06009 Grant ostatní: EC(XE) 05-1000004-7761 Institutional research plan: CEZ:AV0Z50520514 Keywords : IgE * asthma * cat allergens Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 2.906, year: 2009

  2. 75 FR 60655 - Airworthiness Directives; Airbus Model A330-201, -202, -203, -223, and -243 Airplanes; Airbus...

    Science.gov (United States)

    2010-10-01

    ... Inspection Requirements'' (66 FR 23086, May 7, 2001). In addition to new airworthiness standards for... Policies and Procedures (44 FR 11034, February 26, 1979); and 3. Will not have a significant economic... power unit (APU) bleed leak detection system could result in overheat of the fuel tank located in...

  3. 76 FR 432 - Airworthiness Directives; Airbus Model A330-201, -202, -203, -223, and -243 Airplanes; Airbus...

    Science.gov (United States)

    2011-01-05

    ... October 1, 2010 (75 FR 60655). That NPRM proposed to correct an unsafe condition for the specified...'' under the DOT Regulatory Policies and Procedures (44 FR 11034, February 26, 1979); and 3. Will not have... definition review against explosion hazards. * * * * * Failure of the auxiliary power unit (APU) bleed...

  4. Intra-operative frozen section diagnosis of breast lesions: a retrospective analysis of 13 243 Chinese patients

    Institute of Scientific and Technical Information of China (English)

    NIU Yun; FU Xi-lin; YU Yong; Peizhong Peter Wang; CAO Xu-chen

    2007-01-01

    Background Although cytological methods for breast oncology have been used in recent decades, intra-operative frozen section has been playing a vital role in making therapeutic decisions. We analyzed a large series of frozen section diagnoses for Chinese cases of breast lesion within the last 15 years. The experience was expected to increase the diagnostic accuracy of cases with breast lesions.Methods The data from consecutive 13243 cases of breast lesions diagnosed with intra-operative frozen sections between 1988 to 2002 were compared with paraffin sections in a case by case manner. The causes of false negative and positive diagnoses as well as delayed diagnoses were analyzed.Results One hundred and seventeen cases (0.9%) were falsely diagnosed, with one false positive case and 116 false negative cases. The diagnosis of 47 cases (0.4%) was delayed. The proportion of several lesions had the features of the patients'ages. Six types (false invasion, peri-papilloma, adenoma of nipple duct, florid adenosis, sclerosing adenosis,and granulose cell tumor) of lesions may lead to false positive, and four types (morphological changes responding chemotherapy, well differentiated papillary carcinoma, invasive lobular carcinoma, and tubular carcinoma) to a false negative. Gross and microscopic findings may be inconsistent in two types of lesions (radial scar and florid adenosis)microscopic and clinical findings in three types (ganulomatous mastitis mammary, duct ectasia, and fat necrosis), and three types (abundant fat or sclerous tissues; borderline lesions and changes of post-chemotherapy) were likely wrongly classified.Conclusions Intra-operative frozen section can accurately identify breast lesions in many instances, leading to fewer errors on account of more diagnostic experience and understanding of diagnostic limitations.

  5. Discovery of Isotopes of the Transuranium Elements with 93 <= Z <= 98

    OpenAIRE

    Fry, C; Thoennessen, M

    2012-01-01

    One hundred and five isotopes of the transuranium elements neptunium, plutonium, americium, curium, berkelium and californium have so far been observed; the discovery of these isotopes is discussed. For each isotope a brief summary of the first refereed publication, including the production and identification method, is presented.

  6. SU-E-J-243: Reproducibility of Radiomics Features Through Different Voxel Discretization Levels in F18-FDG PET Images of Cervical Cancer

    International Nuclear Information System (INIS)

    Purpose: Site-specific investigations of the role of Radiomics in cancer diagnosis and therapy are needed. We report of the reproducibility of quantitative image features over different discrete voxel levels in PET/CT images of cervical cancer. Methods: Our dataset consisted of the pretreatment PET/CT scans from a cohort of 76 patients diagnosed with cervical cancer, FIGO stage IB-IVA, age range 31–76 years, treated with external beam radiation therapy to a dose range between 45–50.4 Gy (median dose: 45 Gy), concurrent cisplatin chemotherapy and MRI-based Brachytherapy to a dose of 20–30 Gy (median total dose: 28 Gy). Two board certified radiation oncologists delineated Metabolic Tumor volume (MTV) for each patient. Radiomics features were extracted based on 32, 64, 128 and 256 discretization levels (DL). The 64 level was chosen to be the reference DL. Features were calculated based on Co-occurrence (COM), Gray Level Size Zone (GLSZM) and Run-Length (RLM) matrices. Mean Percentage Differences (Δ) of features for discrete levels were determined. Normality distribution of Δ was tested using Kolomogorov - Smirnov test. Bland-Altman test was used to investigate differences between feature values measured on different DL. The mean, standard deviation and upper/lower value limits for each pair of DL were calculated. Interclass Correlation Coefficient (ICC) analysis was performed to examine the reliability of repeated measures within the context of the test re-test format. Results: 3 global and 5 regional features out of 48 features showed distribution not significantly different from a normal one. The reproducible features passed the normality test. Only 5 reproducible results were reliable, ICC range 0.7 – 0.99. Conclusion: Most of the radiomics features tested showed sensitivity to voxel level discretization between (32 – 256). Only 4 GLSZM, 3 COM and 1 RLM showed insensitivity towards mentioned discrete levels

  7. A Rare Interstitial Duplication of 8q22.1–8q24.3 Associated with Syndromic Bilateral Cleft Lip/Palate

    Directory of Open Access Journals (Sweden)

    Regina Ferreira Rezek

    2014-01-01

    Full Text Available We present a rare case of 8q interstitial duplication derived from maternal balanced translocations in a patient with bilateral cleft lip and palate in syndromic form associated with other congenital malformations. G-banding cytogenetic analysis revealed a chromosomal abnormality in the form of the karyotype 46,XX der(22t(8;22(q22.1;p11.1mat. Chromosome microarray analysis evidenced a 49 Mb duplicated segment of chromosome 8q with no pathogenic imbalances on chromosome 22. Two siblings also carry the balanced translocation. We have compared this case with other “pure” trisomies of 8q patients reported in the literature and with genome wide association studies recently published. This work highlights the involvement of chromosome 8q in orofacial clefts.

  8. Comment on ”John’s stone: A possible fragment of the 1908 Tunguska meteorite” (Anfinogenov et al., 2014, Icarus 243, 139-147)

    DEFF Research Database (Denmark)

    Haack, Henning; Greenwood, Richard; Busemann, Henner

    2016-01-01

    et al. However, since sandstones can only form on a parent body with liquid water and by inference, also an atmosphere, we argue that there are only two possible parent bodies in the Solar System: the Earth and Mars. Mars can be ruled out for several reasons, including the oxygen isotopic and noble...

  9. 76 FR 24832 - Airworthiness Directives; Airbus Model A330-201, -202, -203, -223, and -243 Airplanes, A330-300...

    Science.gov (United States)

    2011-05-03

    ... Procedures (44 FR 11034, February 26, 1979); and 3. Will not have a significant economic impact, positive or... include vacuum loss and elasticity laminate checker inspections for damage including de-bonding between... exist or develop on other products of the same type design. Differences Between This AD and the MCAI...

  10. Crystal structure of 1,5-diethyl-1H-1,5-benzodiazepine-2,4(3H,5H-dithione

    Directory of Open Access Journals (Sweden)

    Abderrahman Lamkaddem

    2015-02-01

    Full Text Available In the title compound, C13H16N2S2, the seven-membered ring adopts a boat conformation, with the two phenylene C atoms representing the stern and the methylene C atom as the prow. The thione S atoms and N-bound ethyl groups lie on the opposite side of the molecule to the phenylene ring so that the molecule approximates mirror symmetry. In the crystal, supramolecular layers in the bc plane are sustained by a pair of C—H...S interactions to the same S atom acceptor.

  11. Decree 243/994 National Direction of Especial Subjects it create and will operate in the orbit of the External Relation Ministere

    International Nuclear Information System (INIS)

    Creates in the Ministry of External Relationships the Direction of Special Matters, to which concerns to study, to coordinate and to execute in the pertinent thing, the foreign policy of the Republic in the related with Nuclear Energy, Dismantle, human rights and Humanitarian Right, Population, Migration and Refugees, Drug traffic, Terrorism, Space Right and all those topics of political character that require to be considered in form separated by their special characteristic . The Direction of Special Political Matters in opinion of the Ministry of External Relationships will depend directly on the General Direction for Political Matters

  12. 2.43 贲门失弛缓症患者的食管运动功能障碍的研究

    Institute of Scientific and Technical Information of China (English)

    陈焰; 宋震亚; 唐训球; 钱可大; 杜勤

    2001-01-01

    目的贲门失弛缓症是原发性食管运动功能障碍性疾病,其病因未明,多数认为是一种神经原性疾病,与食管壁肌间神经丛(Auerbach's神经丛)变性有关,患者食管体部缺少蠕动、食管下括约肌(LES)松弛不全.以往诊断主要依靠食管钡餐检查,本文研究贲门失弛缓症食管测压的改变及对诊断的价值.方法 35例贲门失弛缓症及30例健康志愿者.主要症状:吞咽困难35例,反流11例,胸痛5例,消瘦23例.所有患者均内镜检查,25例患者的食管腔扩大,11例同时伴滞留液,30例贲门区紧闭,推进胃镜时阻力感.5例可以较顺利进镜.食管钡餐表现:32例患者均显示钡剂通过贲门时的受阻,上方食管有不同程度的扩张,贲门部呈鸟嘴样改变.2 例食管钡餐无异常发现.食管测压采用液导法(仪器均是瑞典(CTD-Synectics公司产品). 测定食管下括约肌静息压(LESP)、下括约肌松弛压(LESRP),计算下括约肌松弛率(LESRR), 同时测食管上括约肌静息压(UESP)、食管上括约肌松弛压(UESRP).食管体部蠕动波幅、同步收缩波(局部或全程的同步收缩)和继发性收缩波(未吞咽时食管的收缩波)的发生百分比. 所有数据均采用x -±s表示,统计处理采用t检验.结果 1.食管体部测压表现:35例贲门失弛缓症患者体部100%均为同步收缩波,其中91.4%(32/35)为低幅同步收缩汉.8.6%(3/35)为正常幅度收缩波.85.7%(30/35 )同时存在继发性收缩,且继发性收缩也均是非传导性收缩波.静息食管压均高于胃内压.2 .食管下括约肌测定:贲门失弛缓症患者的LESP为49.0±41.3mmHg,明显高于对照的18. 7±4.5mmHg(P<0.01),82.9%(29/35)的患者的LESP明显高于对照,仅17.1%(6/35) 在正常范围内.食管下括约肌松弛率(LESRR)为69.1±16.3%,明显低于正常对照的96.0 ±0.1%(P<0.01).3.食管上括约肌测定:贲门失弛缓症患者食管上括约肌压力(UES P)为41.0±17.8mmHg,与正常对照组39.4±14.4mmHg无差异(P>0.05).结论食管测压是一种操作简便、快速而安全的食管功能检测方法,可观察食管各部位的运动功能.贲门失弛缓症患者食管体部低幅同步收缩波和LESRR增高尤其重要 ,可早期诊断及判断轻重程度,是确诊本病的可靠的方法.对所有疑为贲门失弛缓症的患者均应进行早期食管测压,不仅可早期发现疾病且对判断预后有帮助.

  13. Deletions in chromosome 6p22.3-p24.3, including ATXN1, are associated with developmental delay and autism spectrum disorders

    Directory of Open Access Journals (Sweden)

    Celestino-Soper Patrícia BS

    2012-04-01

    Full Text Available Abstract Interstitial deletions of the short arm of chromosome 6 are rare and have been associated with developmental delay, hypotonia, congenital anomalies, and dysmorphic features. We used array comparative genomic hybridization in a South Carolina Autism Project (SCAP cohort of 97 subjects with autism spectrum disorders (ASDs and identified an ~ 5.4 Mb deletion on chromosome 6p22.3-p23 in a 15-year-old patient with intellectual disability and ASDs. Subsequent database queries revealed five additional individuals with overlapping submicroscopic deletions and presenting with developmental and speech delay, seizures, behavioral abnormalities, heart defects, and dysmorphic features. The deletion found in the SCAP patient harbors ATXN1, DTNBP1, JARID2, and NHLRC1 that we propose may be responsible for ASDs and developmental delay.

  14. Interstitial deletion of 14q24.3-q32.2 in a male patient with plagiocephaly, BPES features, developmental delay, and congenital heart defects

    DEFF Research Database (Denmark)

    Cingöz, Sultan; Bache, Iben; Bjerglund, Lise;

    2011-01-01

    with developmental delay, language impairment, plagiocephaly, BPES features (blepharophimosis, ptosis, epicanthus), and congenital heart defect. The deletion breakpoints were fine mapped using fluorescence in situ hybridization (FISH) and the size of the deletion is estimated to be approximately 23¿Mb....... Based on genotype-phenotype comparisons of the 10 previously published patients and the present case, we suggest that the shortest regions for deletion overlap may include candidate genes for speech impairment, mental retardation, and hypotonia....

  15. Cavendish, Sueli & Valois, Michelle (Org. Teoria e prática da tradução literária. Recife: Editora UFPE, 2014. 243p.

    Directory of Open Access Journals (Sweden)

    Sonia Ramalho Farias

    2015-12-01

    Full Text Available Critical review of the book Theory and Practice of Literary Translation organized by Sueli Cavendish and Michelle Valois, seeking to learn simultaneously the double objective that sets the collection: the practice of translation and the need to theorize about it through the characteristic disciplinary character of several studies. Some tests were selected from a total of fourteen forming the Anthology. The review aims to detect multiple ways of thinking about translation and the extension of its concept by the various essayists. The text focuses specifically on the interchangeability of translating concepts, interpretation and criticism and dialogue that Translation Studies have with the Literary Theory, Comparative Literature and other disciplines.

  16. SU-E-T-243: MonteCarlo Simulation Study of Polymer and Radiochromic Gel for Three-Dimensional Proton Dose Distribution

    Energy Technology Data Exchange (ETDEWEB)

    Park, M; Jung, H; Kim, G; Ji, Y; Kim, K; Park, S [Korea Institute of Radiological and Medical Sciences, Seoul, Nowon-gu (Korea, Republic of)

    2014-06-01

    Purpose: To estimate the three dimensional dose distributions in a polymer gel and a radiochromic gel by comparing with the virtual water phantom exposed to proton beams by applying Monte Carlo simulation. Methods: The polymer gel dosimeter is the compositeness material of gelatin, methacrylic acid, hydroquinone, tetrakis, and distilled water. The radiochromic gel is PRESAGE product. The densities of polymer and radiochromic gel were 1.040 and 1.0005 g/cm3, respectively. The shape of water phantom was a hexahedron with the size of 13 × 13 × 15 cm3. The proton beam energies of 72 and 116 MeV were used in the simulation. Proton beam was directed to the top of the phantom with Z-axis and the shape of beam was quadrangle with 10 × 10 cm2 dimension. The Percent depth dose and the dose distribution were evaluated for estimating the dose distribution of proton particle in two gel dosimeters, and compared with the virtual water phantom. Results: The Bragg-peak for proton particles in two gel dosimeters was similar to the virtual water phantom. Bragg-peak regions of polymer gel, radiochromic gel, and virtual water phantom were represented in the identical region (4.3 cm) for 72 MeV proton beam. For 116 MeV proton beam, the Bragg-peak regions of polymer gel, radiochromic gel, and virtual water phantom were represented in 9.9, 9.9 and 9.7 cm, respectively. The dose distribution of proton particles in polymer gel, radiochromic gel, and virtual water phantom was approximately identical in the case of 72 and 116 MeV energies. The errors for the simulation were under 10%. Conclusion: This work indicates the evaluation of three dimensional dose distributions by exposing proton particles to polymer and radiochromic gel dosimeter by comparing with the water phantom. The polymer gel and the radiochromic gel dosimeter show similar dose distributions for the proton beams.

  17. Measurement of differential cross sections for antiproton-proton annihilation into charged pion and kaon pairs between 0.79 and 2.43 GeV/c

    International Nuclear Information System (INIS)

    Differential cross sections have been measured for the interactions anti pp→π-π+ and anti pp→K-K+ over a centre of mass angular range -0.95-π+ and 300 K-K+ events were obtained at each momentum. Results are compared with those from related experiments. (Auth.)

  18. A comprehensive study of fission in 24.3 MeV/nucleon U reactions induced on C, Si, Ni, Au targets

    International Nuclear Information System (INIS)

    Fission is a powerful tool for studying the primary reaction mechanisms in nucleus-nucleus collisions involving at least one fissionable nucleus. This is well shown when an additional information on the violence of the collision is provided by a totally independent observable such as the neutron multiplicity. The mass asymmetry in the entrance channel and the impact parameter are shown to have a decisive influence on the fate of the collision leading to either fusion or a two-body deeply inelastic reaction, analogous to what is known at lower bombarding energies. The experimental approach allows also to single out electromagnetic fission of U after interaction with Au and to provide some characteristics of such a process. (author)

  19. SU-E-J-243: Reproducibility of Radiomics Features Through Different Voxel Discretization Levels in F18-FDG PET Images of Cervical Cancer

    Energy Technology Data Exchange (ETDEWEB)

    Altazi, B; Fernandez, D; Zhang, G; Biagioli, M; Moros, E; Moffitt, H. Lee [Cancer Center, Tampa, FL, University of South Florida, Tampa, FL (United States)

    2015-06-15

    Purpose: Site-specific investigations of the role of Radiomics in cancer diagnosis and therapy are needed. We report of the reproducibility of quantitative image features over different discrete voxel levels in PET/CT images of cervical cancer. Methods: Our dataset consisted of the pretreatment PET/CT scans from a cohort of 76 patients diagnosed with cervical cancer, FIGO stage IB-IVA, age range 31–76 years, treated with external beam radiation therapy to a dose range between 45–50.4 Gy (median dose: 45 Gy), concurrent cisplatin chemotherapy and MRI-based Brachytherapy to a dose of 20–30 Gy (median total dose: 28 Gy). Two board certified radiation oncologists delineated Metabolic Tumor volume (MTV) for each patient. Radiomics features were extracted based on 32, 64, 128 and 256 discretization levels (DL). The 64 level was chosen to be the reference DL. Features were calculated based on Co-occurrence (COM), Gray Level Size Zone (GLSZM) and Run-Length (RLM) matrices. Mean Percentage Differences (Δ) of features for discrete levels were determined. Normality distribution of Δ was tested using Kolomogorov - Smirnov test. Bland-Altman test was used to investigate differences between feature values measured on different DL. The mean, standard deviation and upper/lower value limits for each pair of DL were calculated. Interclass Correlation Coefficient (ICC) analysis was performed to examine the reliability of repeated measures within the context of the test re-test format. Results: 3 global and 5 regional features out of 48 features showed distribution not significantly different from a normal one. The reproducible features passed the normality test. Only 5 reproducible results were reliable, ICC range 0.7 – 0.99. Conclusion: Most of the radiomics features tested showed sensitivity to voxel level discretization between (32 – 256). Only 4 GLSZM, 3 COM and 1 RLM showed insensitivity towards mentioned discrete levels.

  20. OPTICAL VARIABILITY OF THE ACCRETION DISK AROUND THE INTERMEDIATE-MASS BLACK HOLE ESO 243-49 HLX-1 DURING THE 2012 OUTBURST

    International Nuclear Information System (INIS)

    We present dedicated quasi-simultaneous X-ray (Swift) and optical (Very Large Telescope, V-, and R-band) observations of the intermediate-mass black hole candidate HLX-1 before and during the 2012 outburst. We show that the V-band magnitudes vary with time, thus proving that a portion of the observed emission originates in the accretion disk. Using the first quiescent optical observations of HLX-1, we show that the stellar population surrounding HLX-1 is fainter than V ∼ 25.1 and R ∼ 24.2. We show that the optical emission may increase before the X-ray emission consistent with the scenario proposed by Lasota et al. in which the regular outbursts could be related to the passage at periastron of a star circling the intermediate-mass black hole in an eccentric orbit, which triggers mass transfer into a quasi-permanent accretion disk around the black hole. Further, if there is indeed a delay in the X-ray emission we estimate the mass-transfer delivery radius to be ∼1011 cm

  1. Konference o srovnávacím výzkumu bydlení, Delft, Nizozemsko, 24.3. – 25.3. 2010

    Czech Academy of Sciences Publication Activity Database

    Sládek, Jan

    2010-01-01

    Roč. 8, č. 5 (2010), s. 9. ISSN 1214-1720 R&D Projects: GA ČR GA403/09/1915 Institutional research plan: CEZ:AV0Z70280505 Keywords : methodology * city * theory Subject RIV: AO - Sociology, Demography http://www.socioweb.cz/upl/editorial/download/179_soc.web._05-2010%20final!.pdf

  2. Interstitial 14q24.3 to q31.3 deletion in a 6-year-old boy with a non-specific dysmorphic phenotype

    OpenAIRE

    Riegel, Mariluce; Moreira, Lilia MA; Espirito Santo, Layla D; Maria Betânia P. Toralles; Schinzel, Albert

    2014-01-01

    Background Few patients with interstitial deletions in the distal long arm of chromosome 14 have been reported, and these patients showed rather indistinct features, including growth and mental retardation and phenotypic alterations. Results We describe a de novo 14q interstitial deletion in a 6-year-old boy with dysmorphic facial traits such as hypertelorism, short and narrow palpebral fissures, broad nose with anteverted nostrils, long philtrum, thin upper lip with cupid’s bow, prominent an...

  3. Interstitial 14q24.3 to q31.3 deletion in a 6-year-old boy with a non-specific dysmorphic phenotype

    OpenAIRE

    Riegel, Mariluce; Moreira, Lilia M; Espirito Santo, Layla D; Toralles, Maria B P; Schinzel, Albert

    2014-01-01

    BACKGROUND: Few patients with interstitial deletions in the distal long arm of chromosome 14 have been reported, and these patients showed rather indistinct features, including growth and mental retardation and phenotypic alterations. RESULTS: We describe a de novo 14q interstitial deletion in a 6-year-old boy with dysmorphic facial traits such as hypertelorism, short and narrow palpebral fissures, broad nose with anteverted nostrils, long philtrum, thin upper lip with cupid's bow, promine...

  4. Benjamin Fondane notebooks. Benjamin Fondane facing the History. About the Existential Monday. The Poem time, no. 14/2011, Editions Kedem, Tel Aviv, 243 p.

    Directory of Open Access Journals (Sweden)

    Speranţa Sofia MILANCOVICI

    2011-01-01

    Full Text Available Luna august reprezintă, pentru membrii sau colaboratorii Socièté d’Etudes Benjamin Fondane, momentul întâlnirii ştiinţifice anuale sub genericul Rencontres de Peyresq. Fiecare astfel de reuniune este succedată de apariţia unui volum critic realizat cu sprijinul Centre National du Livre – France. Este vorba despre seria deja cunoscutelor, în bibliografia de specialitate, Cahiers Benjamin Fondane.Volumul recent apărut poartă titlul Benjamin Fondane devant l’Histoire. Autour du Lundi existentiel. Au temps du Poème şi este cel de al paisprezecelea număr din seria caietelor.În îngrijirea energicei şi competentei preşedinte a Société d’Etudes Benjamin Fondane, prof. dr. Monique Jutrin, volumul propune spre lectură cercetătorilor de specialitate un corpus de eseuri critice grupate pe secţiuni: editorial, filosofie, poezie, opera în limba română a lui Benjamin Fundoianu, bibliografie de specialitate etc.

  5. SCRIB and PUF60 are primary drivers of the multisystemic phenotypes of the 8q24.3 copy-number variant

    DEFF Research Database (Denmark)

    Dauber, Andrew; Golzio, Christelle; Guenot, Cécile;

    2013-01-01

    Copy-number variants (CNVs) represent a significant interpretative challenge, given that each CNV typically affects the dosage of multiple genes. Here we report on five individuals with coloboma, microcephaly, developmental delay, short stature, and craniofacial, cardiac, and renal defects who...... phenotype, and the combinatorial suppression of both genes exacerbated some, but not all, phenotypic components. Consistent with these findings, we identified an individual with microcephaly, short stature, intellectual disability, and heart defects with a de novo c.505C>T variant leading to a p.His169Tyr...

  6. Neutron multiplicities for the transplutonium nuclides

    International Nuclear Information System (INIS)

    This paper continues, with respect to the transplutonium nuclides, earlier efforts to collate and evaluate data from the scientific literature on the prompt neutron multiplicity distribution from fission and its first moment = ΣnuPnu. The isotopes considered here for which P/sub nu/ and or data (or both) were found in the literature are of americium (Am), curium (Cm), berkelium (Bk), californium (Cf), einsteinium (Es), fermium (Fm), and nobelium (No)

  7. 16 CFR 24.3 - Misuse of the terms “waterproof,” “dustproof,” “warpproof,” “scuffproof,” “scratchproof,” “scuff...

    Science.gov (United States)

    2010-01-01

    ... indicating that the product is not subject to wear in any other respect, to describe an industry product unless the outside surface of the product is immune to scratches or scuff marks, or is not subject...

  8. SU-E-J-243: Possibility of Exposure Dose Reduction of Cone-Beam Computed Tomography in An Image Guided Patient Positioning System by Using Various Noise Suppression Filters

    Energy Technology Data Exchange (ETDEWEB)

    Kamezawa, H [Graduate School of Medical Sciences, Kyushu University, Higashi-ku, Fukuoka (Japan); Fujimoto General Hospital, Miyakonojo, Miyazaki (Japan); Arimura, H; Ohki, M [Faculty of Medical Sciences, Kyushu University, Higashi-ku, Fukuoka (Japan); Shirieda, K; Kameda, N [Fujimoto General Hospital, Miyakonojo, Miyazaki (Japan)

    2014-06-01

    Purpose: To investigate the possibility of exposure dose reduction of the cone-beam computed tomography (CBCT) in an image guided patient positioning system by using 6 noise suppression filters. Methods: First, a reference dose (RD) and low-dose (LD)-CBCT (X-ray volume imaging system, Elekta Co.) images were acquired with a reference dose of 86.2 mGy (weighted CT dose index: CTDIw) and various low doses of 1.4 to 43.1 mGy, respectively. Second, an automated rigid registration for three axes was performed for estimating setup errors between a planning CT image and the LD-CBCT images, which were processed by 6 noise suppression filters, i.e., averaging filter (AF), median filter (MF), Gaussian filter (GF), bilateral filter (BF), edge preserving smoothing filter (EPF) and adaptive partial median filter (AMF). Third, residual errors representing the patient positioning accuracy were calculated as an Euclidean distance between the setup error vectors estimated using the LD-CBCT image and RD-CBCT image. Finally, the relationships between the residual error and CTDIw were obtained for 6 noise suppression filters, and then the CTDIw for LD-CBCT images processed by the noise suppression filters were measured at the same residual error, which was obtained with the RD-CBCT. This approach was applied to an anthropomorphic pelvic phantom and two cancer patients. Results: For the phantom, the exposure dose could be reduced from 61% (GF) to 78% (AMF) by applying the noise suppression filters to the CBCT images. The exposure dose in a prostate cancer case could be reduced from 8% (AF) to 61% (AMF), and the exposure dose in a lung cancer case could be reduced from 9% (AF) to 37% (AMF). Conclusion: Using noise suppression filters, particularly an adaptive partial median filter, could be feasible to decrease the additional exposure dose to patients in image guided patient positioning systems.

  9. SU-E-J-243: Possibility of Exposure Dose Reduction of Cone-Beam Computed Tomography in An Image Guided Patient Positioning System by Using Various Noise Suppression Filters

    International Nuclear Information System (INIS)

    Purpose: To investigate the possibility of exposure dose reduction of the cone-beam computed tomography (CBCT) in an image guided patient positioning system by using 6 noise suppression filters. Methods: First, a reference dose (RD) and low-dose (LD)-CBCT (X-ray volume imaging system, Elekta Co.) images were acquired with a reference dose of 86.2 mGy (weighted CT dose index: CTDIw) and various low doses of 1.4 to 43.1 mGy, respectively. Second, an automated rigid registration for three axes was performed for estimating setup errors between a planning CT image and the LD-CBCT images, which were processed by 6 noise suppression filters, i.e., averaging filter (AF), median filter (MF), Gaussian filter (GF), bilateral filter (BF), edge preserving smoothing filter (EPF) and adaptive partial median filter (AMF). Third, residual errors representing the patient positioning accuracy were calculated as an Euclidean distance between the setup error vectors estimated using the LD-CBCT image and RD-CBCT image. Finally, the relationships between the residual error and CTDIw were obtained for 6 noise suppression filters, and then the CTDIw for LD-CBCT images processed by the noise suppression filters were measured at the same residual error, which was obtained with the RD-CBCT. This approach was applied to an anthropomorphic pelvic phantom and two cancer patients. Results: For the phantom, the exposure dose could be reduced from 61% (GF) to 78% (AMF) by applying the noise suppression filters to the CBCT images. The exposure dose in a prostate cancer case could be reduced from 8% (AF) to 61% (AMF), and the exposure dose in a lung cancer case could be reduced from 9% (AF) to 37% (AMF). Conclusion: Using noise suppression filters, particularly an adaptive partial median filter, could be feasible to decrease the additional exposure dose to patients in image guided patient positioning systems

  10. Crystal structure of 3-{1-[(1-allyl-1H-indazol-6-ylamino]ethylidene}-6-methyl-2H-pyran-2,4(3H-dione

    Directory of Open Access Journals (Sweden)

    Mohamed El Ghozlani

    2014-12-01

    Full Text Available In the title compound, C18H17N3O3, the dihedral angle between the planes of the indazole ring system [maximum deviation = 0.012 (1 Å] and the pyran-2,4-dione ring is 54.03 (6°. An intramolecular N—H...O hydrogen bond closes an S(6 ring. The same H atom also participates in an intermolecular N—H...O hydrogen bond, which generates an inversion dimer. The dimers are linked by weak C—H...O contacts, thereby forming a three-dimensional network.

  11. Multibeam collection for TN243: Multibeam data collected aboard Thomas G. Thompson from 2009-11-07 to 2009-11-09, departing from Seattle, WA and returning to Seattle, WA

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — This data set is part of a larger set of data called the Multibeam Bathymetry Database (MBBDB) where other similar data can be found at...

  12. El general de brigada es um tipo de caramelo – tradução automática e aprendizagem cultural.
    DOI: 10.5007/2175-7968.2011v1n27p243

    OpenAIRE

    Nylcea Thereza de Siqueira Pedra; Ruth Bohunovsky

    2011-01-01

    O presente artigo tem por objetivo averiguar o papel assumido pela tradução (automática) no ensino/aprendizagem de línguas estrangeiras. Para tanto, discute-se, primeiramente, diferentes funções didáticas atribuídas à tradução. Entre elas, destaca-se a que objetiva a “aprendizagem cultural”, visando à sensibilização dos aprendizes para aspectos culturais relacionados à língua. Recorrendo a alguns teóricos, problematiza-se o uso de conceitos como “cultura”, “língua” e “tradução” e encontra-se ...

  13. Built environment score related to leisure-time physical activity: application in a region of low socioeconomic status. http://dx.doi.org/10.5007/1980-0037.2013v15n2p243

    OpenAIRE

    Emanuel Péricles Salvador; Vanessa Valente Guimarães; Leandro Martin Totaro Garcia; Alex Antonio Florindo; Homero Fonseca; Rodrigo Siqueira Reis; José Cazuza Farias Júnior

    2013-01-01

    There is little evidence on the relationship between leisure-time physical activity (LTPA) and built environment in Brazil, especially in areas of low socioeconomic status. The objective of this study was to describe indicators of built environment score related to LTPA for adults living in a region of low socioeconomic status. We conducted a cross-sectional study of 767 adults living in Ermelino Matarazzo district in São Paulo, 2007. The dependent variable was the practice of LTPA (in minute...

  14. A rare prenatal case with two de novo inversions and a translocation: 48, XX,t(9;12)(q32;p24.3), inv(11)(p15.1q25), inv(13)(q12.q22)

    Energy Technology Data Exchange (ETDEWEB)

    Harrison, B.; Balaban, L.; Eldred, C. [Albany Medical College, Albany, NY (United States)] [and others

    1994-09-01

    Ultrasound examination of a para 1, gravida 2, 26 y.o. showed severe hydrocephalus and polyhydramnios. Amniocentesis was performed at 27 weeks. High resolution chromosome analysis revealed a karyotype with a 9;12 translocation, a pericentric inversion of chromosome 11, and a paracentric inversion of chromosome 13. Parental chromosome studies were normal. The mother was not on medication prior to her pregnancy and there was no known exposure to radiation. Delivery was at 34 weeks gestation. The phenotype consisted of micrognathia, low set ears, hypertelorism, and hydrodcephaly. Review of the literature revealed a single report with multiple de novo aberrations consisting of a 6;14 translocation and a deleted 7. This was diagnosed in the child of a woman with systemic lupus erythematous treated with azathioprine. These types of abnormalities have been known to be induced by chemical and radiation exposure. High resolution banding combined with molecular studies presently improve our ability to detect subtle structural aberrations.

  15. Method validation for 243 pesticides and environmental contaminants in meats and poultry by tandem mass spectrometry coupled to low-pressure gas chromatography and ultra high-performance liquid chromatography

    Science.gov (United States)

    An easy and reliable high-throughput analysis method was developed and validated for 192 diverse pesticides and 51 environmental contaminants (13 PCB congeners, 14 PAHs, 7 PBDE congeners, and 17 novel flame retardants) in cattle, swine, and poultry muscle. Sample preparation was based on the “quick,...

  16. María Teresa Pozzoli, Pensar de nuevo. Ensayos sobre pensamiento complejo (ecología, arte, psicología, educación y vida cotidiana), Editorial Universidad Bolivariana, Santiago, 2009, 243 p.

    OpenAIRE

    Cuadra, César

    2011-01-01

    María Teresa Pozzoli acaba de publicar su tercer libro de ensayos: Pensar de nuevo. Sin duda, un nuevo eslabón en su sostenida tarea por crear nuevas cartografías y nuevas rutas para el pensamiento en este nuevo milenio. Antes de éste, publicó La obediencia de Abraham (ensayo sobre el aprendizaje institucional de la obediencia patológica). Y aun antes, había publicado Complexus (un ensayo que transita por la psicología y las ciencias de la salud, y cuya propuesta apunta a un cambio cultural d...

  17. An unbalanced submicroscopic translocation t(8;16)(q24.3;p13.3)pat associated with tuberous sclerosis complex, adult polycystic kidney disease, and hypomelanosis of Ito

    NARCIS (Netherlands)

    H.J.F.M.M. Eussen (Bert); S. Verhoef; A. Fois; D.J.J. Halley (Dicky); G. Bartalini (Gabriella); L. Bakker (Lida); P. Balestri (Paolo); C. di Lucca; J.O. van Hemel; H. Dauwerse; A.M.W. van den Ouweland (Ans); C. Ris-Stalpers (Carolyn)

    2000-01-01

    textabstractWe report on a familial submicroscopic translocation involving chromosomes 8 and 16. The proband of the family had a clinical picture suggestive of a large deletion in the chromosome 16p13.3 area, as he was affected with tuberous sclerosis complex (TSC) and had alpha th

  18. TOWARD AN IMPROVED UNDERSTANDING OF STRUCTURE AND MAGNETISM IN NEPTUNIUM AND PLUTONIUM PHOSPHONATES AND SULFONATES

    Energy Technology Data Exchange (ETDEWEB)

    Albrecht-Schmitt, Thomas

    2012-03-01

    This grant supported the exploratory synthesis of new actinide materials with all of the actinides from thorium to californium with the exceptions of protactinium and berkelium. We developed detailed structure-property relationships that allowed for the identification of novel materials with selective ion-exchange, selective oxidation, and long-range magnetic ordering. We found novel bonding motifs and identified periodic trends across the actinide series. We identified structural building units that would lead to desired structural features and novel topologies. We also characterized many different spectroscopic trends across the actinide series. The grant support the preparation of approximately 1200 new compounds all of which were structurally characterized.

  19. Composition containing transuranic elements for use in the homeopathic treatment of aids

    International Nuclear Information System (INIS)

    A homeopathic remedy consisting of a composition containing one or more transuranic elements, particularly plutonium, for preventing and treating acquired immunodeficiency syndrome (AIDS) in humans, as well as seropositivity for human immunodeficiency virus (HIV). Said composition is characterized in that it uses any chemical or isotopic form of one or more transuranic elements (neptunium, plutonium, americium, curium, berkelium, californium or einsteinium), particularly plutonium, said form being diluted and dynamized according to conventional homeopathic methods, particularly the so-called Hahnemann and Korsakov methods, and provided preferably but not exclusively in the form of lactose and/or saccharose globules or granules impregnated with the active principle of said composition. (author)

  20. Detection of rare earth elements in Powder River Basin sub-bituminous coal ash using laser-induced breakdown spectroscopy (LIBS)

    Energy Technology Data Exchange (ETDEWEB)

    Tran, Phuoc [National Energy Technology Lab. (NETL), Pittsburgh, PA, (United State; Mcintyre, Dustin [National Energy Technology Lab. (NETL), Pittsburgh, PA, (United State

    2015-10-01

    We reported our preliminary results on the use of laser-induced breakdown spectroscopy to analyze the rare earth elements contained in ash samples from Powder River Basin sub-bituminous coal (PRB-coal). We have identified many elements in the lanthanide series (cerium, europium, holmium, lanthanum, lutetium, praseodymium, promethium, samarium, terbium, ytterbium) and some elements in the actinide series (actinium, thorium, uranium, plutonium, berkelium, californium) in the ash samples. In addition, various metals were also seen to present in the ash samples

  1. PROCEEDINGS OF THE SYMPOSIUM COMMEMORATING THE 25th ANNIVERSARY OF ELEMENTS 97 and 98 HELD ON JAN. 20, 1975

    Energy Technology Data Exchange (ETDEWEB)

    Seaborg, Glenn T.; Street Jr., Kenneth; Thompson, Stanley G.; Ghiorso, Albert

    1976-07-01

    This volume includes the talks given on January 20, 1975, at a symposium in Berkeley on the occasion of the celebration of the 25th anniversary of the discovery of berkelium and californium. Talks were given at this symposium by the four people involved in the discovery of these elements and by a number of people who have made significant contributions in the intervening years to the investigation of their nuclear and chemical properties. The papers are being published here, without editing, in the form in which they were submitted by the authors in the months following the anniversary symposium, and they reflect rather faithfully the remarks made on that occasion.

  2. Dicty_cDB: Contig-U00892-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 124 ggattattttaaagaattaaagagatatatatatttncttcatctcttttcaaccaataa 183 Query: 184 attgncaaatgaaaatgtgttaccna...|||||||||||||||| Sbjct: 184 attgncaaatgaaaatgtgttaccnataactcaaaactaaataataatattcnactttgc 243 Query: 244 naaa...aacc 303 Query: 304 cnattttaatggctgncctcccnagcttcnaactantgcttgatattatttananataaa 363 |||||||||||||||||||||||...||||||||||||||||||||||||||||||||||||| Sbjct: 304 cnattttaatggctgncctcccnagcttcnaactantgcttgatattatttananataa...Query: 184 attgncaaatgaaaatgtgttaccnataactcaaaactaaataataatattcnactttgc 243 ||||||||||||||||||||||||||||||||

  3. 77 FR 50323 - Railroad Workplace Safety; Roadway Worker Protection Miscellaneous Revisions (RRR)

    Science.gov (United States)

    2012-08-20

    ... of contractor employees at Sec. Sec. 243.1(b), 243.101(e)-(f), and 243.209. 77 FR 6453. These... Railroad Workplace Safety; Roadway Worker Protection Miscellaneous Revisions (RRR); Proposed Rule #0;#0... TRANSPORTATION Federal Railroad Administration 49 CFR Part 214 RIN 2130-AB89 Railroad Workplace Safety;...

  4. Further Study is Needed to Define and Measure the Use of Reflective Practice in Library and Information Science. A review of: Grant, Maria J. “The Role of Reflection in the Library and Information Sector: A Systematic Review.” Health Information and Libraries Journal 24.3 (2007: 155‐66.

    Directory of Open Access Journals (Sweden)

    Carol Perryman

    2008-03-01

    Full Text Available Objectives ‐ To identify and review the literature of reflective practice in library and information science (LIS in order to understand its role, particularly with regard to health libraries.Design ‐ Systematic reviewSetting ‐ LIS English‐language articles published between 1969 and 2006, and indexed in the Library and Information Science Abstracts (LISA database.Subjects ‐ 929 citations retrieved from the LISA database.Methods ‐ The author conducted free text searches in the LISA database for the terms ‘reflective,’ ‘reflection*,’ or ‘reflexion*.’ An initial search series was conducted in 2004 in order to retrieve items published between 1969‐2003, then in 2007 for articles published between 2004‐2006. In all, 929 article citations were retrieved. Exclusion criteria included those articles addressing the facilitation of reflective practices in others, as well as non‐English language materials,and those pre-dating 1969. After review, 55 articles met the author’s relevance standard.Citation tracking then added 10 articles to the total. From this dataset, full‐text articles were obtained where possible, if determined on initial scrutiny to be deserving of further examination. Thirteen articles (.013% were ultimately selected for analysis. These articles were categorized as analytical or non‐analytical, with respect to perspective (individual or organizational, and recency of events (retrospective or recent. In addition, a determination was made about whether the articles’ foci were reflection occurring on (in retrospect to or in (during practice.Main results ‐ Of thirteen articles, five were found to be non‐analytical, with the other six being analytical. Three of the non-analytical items were the reflections of an individual, while the remaining two offered an organizational perspective. The non-analytical accounts were found to be descriptive accounts by an individual, mostly retrospective and offering no consideration of implications for LIS practice. Analytical reflective accounts attempt to systematically appraise events from the recent past, and draw conclusions in order to improve future actions.Conclusion – A gradual increase in the use of analytical reflective practice is demonstrated over the period from 1969‐2006, although insufficient examples of the practice were found in the published literature. Reflective practice is likely to be beneficial to LIS practitioners, especially when time is spent in considering the implications of lessons learned from practice.

  5. University Students Are Unaware of the Role of Academic Librarians. A Review of: Bickley, R. & Corral, S. (2011. Student perceptions of staff in the information commons: A survey at the University of Sheffield. Reference Services Review, 39(2, 223-243. doi:10.1108/00907321111135466

    Directory of Open Access Journals (Sweden)

    Kirsty Thomson

    2012-06-01

    Full Text Available Objective – To discover students’ perceptionsof information commons staff, and todetermine how these perceptions influence theuse of library resources.Design – Post-experience survey with onefollow-up interview.Setting – The University of Sheffield, a postsecondaryinstitution in England.Subjects – All undergraduate andpostgraduate students were invited to takepart. Just over 1% of the student population, or250 students, completed the survey.Methods – Information about the survey wassent to students’ institutional email addresses.One follow up interview was carried out viaemail using the critical incident technique.Main Results – Students do not understandthe academic roles of librarians. They areunlikely to approach library staff for academicsupport, preferring to turn to instructors, otherstudents, friends, and family. Most studentshad positive opinions about assistancereceived in the Information Commons, but asmall number reflected on previous badexperiences with staff, or on a fear of beingmade to feel foolish. The vast majority ofstudents who did not seek help in theInformation Commons stated that this wasbecause they did not require assistance. Most students do not perceive a difference between Information Commons staff and library staff.Conclusion – Students have positive views of Information Commons staff at the University of Sheffield, but have low awareness of the roles of professional librarians. Librarians need to develop partnerships with academic staff and strengthen their presence in both physical and online learning environments to promote their academic roles.

  6. [Dimitri Steinke: Die Zivilrechtsordnungen des Baltikums unter dem Einfluss ausländischer, insbesondere deutscher Rechtsquellen. (Osnabrücker Schriften zur Rechtsgeschichte, Bd. 16.) V&R unipress. Göttingen 2009. 243 S. ISBN 978-3-89971-573-6] / M

    Index Scriptorium Estoniae

    Luts-Sootak, Marju, 1966-

    2011-01-01

    Arvustus: Dimitri Steinke. Die Zivilrechtsordnungen des Baltikums unter dem Einfluss ausländischer, insbesondere deutscher Rechtsquellen. (Osnabrücker Schriften zur Rechtsgeschichte ; 16). Göttingen, 2009

  7. Dime, ¿y acaso tú sabes qué e' lo que e' la experiencia? : Barnet, Miguel (2012): Biografía de un cimarrón. La Habana, Editorial de Letras Cubanas, 243 pp. (Primera edición: 1966, Editorial de la Academia de Ciencias de Cuba)

    OpenAIRE

    Recchia Páez, Juan

    2014-01-01

    Me acababa de bajar del camión que nos trajo desde Santiago de Cuba y, caminando por las calles de Manzanillo, un pueblo ubicado en la costa oeste de la provincia de Granma, me adentré en una biblioteca. Enseguida una mujer me preguntó si buscaba algo particular, le conté que soy estudiante de literatura y profesor en escuelas secundarias, por lo que estaba recorriendo librerías de un modo un tanto casual, más bien para ver qué se publicaba y qué se leía en Cuba. Me habló de la circulación de...

  8. An atomic beam source for actinide elements: concept and realization

    International Nuclear Information System (INIS)

    For ultratrace analysis of actinide elements and studies of their atomic properties with resonance ionization mass spectroscopy (RIMS), efficient and stable sources of actinide atomic beams are required. The thermodynamics and kinetics of the evaporation of actinide elements and oxides from a variety of metals were considered, including diffusion, desorption, and associative desorption. On this basis various sandwich-type filaments were studied. The most promising system was found to consist of tantalum as the backing material, an electrolytically deposited actinide hydroxide as the source of the element, and a titanium covering layer for its reduction to the metal. Such sandwich sources were experimentally proven to be well suited for the production of atomic beams of plutonium, curium, berkelium and californium at relatively low operating temperatures and with high and reproducible yields. (orig.)

  9. EC decay of 244Bk

    Science.gov (United States)

    Sodaye, Suparna; Tripathi, R.; Sudarshan, K.; Sharma, S. K.; Pujari, P. K.; Palit, R.; Mukhopadhyay, S.

    2014-12-01

    Berkelium isotopes have been produced in 11B-induced reaction on 238U. The EC decay of 244Bk → 244Cm has been studied by carrying out the single and coincidence measurements of the γ-rays emitted during the de-excitation of the 244Cm levels. Radiochemical separations have been carried out to minimize the contribution from the fission products and target. The new half-life of 244Bk is obtained as 5.02 ± 0.03 h, which is close to the theoretically calculated value. The relative intensities of the decay γ-rays have been re-evaluated. Based on the coincidence measurements, a tentative partial level scheme for 244Bk → 244Cm decay has been proposed.

  10. Nuclear fission and the transuranium elements

    International Nuclear Information System (INIS)

    Many of the transuranium elements are produced and isolated in large quantities through the use of neutrons furnished by nuclear fission reactions: plutonium (atomic number 94) in ton quantities; neptunium (93), americium (95), and curium (96) in kilogram quantities; berkelium (97) in 100 milligram quantities; californium (98) in gram quantities; and einsteinium (99) in milligram quantities. Transuranium isotopes have found many practical applications---as nuclear fuel for the large-scale generation of electricity, as compact, long-lived power sources for use in space exploration, as means for diagnosis and treatment in the medical area, and as tools in numerous industrial processes. Of particular interest is the unusual chemistry and impact of these heaviest elements on the periodic table. This account will feature these aspects. 9 refs., 5 figs

  11. Nuclear fission and the transuranium elements

    Energy Technology Data Exchange (ETDEWEB)

    Seaborg, G.T.

    1989-02-01

    Many of the transuranium elements are produced and isolated in large quantities through the use of neutrons furnished by nuclear fission reactions: plutonium (atomic number 94) in ton quantities; neptunium (93), americium (95), and curium (96) in kilogram quantities; berkelium (97) in 100 milligram quantities; californium (98) in gram quantities; and einsteinium (99) in milligram quantities. Transuranium isotopes have found many practical applications---as nuclear fuel for the large-scale generation of electricity, as compact, long-lived power sources for use in space exploration, as means for diagnosis and treatment in the medical area, and as tools in numerous industrial processes. Of particular interest is the unusual chemistry and impact of these heaviest elements on the periodic table. This account will feature these aspects. 9 refs., 5 figs.

  12. EC decay of 244Bk

    International Nuclear Information System (INIS)

    Berkelium isotopes have been produced in 11B-induced reaction on 238U. The EC decay of 244Bk → 244Cm has been studied by carrying out the single and coincidence measurements of the γ-rays emitted during the de-excitation of the 244Cm levels. Radiochemical separations have been carried out to minimize the contribution from the fission products and target. The new half-life of 244Bk is obtained as 5.02 ± 0.03 h, which is close to the theoretically calculated value. The relative intensities of the decay γ-rays have been re-evaluated. Based on the coincidence measurements, a tentative partial level scheme for 244Bk → 244Cm decay has been proposed. (paper)

  13. Production of transuranium elements

    International Nuclear Information System (INIS)

    The Radiochemical Engineering Development Center (REDC) has the programmatic responsibility for the Department of Energy's Transuranium Element Program. Principle elements from the program are einsteinium, berkelium, and fermium. Targets containing curium oxide mixed with aluminum powder are fabricated by the REDC and irradiated in the Oak Ridge National Laboratory (ORNL) High Flux Isotope Reactor. Following an irradiation period of 6-12 months, targets are returned to the REDC for chemical processing. Processing operations consists of aluminum dejacketing in a caustic-nitrate solution, filtration, acid dissolution, solvent extraction, anion exchange, and finally a cation exchange to recover the actinides. The processing operations take place in heavily shielded hot cell facilities and all operations are carried out remotely. The chemistry for the separations has been well established over the 26-yr. operating life of the facility

  14. Local Purchasing of Journals is Required in Addition to a Nationally Purchased Collection to Meet the Information Needs of NHS Staff. A review of: Glover, Steven William, John Addison, Colette Gleghorn, and John Bramwell. “Journal Usage in NHS Hospitals: A Comparison Report of Total Usage at an Acute NHS Trust and a Specialist NHS Trust in the North West of England.” Health Information and Libraries Journal 24.3 (2007): 193‐9.

    OpenAIRE

    Jennie Kelson

    2008-01-01

    Objective ‐ To compare journal usage between an acute National Health Service (NHS) Trust and a specialist NHS Trust located in North West England to provide some evidence as to how well the National Core Content Collection (provided by ProQuest) meets the needs of staff in these settings.Design ‐ Comparative studySetting ‐ An acute NHS Trust, comprising four hospital sites, and a cancer specialist NHS Trust based on a single site. Both Trusts are located in North West England. The cancer spe...

  15. Measurements of minor actinides cross sections for transmutation

    International Nuclear Information System (INIS)

    The existing reactors produce two kinds of nuclear waste: the fission products and heavy nuclei beyond uranium called minor actinides (Americium and Curium isotopes). Two options are considered: storage in deep geological site and/or transmutation by fast neutron induced fission. These studies involve many neutron data. Unfortunately, these data bases have still many shortcomings to achieve reliable results. The aim of these measurements is to update nuclear data and complement them. We have measured the fission cross section of 243Am (7370 y) in reference to the (n,p) elastic scattering to provide new data in a range of fast neutrons (1-8 MeV). A statistical model has been developed to describe the reaction 243Am (n,f). Moreover, the cross sections from the following reactions have been be extracted from these calculations: inelastic scattering 243Am (n,n') and radiative capture 243Am (n,γ) cross sections. The direct measurements of neutron cross sections are often a challenge considering the short half-lives of minor actinides. To overcome this problem, a surrogate method using transfer reactions has been used to study few isotopes of curium. The reactions 243Am (3He, d)244Cm, 243Am (3He, t)243Cm and 243Am (3He, α)242Am allowed to measure the fission probabilities of 243,244Cm and 242Am. The fission cross sections of 242,243Cm (162,9 d, 28,5 y) and 241Am (431 y) have been obtained by multiplying these fission probabilities by the calculated compound nuclear neutron cross section relative to each channel. For each measurement, an accurate assessment of the errors was realized through variance-covariance studies. For measurements of the reaction 243Am(n,f), the analysis of error correlations allowed to interpret the scope of these measures within the existing measurements. (author)

  16. EST Table: BP120125 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available BP120125 ceN-1863 10/09/28 100 %/243 aa ref|NP_001036916.1| G protein alpha subunit Go isoform 1 ... 8 88 %/243 aa C26C6.2#CE05311#WBGene00001648#locus:goa -1#guanine nucleotide-binding protein#status:Confir ...

  17. Marine data and information management system for the Indian Ocean

    Digital Repository Service at National Institute of Oceanography (India)

    Sarupria, J.S.

    stream_size 8 stream_content_type text/plain stream_name IGBP_India_2000_243.pdf.txt stream_source_info IGBP_India_2000_243.pdf.txt Content-Encoding ISO-8859-1 Content-Type text/plain; charset=ISO-8859-1 ...

  18. AcEST: BP914429 [AcEST

    Lifescience Database Archive (English)

    Full Text Available EGEK SATKWI Sbjct: 184 LSENEEDLSDCAKRGIAVKPRKGDALLFFNLHPDAIPDPLSLHGGCPVIEGEKWSATKWI 243 Query: 184 HVQSLDSPARDVGDCKDEDESCG...PDAIPDPLSLHGGCPVIEGEKWSATKWI 243 Query: 184 HVQSLDSPARDVGDCKDEDESCGEWAAYGECQKNPTYMIGTSEQPGYCRRS 32 HV S D G+...IPVKPRKGDALLFYSLHPNATPDPLSLHGGCPVIQGEKWSATKWI 239 Query: 184 HVQSLDSPARDVGDCKDEDESCGEWAAYGECQKNPTYMIGTSEQPGY...ct: 152 KDDSWSACGKTGVAVKPRKGDALLFFSLHPSAVPDESSLHTGCPVIEGEKWSATKWIHVA 211 Query: 175 SLDSPARDVGDCKDEDESCG...PDPFSLHGGCPVIEGEKWSATKWI 242 Query: 184 HVQSLDSPARDVGDCKDEDESCGEWAAYGECQKNPTYMIGT

  19. Unigene BLAST: CBRC-CELE-02-0076 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-CELE-02-0076 gnl|UG|Cel#S5711810 Caenorhabditis elegans Serpentine Receptor, c...lass H family member (srh-243) (srh-243) mRNA, complete cds /cds=p(1,1014) /gb=NM_071378 /gi=17563407 /ug=Cel.28794 /len=1014 3e-72 41% ...

  20. Classification of Dickeya and Pectobacterium species by HPLC and gel isoeletric focusing

    Czech Academy of Sciences Publication Activity Database

    Kubesová, Anna; Moravcová, Dana; Šalplachta, Jiří; Horký, J.; Horká, Marie

    2013. s. 243-243. [International Symposium on High Performance Liquid Phase Separations and Related Techniques /39./. 16.06.2013-20.06.2013, Amsterdam] R&D Projects: GA MV VG20112015021 Institutional support: RVO:68081715 Keywords : Dickeya * fingerprint * characterization Subject RIV: CB - Analytical Chemistry, Separation

  1. Drug: D02578 [KEGG MEDICUS

    Lifescience Database Archive (English)

    Full Text Available D02578 Drug Agomelatine (INN); Valdoxan (TN) C15H17NO2 243.1259 243.301 D02578.gif ATC code: N06 ... r08303] N NERVOUS SYSTEM N06 PSYCHOANALEPTICS N06A ANTIDEPRESSANTS ... N06AX Other antidepressants ... N06AX22 Agomelatine D0 ...

  2. Calculations of Solid-State NMR Parameters of Isocytosine and Sesquiterpene Lactones

    Czech Academy of Sciences Publication Activity Database

    Dračínský, Martin; Buděšínský, Miloš; Warzajtis, B.; Rychlewska, U.

    Ireland : University College Dublin, 2012. s. 243-243. [EUROMAR 2012. Magnetic Resonance Conference. 01.07.2012-05.07.2012, Dublin] Institutional research plan: CEZ:AV0Z40550506 Keywords : NMR * solid-state * DFT calculations * crystal packing Subject RIV: CC - Organic Chemistry

  3. Male gender, Charnley class C, and severity of bone defects predict the risk for aseptic loosening in the cup of ABG I hip arthroplasty

    Czech Academy of Sciences Publication Activity Database

    Gallo, J.; Havránek, Vítězslav; Zapletalová, J.; Lošťák, J.

    2010-01-01

    Roč. 11, č. 10 (2010), 243/1-243/7. E-ISSN 1471-2474 Institutional research plan: CEZ:AV0Z10100522 Keywords : hip arthroplasty * ABG I Subject RIV: BH - Optics, Masers, Lasers Impact factor: 1.941, year: 2010

  4. U.S. Trends in Solid Waste Management and GHG Emissions

    Science.gov (United States)

    In 2009, 243 million tons of municipal solid waste (MSW) was produced in the United States. Currently, 34% of the 243 million tons of MSW is recovered and recycled or composted which conserves energy and natural resources as well as avoid waste disposal. Of the remaining MSW th...

  5. Nuclear Chemistry Institute, Mainz University. Annual Report 1995

    International Nuclear Information System (INIS)

    The annual report of the Institut fuer Kernchemie addresses inter alia three main research activities. The first belongs to the area of basic research, covering studies in the fields of nuclear fission, chemistry of the super-heavy elements and of heavy-ion reactions extending from the Coulomb barrier to relativistic energies, and nuclear astrophysics in connection with the ''r process''. By means of laser technology, high-precision data could be measured of the ionization energies of berkelium and californium. Studies of atomic clusters in the vacuum of an ionization trap revealed interesting aspects. The second major activity was devoted to the analysis of environmental media, applying inter alia neutron activation analysis and resonance ionization mass spectroscopy (RIMS). The third activity resulted in the development of novel processes, or the enhancement of existing processes or methods, for applications in basic research work and in environmental analytics. Another item of interest is the summarizing report on the operation of the TRIGA research reactor. (orig./SR)

  6. Paul Scherrer Institute Scientific Report 1999. Volume I: Particles and Matter

    International Nuclear Information System (INIS)

    Although originally planned for fundamental research in nuclear physics, the particle beams of pions, muons, protons and neutrons are now used in a large variety of disciplines in both natural science and medicine. The beams at PSI have the world's highest intensities and therefore allow certain experiments to be performed, which would not be possible elsewhere. The highlight of research this year was the first-ever determination of the chemical properties of the superheavy element 107 Bohrium. This was undertaken, by an international team led by H. Gaeggeler of PSI's Laboratory for Radiochemistry. Bohrium was produced by bombarding a Berkelium target with Neon ions from the Injector I cyclotron and six atoms were detected after having passed through an online gas chromatography device. At the Laboratory for Particle Physics the focus has shifted from nuclear physics to elementary particle physics with about a fifty-fifty split between investigations of rare processes or particle decays using the high intensity muon, pion and recently also polarized neutron beams of PSI, and research at the highest energy frontier at CERN (Geneva) and DESY (Hamburg). Important space instrumentation has been contributed by the Laboratory for Astrophysics to the European Space Agency and NASA satellite programmes. The Laboratory for Micro and Nanotechnology continued to focus on research into molecular nanotechnology and SiGeC nanostructures, the latter with the aim of producing silicon based optoelectronics. Progress in 1999 in these topical areas is described in this report. A list of scientific publications in 1999 is also provided

  7. Investigations for the influence of geochemical parameters on the sorption and desorption of lanthanides and uranium onto opalinus clay as potential host rock for a repository

    International Nuclear Information System (INIS)

    The development of a disposal in deep geological formations for radioactive waste is a very important task for the future. The safety assessment for more than a hundred thousand years needs a full understanding of all processes of interaction between the radioactive waste and the surrounded formations. This work contributes to this understanding. The interaction between lanthanides (homologues of the actinides americium, curium and berkelium) / uranium and the host rock opalinus clay under influence of organic substances (NOM) have been analyzed and discussed. The complex system was split into 3 binary basic systems with the following interactions - Interactions between lanthanides / uranium and NOM - Interactions between lanthanides / uranium and the opalinus clay - Interactions between NOM and opalinus clay All binary systems can be influenced by geological parameters like pH, ion strength and competing cations. The sorption / desorption of the lanthanides onto the opalinus clay is analyzed via inductively coupled plasma mass spectrometry. For the investigation of the complexation behavior of metals with NOM we used capillary electrophoresis coupled with inductively coupled plasma mass spectrometry. Under these conditions the chosen model organic humic acid affected the sorption of the lanthanides onto opalinus clay favorably. The smaller organic compounds, which dominate in the composition of the clay organics, remobilized the metals after sorption onto clay and the sorption can be inhibited by NOM. Due to the reduced metal sorption onto Opalinus clay by NOM, a migration through the clay may be possible.

  8. Off-line tuning of a PI speed controller for a permanent magnet brushless DC motor using DSP

    International Nuclear Information System (INIS)

    In this paper, a new method of tuning Proportional Integral (PI) coefficients for a permanent magnet brushless DC (PMBLDC) motor drives is proposed. Artificial neural network is used to identify the whole system using maximum overshoot and settling time obtained from the application circuit for different Kp-Ki pairs. Optimal values of PI controller coefficients are obtained using genetic algorithm. Motion Control Kit (MCK243) is used to carry out digital motion control applications. The MCK243 kit includes a power module and a three-phase brushless motor. TMS320F243 programs are used for PMBLDC motor speed control. Experimental results are given to show the validity of this method.

  9. EST Table: FS863113 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available FS863113 E_FL_fner_20N15_R_0 10/09/28 48 %/243 aa ref|XP_975194.1| PREDICTED: similar to something...l|GB19080-PA 10/09/10 48 %/243 aa gi|91081571|ref|XP_975194.1| PREDICTED: similar to something about silencing protein 10 [Tribolium castaneum] FS823506 fner ... ... about silencing protein 10 [Tribolium castaneum] gb|EFA01562.1| hypothetical protein TcasGA2...43 aa AGAP002960-PA Protein|2R:30130647:30132122:-1|gene:AGAP002960 10/09/10 44 %/249 aa gnl|Ame

  10. AcEST: DK954028 [AcEST

    Lifescience Database Archive (English)

    Full Text Available TST39A01NGRL0019_F16 533 Adiantum capillus-veneris mRNA. clone: TST39A01NGRL0019_F16. 5' end seq ... se (Fragment) OS=Ama... 243 3e-63 tr|Q403V7|Q403V7_TAX DI Glutamyl-tRNA reductase (Fragment) OS=Tax ... 243 ... 4e-63 tr|Q403V5|Q403V5_TAX DI Glutamyl-tRNA reductase (Fragment) OS=Tax ... 243 ...

  11. AcEST: DK946138 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU02A01NGRL0011_J16 568 Adiantum capillus-veneris mRNA. clone: YMU02A01NGRL0011_J16. 5' end seq ... NVFIRKVKILKAPKFDIGKLMEVHGDYSEDVGVKL 243 Query: 543 ERP ... 551 +RP Sbjct: 244 DRP 246 >sp|Q42262|RS3A2_ARATH ... VFIRKVKILKAPKFDLGKLMEVHGDYTAEDVGVK 243 Query: 540 VERP ... 551 V+RP Sbjct: 244 VDRP 247 >sp|P33444|RS3A_CATRO ... NVFIRKVKILKAPKFDLGKLMEVHGDYNEDIGTKL 243 Query: 543 ERP ... 551 +RP Sbjct: 244 DRP 246 >sp|Q9CAV0|RS3A1_ARATH ... VFIRKVKILKAPKFDLGKLMDVHGDYSAEDVGVK 243 Query: 540 VERP ... 551 V+RP Sbjct: 244 VDRP 247 >sp|P49397|RS3A_ORYSJ ...

  12. Vladimír Bergauer a česká eugenika

    Czech Academy of Sciences Publication Activity Database

    Šimůnek, Michal V.

    Praha: Karolinum, 2006 - (Černý, K.; Svobodný, P.), s. 205-243 ISBN 80-246-1099-X Institutional research plan: CEZ:AV0Z80630520 Keywords : eugenics - phycians - biographies Subject RIV: AB - History

  13. The Relation between Moral and Legal Obligation: an Alternative Kantian Reading

    Czech Academy of Sciences Publication Activity Database

    Pavlakos, George

    Cambridge : Cambridge University Press, 2015 - (Pavlakos, G.; Rodriguez-Blanco, V.), s. 228-243 ISBN 978-1-107-07072-1 Institutional support: RVO:68378122 Keywords : moral obligation * legal obligation * philosophy of law Subject RIV: AG - Legal Sciences

  14. Advances in Weight Loss Surgery: The Fully Robotic Gastric Bypass

    Medline Plus

    Full Text Available ... call, weighs approximately 243 pounds, has a body mass index or a BMI of 41, which qualifies ... instance, this patient here, who has a body mass index of 41, we know that those patients ...

  15. Tagasi Pariisis / Karl Rumor

    Index Scriptorium Estoniae

    Rumor, Karl, pseud., 1886-1971

    2008-01-01

    Prantsusmaa sisepoliitilisest olustikust. Poliitilistest oludest 1937. aasta Euroopas, sõjameeleoludest Vahemerel, Nyloni konverentsist. Varem ilmunud: Uus Eesti 21. juuni 1937, nr. 166; 8., 13. sept. 1937, nr. 243, 248

  16. K některým otázkám etnochoreologického studia: tanec, gender a politika

    Czech Academy of Sciences Publication Activity Database

    Stavělová, Daniela

    2010-01-01

    Roč. 20, č. 4 (2010), s. 239-243. ISSN 0862-8351 Institutional research plan: CEZ:AV0Z90580513 Keywords : dance * gender * politics * national movement * identity Subject RIV: AC - Archeology, Anthropology, Ethnology

  17. Nápěvy písní k tanci "do kolečka"– textová výstavba a deklamace

    Czech Academy of Sciences Publication Activity Database

    Vejvoda, Zdeněk

    2006-01-01

    Roč. 93, č. 3 (2006), s. 243-258. ISSN 0009-0794 Institutional research plan: CEZ:AV0Z90580513 Keywords : round and round * structural analysis * declamation Subject RIV: AC - Archeology, Anthropology, Ethnology

  18. Advances in Weight Loss Surgery: The Fully Robotic Gastric Bypass

    Medline Plus

    Full Text Available ... feet-five-inches call, weighs approximately 243 pounds, has a body mass index or a BMI of ... sleep apnea, gastroesophageal reflux disease, and depression. She has a previous open cholecystectomy, not laparoscopic, and that ...

  19. Mineralogy of halloysites and their interaction with porphyrine

    Czech Academy of Sciences Publication Activity Database

    Vašutová, V.; Bezdička, Petr; Lang, Kamil; Hradil, David

    2013-01-01

    Roč. 57, č. 3 (2013), s. 243-250. ISSN 0862-5468 Institutional support: RVO:61388980 Keywords : organoclays * mineralogy * porphyrine * CEC Subject RIV: CA - Inorganic Chemistry Impact factor: 0.434, year: 2013

  20. Optická tloušťka atmosféry jako parametr pro stanovení obyvatelných zón exoplanet

    Czech Academy of Sciences Publication Activity Database

    Pintr, Pavel

    2013-01-01

    Roč. 58, č. 9 (2013), s. 243-246. ISSN 0447-6441 Institutional support: RVO:61389021 Keywords : Habitable zones * exoplanets * stellar spectral classes Subject RIV: JA - Electronics ; Optoelectronics, Electrical Engineering

  1. Cyclotella hinziae sp. nov. – a small Cyclotella (Bacillariophyceae) from subalpine lake Schliersee (Bavaria, Germany)

    Czech Academy of Sciences Publication Activity Database

    Houk, Václav; König, C.; Klee, R.

    2015-01-01

    Roč. 15, č. 2 (2015), s. 235-243. ISSN 1802-5439 Institutional support: RVO:67985939 Keywords : halassiosiraceae * taxonomy * valve ultrastructure Subject RIV: EF - Botanics Impact factor: 1.930, year: 2014

  2. delta-Thiolactones as Prodrugs of Thiol-Based Glutamate Carboxypeptidase II (GCPII) Inhibitors

    Czech Academy of Sciences Publication Activity Database

    Ferraris, D. V.; Majer, Pavel; Ni, C.; Slusher, C. E.; Rais, R.; Wu, Y.; Wozniak, K. M.; Alt, J.; Rojas, C.; Slusher, B. S.; Tsukamoto, T.

    2014-01-01

    Roč. 57, č. 1 (2014), s. 243-247. ISSN 0022-2623 Institutional support: RVO:61388963 Keywords : pharmacokinetics * discovery * disorders * diagnosis * pain Subject RIV: CC - Organic Chemistry Impact factor: 5.447, year: 2014

  3. Ergot alkaloids as chiral selectors in capillary electrophoresis and other electromigration methods

    Czech Academy of Sciences Publication Activity Database

    Sinibaldi, M.; Messina, A.; Stodůlková, Eva; Flieger, Miroslav

    2010-01-01

    Roč. 1, č. 3 (2010), s. 233-243. ISSN 0976-5514 Institutional research plan: CEZ:AV0Z50200510 Keywords : capillary electrophoresis * capillary electrochromatography * chiral analysis Subject RIV: CB - Analytical Chemistry, Separation

  4. Jazyk, barvy a matematizace?

    Czech Academy of Sciences Publication Activity Database

    Beran, Ondřej

    Červený Kostelec: Pavel Mervart, 2011 - (Kůrka, P.; Matoušek, A.), s. 243-260 ISBN 978-80-7465-012-3 Institutional support: RVO:67985955 Keywords : mathematization * model Subject RIV: AA - Philosophy ; Religion

  5. Mohelno-Plevovce: Lokalita osídlená v průběhu posledního glaciálního maxima a pozdního glaciálu

    Czech Academy of Sciences Publication Activity Database

    Škrdla, Petr; Rychtaříková, Tereza; Eigner, J.; Bartík, J.; Nikolajev, P.; Vokáč, M.; Nývltová Fišáková, Miriam; Čerevková, A.; Knotková, J.

    2014-01-01

    Roč. 66, č. 2 (2014), s. 243-270. ISSN 0323-1267 Institutional support: RVO:68081758 Keywords : Moravia * Mohelno * MIS -2 * LGM * dwelling * pavement * Epigravettian * Epiaurignacian Subject RIV: AC - Archeology, Anthropology, Ethnology

  6. Report on progress of researches by common utilization of JAERI nuclear facilities, for fiscal 1993

    International Nuclear Information System (INIS)

    The results of the joint researches by utilizing the facilities of JAERI in 1993 fiscal year were summarized. The number of research themes in 1993 was 228 cases. In this book, 243 reports are collected. (J.P.N.)

  7. Dutch occupational physicians and general practitioners wish to improve cooperation

    NARCIS (Netherlands)

    Buijs, P.; Amstel, R. van; Dijk, F. van

    1999-01-01

    Objectives - To investigate cooperation between occupational physicians (OPs) and general practitioners (GPs). Methods - Literature review; structured interviews; questionnaires sent to randomised samples of OPs (n = 232) and GPs (n = 243). Results - Actual cooperation is poor. However, more than 80

  8. Large-scale evaluation of carnivore road mortality: the effect of landscape and local scale characteristics

    Czech Academy of Sciences Publication Activity Database

    Červinka, J.; Riegert, J.; Grill, S.; Šálek, Martin

    2015-01-01

    Roč. 60, č. 3 (2015), s. 233-243. ISSN 2199-2401 Institutional support: RVO:68081766 Keywords : Carnivores * Landscape characteristics * Linear structures * Local characteristics * Road mortality * Temporal pattern Subject RIV: EH - Ecology, Behaviour

  9. CPAP Tips

    Medline Plus

    Full Text Available ... Rory Brown 47,243 views 4:17 Cool New Tool Helps Cure Sleep Apnea - As Featured on ... Terms Privacy Policy & Safety Send feedback Try something new! Loading... Working... Sign in to add this to ...

  10. Preparation of Nanostructurated Materials by ArF Laser Ablation

    Czech Academy of Sciences Publication Activity Database

    Koštejn, Martin; Fajgar, Radek; Tomovska, R.; Blazevska-Gilev, J.

    -: -, 2014, s. 243. ISBN N. [International Conference on Nanosciences & Nanotechnologie (NN13) /10./. Thessaloniki (GR), 09.07.2014-12.07.2014] Institutional support: RVO:67985858 Keywords : laser ablation * electron diffraction * spectroscopy Subject RIV: CH - Nuclear ; Quantum Chemistry

  11. Otakar Binar

    Czech Academy of Sciences Publication Activity Database

    Hnídková, Vendula

    [Řevnice]: Arbor vitae, 2012 - (Švácha, R.), s. 240-243 ISBN 978-80-87164-87-7 Institutional support: RVO:68378033 Keywords : Czech architecture * SIAL Subject RIV: AL - Art, Architecture, Cultural Heritage

  12. Improvement of the banana "Musa acuminata" reference sequence using NGS data and semi-automated bioinformatics methods

    Czech Academy of Sciences Publication Activity Database

    Martin, G.; Baurens, F.C.; Droc, G.; Rouard, M.; Cenci, A.; Kilian, A.; Hastie, A.; Doležel, Jaroslav; Aury, J. M.; Alberti, A.; Carreel, F.; D'Hont, A.

    2016-01-01

    Roč. 17, MAR 16 (2016), s. 243. ISSN 1471-2164 Institutional support: RVO:61389030 Keywords : Musa acuminata * Genome assembly * Bioinformatics tool Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 3.986, year: 2014

  13. Pediatric Palliative Care: A Personal Story

    Medline Plus

    Full Text Available ... count__/__total__ Find out why Close Pediatric Palliative Care: A Personal Story NINRnews Subscribe Subscribed Unsubscribe 243 ... and her family. The story demonstrates how palliative care can positively influence a patient's and family's experience ...

  14. Disease: H00084 [KEGG MEDICUS

    Lifescience Database Archive (English)

    Full Text Available bone marrow transplant. Annu Rev Med 54:29-52 (2003) PMID:15931364 (drug) Iwasaki T. Recent advances in the treatment of graft-versus-host disease. Clin Med Res 2:243-52 (2004) ...

  15. The most ancient lagomorphs of Sardinia: An overview

    Czech Academy of Sciences Publication Activity Database

    Angelone, Ch.; Čermák, Stanislav; Kotsakis, T.

    2015-01-01

    Roč. 48, July/September (2015), s. 287-296. ISSN 0016-6995 Institutional support: RVO:67985831 Keywords : insularity * Leporidae * Mediterranean * Ochotonidae * palaeobiogeography * phylogeny * taxonomy Subject RIV: DB - Geology ; Mineralogy Impact factor: 1.243, year: 2014

  16. Wind tunnel measurement of vertical fluxes of passive pollutant

    Czech Academy of Sciences Publication Activity Database

    Bezpalcová, Klára; Ohba, M.; Jaňour, Zbyněk

    Hatfield : University of Hertfordshire, 2009. s. 243-243. ISBN 978-1-905313-63-1. [International Conference on Air Quality Science and Application. 24.03.2009-27.03.2009, Istanbul] R&D Projects: GA MŠk(CZ) OC 113 Institutional research plan: CEZ:AV0Z20760514 Keywords : air pollution * atmospheric boundary lyaer * turbulent diffusion Subject RIV: DG - Athmosphere Sciences, Meteorology

  17. Regional growth curves and improved design value estimates of extreme precipitation events in the Czech Republic

    Czech Academy of Sciences Publication Activity Database

    Kyselý, Jan; Picek, J.

    2007-01-01

    Roč. 33, č. 3 (2007), s. 243-255. ISSN 0936-577X R&D Projects: GA AV ČR KJB300420601 Institutional research plan: CEZ:AV0Z30420517 Keywords : extreme precipitation event * regional frequency analysis * design values * central Europe * Czech Republic Subject RIV: DG - Athmosphere Sciences, Meteorology Impact factor: 1.307, year: 2007 http://www.int-res.com/articles/cr2007/33/c033p243.pdf

  18. Actinides separation and long-lived fission products from the high activity effluent

    International Nuclear Information System (INIS)

    The aim of this document is to study the decontamination of a high activity effluent in minor actinides-α transmitters (241Am, 243Am, 243Cm, 245Cm, 237Np, 238Pu, 242Pu, 235U, 238U) and long-life fissions products (133Cs, 137Cs) and then the separation of Am, Cm, Np, Cs and Pu, U traces. (TEC). 16 figs., 1 tab

  19. Superpave沥青混凝土的应用和控制

    Institute of Scientific and Technical Information of China (English)

    肖国华

    2010-01-01

    在S243省道的路面设计采用superpave型.同时在上面层中采用SBS改性沥青.笔者通过在243省道沥青混凝土的施工中的实践和体会,谈谈Superpave沥青混凝土的应用和控制.

  20. Binding of peptides to HLA-DQ molecules: peptide binding properties of the disease-associated HLA-DQ(alpha 1*0501, beta 1*0201) molecule

    DEFF Research Database (Denmark)

    Johansen, B H; Buus, S; Vartdal, F;

    1994-01-01

    assay. The MB 65 kDa 243-255Y peptide bound to DQ2 in a strictly pH-dependent fashion, with optimal binding around pH 5 and only weak binding at pH 7.4. The association of the MB 65 kDa 243-255Y peptide to DQ2 was slow, but once formed, the peptide-HLA complexes were very stable. The binding of peptides...

  1. Method of preparation of tracer radionuclide 239Np using extraction chromatography

    International Nuclear Information System (INIS)

    This poster describes the preparation of tracers 239Np from 243Am. Used method involves stabilization of Np(IV) by ascorbic acid and ferric nitrate, separation of 239Np from 243Am using extraction chromatography and determination of activity of the solution obtained with 239Np using HPGe detector. In the experiment we used the commercially available sorbent TEVA Resin from the company Eichrom Technologies.

  2. The contribution of IL-6 to beta 3 adrenergic receptor mediated adipose tissue remodeling.

    Science.gov (United States)

    Buzelle, Samyra L; MacPherson, Rebecca E K; Peppler, Willem T; Castellani, Laura; Wright, David C

    2015-02-01

    The chronic activation of beta 3 adrenergic receptors results in marked alterations in adipose tissue morphology and metabolism, including increases in mitochondrial content and the expression of enzymes involved in lipogenesis and glyceroneogenesis. Acute treatment with CL 316,243, a beta 3 adrenergic agonist, induces the expression of interleukin 6. Interestingly, IL-6 has been shown to induce mitochondrial genes in cultured adipocytes. Therefore, the purpose of this paper was to examine the role of interleukin 6 in mediating the in vivo effects of CL 316,243 in white adipose tissue. Circulating IL-6, and markers of IL-6 signaling in white adipose tissue were increased 4 h following a single injection of CL 316,243 in C57BL6/J mice. Once daily injections of CL 316,243 for 5 days increased the protein content of a number of mitochondrial proteins including CORE1, Cytochrome C, PDH, MCAD, and Citrate Synthase to a similar extent in adipose tissue from WT and IL-6(-/-) mice. Conversely, CL 316,243-induced increases in COXIV and phosphorylated AMPK were attenuated in IL-6(-/-) mice. Likewise, the slight, but significant, CL 316,243-induced increases in ATGL, PEPCK, and PPARγ, were reduced or absent in adipose tissue IL-6(-/-) mice. The attenuated response to CL 316,243 in white adipose tissue in IL-6(-/-) mice was associated with reductions in whole-body oxygen consumption and energy expenditure in the light phase. Our findings suggest that IL-6 plays a limited role in CL 316,243-mediated adipose tissue remodeling. PMID:25713332

  3. Molecular Detection of Healthiness of Bombyx mori

    Institute of Scientific and Technical Information of China (English)

    2012-01-01

    [Objective] The paper was to explore the regularity between heat shock protein expression and the healthiness changes of Bombyx moil materials. [Method] The representative heat shock protein gene Bmhsp24.3 was screened by bioinfor- matic analysis method, and carried out real-time PCR expression analysis. [Result] The target gene Bmhsp24.3 expressed in different B. mori materials, but the expres- sion level in different materials significantly varied. The relative expression level of the gene had different degrees of changes under different rearing conditions. With the increase of rearing temperature, the gene expression was upregulated. The ma- terials with better healthiness had remarkable increase in expression of target gene, while the materials with poorer healthiness had less increase in expression of target gene. The expression difference of target gene Bmhsp24.3 was exactly consistent with the healthiness of breeds. [Conclusion] The healthiness of materials had rela- tionship with expression of target gene Bmhsp24.3. the higher the expression of tar- get gene Bmhsp24.3 was, the better the healthiness of materials was; conversely, the lower the expression of target gene Bmhsp24.3 was, the poorer the healthiness of materials was.

  4. Minor Actinide Burning in Thermal Reactors. A Report by the Working Party on Scientific Issues of Reactor Systems

    International Nuclear Information System (INIS)

    The actinides (or actinoids) are those elements in the periodic table from actinium upwards. Uranium (U) and plutonium (Pu) are two of the principal elements in nuclear fuel that could be classed as major actinides. The minor actinides are normally taken to be the triad of neptunium (Np), americium (Am) and curium (Cm). The combined masses of the remaining actinides (i.e. actinium, thorium, protactinium, berkelium, californium, einsteinium and fermium) are small enough to be regarded as very minor trace contaminants in nuclear fuel. Those elements above uranium in the periodic table are known collectively as the transuranics (TRUs). The operation of a nuclear reactor produces large quantities of irradiated fuel (sometimes referred to as spent fuel), which is either stored prior to eventual deep geological disposal or reprocessed to enable actinide recycling. A modern light water reactor (LWR) of 1 GWe capacity will typically discharge about 20-25 tonnes of irradiated fuel per year of operation. About 93-94% of the mass of uranium oxide irradiated fuel is comprised of uranium (mostly 238U), with about 4-5% fission products and ∼1% plutonium. About 0.1-0.2% of the mass is comprised of neptunium, americium and curium. These latter elements accumulate in nuclear fuel because of neutron captures, and they contribute significantly to decay heat loading and neutron output, as well as to the overall radio-toxic hazard of spent fuel. Although the total minor actinide mass is relatively small - approximately 20-25 kg per year from a 1 GWe LWR - it has a disproportionate impact on spent fuel disposal, and thus the longstanding interest in transmuting these actinides either by fission (to fission products) or neutron capture in order to reduce their impact on the back end of the fuel cycle. The combined masses of the trace actinides actinium, thorium, protactinium, berkelium and californium in irradiated LWR fuel are only about 2 parts per billion, which is far too low for

  5. Radiological safety considerations in the design and operation of the Oak Ridge National Laboratory Transuranium Research Laboratory (TRL)

    International Nuclear Information System (INIS)

    The Transuranium Research Laboratory (TRL) is the central facility at Oak Ridge National Laboratory (ORNL) for chemical and physical research involving transuranium elements. Transuranium Research Laboratory investigations are about equally divided between studies of inorganic and structural chemistry of the heavy elements and nuclear structure and properties of their isotopes. Elements studied include neptunium, plutonium, americium, curium, berkelium, californium, and einsteinium, each in microgram-to-gram quantities depending upon availability and experimental requirements. This paper describes an eight-step safety procedure that is followed in planning and approving individual research projects. This procedure should provide an ''optimum margin of safety'' and should permit the accomplishment of successful research. Steps in the procedure are as follows: (1) Evaluate the external and internal exposure radioactivity hazards. (2) Establish any concurrent conventional industrial safety risks that may be encountered in the operation. (3) Consider, in the proper perspective, the potential consequences of possible interactions of radioactivity risks with associated industrial safety risks and problems, applying the concepts of credibility and probability. (4) Design equipment, develop operating procedures, and ensure the proficiency of operating personnel to provide necessary safeguards to accomplish programme objectives with minimum risks and minimum operational constraints. (5) Ensure that necessary safeguards are, in fact, incorporated in equipment and procedures before actual work is begun. (6) Ensure that appropriate monitoring instrumentation, surveillance, and other necessary protective technical and craft support are available and are used during operation. (7) Make certain that appropriate measures exist to manage credible radiation accidents and other emergencies properly. (8) Inform others, in sufficient detail, of the success or deficiency of design

  6. Radiochemical studies of neutron deficient actinide isotopes

    International Nuclear Information System (INIS)

    The production of neutron deficient actinide isotopes in heavy ion reactions was studied using alpha, gamma, x-ray, and spontaneous fission detection systems. A new isotope of berkelium, 242Bk, was produced with a cross-section of approximately 10 μb in reactions of boron on uranium and nitrogen on thorium. It decays by electron capture with a half-life of 7.0 +- 1.3 minutes. The alpha-branching ratio for this isotope is less than 1% and the spontaneous fission ratio is less than 0.03%. Studies of (Heavy Ion, pxn) and (Heavy Ion, αxn) transfer reactions in comparison with (Heavy ion, xn) compound nucleus reactions revealed transfer reaction cross-sections equal to or greater than the compound nucleus yields. The data show that in some cases the yield of an isotope produced via a (H.I.,pxn) or (H.I.,αxn) reaction may be higher than its production via an xn compound nucleus reaction. These results have dire consequences for proponents of the ''Z1 + Z2 = Z/sub 1+2/'' philosophy. It is no longer acceptable to assume that (H.I.,pxn) and (H.I.,αxn) product yields are of no consequence when studying compound nucleus reactions. No evidence for spontaneous fission decay of 228Pu, 230Pu, 232Cm, or 238Cf was observed indicating that strictly empirical extrapolations of spontaneous fission half-life data is inadequate for predictions of half-lives for unknown neutron deficient actinide isotopes

  7. Transuranium Processing Plant semiannual report of production, status, and plans for period ending December 31, 1975

    Energy Technology Data Exchange (ETDEWEB)

    King, L.J.; Bigelow, J.E.; Collins, E.D.

    1976-10-01

    Between July 1, 1975, and December 31, 1975, maintenance was conducted at TRU for a period of three months, 295 g of curium oxide (enough for approximately 26 HFIR targets) were prepared, 100 mg of high-purity /sup 248/Cm, were separated from /sup 252/Cf that had been purified during earlier periods, 11 HFIR targets were fabricated, and 28 product shipments were made. No changes were made in the chemical processing flowsheets normally used at TRU during this report period. However, three equipment racks were replaced (with two new racks) during this time. In Cubicle 6, the equipment replaced was that used to decontaminate the transplutonium elements from rare earth fission products and to separate curium from the heavier elements by means of the LiCl-based anion-exchange process. In Cubicle 5, the equipment used to separate the transcurium elements by high-pressure ion exchange and to purify berkelium by batch solvent extraction was replaced. Two neutron sources were fabricated, bringing the total fabricated to 79. One source that had been used in a completed project was returned to the TRU inventory and is available for reissue. Three sources, for which no further use was foreseen, were processed to isolate and recover the ingrown /sup 248/Cm and the residual /sup 252/Cf. Eight pellets, each containing 100 ..mu..g of high-purity /sup 248/Cm were prepared for irradiation in HFIR to study the production of /sup 250/Cm. The values currently being used for transuranium element decay data and for cross-section data in planning irradiation-processing cycles, calculating production forecasts, and assaying products are tabulated.

  8. Radiochemical studies of neutron deficient actinide isotopes

    Energy Technology Data Exchange (ETDEWEB)

    Williams, K.E.

    1978-04-01

    The production of neutron deficient actinide isotopes in heavy ion reactions was studied using alpha, gamma, x-ray, and spontaneous fission detection systems. A new isotope of berkelium, /sup 242/Bk, was produced with a cross-section of approximately 10 ..mu..b in reactions of boron on uranium and nitrogen on thorium. It decays by electron capture with a half-life of 7.0 +- 1.3 minutes. The alpha-branching ratio for this isotope is less than 1% and the spontaneous fission ratio is less than 0.03%. Studies of (Heavy Ion, pxn) and (Heavy Ion, ..cap alpha..xn) transfer reactions in comparison with (Heavy ion, xn) compound nucleus reactions revealed transfer reaction cross-sections equal to or greater than the compound nucleus yields. The data show that in some cases the yield of an isotope produced via a (H.I.,pxn) or (H.I.,..cap alpha..xn) reaction may be higher than its production via an xn compound nucleus reaction. These results have dire consequences for proponents of the ''Z/sub 1/ + Z/sub 2/ = Z/sub 1+2/'' philosophy. It is no longer acceptable to assume that (H.I.,pxn) and (H.I.,..cap alpha..xn) product yields are of no consequence when studying compound nucleus reactions. No evidence for spontaneous fission decay of /sup 228/Pu, /sup 230/Pu, /sup 232/Cm, or /sup 238/Cf was observed indicating that strictly empirical extrapolations of spontaneous fission half-life data is inadequate for predictions of half-lives for unknown neutron deficient actinide isotopes.

  9. Paul Scherrer Institute Scientific Report 1999. Volume I: Particles and Matter

    Energy Technology Data Exchange (ETDEWEB)

    Gobrecht, J.; Gaeggeler, H.; Herlach, D.; Junker, K.; Kettle, P.-R.; Kubik, P.; Zehnder, A. [eds.

    2000-07-01

    lthough originally planned for fundamental research in nuclear physics, the particle beams of pions, muons, protons and neutrons are now used in a large variety of disciplines in both natural science and medicine. The beams at PSI have the world's highest intensities and therefore allow certain experiments to be performed, which would not be possible elsewhere. The highlight of research this year was the first-ever determination of the chemical properties of the superheavy element {sup 107} Bohrium. This was undertaken, by an international team led by H. Gaeggeler of PSI's Laboratory for Radiochemistry. Bohrium was produced by bombarding a Berkelium target with Neon ions from the Injector I cyclotron and six atoms were detected after having passed through an online gas chromatography device. At the Laboratory for Particle Physics the focus has shifted from nuclear physics to elementary particle physics with about a fifty-fifty split between investigations of rare processes or particle decays using the high intensity muon, pion and recently also polarized neutron beams of PSI, and research at the highest energy frontier at CERN (Geneva) and DESY (Hamburg). Important space instrumentation has been contributed by the Laboratory for Astrophysics to the European Space Agency and NASA satellite programmes. The Laboratory for Micro and Nanotechnology continued to focus on research into molecular nanotechnology and SiGeC nanostructures, the latter with the aim of producing silicon based optoelectronics. Progress in 1999 in these topical areas is described in this report. A list of scientific publications in 1999 is also provided.

  10. Actinide production in the reaction of heavy ions with curium-248

    International Nuclear Information System (INIS)

    Chemical experiments were performed to examine the usefulness of heavy ion transfer reactions in producing new, neutron-rich actinide nuclides. A general quasi-elastic to deep-inelastic mechanism is proposed, and the utility of this method as opposed to other methods (e.g. complete fusion) is discussed. The relative merits of various techniques of actinide target synthesis are discussed. A description is given of a target system designed to remove the large amounts of heat generated by the passage of a heavy ion beam through matter, thereby maximizing the beam intensity which can be safely used in an experiment. Also described is a general separation scheme for the actinide elements from protactinium (Z=91) to mendelevium (Z=101), and fast specific procedures for plutonium, americium and berkelium. The cross sections for the production of several nuclides from the bombardment of 248Cm with 18O, 86Kr and 136Xe projectiles at several energies near and below the Coulomb barrier were determined. The results are compared with yields from 48Ca and 238U bombardments of 248Cm. Simple extrapolation of the product yields into unknown regions of charge and mass indicates that the use of heavy ion transfer reactions to produce new, neutron-rich above-target species is limited. The substantial production of neutron-rich below-target species, however, indicates that with very heavy ions like 136Xe and 238U the new species 248Am, 249Am and 247Pu should be produced with large cross sections from a 248Cm target. A preliminary, unsuccessful attempt to isolate 247Pu is outlined. The failure is probably due to the half life of the decay, which is calculated to be less than 3 minutes. The absolute gamma ray intensities from 251Bk decay, necessary for calculating the 251Bk cross section, are also determined

  11. Chelation of curium in the adult baboon using Ca- and Zn-DTPA

    International Nuclear Information System (INIS)

    The effectiveness of Ca-DTPA in removing internally deposited Cm-243, 244 was tested in the baboon at 1.5 and 8-month intervals between injection of Cm-243, 244 and treatment. Four young adult female baboons were injected IV with the radionuclides in citrate form. Ca-DTPA was administered three times in five days on alternate days beginning at 1.5 months in one baboon and at 8 months in another. The two remaining control baboons were administered physiological saline only. In vivo counting was performed to determine the total body, skeletal, and liver retention before, during and after chelation therapy. All urine and feces were collected and the Cm-243, 244 content of each was determined daily. A comparison of the efficacy of chelate therapy with Cm-243, 244 and Am-241 when treatment was delayed for 1.5 months after Am-241 injection showed that Ca-DTPA is more effective in enhancing the excretion of established burdens of Cm-243, 244 than that of Am-241 by approximately 34 percent in the urine and 87 percent in the feces during the first seven days after initiation of therapy

  12. Enhanced sensitivity in H photofragment detection by two-color reduced-Doppler ion imaging

    Energy Technology Data Exchange (ETDEWEB)

    Epshtein, Michael; Portnov, Alexander; Kupfer, Rotem; Rosenwaks, Salman; Bar, Ilana, E-mail: ibar@bgu.ac.il [Department of Physics, Ben-Gurion University of the Negev, Beer-Sheva 84105 (Israel)

    2013-11-14

    Two-color reduced-Doppler (TCRD) and one-color velocity map imaging (VMI) were used for probing H atom photofragments resulting from the ∼243.1 nm photodissociation of pyrrole. The velocity components of the H photofragments were probed by employing two counterpropagating beams at close and fixed wavelengths of 243.15 and 243.12 nm in TCRD and a single beam at ∼243.1 nm, scanned across the Doppler profile in VMI. The TCRD imaging enabled probing of the entire velocity distribution in a single pulse, resulting in enhanced ionization efficiency, as well as improved sensitivity and signal-to-noise ratio. These advantages were utilized for studying the pyrrole photodissociation at ∼243.1 and 225 nm, where the latter wavelength provided only a slight increase in the H yield over the self-signal from the probe beams. The TCRD imaging enabled obtaining high quality H{sup +} images, even for the low H photofragment yields formed in the 225 nm photolysis process, and allowed determining the velocity distributions and anisotropy parameters and getting insight into pyrrole photodissociation.

  13. Off-line tuning of a PI speed controller for a permanent magnet brushless DC motor using DSP

    Energy Technology Data Exchange (ETDEWEB)

    Demirtas, Metin, E-mail: mdtas@balikesir.edu.t [Electrical and Electronics Engineering Department, Balikesir University, Balikesir (Turkey)

    2011-01-15

    In this paper, a new method of tuning Proportional Integral (PI) coefficients for a permanent magnet brushless DC (PMBLDC) motor drives is proposed. Artificial neural network is used to identify the whole system using maximum overshoot and settling time obtained from the application circuit for different K{sub p}-K{sub i} pairs. Optimal values of PI controller coefficients are obtained using genetic algorithm. Motion Control Kit (MCK243) is used to carry out digital motion control applications. The MCK243 kit includes a power module and a three-phase brushless motor. TMS320F243 programs are used for PMBLDC motor speed control. Experimental results are given to show the validity of this method.

  14. Generation of an actinide isotopes cross section set for fast reactor calculations using data from ENDL and ENDF/B-IV

    International Nuclear Information System (INIS)

    A Bondarenko format 25-group cross section set of actinide isotopes was generated for the fuel cycle evaluation and the incineration study in fast reactor systems. Evaluated Nuclear Data Library of Lawrence Livermore Laboratory (U.S.) was used as the source data. The actinide isotopes treated are the following 28: Th-232, U-233, U-234, U-235, U-236, U-237, Pu-238, Pu-239, Pu-240, Pu-241, Pu-242, Pu-243, Am-241, Am-242, Am-243, Cm-242, Cm-243, Cm-245, Cm-246, Cm-247, Cm-248, Bk-249, Cf-249, Cf-250, Cf-251, Cf-252 and a pseudo-fission product. ENDF/B-IV was used for U-238. The set was then collapsed to one energy group using a large LMFBR core spectrum for the comparison with other one-group sets. (author)

  15. Simultaneous spectrophotometric determination of drotaverine hydrochloride and paracetamol in tablet

    Directory of Open Access Journals (Sweden)

    Mahaparale Sonali

    2010-01-01

    Full Text Available Two simple, accurate and reproducible spectrophotometric methods; Q analysis and first order derivative method have been described for the simultaneous estimation of drotaverine hydrochloride and paracetamol in combined tablet dosage form. Absorption maxima of drotaverine hydrochloride and paracetamol in distilled water were found to be 303.5 nm and 243.5 nm respectively. Beer′s law was obeyed in the concentration range 5-50 µg/ml for drotaverine and 5-60 µg/ml for paracetamol. In Q analysis method, two wavelengths were selected at isobestic point (277 nm and λmax of paracetamol (243.5 nm. In first order derivative method, zero crossing point for drotaverine hydrochloride and paracetamol were selected at 303.5 nm and 243.5 nm, respectively. The results of two methods were validated statistically and recovery studies were found to be satisfactory.

  16. Construction and identification of reverse genetics system of Dengue type 2 virus isolated in China

    Institute of Scientific and Technical Information of China (English)

    ZHU Wuyang; CHEN Shuiping; QIN Chenggeng; YU Man; JIANG Tao; DENG Yongqiang; QIN Ede

    2006-01-01

    To construct infectious full-length cDNA clone of dengue virus type 2 isolated in China (DEN2-43), according to the published nucleotide sequence of the virus strain, the approximately 11 kb full-length cDNAs of DEN2-43 were amplified by long RT-PCR and fusion PCR. Full-length cDNA clones were constructed by inserting the full-length cDNA into a low copy vector pWSK29, from which rescued virus D212 was acquired by transcription in vitro and electroporation. The full-length cDNA clone pD212 was infectious, and rescued virus acquired in C6/36 cells was indistinguishable from DEN2-43 virus in biological properties including suckling mice neurovirulence. The reverse genetics system helps elucidate the mechanism of pathogenesis of dengue virus and develop novel vaccine against dengue.

  17. New data on transuranium elements in the ecosystem of the Yenisei river floodplain

    Energy Technology Data Exchange (ETDEWEB)

    Bolsunovsky, A. [Russian Academy of Sciences, Siberian Branch, Krasnoyarsk (Russian Federation). Inst. of Biophysics; Ermakov, A.; Sobolev, A. [SIA ' RADON' , Moscow (Russian Federation)

    2007-07-01

    The aim of the study is to investigate levels of transuranium elements in the ecosystem of the Yenisei river floodplain in the vicinity of the Mining-and-Chemical Combine of Rosatom. For the first time, the transuranium isotopes {sup 243,244}Cm have been detected in sediment, floodplain soil, and a berry shrub (Ribes nigrum - the blackcurrant) in the floodplain of the Yenisei river. The highest level of curium isotopes registered in the sediment of the Yenisei river is 21.4Bq/kg (dry), which is more than twice higher than maximum curium levels reported for soils sampled not far from the Chernobyl Nuclear Plant. Blackcurrant plants growing on radioactively contaminated soils contain the same transuranium elements as the soil (plutonium isotopes, americium, and curium). The highest activity concentrations of all transuranic elements have been found in ashed roots of the blackcurrant plants: {sup 239,240}Pu - 9.3Bq/kg, {sup 241}Am - 6.9Bq/kg, and {sup 243,244}Cm - 1.8Bq/kg. The highest soil-plant transfer factor (TF) for {sup 243,244}Cm is determined for roots - 0.073; the TF of {sup 243,244}Cm in berries is 0.027. The TF for {sup 239,240}Pu in berries is 0.006, which is several times lower than the TF for {sup 243,244}Cm. Analysis of our results and the literature data suggests that TFs for {sup 243,244}Cm are higher than those for {sup 239,240}Pu and {sup 241}Am. (orig.)

  18. Dicty_cDB: CFE467 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CF (Link to library) CFE467 (Link to dictyBase) - G21752 DDB0187369 Contig-U11569-1 CFE467P (Lin ... 5e-63 BC114556_1( BC114556 |pid:none) Homo sapiens thyroid ... hormone recep... 244 5e-63 BC113891_1( BC113891 |p ... id:none) Homo sapiens thyroid ... hormone recep... 244 5e-63 BC105889_1( BC105889 |p ... id:none) Rattus norvegicus thyroid ... hormone ... 243 9e-63 BC100624_1( BC100624 |pid:no ... ne) Rattus norvegicus thyroid ... hormone ... 243 9e-63 BC088304_1( BC088304 |pid:no ...

  19. Surface behavior of apolipoprotein A-I and its deletion mutants at model lipoprotein interfaces

    OpenAIRE

    Wang, Libo; Mei, Xiaohu; Atkinson, David; Small, Donald M.

    2014-01-01

    Apolipoprotein A-I (apoA-I) has a great conformational flexibility to exist in lipid-free, lipid-poor, and lipid-bound states during lipid metabolism. To address the lipid binding and the dynamic desorption behavior of apoA-I at lipoprotein surfaces, apoA-I, Δ(185-243)apoA-I, and Δ(1-59)(185-243)apoA-I were studied at triolein/water and phosphatidylcholine/triolein/water interfaces with special attention to surface pressure. All three proteins are surface active to both interfaces lowering th...

  20. Dicty_cDB: Contig-U15696-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available me number (1..6, M) 1 Chromosome length 4919822 Start point 1256537 End point 1258452 Strand...= 2936 Score = 1544 bits (779), Expect = 0.0 Identities = 779/779 (100%) Strand = Plus / Plus Query: 1746 aa...e = 827 bits (417), Expect = 0.0 Identities = 417/417 (100%) Strand = Plus / Plus...= e-151 Identities = 270/270 (100%) Strand = Plus / Plus Query: 519 gattcagatgatgaacaagaagaaattcctcaaccagtca...tgataaaaagaaaggtgttaaacatgtt 788 Score = 327 bits (165), Expect = 6e-89 Identities = 224/243 (92%), Gaps = 3/243 (1%) Strand

  1. Increased spectral bandwidths in nonlinear conversion processes by use of multicrystal designs.

    Science.gov (United States)

    Brown, M

    1998-10-15

    The fourth-harmonic generation of broadband 243-nm radiation is reported. The broadband radiation is achieved by implementation of a multicrystal design to overcome spectral bandwidth limitations, and a plane-wave analysis is developed that shows increased spectral bandwidths for these designs. The fourth harmonic of a Cr:LiSAF laser operating at 972 nm is generated in beta-barium borate (BBO). The results demonstrate a spectral bandwidth at 243 nm more than five times broader than that which is expected from a single BBO crystal of equivalent length. PMID:18091854

  2. Comparison of fission and capture cross sections of minor actinides

    CERN Document Server

    Nakagawa, T

    2003-01-01

    The fission and capture cross sections of minor actinides given in JENDL-3.3 are compared with other evaluated data and experimental data. The comparison was made for 32 nuclides of Th-227, 228, 229, 230, 233, 234, Pa-231, 232, 233, U-232, 234, 236, 237, Np-236, 237, 238, Pu-236, 237, 238, 242, 244, Am-241, 242, 242m, 243, Cm-242, 243, 244, 245, 246, 247 and 248. Given in the present report are figures of these cross sections and tables of cross sections at 0.0253 eV and resonance integrals.

  3. Comparison of fission and capture cross sections of minor actinides

    International Nuclear Information System (INIS)

    The fission and capture cross sections of minor actinides given in JENDL-3.3 are compared with other evaluated data and experimental data. The comparison was made for 32 nuclides of Th-227, 228, 229, 230, 233, 234, Pa-231, 232, 233, U-232, 234, 236, 237, Np-236, 237, 238, Pu-236, 237, 238, 242, 244, Am-241, 242, 242m, 243, Cm-242, 243, 244, 245, 246, 247 and 248. Given in the present report are figures of these cross sections and tables of cross sections at 0.0253 eV and resonance integrals. (author)

  4. Bibliometric evaluation of the scientific production of the Stomatos Dental Journal

    OpenAIRE

    Paula Braga Gomes; Simone Helena Ferreira; Vanessa Ceolin Poletto; Juliane Bervian; Paulo Floriani Kramer

    2011-01-01

    This cross-sectional study aimed to evaluate the abstracts of all articles published in the Stomatos Dental Journal between 1995 and 2009 and to obtain data on the methodological design of each article, the dental specialties focused on, and the authors¿ institution of origin. A total of 206 abstracts were reviewed by two independent examiners. The results showed that the most frequent study designs were literature reviews (24.3%), cross-sectional studies (24.3%), laboratory in vitro studies ...

  5. Some notes on the butterflies (Lepidoptera: Papilionoidea of Tantirimale Archaeological Site, Anuradhapura District, Sri Lanka

    Directory of Open Access Journals (Sweden)

    M.D.C. Asela

    2009-07-01

    Full Text Available There are 243 species of butterflies which including 5 families in Sri Lanka and 20 of them are endemic. However out of the 243 species 37 butterfly species belonging to 4 families was discovered from Tanthirimale Archaeological Forest area. This forest is classified as a Tropical dry mixed evergreen forests and its situated dry zone in Anuradapura district of Sri Lanka. We select three habitat types such as: forests, Rock outcrops and scrublands for studding composition and structure of butterflies in Archaeological Forest area. However, this important forest is threatened by harmful human activities such as man made fire, illegal logging, chena cultivation and road kills.

  6. Neutron-induced fission cross sections of short-lived actinides with the surrogate reaction method

    International Nuclear Information System (INIS)

    Neutron-induced fission cross sections for 242,243Cm and 241Am have been obtained with the surrogate reaction method. Recent results for the neutron-induced cross section of 243Cm are questioned by the present data. For the first time, the 242Cm cross section has been determined up to the onset of second-chance fission. The good agreement at the lowest excitation energies between the present results and the existing neutron-induced data indicates that the distributions in spin and parity of states populated with both techniques are similar.

  7. Research of vertical migration of radionuclides in the soil at testing 'Red forest' area

    International Nuclear Information System (INIS)

    Researches of vertical migration of Chernobyl origin radionuclides at testing 'Red forest' rea in 5-km ChNPP-zone were carried out. The γ- and β- spectrometer measurements of soil samples were carried out using the anticompton spectrometer and a beta spectrometer. Presence of 60Co, 134, 137Cs, 154,155Eu, 241Am to depth of 30 cm in all soil cuts was fixed. The sites with sod-low-podzol sandy soils on alluvial sands contain 137Cs, 90Sr and 241Am to depth of 60 cm. The presence 243Am and 243Cm was found in the top layers of soils at territory of testing area.

  8. Description of Three New α Variants and Four New β Variants: Hb Montluel [α110(G17)Ala → Val; HBA1: c.332C > T], Hb Cap d'Agde [α131(H14)Ser → Cys; HBA2: c.395C > G] and Hb Corsica [α100(G7)Leu → Pro; HBA1: 302T > C]; Hb Nîmes [β104(G6)Arg → Gly; HBB: c.313A > G], Hb Saint Marcellin [β112(G14)Cys → Gly; HBB: c.337T > G], Hb Saint Chamond [β80(EF4)Asn → 0; HBB: c.241_243delAAC] and Hb Dompierre [β29(B11)Gly → Arg; HBB: c.88G > C].

    Science.gov (United States)

    Renoux, Céline; Feray, Cécile; Joly, Philippe; Lacan, Philippe; Francina, Alain

    2015-01-01

    We present here seven new hemoglobin (Hb) variants identified during routine Hb analysis. All of them are caused by a missense mutation except Hb Saint Chamond, which results from an in-frame deletion of the asparagine residue at β80. All these variants are clinically silent in the heterozygous state but two of them (Hb Cap d'Agde and Hb Dompierre) may be unstable, whereas Hb Nîmes could present a very slightly elevated oxygen affinity. These data are to be confirmed by appropriate biochemical tests. PMID:26100115

  9. Progressive rod-cone degeneration (PRCD) in selected dog breeds and variability in its phenotypic expression

    Czech Academy of Sciences Publication Activity Database

    Dostál, Jaromír; Hrdlicová, Anna; Horák, Pavel

    2011-01-01

    Roč. 56, č. 5 (2011), s. 243-247. ISSN 0375-8427 Institutional research plan: CEZ:AV0Z50450515 Keywords : canine * retinitis pigmentosa * autosomal Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 0.748, year: 2011

  10. Curvature-induced bound states in Robin waveguides and their asymptotical properties

    Czech Academy of Sciences Publication Activity Database

    Exner, Pavel; Minakov, A.

    2014-01-01

    Roč. 55, č. 12 (2014), s. 122101. ISSN 0022-2488 R&D Projects: GA ČR(CZ) GA14-06818S Institutional support: RVO:61389005 Keywords : strong delta-interaction * Schrodinger operator * large parameter Subject RIV: BE - Theoretical Physics Impact factor: 1.243, year: 2014

  11. Blacks and High Self-Esteem: A Puzzle

    Science.gov (United States)

    Simmons, Roberta G.

    1978-01-01

    Changes in research findings related to the self-esteem of blacks may be due to the impact of ideology; or to methodological differences, such as the populations studied, the definitions and dimensions of self-image conceptualized, and the measures used. This article is a commentary on the previous Adam article (TM 503 243). (BW)

  12. Remarkable catalytic properties of hierarchical zeolite-Beta in epoxide rearrangement reactions

    Czech Academy of Sciences Publication Activity Database

    García-Munoz, J.L.; Serrano, D. P.; Vicente, G.; Linares, M.; Vitvarová, Dana; Čejka, Jiří

    2015-01-01

    Roč. 243, APR 2015 (2015), s. 141-152. ISSN 0920-5861 R&D Projects: GA ČR GBP106/12/G015 Institutional support: RVO:61388955 Keywords : hierarchical zeolites * zeolite beta * hybridzeolitic - mesostructured materials Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 3.893, year: 2014

  13. The Morquio A syndrome (mucopolysaccharidosis IVA) gene maps to 16q24. 3

    Energy Technology Data Exchange (ETDEWEB)

    Baker, E.; Xiaohui Guo; Orsborn, A.M.; Sutherland, G.R.; Callen, D.F.; Hopwood, J.J.; Morris, C.P. (Adelaide Children' s Hospital, North Adelaide (Australia))

    1993-01-01

    The gene for N-acetylgalactosamine-6-sulfatase, the deficiency of which results in Morquio A syndrome (mucopolysaccharidosis type IVA), was assigned to chromosome 16 at band q24.3 by fluorescence in situ hybridization. Localization to this band was confirmed by PCR analysis of a somatic cell hybrid panel used for fine mapping of chromosome 16. 12 refs., 1 fig., 1 tab.

  14. Rhizoremediation for decontamination of long-term PCB contaminated soil with focus on microbial diversity

    Czech Academy of Sciences Publication Activity Database

    Beranová, K.; Kochánková, L.; Macek, Tomáš; Macková, M.

    Elsevier. Roč. 131, 2S (2007), S243. ISSN 0168-1656. [European Congress on Biotechnology /13./. 16.09.2007-19.09.2007, Barcelona] R&D Projects: GA MŠk(CZ) 1P05ME745 Institutional research plan: CEZ:AV0Z40550506 Keywords : rhizoremediation * microbial diversity * PCB degradation Subject RIV: EI - Biotechnology ; Bionics

  15. Geochemical and palynological sea-level proxies in hemipelagic sediments: A critical assessment from the Upper Cretaceous of the Czech Republic

    Czech Academy of Sciences Publication Activity Database

    Olde, K.; Jarvis, I.; Uličný, David; Pearce, M. A.; Trabucho-Alexandre, J.; Čech, S.; Gröcke, D. R.; Laurin, Jiří; Švábenická, L.; Tocher, B. A.

    2015-01-01

    Roč. 435, October (2015), s. 222-243. ISSN 0031-0182 R&D Projects: GA ČR GAP210/10/1991 Institutional support: RVO:67985530 Keywords : sea- level change * Cretaceous * chemostratigraphy Subject RIV: DB - Geology ; Mineralogy Impact factor: 2.339, year: 2014

  16. Comparison of soil nematode communities in three forest types on sand and clay coal-mining dumps in Germany and Czech Republic

    Czech Academy of Sciences Publication Activity Database

    Háněl, Ladislav

    2003-01-01

    Roč. 40, č. 4 (2003), s. 237-243. ISSN 0440-6605 R&D Projects: GA ČR GA526/01/1055 Institutional research plan: CEZ:AV0Z6066911 Keywords : Nematoda * diversity * trophic groups Subject RIV: EH - Ecology, Behaviour Impact factor: 0.474, year: 2003

  17. Die bosnischen Anklänge in der Militärmusik zwischen 1878-1908 und der tschechische Militärkapellmeister Julius Fučík in Sarajewo 1897-1900

    Czech Academy of Sciences Publication Activity Database

    Bajgarová, Jitka; Šebesta, J.

    Ljubljana: Festival Ljubljana, 2010 - (Kuret, P.), s. 236-243 ISBN 978-961-91596-9-9. [Mediteran - vir glasbe in hrepenenja evropske romantike in moderne. Ljubljana (SI), 10.03.2009-14.03.2009] Institutional research plan: CEZ:AV0Z90580513 Keywords : military music * Bosnia * Czech military musicians * Julius Fučík Subject RIV: AL - Art, Architecture, Cultural Heritage

  18. Class Attendance in College: A Meta-Analytic Review of the Relationship of Class Attendance with Grades and Student Characteristics

    Science.gov (United States)

    Crede, Marcus; Roch, Sylvia G.; Kieszczynka, Urszula M.

    2010-01-01

    A meta-analysis of the relationship between class attendance in college and college grades reveals that attendance has strong relationships with both class grades (k = 69, N = 21,195, p = 0.44) and GPA (k = 33, N = 9,243, p = 0.41). These relationships make class attendance a better predictor of college grades than any other known predictor of…

  19. WO.sub.3./sub.-doped zinc borophosphate glasses

    Czech Academy of Sciences Publication Activity Database

    Šubčík, J.; Koudelka, L.; Mošner, P.; Gregora, Ivan; Montagne, L.; Revel, B.

    2009-01-01

    Roč. 50, č. 4 (2009), 243-248. ISSN 1753-3562 R&D Projects: GA AV ČR KAN301370701 Institutional research plan: CEZ:AV0Z10100520 Keywords : tungstate zinc borophosphate glasses * Raman spectroscopy * temperature * NMR Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 0.553, year: 2009

  20. Why Are Drugs So Hard to Quit?

    Medline Plus

    Full Text Available ... Drugs So Hard to Quit? National Institute on Drug Abuse (NIDA/NIH) Subscribe Subscribed Unsubscribe 4,243 4K ... Free Will - Duration: 21:12. National Institute on Drug Abuse (NIDA/NIH) 12,843 views 21:12 Anyone ...

  1. Germanosilicate UTL and its rich chemistry of solid-statetransformations towards IPC-2 (OKO) zeolite

    Czech Academy of Sciences Publication Activity Database

    Mazur, Michal; Kubů, Martin; Wheatley, P. S.; Eliášová, Pavla

    2015-01-01

    Roč. 243, APR 2015 (2015), s. 23-31. ISSN 0920-5861 R&D Projects: GA ČR GBP106/12/G015 Institutional support: RVO:61388955 Keywords : ADOR * zeolite UTL * IPC-2 Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 3.893, year: 2014

  2. 25 CFR 170.471 - How are projects administered?

    Science.gov (United States)

    2010-04-01

    ... under ISDEAA, BIA will monitor performance under the requirements of 25 CFR 900.130 and 900.131(b)(9) or 25 CFR 1000.243 and 1000.249(c) and (e), as appropriate. If BIA discovers a problem during an on-site... PROGRAM Planning, Design, and Construction of Indian Reservation Roads Program Facilities Construction...

  3. Science and technology research and development in support to ITER and the Broader Approach at CEA

    Czech Academy of Sciences Publication Activity Database

    Bécoulet, A.; Hoang, G.T.; Abiteboul, J.; Achard, J.; Alarcon, T.; Alba-Duran, J.; Allegretti, L.; Allfrey, S.; Amiel, S.; Ané, J.M.; Aniel, T.; Antar, G.; Argouarch, A.; Armitano, A.; Arnaud, J.; Arranger, D.; Artaud, J.F.; Audisio, D.; Aumeunier, M.; Autissier, E.; Azcona, L.; Back, A.; Bahat, A.; Bai, X.; Baiocchi, B.; Balaguer, D.; Balme, S.; Balorin, C.; Barana, O.; Barbier, D.; Barbuti, A.; Basiuk, V.; Baulaigue, O.; Bayetti, P.; Baylard, B.; Beaufils, S.; Beaute, A.; Bécoulet, M.; Bej, Z.; Benkadda, S.; Benoit, F.; Berger-By, G.; Bernard, J.M.; Berne, A.; Bertrand, B.; Bertrand, E.; Beyer, P.; Bigand, A.; Bonhomme, G.; Borel, G.; Boron, A.; Bottereau, C.; Bottollier-Curtet, H.; Bouchand, C.; Bouquey, F.; Bourdelle, C.; Bourg, J.; Bourmaud, S.; Brémond, S.; Bribiesca Argomedo, F.; Brieu, M.; Brun, C.; Bruno, V.; Bucalossi, J.; Bufferand, H.; Buravand, Y.; Cai, L.; Cantone, V.; Cantone, B.; Caprin, E.; Cartier-Michaud, T.; Castagliolo, A.; Belo, J.; Catherine-Dumont, V.; Caulier, G.; Chaix, J.; Chantant, M.; Chatenet, M.; Chauvin, D.; Chenevois, J.; Chouli, B.; Christin, L.; Ciazynski, D.; Ciraolo, G.; Clairet, F.; Clapier, R.; Cloez, H.; Coatanea-Gouachet, M.; Colas, L.; Colledani, G.; Commin, L.; Coquillat, P.; Corbel, E.; Corre, Y.; Cottet, J.; Cottier, P.; Courtois, X.; Crest, I.; Dachicourt, R.; Dapena Febrer, M.; Daumas, C.; de Esch, H.P.L.; De Gentile, B.; Dechelle, C.; Decker, J.; Decool, P.; Deghaye, V.; Delaplanche, J.; Delchambre-Demoncheaux, E.; Delpech, L.; Desgranges, C.; Devynck, P.; Dias Pereira Bernardo, J.; Dif-Pradalier, G.; Doceul, L.; Dong, Y.; Douai, D.; Dougnac, H.; Dubuit, N.; Duchateau, J.-L.; Ducobu, L.; Dugue, B.; Dumas, N.; Dumont, R.; Durocher, A.; Durocher, A.; Duthoit, F.; Ekedahl, A.; Elbeze, D.; Escarguel, A.; Escop, J.; Fäisse, F.; Falchetto, G.; Farjon, J.; Faury, M.; Fedorzack, N.; Féjoz, P.; Fenzi, C.; Ferlay, F.; Fiet, P.; Firdaouss, M.; Francisquez, M.; Franel, B.; Frauche, J.; Frauel, Y.; Futtersack, R.; Garbet, X.; Garcia, J.; Gardarein, J.; Gargiulo, L.; Garibaldi, P.; Garin, P.; Garnier, D.; Gauthier, E.; Gaye, O.; Geraud, A.; Gerome, M.; Gervaise, V.; Geynet, M.; Ghendrih, P.; Giacalone, I.; Gibert, S.; Gil, C.; Ginoux, S.; Giovannangelo, L.; Girard, S.; Giruzzi, G.; Goletto, C.; Goncalves, R.; Gonde, R.; Goniche, M.; Goswami, R.; Grand, C.; Grandgirard, V.; Gravil, B.; Grisolia, C.; Gros, G.; Grosman, A.; Guigue, J.; Guilhem, D.; Guillemaut, C.; Guillerminet, B.; Guimaraes Filho, Z.; Guirlet, R.; Gunn, J. P.; Gurcan, O.; Guzman, F.; Hacquin, S.; Hariri, F.; Hasenbeck, F.; Hatchressian, J.C.; Hennequin, P.; Hernandez, C.; Hertout, P.; Heuraux, S.; Hillairet, J.; Honore, C.; Hornung, G.; Houry, M.; Hunstad, I.; Hutter, T.; Huynh, P.; Icard, V.; Imbeaux, F.; Irishkin, M.; Isoardi, L.; Jacquinot, J.; Jacquot, J.; Jiolat, G.; Joanny, M.; Joffrin, E.; Johner, E.; Joubert, P.; Jourd’Heuil, L.; Jouve, M.; Junique, C.; Keller, D.; Klepper, C.; Kogut, M.; Kubič, M.; Labassé, F.; Lacroix, B.; Lallier, Y.; Lamaison, V.; Lambert, R.; Larroque, S.; Latu, G.; Lausenaz, Y.; Laviron, C.; Le, R.; Le Luyer, A.; Le Niliot, C.; Le Tonqueze, Y.; Lebourg, P.; Lefevre, T.; Leroux, F.; Letellier, L.; Li, Y.; Lipa, M.; Lister, J.; Litaudon, X.; Liu, F.; Loarer, T.; Lombard, G.; Lotte, P.; Lozano, M.; Lucas, J.; Lütjens, H.; Magaud, P.; Maget, P.; Magne, R.; Mahieu, J.-F.; Maini, P.; Malard, P.; Manenc, L.; Marandet, Y.; Marbach, G.; Marechal, J.-L.; Marfisi, L.; Marle, M.; Martin, C.; Martin, V.; Martin, G.; Martinez, A.; Martino, P.; Masset, R.; Mazon, D.; Mellet, N.; Mercadier, L.; Merle, A.; Meshcheriakov, D.; Messina, P.; Meyer, O.; Millon, L.; Missirlian, M.; Moerel, J.; Molina, D.; Mollard, P.; Moncada, V.; Monier-Garbet, P.; Moreau, D.; Moreau, M.; Moreau, P.; Morel, P.; Moriyama, T.; Motassim, Y.; Mougeolle, G.; Moulton, D.; Moureau, G.; Mouyon, D.; Naim Habib, M.; Nardon, E.; Négrier, V.; Nemeth, J.; Nguyen, C.; Nguyen, M.; Nicolas, L.; Nicolas, T.; Nicollet, S.; Nilsson, E.; N’Konga, B.; Noel, F.; Nooman, A.; Norscini, C.; Nouailletas, R.; Oddon, P.; Ohsako, T.; Orain, F.; Ottaviani, M.; Pagano, M.; Palermo, F.; Panayotis, S.; Parrat, H.; Pascal, J.-Y.; Passeron, C.; Pastor, P.; Patterlini, J.; Pavy, K.; Pecquet, A.-L.; Pégourié, B.; Peinturier, C.; Pelletier, T.; Peluso, B.; Petržílka, Václav; Peysson, Y.; Pignoly, E.; Pirola, R.; Pocheau, C.; Poitevin, E.; Poli, V.; Poli, S.; Pompon, F.; Porchy, I.; Portafaix, C.; Preynas, M.; Prochet, P.; Prou, M.; Ratnani, A.; Raulin, D.; Ravenel, N.; Renard, S.; Ricaud, B.; Richou, M.; Ritz, G.; Roche, H.; Roubin, P.; Roux, C.; Ruiz, K.; Sabathier, F.; Sabot, R.; Saille, A.; Saint-Laurent, F.; Sakamoto, R.; Salasca, S.; Salmon, T.; Salmon, T.; Samaille, F.; Sanchez, S.; Santagiustina, A.; Saoutic, B.; Sarazin, Y.; Sardain, P.; Schlosser, J.; Schneider, M.; Schwob, J.; Segui, J.; Seguin, N.; Selig, G.; Serret, D.; Signoret, J.; Signoret, J.; Simonin, A.; Soldaini, M.; Soler, B.; Soltane, C.; Song, S.; Sourbier, F.; Sparagna, J.; Spitz, P.; Spuig, P.; Storelli, A.; Strugarek, A.; Tamain, P.; Tena, M.; Theis, J.; Thomine, O.; Thouvenin, D.; Torre, A.; Toulouse, L.; Travere, J.; Tsitrone, E.; Turck, B.; Urban, J.; Vallet, J.-C.; Vallory, J.; Valognes, A.; Van Helvoirt, J.; Vartanian, S.; Verger, J.-M.; Vermare, L.; Vermare, C.; Vezinet, D.; Vicente, K.; Vidal, J.; Vignal, N.; Vigne, T.; Villecroze, F.; Villedieu, E.; Vincent, B.; Volpe, B.; Volpe, D.; Volpe, R.; Wagrez, J.; Wang, H.; Wauters, T.; Wintersdorff, O.; Wittebol, E.; Zago, B.; Zani, L.; Zarzoso, D.; Zhang, Y.; Zhong, W.; Zou, X.L.

    2013-01-01

    Roč. 53, č. 10 (2013), s. 104023-104023. ISSN 0029-5515 Institutional support: RVO:61389021 Keywords : ITER * Tore Supra * system * plasma Subject RIV: BL - Plasma and Gas Discharge Physics Impact factor: 3.243, year: 2013 http://iopscience.iop.org/0029-5515/53/10/104023/pdf/0029-5515_53_10_104023.pdf

  4. Constructive lower bounds for off-diagonal Ramsey numbers

    Czech Academy of Sciences Publication Activity Database

    Alon, N.; Pudlák, Pavel

    2001-01-01

    Roč. 122, č. 3 (2001), s. 243-251. ISSN 0021-2172 R&D Projects: GA AV ČR IAA1019901; GA MŠk ME 103 Institutional research plan: CEZ:AV0Z1019905; CEZ:AV0Z1019905 Keywords : Ramsey's theorem * graph Subject RIV: BA - General Mathematics Impact factor: 0.545, year: 2001

  5. A Study of Social Cognitive Theory: The Relationship between Professional Learning Communities and Collective Teacher Efficacy in International School Settings

    Science.gov (United States)

    Hardin, James

    2010-01-01

    In "Self-Efficacy: The Exercise of Control" (1997), Albert Bandura writes, "Teachers operate collectively within an interactive social system rather than as isolates" (p. 243). Bandura's attention to the existence of the communal systems that exist in schools is an appreciation shared by many educational reformers, especially those who advocate…

  6. Time-dependent mechanical characteristics measured through the use of a microindentation technique

    Czech Academy of Sciences Publication Activity Database

    Minster, Jiří; Bláhová, O.; Lukeš, J.; Němeček, J.

    2010-01-01

    Roč. 14, č. 3 (2010), s. 243-251. ISSN 1385-2000 R&D Projects: GA AV ČR(CZ) IAA200710801 Institutional research plan: CEZ:AV0Z20710524 Keywords : material s testing * microindentation * viscoelastic compliance * relaxation modulus Subject RIV: JI - Composite Material s Impact factor: 0.955, year: 2010

  7. The systematics research on (p,n) and (p,2n) reaction excitation functions

    International Nuclear Information System (INIS)

    On the basis of Planck formula of black body radiation and experimental excitation functions of (p,n) and (p,2n) reactions, an empirical systematics formula with two parameters is presented, which can describe experimental data of (p,n) and (p,2n) reactions well for incident proton energies from threshold to 150 MeV, target masses from 30 to 243

  8. Relationships among Shyness, Social Competence, Peer Relations, and Theory of Mind among Pre-Adolescents

    Science.gov (United States)

    Kokkinos, Constantinos M.; Kakarani, Styliani; Kolovou, Demetra

    2016-01-01

    The present study examined the relationships between shyness, a number of personal and interpersonal variables (i.e. social skills, self-esteem, attachment style, advanced Theory of Mind skills and peer relations) in a sample of 243 Greek pre-adolescents. Participants completed self-reports of the variables. Results indicated that females scored…

  9. On the existence of bound states in asymmetric leaky wires

    Czech Academy of Sciences Publication Activity Database

    Exner, Pavel; Vugalter, S.

    2016-01-01

    Roč. 57, č. 2 (2016), s. 022104. ISSN 0022-2488 R&D Projects: GA ČR(CZ) GA14-06818S Institutional support: RVO:61389005 Keywords : quantum wave-guides * graphs Subject RIV: BE - Theoretical Physics Impact factor: 1.243, year: 2014

  10. AcEST: DK958773 [AcEST

    Lifescience Database Archive (English)

    Full Text Available TST39A01NGRL0002_O07 524 Adiantum capillus-veneris mRNA. clone: TST39A01NGRL0002_O07. 5' end seq ... (49%), Gaps = 6/67 (8%) Frame = +1 Query: 82 ASTVK-TSH SFDSY-----DLFMELSPVAEQKTVSTRKQAAGSSSKDSTPHMKVGKEYAL ... 243 A+T+K TSH ... + Y L LS + Q+ +QAA SKD PH+ + Y + Sbjct: 120 ATTLKP ...

  11. Homogeneous nucleation in high-pressure multi-component systems: Application to mixtures of N-Alkanes

    Czech Academy of Sciences Publication Activity Database

    Hrubý, Jan; Peeters, P.; Dongen, M. E. H.

    New York: American Institute of Physics, 2000 - (Hale, B.; Kulmala, M.), s. 143-146 ISBN 0-7354-0133. ISSN 0094-243X. [International conference on Nucleation and atmospheric aerosols. Rolla, Missouri (US), 06.08.2000-11.08.2000] Institutional research plan: CEZ:AV0Z2076919 Keywords : nucleation Subject RIV: BJ - Thermodynamics

  12. Data z výzkumů volebního chování v České republice

    Czech Academy of Sciences Publication Activity Database

    Lyons, Pat

    Praha : SLON, 2012 - (Krejčí, J.; Leontiyeva, Y.), s. 225-243 ISBN 978-80-7419-111-4; ISBN 978-80-7330-204-7 R&D Projects: GA MŠk LA09010 Institutional support: RVO:68378025 Keywords : political attitudes * voting behaviour * political survey research Subject RIV: AO - Sociology, Demography

  13. The study of spallation reactions, neutron production, and transport in a thick lead target and a uranium blanket during 1.5 GeV proton irradiation

    Czech Academy of Sciences Publication Activity Database

    Křížek, Filip; Wagner, Vladimír; Adam, Jindřich; Čaloun, Pavel; Henzl, Vladimír; Henzlová, Daniela; Krása, Antonín; Kugler, Andrej; Majerle, Mitja

    2006-01-01

    Roč. 56, č. 3 (2006), s. 243-252. ISSN 0011-4626 R&D Projects: GA MŠk 1P04LA213 Institutional research plan: CEZ:AV0Z10480505 Keywords : ADS * MCNPX * spallation Subject RIV: BG - Nuclear, Atomic and Molecular Physics, Colliders Impact factor: 0.568, year: 2006

  14. Shuffling in displacive phase transformations

    Czech Academy of Sciences Publication Activity Database

    Paidar, Václav

    481-482, - (2008), 243-246. ISSN 0921-5093 R&D Projects: GA MŠk OC 149; GA AV ČR IAA1041302 Institutional research plan: CEZ:AV0Z10100520 Keywords : mechanisms of phase transitions * stacking sequences * planar crystal defects Subject RIV: BE - Theoretical Physics Impact factor: 1.806, year: 2008

  15. Limited Agreement between the Interfacial Tension and Differential Capacity Data for the Polarised Water|1,2-dichloroethane Interface

    Czech Academy of Sciences Publication Activity Database

    Trojánek, Antonín; Lhotský, Alexandr; Mareček, Vladimír; Samec, Zdeněk

    2004-01-01

    Roč. 565, 1/2 (2004), s. 243-250. ISSN 0022-0728 R&D Projects: GA MŠk ME 502 Institutional research plan: CEZ:AV0Z4040901 Keywords : quasi-elastic laser light scattering * immiscible electrolyte solutions * differential capacity Subject RIV: CG - Electrochemistry Impact factor: 2.228, year: 2004

  16. KONTRIBUSI KOMPETENSI EMOSIONAL DAN PRAKTIK KEPEMIMPINAN TRANSFORMASIONAL KEPALA SEKOLAH TERHADAP KEBERDAYAAN GURU SEKOLAH MENENGAH KEJURUAN

    OpenAIRE

    Syamsul Hadi

    2016-01-01

    Abstract: Contributions of Principals' Emotional Competencies and Transformational Leadership Practices to Vocational High School Teachers Empowerment. This study was intended to empirically investigate the indirect effect of principals' emotional competencies on teacher empowerment through the transformational leadership practiced by the principals. Data were collected from 243 teachers working at 74 Vocational High Schools (VHS) in territory of Malign Ray. Teachers' perceived questionnaires...

  17. On the weak solutions to the equations of a compressible heat conducting gas

    Czech Academy of Sciences Publication Activity Database

    Chiodaroli, E.; Feireisl, Eduard; Kreml, O.

    2015-01-01

    Roč. 32, č. 1 (2015), s. 225-243. ISSN 0294-1449 EU Projects: European Commission(XE) 320078 - MATHEF Institutional support: RVO:67985840 Keywords : Euler-Fourier system * convex integration * weak solution Subject RIV: BA - General Mathematics Impact factor: 1.341, year: 2014 http://www.sciencedirect.com/science/article/pii/S0294144913001339

  18. Estimating trematode prevalence in snail hosts using a single-step duplex PCR: how badly does cercarial shedding underestimate infection rates?

    Czech Academy of Sciences Publication Activity Database

    Born-Torrijos, A.; Poulin, R.; Raga, J. A.; Holzer, Astrid S.

    2014-01-01

    Roč. 7, MAY 2014 (2014), s. 243. ISSN 1756-3305 R&D Projects: GA ČR GBP505/12/G112 Institutional support: RVO:60077344 Keywords : prevalence * detection * snail host * double infection * single-steo duplex PCR Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 3.430, year: 2014

  19. The Wess-Zumino-Witten term of the M5-brane and differential cohomotopy

    Czech Academy of Sciences Publication Activity Database

    Fiorenza, D.; Sati, H.; Schreiber, Urs

    2015-01-01

    Roč. 56, č. 10 (2015), s. 102301. ISSN 0022-2488 Institutional support: RVO:67985840 Keywords : differential cohomology Subject RIV: BA - General Mathematics Impact factor: 1.243, year: 2014 http://scitation.aip.org/content/aip/journal/jmp/56/10/10.1063/1.4932618

  20. Technical challenges in the construction of the steady-state stellarator Wendelstein 7-X

    Czech Academy of Sciences Publication Activity Database

    Bosch, H.-S.; Wolf, R.C.; Andreeva, T.; Baldzuhn, J.; Birus, D.; Bluhm, T.; Bräuer, T.; Braune, H.; Bykov, V.; Cardella, A.; Durodié, F.; Endler, M.; Erckmann, V.; Gantenbein, G.; Hartmann, D.; Hathiramani, D.; Heimann, P.; Heinemann, B.; Hennig, C.; Hirsch, M.; Holtum, D.; Jagielski, J.; Jelonnek, J.; Kasparek, W.; Klinger, T.; König, R.; Kornejew, P.; Kroiss, H.; Krom, J.G.; Kühner, G.; Laqua, H.; Laqua, H.P.; Lechte, C.; Lewerentz, M.; Maier, J.; McNeely, P.; Messiaen, A.; Michel, G.; Ongena, J.; Peacock, A.; Pedersen, T.S.; Riedl, R.; Riemann, H.; Rong, P.; Rust, N.; Schacht, J.; Schauer, F.; Schroeder, R.; Schweer, B.; Spring, A.; Stäbler, A.; Thumm, M.; Turkin, Y.; Wegener, L.; Werner, A.; Zhang, D.; Zilker, M.; Akijama, T.; Alzbutas, R.; Ascasibar, E.; Balden, M.; Banduch, M.; Baylard, Ch.; Behr, W.; Beidler, C.; Benndorf, A.; Bergmann, T.; Biedermann, C.; Bieg, B.; Biel, W.; Borchardt, M.; Borowitz, G.; Borsuk, V.; Bozhenkov, S.; Brakel, R.; Brand, H.; Brown, T.; Brucker, B.; Burhenn, R.; Buscher, K.-P.; Caldwell-Nichols, C.; Cappa, A.; Cardella, A.; Carls, A.; Carvalho, P.; Ciupinski, L.; Cole, M.; Collienne, J.; Czarnecka, A.; Czymek, G.; Dammertz, G.; Dhard, C.P.; Davydenko, V.I.; Dinklage, A.; Drevlak, M.; Drotziger, S.; Dudek, A.; Dumortier, P.; Dundulis, G.; Eeten, P.v.; Egorov, K.; Estrada, T.; Faugel, H.; Fellinger, J.; Feng, Y.; Fernandes, H.; Fietz, W.H.; Figacz, W.; Fischer, F.; Fontdecaba, J.; Freund, A.; Funaba, T.; Fünfgelder, H.; Galkowski, A.; Gates, D.; Giannone, L.; García Regana, J.M.; Geiger, J.; Geißler, S.; Greuner, H.; Grahl, M.; Groß, S.; Grosman, A.; Grote, H.; Grulke, O.; Haas, M.; Haiduk, L.; Hartfuß, H.-J.; Harris, J.H.; Haus, D.; Hein, B.; Heitzenroeder, P.; Helander, P.; Heller, R.; Hidalgo, C.; Hildebrandt, D.; Höhnle, H.; Holtz, A.; Holzhauer, E.; Holzthüm, R.; Huber, A.; Hunger, H.; Hurd, F.; Ihrke, M.; Illy, S.; Ivanov, A.; Jablonski, S.; Jaksic, N.; Jakubowski, M.; Jaspers, R.; Jensen, H.; Jenzsch, H.; Kacmarczyk, J.; Kaliatk, T.; Kallmeyer, J.; Kamionka, U.; Karaleviciu, B.; Kern, S.; Keunecke, M.; Kleiber, R.; Knauer, J.; Koch, R.; Kocsis, G.; Könies, A.; Köppen, M.; Koslowski, R.; Koshurinov, J.; Krämer-Flecken, A.; Krampitz, R.; Kravtsov, Y.; Krychowiak, M.; Krzesinski, G.; Ksiazek, I.; Kubkowska, Fr.; Kus, A.; Langish, S.; Laube, R.; Laux, M.; Lazerson, S.; Lennartz, M.; Li, C.; Lietzow, R.; Lohs, A.; Lorenz, A.; Louche, F.; Lubyako, L.; Lumsdaine, A.; Lyssoivan, A.; Maaßberg, H.; Marek, P.; Martens, C.; Marushchenko, N.; Mayer, M.; Mendelevitch, B.; Mertens, Ph.; Mikkelsen, D.; Mishchenko, A.; Missal, B.; Mizuuchi, T.; Modrow, H.; Mönnich, T.; Morizaki, T.; Murakami, S.; Musielok, F.; Nagel, M.; Naujoks, D.; Neilson, H.; Neubauer, O.; Neuner, U.; Nocentini, R.; Noterdaeme, J.-M.; Nührenberg, C.; Obermayer, S.; Offermanns, G.; Oosterbeek, H.; Otte, M.; Panin, A.; Pap, M.; Paquay, S.; Pasch, E.; Peng, X.; Petrov, S.; Pilopp, D.; Pirsch, H.; Plaum, B.; Pompon, F.; Povilaitis, M.; Preinhaelter, Josef; Prinz, O.; Purps, F.; Rajna, T.; Récsei, S.; Reiman, A.; Reiter, D.; Remmel, J.; Renard, S.; Rhode, V.; Riemann, J.; Rimkevicius, S.; Riße, K.; Rodatos, A.; Rodin, I.; Romé, M.; Roscher, H.-J.; Rummel, K.; Rummel, Th.; Runov, A.; Ryc, L.; Sachtleben, J.; Samartsev, A.; Sanchez, M.; Sano, F.; Scarabosio, A.; Schmid, M.; Schmitz, H.; Schmitz, O.; Schneider, M.; Schneider, W.; Scheibl, L.; Scholz, M.; Schröder, G.; Schröder, M.; Schruff, J.; Schumacher, H.; Shikhovtsev, I.V.; Shoji, M.; Siegl, G.; Skodzik, J.; Smirnow, M.; Speth, E.; Spong, D.A.; Stadler, R.; Sulek, Z.; Szabó, V.; Szabolics, T.; Szetefi, T.; Szökefalvi-Nagy, Z.; Tereshchenko, A.; Thomsen, H.; Thumm, M.; Timmermann, D.; Tittes, H.; Toi, K.; Tournianski, M.; Toussaint, U.v.; Tretter, J.; Tulipán, S.; Turba, P.; Uhlemann, R.; Urban, Jakub; Urbonavicius, E.; Urlings, P.; Valet, S.; Van Eester, D.; Van Schoor, M.; Vervier, M.; Viebke, H.; Vilbrandt, R.; Vrancken, M.; Wauters, T.; Weissgerber, M.; Weiß, E.; Weller, A.; Wendorf, J.; Wenzel, U.; Windisch, T.; Winkler, E.; Winkler, M.; Wolowski, J.; Wolters, J.; Wrochna, G.; Xanthopoulos, P.; Yamada, H.; Yokoyama, M.; Zacharias, D.; Zajac, Jaromír; Zangl, G.; Zarnstorff, M.; Zeplien, H.; Zoletnik, S.; Zuin, M.

    2013-01-01

    Roč. 53, č. 12 (2013), s. 126001-126001. ISSN 0029-5515 Institutional support: RVO:61389021 Keywords : plasma * stellarator * technology * diagnostics * data acquisition * Wendelstein 7-X * electron cyclotron heating * electron Bernstein wave Subject RIV: BL - Plasma and Gas Discharge Physics Impact factor: 3.243, year: 2013 http://iopscience.iop.org/0029-5515/53/12/126001/article

  1. On absence of bound states for weakly attractive delta'-interactions supported on non-closed curves in R-2

    Czech Academy of Sciences Publication Activity Database

    Jex, M.; Lotoreichik, Vladimir

    2016-01-01

    Roč. 57, č. 2 (2016), s. 022101. ISSN 0022-2488 R&D Projects: GA ČR(CZ) GA14-06818S Institutional support: RVO:61389005 Keywords : dimensional Schrodinger-operators * hypersurfaces * spectra Subject RIV: BE - Theoretical Physics Impact factor: 1.243, year: 2014

  2. Magnetic Properties of CoFe2O4–BaTiO3 Composites

    Czech Academy of Sciences Publication Activity Database

    Čuda, J.; Mousa, I.; David, Bohumil; Pizúrová, Naděžda; Tuček, J.; Žák, Tomáš; Mašláň, M.; Schneeweiss, Oldřich

    Melville, NY : American Institue of Physics, 2012, s. 123-132. ISBN 978-0-7354-1101-2. ISSN 0094-243X. - (AIP Conference Proceedings. Vol. 1489). [Mossbauer Spectroscopy in Materials Science /10./. Olomouc (CZ), 11.06.2012-15.06.2012] Institutional support: RVO:68081723 Keywords : Barium titanate * Cobalt ferrite * Magnetic properties * Mossbauer spectroscopy Subject RIV: BM - Solid Matter Physics ; Magnetism

  3. 5 CFR 180.101 - Scope and purpose.

    Science.gov (United States)

    2010-01-01

    ... 5 Administrative Personnel 1 2010-01-01 2010-01-01 false Scope and purpose. 180.101 Section 180.101 Administrative Personnel OFFICE OF PERSONNEL MANAGEMENT CIVIL SERVICE REGULATIONS EMPLOYEES...' Claims Act of 1964, 31 U.S.C. 240 to 243, authorizes the Director, Office of Personnel Management...

  4. 47 CFR 2.106 - Table of Frequency Allocations.

    Science.gov (United States)

    2010-10-01

    ... frequencies 121.5 MHz, 156.8 MHz and 243 MHz may also be used, in accordance with the procedures in force for..., Indonesia, Iran (Islamic Republic of), Malaysia, Pakistan, Singapore and Thailand, the band 50-54 MHz is..., Malaysia, Oman, Pakistan, the...

  5. New cytotoxic butyltin complexes with 2-sulfobenzoic acid: Molecular interaction with lipid bilayers and DNA as well as in vitro anticancer activity

    Czech Academy of Sciences Publication Activity Database

    Pruchnik, H.; Kral, Teresa; Poradowski, D.; Drynda, A.; Obmińska-Mrukowicz, B.; Hof, Martin

    2016-01-01

    Roč. 243, JAN 2016 (2016), s. 107-118. ISSN 0009-2797 R&D Projects: GA ČR GBP208/12/G016 Institutional support: RVO:61388955 Keywords : Butyltin 2-sulfobenzoates * Antitumor activity * Lipid bilayer Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 2.577, year: 2014

  6. 77 FR 6411 - Training, Qualification, and Oversight for Safety-Related Railroad Employees

    Science.gov (United States)

    2012-02-07

    ...). 75 FR 47906. The Final Crane Rule sets forth requirements that are designed to improve safety for... titled ``Railroad Occupational Safety and Health Standards'' (Policy Statement). 43 FR 10583. The Policy..., and 243 Training, Qualification, and Oversight for Safety-Related Railroad Employees; Proposed Rule...

  7. ARL Academic Health Sciences Library Statistics, 2004-05

    Science.gov (United States)

    Young, Mark, Comp.; Kyrillidou, Martha, Comp.

    2006-01-01

    This report contains the results of the Association of Research Libraries' survey of academic Health Sciences libraries for 2004-05. Data are presented on collections, expenditures, and personnel and public services. Out of 113 ARL university libraries, 67 responded to the survey. Health Sciences libraries reported median values of 243,011 volumes…

  8. Niobium-Thorium-Strontium-Rare Earth Element Mineralogy and Preliminary Sulphur Isotope Geochemistry of the Eaglet Property, East-Central British Columbia (NTS 093A/10W)

    Czech Academy of Sciences Publication Activity Database

    Hora, Z. D.; Langrová, Anna; Pivec, Edvín; Žák, Karel

    2010-01-01

    Roč. 2009, č. 1 (2010), s. 93-96. ISSN 0381-243X Institutional research plan: CEZ:AV0Z30130516 Keywords : fluorite * celestite * pyrochlore * thorite * titanbetafite * bastnaesite * sulphur isotopes * Eaglet deposit * MINFILE 093A46 Subject RIV: DD - Geochemistry http://www.empr.gov.bc.ca/Mining/Geoscience/PublicationsCatalogue/Fieldwork/Documents/2009/08_Hora_2009.pdf

  9. Construction and evaluation of a new hydride generator combining an electrochemical cell and a membrane gas-liquid separator into a single unit

    Czech Academy of Sciences Publication Activity Database

    Šíma, J.; Rychlovský, P.; Dědina, Jiří

    Košice : Štroffek publishing, 1998. s. 243-246. [Seminar on Atomic Spectrochemistry /14./. 07.09.1998-11.09.1998, Podbanske] R&D Projects: GA ČR GA203/98/0754 Subject RIV: CB - Analytical Chemistry, Separation

  10. Monitoring load, recovery and performance in young elite soccer players

    NARCIS (Netherlands)

    Brink, Michel S.; Nederhof, Esther; Visscher, Chris; Schmikli, Sandor L.; Lemmink, Koen A. P. M.

    2010-01-01

    Brink, MS, Nederhof, E, Visscher, C, Schmikli, SL, and Lemmink, KAPM. Monitoring load, recovery, and performance in young elite soccer players. J Strength Cond Res 24(3): 597603, 2010-The purpose of this study was to investigate the relation between training load, recovery, and monthly field test pe

  11. Microwave Assisted Synthesis of Magnetically Responsive Composite Materials

    Czech Academy of Sciences Publication Activity Database

    Šafařík, Ivo; Pospišková, K.; Maděrová, Zdeňka; Baldíková, E.; Horská, Kateřina; Šafaříková, Miroslava

    2015-01-01

    Roč. 32, č. 1 (2015), s. 239-243. ISSN 0749-503X R&D Projects: GA MŠk(CZ) LD13023; GA ČR(CZ) GAP503/11/2263 Institutional support: RVO:67179843 Keywords : saccharomyces cerevisiae * cells immobilization * chitosan * magnetite * microwave irradiation * yeast Subject RIV: EH - Ecology, Behaviour Impact factor: 1.634, year: 2014

  12. Experimental study on pathogenic potential of six Acanthamoeba strains isolated from fish

    Czech Academy of Sciences Publication Activity Database

    Veverková, Marie; Dyková, Iva; Pecková, Hana

    2002-01-01

    Roč. 49, č. 3 (2002), s. 243-245. ISSN 0015-5683 R&D Projects: GA AV ČR KSK6005114 Institutional research plan: CEZ:AV0Z6022909 Keywords : amoeba * fish * pathology Subject RIV: EA - Cell Biology Impact factor: 0.515, year: 2002

  13. Demographic Variables and Fathers' Involvement with Their Child with Disabilities

    Science.gov (United States)

    Bragiel, Józefa; Kaniok, Przemyslaw E.

    2014-01-01

    The main purpose of this study is to examine whether fathers' involvement with their child with disabilities is correlated with some of the demographic variables. Data were collected from 243 Polish fathers who were married and who had at least one child with disabilities. The issue was assessed by two measures: a Questionnaire and the Father…

  14. 77 FR 63240 - Telephone Consumer Protection Act of 1991

    Science.gov (United States)

    2012-10-16

    .... Title: Rules and Regulations Implementing the Telephone Consumer Protection Act (TCPA) of 1991, CG... is found in the Telephone Consumer Protection Act of 1991 (TCPA), Public Law 102-243, December 20... COMMISSION 47 CFR Part 64 Telephone Consumer Protection Act of 1991 AGENCY: Federal Communications...

  15. Method for assessment of distribution of UHMWPE wear particles in periprosthetic tissues in total hip arthroplasty

    Czech Academy of Sciences Publication Activity Database

    Pokorný, D.; Šlouf, Miroslav; Horák, Zdeněk; Jahoda, D.; Entlicher, G.; Eklová, S.; Sosna, A.

    2006-01-01

    Roč. 73, č. 4 (2006), s. 243-250. ISSN 0001-5415 R&D Projects: GA ČR GA106/04/1118 Institutional research plan: CEZ:AV0Z40500505 Keywords : wear * polyethylene * total hip arthroplasty Subject RIV: CD - Macromolecular Chemistry http://www.achot.cz/cislo.php?cis=5

  16. Kvalitativní metody

    Czech Academy of Sciences Publication Activity Database

    Čermák, Ivo; Chrz, Vladimír; Zábrodská, Kateřina; Urbánek, Tomáš

    Brno: Psychologický ústav AV ČR, v.v.i, 2014 - (Blatný, M.), s. 243-263 ISBN 978-80-86174-18-1 Institutional support: RVO:68081740 Keywords : qualitative methods * collective biography * discourse analysis * narrative oriented inquiry * semiotics Subject RIV: AN - Psychology

  17. Spindle trees (Euonymus japonica Thunb.) growing in a polluted environment are less sensitive to gamma irradiation

    Czech Academy of Sciences Publication Activity Database

    Kim, J. K.; Cha, M.; Mukherjee, A.; Wilhelmová, Naděžda

    2013-01-01

    Roč. 11, č. 4 (2013), s. 233-243. ISSN 2322-3243 Institutional research plan: CEZ:AV0Z50380511 Keywords : Spindle tree * oxidative stress * ionizing radiation Subject RIV: EF - Botanics http://www.ijrr.com/browse.php?a_code=A-10-1-478&slc_lang=en&sid=1

  18. Identification of bifidobacteria isolated from Asian elephant (Elephas maximus)

    Czech Academy of Sciences Publication Activity Database

    Bunešová, V.; Vlková, E.; Rada, V.; Killer, Jiří; Kmeť, V.

    2013-01-01

    Roč. 38, č. 2 (2013), s. 239-243. ISSN 0250-5991 R&D Projects: GA ČR GA523/08/1091 Institutional support: RVO:67985904 Keywords : 16S rRNA genes sequencing * bifidobacteria * Elephas maximus Subject RIV: EE - Microbiology, Virology Impact factor: 1.939, year: 2013

  19. 7 CFR 2.21 - Under Secretary for Research, Education, and Economics.

    Science.gov (United States)

    2010-01-01

    ..., exercise the functions delegated to the Secretary by Executive Order 12580, 3 CFR, 1987 Comp., p. 193... pollution control standards and section 1-601 of Executive Order 12088, 3 CFR, 1978 Comp., p. 243, to enter... 7 Agriculture 1 2010-01-01 2010-01-01 false Under Secretary for Research, Education, and...

  20. Repetitive sensorimotor events modulate the magnitude and functional coupling of brain rhythmicity in human temporal cortex: a SEEG coherence study

    Czech Academy of Sciences Publication Activity Database

    Vecchio, F.; Babiloni, C.; Bareš, M.; Brázdil, M.; Moretti, D. V.; Nestrašil, I.; Jurák, Pavel; Cola, B.; Rossini, P. M.; Rektor, I.

    Budapest: HBM, 2005, TH243:1-3. [Annual Meeting of the Organization for Human Brain Mapping /10./ (HMB 2004). Budapest (HU), 13.06.2004-17.06.2004] R&D Projects: GA ČR GA102/05/0402 Keywords : intracerebral * ERD/ERS * coherency Subject RIV: FH - Neurology

  1. Self-Help Books Used by Religious Practitioners.

    Science.gov (United States)

    Johnson, W. Brad; Johnson, William L.

    1998-01-01

    Members of the Christian Association for Psychological Studies were surveyed to assess self-help book utilization. Self-help books were used with clients by 92% of respondents (N=243) some of the time. Differences in selection criteria and practices between master's and doctoral-level respondents are noted. Frequently used books are listed.…

  2. Analysis of Textual Data in Psychology

    Czech Academy of Sciences Publication Activity Database

    Urbánek, Tomáš; Czekóová, Kristína

    New York: Nova Science Publishers, 2014 - (Urbánek, T.; Kreitler, h.), s. 243-254 ISBN 978-1-63321-241-1 R&D Projects: GA ČR(CZ) GAP407/12/2432 Institutional support: RVO:68081740 Keywords : textual data * content analysis * semiotic analysis Subject RIV: AN - Psychology

  3. Draft Genome Sequence of Photorhabdus luminescens subsp. laumondii HP88, an Entomopathogenic Bacterium Isolated from Nematodes.

    Science.gov (United States)

    Ghazal, Shimaa; Oshone, Rediet; Simpson, Stephen; Morris, Krystalynne; Abebe-Akele, Feseha; Thomas, W Kelley; Khalil, Kamal M; Tisa, Louis S

    2016-01-01

    Photorhabdus luminescens subsp. laumondii HP88 is an entomopathogenic bacterium that forms a symbiotic association with Heterorhabditis nematodes. We report here a 5.27-Mbp draft genome sequence for P. luminescens subsp. laumondii HP88, with a G+C content of 42.4% and containing 4,243 candidate protein-coding genes. PMID:26988056

  4. Understanding Tobacco-Related Attitudes among College and Noncollege Young Adult Hookah and Cigarette Users

    Science.gov (United States)

    Lee, Youn Ok; Bahreinifar, Sareh; Ling, Pamela M.

    2014-01-01

    Objective: To examine differences in tobacco-related attitudes and hookah and cigarette use among college and noncollege young adults. Participants: Time-location samples of young adult bar patrons in San Diego, California ("N" = 2,243), Tulsa ("N" = 2,095) and Oklahoma City ("N" = 2,200), Oklahoma, Albuquerque…

  5. Moral Disengagement Moderates the Link between Psychopathic Traits and Aggressive Behavior among Early Adolescents

    Science.gov (United States)

    Gini, Gianluca; Pozzoli, Tiziana; Bussey, Kay

    2015-01-01

    This study investigated the relationships between three psychopathic dimensions (callousness/unemotionality, grandiosity/manipulation, and impulsivity/irresponsibility) and reactive and instrumental aggression in a community sample of early adolescents (N = 243, age M = 12.29, SD = 1.18). The moderating role of moral disengagement (MD) was also…

  6. Series of HIV-1 protease nanomolar inhibitors; binding to WT and mutant protease

    Czech Academy of Sciences Publication Activity Database

    Skálová, Tereza; Dohnálek, Jan; Dušková, Jarmila; Petroková, Hana; Vondráčková, Eva; Hašek, Jindřich

    Florence : International Union of Crystallography, 2005. C243. [Congress of the International Union of Crystallography /20./. 23.8.2005-31.8.2005, Florence] R&D Projects: GA AV ČR(CZ) KJB4050312 Keywords : HIV retroviral proteases * HIV drug design * macromolecular crystal structure Subject RIV: EB - Genetics ; Molecular Biology

  7. File list: ALL.Bld.10.AllAg.Leukemic_bone_marrow [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available ALL.Bld.10.AllAg.Leukemic_bone_marrow mm9 All antigens Blood Leukemic bone marrow S...243 http://dbarchive.biosciencedbc.jp/kyushu-u/mm9/assembled/ALL.Bld.10.AllAg.Leukemic_bone_marrow.bed ...

  8. File list: ALL.Bld.20.AllAg.Leukemic_bone_marrow [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available ALL.Bld.20.AllAg.Leukemic_bone_marrow mm9 All antigens Blood Leukemic bone marrow S...243 http://dbarchive.biosciencedbc.jp/kyushu-u/mm9/assembled/ALL.Bld.20.AllAg.Leukemic_bone_marrow.bed ...

  9. Draft Genome Sequence of Photorhabdus luminescens subsp. laumondii HP88, an Entomopathogenic Bacterium Isolated from Nematodes

    OpenAIRE

    Ghazal, Shimaa; Oshone, Rediet; Simpson, Stephen; Morris, Krystalynne; Abebe-Akele, Feseha; Thomas, W Kelley; Khalil, Kamal M.; Tisa, Louis S.

    2016-01-01

    Photorhabdus luminescens subsp. laumondii HP88 is an entomopathogenic bacterium that forms a symbiotic association with Heterorhabditis nematodes. We report here a 5.27-Mbp draft genome sequence for P. luminescens subsp. laumondii HP88, with a G+C content of 42.4% and containing 4,243 candidate protein-coding genes.

  10. The Many Forms of Amorphous Computational Systems. Chapter 13

    Czech Academy of Sciences Publication Activity Database

    Wiedermann, Jiří

    Singapore : World Scientific Publishing Company , 2013 - (Zenil, H.), s. 243-256 ISBN 978-981-4374-29-3 R&D Projects: GA ČR GAP202/10/1333 Institutional research plan: CEZ:AV0Z10300504 Keywords : non-standard models of computations * amorphous computing * nano-machines Subject RIV: IN - Informatics, Computer Science

  11. Současné psychologické přístupy k autobiografické paměti

    Czech Academy of Sciences Publication Activity Database

    Vlčková, Irena; Čermák, Ivo

    Brno: Psychologický ústav AV ČR, 2006, s. 243-249. [Kognice 2006. Praha (CZ), 06.10.2006-07.10.2006] Institutional research plan: CEZ:AV0Z70250504 Keywords : autobiographical memory * self-story * cognitive psychology Subject RIV: AN - Psychology

  12. The risk of multiple sclerosis in nurses

    DEFF Research Database (Denmark)

    Stenager, Egon; Brønnum-Hansen, Henrik; Koch-Henriksen, Nils

    2003-01-01

    The incidence of multiple sclerosis (MS) in nurses during the period 1980-1996 was calculated in a nationwide study. The cohort consisted of 69,428 nurses, 2185 men and 67,243 women. Sixty (two men and 58 women) with definite MS were observed, whereas 69.3 were expected. We found no significant...

  13. Historical review of californium-252 discovery and development

    International Nuclear Information System (INIS)

    This paper discusses the discovery and history of californium 252. This isotope may be synthesized by irradiating plutonium 239, plutonium 242, americium 243, or curium 244 with neutrons in a nuclear reactor. Various experiments and inventions involving 252Cf conducted at the Savannah River Plant are discussed. The evolution of radiotherapy using californium 252 is reviewed

  14. Morphology and mechanical properties of polypropylene/polystyrene blends compatibilized with styrene-butadiene block copolymers

    Czech Academy of Sciences Publication Activity Database

    Fortelný, Ivan; Minkova, L. I.; Kotek, Jiří; Lapčíková, Monika; Michálková, Danuše

    2012-01-01

    Roč. 52, č. 1 (2012), s. 191-204. ISSN 0032-3888 R&D Projects: GA ČR GA106/06/0729; GA AV ČR IAA200500903 Institutional research plan: CEZ:AV0Z40500505 Keywords : polymer blends * compatibilization * morphology Subject RIV: JI - Composite Materials Impact factor: 1.243, year: 2012

  15. Una propuesta de formación en tecnología para docentes de pedagogía /

    OpenAIRE

    Ramírez Torres, Luis Miguel

    2011-01-01

     tesis que para obtener el grado de Doctor en Pedagogía, presenta Luis Miguel Ramírez Torres ; asesor Emilio Aguilar Rodríguez. 243 páginas : diagramas. Doctorado en Pedagogía UNAM, Facultad de Estudios Superiores Aragón, 2011

  16. Internet Gambling and Problem Gambling among 13 to 18 Year Old Adolescents in Iceland

    Science.gov (United States)

    Olason, Daniel Thor; Kristjansdottir, Elsa; Einarsdottir, Hafdis; Haraldsson, Haukur; Bjarnason, Geir; Derevensky, Jeffrey L.

    2011-01-01

    This study reports findings on Internet gambling and problem gambling among Icelandic youth. Participants were 1.537 13-18 year-old students, 786 boys and 747 girls. Results revealed that 56.6% had gambled at least once in the past 12 months and 24.3% on the Internet. Gender and developmental differences were found for Internet gambling, as boys…

  17. The development of identification methods of dynamic parameters of rotating machinery parts

    Czech Academy of Sciences Publication Activity Database

    Daněk, Otakar; Kozánek, Jan; Pešek, Luděk; Procházka, Pavel; Vaněk, František

    Kassel: University of Kassel, 2001 - (Link, M.; Golinval, J.), s. 243-250 ISBN 3-89792-055-7. [Proceedings of international conference on structural system identification. Kassel (NE), 05.09.2001-07.09.2001] R&D Projects: GA ČR GA101/00/0898 Keywords : identification * Jordan structure * pseudoinverse Subject RIV: BI - Acoustics

  18. 75 FR 41123 - Radio Broadcasting Services; Gearhart, OR

    Science.gov (United States)

    2010-07-15

    ... COMMISSION 47 CFR Part 73 . Radio Broadcasting Services; Gearhart, OR AGENCY: Federal Communications... comment on a petition filed by Black Hills Broadcasting, L.P. proposing the allotment of FM Channel 243A... Radio, Radio broadcasting. For the reasons discussed in the preamble, the Federal...

  19. Prevalence, prenatal diagnosis and clinical features of oculo-auriculo-vertebral spectrum

    DEFF Research Database (Denmark)

    Barisic, Ingeborg; Odak, Ljubica; Loane, Maria; Garne, Ester; Wellesley, Diana; Calzolari, Elisa; Dolk, Helen; Addor, Marie-Claude; Arriola, Larraitz; Bergman, Jorieke; Bianca, Sebastiano; Doray, Berenice; Khoshnood, Babak; Klungsoyr, Kari; McDonnell, Bob; Pierini, Anna; Rankin, Judith; Rissmann, Anke; Rounding, Catherine; Queisser-Luft, Annette; Scarano, Gioacchino; Tucker, David

    2014-01-01

    (24.3%) anomalies. There was a high rate (69.5%) of associated anomalies of other organs/systems. The most common were congenital heart defects present in 27.8% of patients. The prevalence of oculo-auriculo-vertebral spectrum, defined as microtia/ear anomalies and at least one major characteristic...

  20. GP8 - Experimental and theoretical study of the Al-Sn-Zn system

    Czech Academy of Sciences Publication Activity Database

    Villain, J.; Klima, S.; Corradi, U.; Weippert, Ch.; Svetly, A.; Drápala, J.; Smetana, B.; Zlá, S.; Vodárek, V.; Lasek, S.; Petlák, D.; Konečná, K.; Kostiuková, G.; Sidorov, V.E.; Kroupa, Aleš; Ipser, H.; Sobczak, N.; Kudyba, A.

    Brno : COST office, 2012 - (Kroupa, A.), s. 243-280 ISBN 978-80-905363-3-3. - (COST MPO602. High-temperature Lead-free Solders. Vol 3) R&D Projects: GA MŠk(CZ) OC08053 Institutional support: RVO:68081723 Keywords : Leads-free solders * Al-Sn-Zn system * Solderability * IMC growth * Structure properties Subject RIV: BJ - Thermodynamics

  1. Effect of abandonment and plant classification on carbohydrate reserves of meadow plants

    Czech Academy of Sciences Publication Activity Database

    Janeček, Štěpán; Lanta, Vojtěch; Klimešová, Jitka; Doležal, Jiří

    2010-01-01

    Roč. 13, č. 2 (2010), s. 243-251. ISSN 1435-8603 R&D Projects: GA ČR GA526/09/0963; GA ČR(CZ) GA526/06/0723 Institutional research plan: CEZ:AV0Z60050516 Keywords : carbohydrates * meadow * abandonment Subject RIV: EF - Botanics Impact factor: 2.409, year: 2010

  2. Doslov: KSČ a Kominterna. Náčrt vývoje nerovného partnerství

    Czech Academy of Sciences Publication Activity Database

    Sommer, Vítězslav

    Praha: Nakladatelství Lidové noviny, 2011, s. 225-243. (Knižnice Dějin a současnosti). ISBN 978-80-7422-046-3 Institutional research plan: CEZ:AV0Z70900502 Keywords : communism * Communist International Subject RIV: AB - History

  3. Gustáv Husák

    Czech Academy of Sciences Publication Activity Database

    Doskočil, Zdeněk

    Praha: Paseka, 2016 - (Ryantová, M.), s. 243-290 ISBN 978-80-7432-500-7 Institutional support: RVO:67985963 Keywords : Gustáv Husák * Communist Party of Czechoslovakia * World War II * bourgeois nationalism * political trials * Prague spring * normalization Subject RIV: AB - History

  4. Using small punch testing method for the analysis of creep behaviour of Al-Al4C3 composites

    Czech Academy of Sciences Publication Activity Database

    Besterci, M.; Dobeš, Ferdinand; Kulu, P.; Sülleiová, K.

    2010-01-01

    Roč. 16, č. 3 (2010), s. 243-254. ISSN 1736-6038 Grant ostatní: Science Grant Agency of Slovakia(SK) VEGA 2/0105/08 Institutional research plan: CEZ:AV0Z20410507 Keywords : dispersion-strengthened Al-Al4C3 composite * mechanical alloying * creep * small punch Subject RIV: JI - Composite Materials

  5. Overview of the JET results with the ITER-like wall

    Czech Academy of Sciences Publication Activity Database

    Romanelli, F.; Abel, I.; Afanesyev, V.; Aftanas, Milan; Agarici, G.; Aggarwal, K.M.; Aho-Mantila, L.; Ahonen, E.; Aints, M.; Airila, M.; Akers, R.; Alarcon, Th.; Albanese, R.; Alexeev, A.; Alfier, A.; Allan, P.; Almaviva, S.; Alonso, A.; Alper, B.; Altmann, H.; Alves, D.; Ambrosino, G.; Amosov, V.; Andersson, F.; Sunden Andersson, E.; Andreev, V.; Andrew, Y.; Angelone, M.; Anghel, M.; Anghel, A.; Angioni, C.; Apruzzese, G.; Arcis, N.; Arena, P.; Argouarch, A.; Ariola, M.; Armitano, A.; Armstrong, R.; Arnoux, G.; Arshad, S.; Artaserse, G.; Artaud, J.F.; Ash, A.; Asp, E.; Asunta, O.; Atanasiu, C.V.; Atkins, G.; Avotina, L.; Axton, M.D.; Ayres, C.; Baciero, A.; Bailescu, V.; Baiocchi, B.; Baker, R.A.; Balboa, I.; Balden, M.; Balorin, C.; Balshaw, N.; Banks, J.W.; Baranov, Y.F.; Barbier, D.; Barlow, I.L.; Barnard, M.A.; Barnsley, R.; Barrena, L.; Barrera, L.; Baruzzo, M.; Basiuk, V.; Bateman, G.; Batistoni, P.; Baumgarten, N.; Baylor, L.; Bazylev, B.; Beaumont, P.S.; Beausang, K.; Bécoulet, M.; Bekris, N.; Beldishevski, M.; Bell, A.C.; Belli, F.; Bellinger, M.; Bellizio, T.; Belo, P.S.A.; Belonohy, E.; Bennett, P.E.; Benterman, N.A.; Berger-By, G.; Bergsåker, H.; Berk, H.; Bernardo, J.; Bernert, M.; Bertrand, B.; Beurskens, M.N.A.; Bieg, B.; Bienkowska, B.; Biewer, T.M.; Bigi, M.; Bílková, Petra; Bin, W.; Bird, J.; Bizarro, J.; Bjorkas, C.; Blackman, T.R.; Blanchard, P.; Blanco, E.; Blum, J.; Bobkov, V.; Boboc, A.; Boilson, D.; Bolshakova, I.; Bolzonella, T.; Boncagni, L.; Bonheure, G.; Bonnin, X.; Borba, D.; Borthwick, A.; Botrugno, A.; Boulbe, C.; Bouquey, F.; Bourdelle, C.; Bovert, K.v.; Bowden, M.; Boyce, T.; Boyer, H.J.; Bozhenkov, A.; Brade, R.J.; Bradshaw, J.M.A.; Braet, J.; Braic, V.; Braithwaite, G.C.; Brault, C.; Breizman, B.; Brémond, S.; Brennan, P.D.; Brett, A.; Breue, J.; Brezinsek, S.; Bright, M.D.J.; Briscoe, F.; Brix, M.; Brombin, M.; Brown, B.C.; Brown, D.P.D.; Brzozowski, J.; Bucalossi, J.; Buckley, M.A.; Budd, T.; Budny, R.V.; Bunting, P.; Buratti, P.; Burcea, G.; Burckhart, A.; Butcher, P.R.; Buttery, R.J.; Cahyna, Pavel; Calabro, G.; Callaghan, C.P.; Caminade, J.P.; Camp, P.G.; Campling, D.C.; Caniello, R.; Canik, J.; Cannas, B.; Capel, A.J.; Carannante, G.; Card, P.J.; Cardinali, A.; Carlstrom, T.; Carman, P.; Carralero, D.; Carraro, L.; Carter, T.; Carvalho, B.B.; Carvalho, I.; Carvalho, P.; Casati, A.; Castaldo, C.; Caughman, J.; Cavazzana, R.; Cavinato, M.; Cecconelo, M.; Cecil, E.; Cecil, F.E.; Cenedese, A.; Centioli, C.; Cesario, R.; Challis, C.D.; Chandler, M.; Chang, C.; Chankin, A.; Chapman, I.T.; Chektybayev, B.; Chernyshova, M.; Child, D.J.; Chiru, P.; Chitarin, G.; Chugonov, I.; Chugunov, I.; Ciric, D.; Clairet, F.; Clarke, R.H.; Clay, R.; Clever, M.; Coad, J.P.; Coates, P.A.; Cocilovo, V.; Coda, S.; Coelho, R.; Coenen, J.; Coffey, I.; Colas, L.; Cole, M.; Collins, S.; Combs, S.; Compan, J.; Conboy, J.E.; Conroy, S.; Cook, N.; Cook, S.P.; Coombs, D.; Cooper, S.R.; Corre, Y.; Corrigan, G.; Cortes, S.; Coster, D.; Counsell, G.F.; Courtois, X.; Cox, M.; Craciunescu, T.; Cramp, S.; Crisanti, F.; Croci, G.; Croft, O.; Crombe, K.; Crombé, K.; Crowley, B.J.; Cruz, N.; Cseh, G.; Cupido, L.; Curuia, M.; Cusack, R.A..; Czarnecka, A.; Czarski, T.; Dalley, S.; Daly, E.T.; Dalziel, A.; Daniel, R.; Darrow, D.; David, O.; Davies, N.; Davies, W.; Davis, J.J.; Day, I.E.; Day, C.; De Angelis, R.; de Arcas, G.; de Baar, M.R.; de la Cal, E.; De La Luna, E.; de Pablos, J.L.; De Tommasi, G.; De Vries, E.; De-Angelis, R.; Degli Agostini, F.; Delabie, E.; del-Castillo-Negrete, D.; Delpech, L.; Denisov, G.; Denyer, A.J.; Denyer, R.F.; Devaux, S.; Devynck, P.; Di Matteo, L.; Di Pace, L.; Dirken, P.J.; Dittmar, T.; Dnestrovskiy, A.; Dodt, D.; Doerner, R.; Doldatov, S.; Dominiczak, K.; Dooley, P.; Dorling, S.E.; Douai, D.; Down, A.P.; Doyle, P.T.; Drake, J.R.; Dreischuh, T.; Drozdov, V.; Dumortier, P.; Dunai, D.; Ďuran, Ivan; Durodié, F.; Dutta, P.; Dux, R.; Dylst, K.; Eaton, R.; Edlington, T.; Edwards, A.M.; Edwards, D.T.; Edwards, P.K.; Eich, Th.; Ekedahl, A.; Elevant, T.; Ellingboe, B.; Elsmore, C.G.; Emmoth, B.; Erdei, G.; Ericsson, G.; Eriksson, L.G.; Eriksson, A.; Esposito, B.; Esser, H.G.; Estrada, T.; Evangelidis, E.A.; Evans, G.E.; Ewart, G.D.; Ewers, D.T.; Falchetto, G.; Falie, D.; Fanthome, J.G.A.; Farthing, J.W.; Fasoli, A.; Faugeras, B.; Fedorczak, N.; Felton, R.C.; Fenzi, C.; Fernades, A.; Fernandes, H.; Ferreira, J.A.; Ferreira, J.; Ferron, J.; Fessey, J.A.; Figini, L.; Figueiredo, J.; Figueiredo, A.; Figueiredo, J.; Finburg, P.; Finken, K.H.; Fischer, U.; Fitzgerald, N.; Flanagan, J.; Fleming, C.; Forbes, A.D.; Ford, O.; Formisano, A.; Fraboulet, D.; Francis, R.J.; Frassinetti, L.; Fresa, R.; Friconneau, J.P.; Frigione, D.; Fullard, K.; Fundameski, W.; Furno Palumbo, M.; Gál, K.; Gao, X.; Garavaglia, S.; Garbet, X.; Garcia, J.; Garcia Munoz, M.; Gardner, W.; Garibaldi, P.; Garnier, D.; Garzotti, L.; Gatu Johnson, M.; Gaudio, P.; Gauthier, E.; Gaze, J.W.; Gear, D.F.; Gedney, J.; Gee, S.J.; Gelfusa, M.; Genangeli, E.; Gerasimov, S.; Geraud, A.; Gerbaud, T.; Gherendi, M.; Ghirelli, N.; Giacalone, J.C.; Giacomelli, L.; Gibson, C.S.; Gil, C.; Gilligan, S.J.; Gimblett, C.G.; Gin, D.; Giovannozzi, E.; Giroud, C.; Giruzzi, G.; Godwin, J.; Goff, J.K.; Gohil, P.; Gójska, A.; Goloborod’ko, V.; Goncalves, B.; Goniche, M.; Gonzales, S.; González de Vicente, S.M.; Goodyear, A.; Gorelenkov, N.; Gorini, G.; Goulding, R.; Graham, B.; Graham, D.; Graham, M.E.; Graves, J.; Green, N.R.; Greuner, H.; Grigore, E.; Griph, F.S.; Grisolia, C.; Gros, G.; Groth, M.; Grünhagen, S.; Gryaznevich, M.P.; Guirlet, R.; Gunn, J.; Gupta, A.; Guzdar, P.; Hackett, L.J.; Hacquin, S.; Haist, B.; Hakola, A.; Halitovs, M.; Hall, S.J.; Hallworth Cook, S.P.; Hamilton, D.T.; Han, H.; Handley, R.C.; Harding, S.; Harling, J.D.W.; Harting, D.; Harvey, M.J.; Haupt, T.D.V.; Hawkes, N.C.; Hawryluk, R.; Hay, J.H.; Hayashi, N.; Haydon, P.W.; Hayward, I.R.; Hazel, S.; Heesterman, P.J.L.; Heidbrink, W.; Heinola, K.; Hellesen, C.; Hellsten, T.; Hemming, O.N.; Hender, T.C.; Henderson, M.; Hennion, V.; Hidalgo, C.; Higashijima, S.; Hill, J.W.; Hill, M.; Hill, K.; Hillairet, J.; Hillis, D.; Hirai, T.; Hitchin, M.; Hobirk, J.; Hogan, C.; Hogben, C.H.A.; Hogeweij, G.M.D.; Hollingham, I.C.; Holyaka, R.; Homfray, D.A.; Honeyands, G.; Hong, S.H.; Hong, J.H.; Horáček, Jan; Horn, B.A.; Horton, A.R.; Horton, L.D.; Hotchin, S.P.; Hough, M.R.; Houlberg, W.; Howell, D.F.; Huber, A.; Huddleston, T.M.; Hudson, Z.; Hughes, M.; Hühnerbein, M.; Hume, C.C.; Hunt, A.J.; Hunter, C.L.; Hutchinson, T.S.; Huygen, S.; Huysmans, G.; Ide, S.; Illescas, C.; Imbeaux, F.; Ivanova, D.; Ivanova-Stanik, I.; Ivings, E.; Jachmich, S.; Jackson, G.; Jacquet, P.; Jakubowska, K.; James, P.V.; Janky, Filip; Järvinen, A.; Jednorog, S.; Jenkins, I.; Jennison, M.A.C.; Jeskins, C.; Jin Kwon, O.; Joffrin, E.; Johnson, M.F.; Johnson, R.; Johnson, T.; Jolovic, D.; Jonauskas, V.; Jones, E.M.; Jones, G.; Jones, H.D.; Jones, T.T.C.; Jouvet, M.; Jupén, C.; Kachtchouk, I.; Kaczmarczyk, J.; Kallenbach, A.; Källne, J.; Kalupin, D.; Kálvin, S.; Kamelander, G.; Kamendje, R.; Kamiya, K.; Kappatou, A.; Kasparek, W.; Kasprowicz, G.; Katramados, I.; Kaveney, G.; Kaye, A.S.; Kear, M.J.; Keeling, D.L.; Kelliher, D.; Kempenaars, M.; Khilar, P.; Khilkevich, E.; Kidd, N.G.; Kiisk, M.; Kim, K.M.; Kim, H.; King, R.F.; Kinna, D.J.; Kirnev, G.; Kirneva, N.; Kirov, K.; Kirschner, A.; Kisielius, R.; Kislov, D.; Kiss, G.; Kizane, G.; Klein, A.; Klepper, C.; Klimov, N.; Klix, A.; Knaup, M.; Kneuper, K.; Kneupner, H.; Knight, P.J.; Knipe, S.J.; Kocan, M.; Koch, R.; Köchl, F.; Kocsis, G.; Koivuranta, S.; Koppitz, T.; Korotkov, A.; Koskela, T.; Koslowski, H.R.; Kotov, V.; Kovari, M.D.; Kramer, G.; Krasilnikov, A.; Krasilnikov, V.; Kraus, S.; Kreter, A.; Krieger, K.; Kritz, A.; Krivchenkov, Y.; Kruezi, U.; Krylov, S.; Ksiazek, I.; Kuhn, S.; Kühnlein, W.; Kukushkin, A.; Kundu, A.; Kurki-Suonio, T.; Kurowski, A.; Kuteev, B.; Kuyanov, A.; Kyrytsya, V.; La Haye, R.; Laan, M.; Labate, C.; Lachichi, A.; Laguardia, L.; Lam, N.; Lang, P.; Large, M.T.; Lasa, A.; Lassiwe, I.; Last, J.R.; Lawson, K.D.; Laxåback, M.; Layne, R.A.; Le Guern, F.; LeBlanc, B.; Lee, S.; Lee, J.; Leggate, H.J.; Lehnen, M.; Leigheb, M.; Lengar, I.; Lennholm, M.; Lerche, E.; Lescure, C.N.; Li, Y.; Li Puma, A.; Liang, Y.; Likonen, J.; Lin, Y.; Lindholm, V.; Linke, J.; Linstead, S.A.; Lipshultz, B.; Litaudon, X.; Litvak, A.G.; Liu, Y.; Loarer, T.; Loarte, A.; Lobel, R.C.; Lomas, P. J.; Long, F.D.; Lönnroth, J.; Looker, D.J.; Lopez, J.; Lotte, Ph.; Louche, F.; Loughlin, M.J.; Loving, A.B.; Lowry, C.; Luce, T.; Lucock, R.M.A.; Lukanitsa, A.; Lukin, A.; Lungu, A.M.; Lungu, C.P.; Lyssoivan, A.; Macheta, P.; Mackenzie, A.S.; Macrae, M.; Maddaluno, G.; Maddison, G.P.; Madsen, J.; Magesh, B.; Maget, P.; Maggi, C.F.; Maier, H.; Mailloux, J.; Makkonen, T.; Makowski, M.; Malaquias, A.; Manning, C.J.; Mansfield, M.; Manso, M.E.; Mantica, P.; Marcenko, N.; Marchitti, M.A.; Mardenfeld, M.; Marechal, J.L.; Marinelli, M.; Marinucci, M.; Marocco, D.; Marren, C.A.; Marsen, S.; Martin, D.; Martin, D.L.; Martin, G.; Martin, Y.; Martín-Solís, J.R.; Masaki, K.; Masiello, A.; Maszl, C.; Matejcik, S.; Matilal, A.; Mattei, M.; Matthews, G.F.; Mattoo, S.; Matveev, D.; Maviglia, F.; May, C.R.; Mayer, M.; Mayoral, M.L.; Mazon, D.; Mazzotta, C.; Mazzucato, E.; McCarthy, P.; McClements, K.G.; McCormick, K.; McCullen, P.A.; McCune, D.; McDonald, D.C.; Mcgregor, R.; Mckivitt, J.P.; Meakins, A.; Medina, F.; Meigs, A.G.; Menard, M.; Meneses, L.; Menmuir, S.; Merrigan, I.R.; Mertens, Ph.; Messiaen, A.; Mészáros, B.; Meyer, H.; Miano, G.; Michling, R.; Miele, M.; Miettunen, J.; Migliucci, P.; Miller, A.G.; Mills, S.F.; Milnes, J.J.; Min Kim, K.; Mindham, T.; Miorin, E.; Mirizzi, F.; Mirones, E.; Mironov, M.; Mitteau, R.; Mlynář, Jan; Mollard, P.; Monakhov, I.; Monier-Garbet, P.; Mooney, R.; Moreau, D.; Moreau, Ph.; Moreira, L.; Morgan, A.; Morgan, P.D.; Morlock, C.; Morris, A.W.; Mort, G.L.; Murakami, M.; Murari, A.; Mustata, I.; Nabais, F.; Nakano, T.; Nardon, E.; Nash, G.; Naulin, V.; Nave, M.F.F.; Nazikian, R.; Nedzelski, I.; Negus, C.R.; Neilson, J.D.; Nemtsev, G.; Neto, A.; Neu, R.; Neubauer, O.; Newbert, G.J.; Newman, M.; Nicholls, K.J.; Nicolai, A.; Nicolas, L.; Nieckchen, P.; Nielsen, A.H.; Nielsen, S.K.; Nielsen, P.; Nielson, G.; Nieto, J.; Nightingale, M.P.S.; Nishijima, D.; Noble, C.; Nocente, M.; Nordman, H.; Norman, M.; Nowak, S.; Nunes, I.; Oberkofler, M.; Odstrčil, Michal; O’Gorman, T.; Ohsako, T.; Okabayashi, M.; Olariu, S.; Oleynikov, A.; O’Mullane, M.; Ongena, J.; Orsitto, F.; Oswuigwe, O.I.; Ottaviani, M.; Oyama, N.; Pacella, D.; Paget, K.; Pajuste, E.; Palazzo, S.; Palénic, J.; Pamela, J.; Pamela, S.; Pangione, L.; Panin, A.; Panja, A.; Pankin, A.; Pantea, A.; Parail, V.; Paris, P.; Parisot, Th.; Park, M.; Parkin, A.; Parsloe, A.; Parsons, B.T.; Pasqualotto, R.; Pastor, P.; Paterson, R.; Paul, M.K.; Peach, D.; Pearce, R.J.H.; Pearson, B.J.; Pearson, I.J.; Pedrick, L.C.; Pedrosa, M.A.; Pegourie, B.; Pereira, R.; Pereslavtsev, P.; Perevezentsev, A.; Perez von Thun, Ch.; Pericoli-Ridolfini, V.; Perona, A.; Perrot, Y.; Peruzzo, S.; Peschanyy, S.; Petravich, G.; Petrizzi, L.; Petrov, V.; Petržílka, Václav; Philipps, V.; Piccolo, F.; Pietropaolo, A.; Pillon, M.; Pinches, S.D.; Pinna, T.; Pintsuk, G.; Piovesan, P.; Pironti, A.; Pisano, F.; Pitts, R.; Plaum, B.; Plyusnin, V.; Polasik, M.; Poli, F.M.; Pomaro, N.; Pompilian, O.; Poncet, L.; Pool, P.J.; Popovichev, S.; Porcelli, F.; Porfiri, M.T.; Portafaix, C.; Pospieszczyk, A.; Possnert, G.; Pozniak, K.; Pradhan, S.; Pragash, R.; Prajapati, V.; Prestopino, G.; Prior, P.; Prokopowicz, R.; Puiatti, M.E.; Purahoo, K.; Pustovitov, V.; Pütterich, Th.; Püttmann-Kneupner, D.; Quercia, A.; Rachlew, E.; Rademaker, R.; Rafiq, T.; Rainford, M.S.J.; Ramogida, G.; Rapp, J.; Rasmussen, J.J.; Rathod, K.; Rattá, G.; Ravera, G.; Refy, D.; Reichle, R.; Reinelt, M.; Reiser, D.; Reiss, R.; Reiter, D.; Rendell, D.; Reux, C.; Rewoldt, G.; Ribeiro, T.T.; Riccardo, V.; Richards, D.; Rigollet, F.; Rimini, F.G.; Rios, L.; Riva, M.; Roberts, J.E.C.; Robins, R.J.; Robinson, D.S.; Robinson, S.A.; Robson, D.W.; Roche, H.; Rödig, M.; Rodionov, N.; Rohde, V.; Rolfe, A.; Romanelli, M.; Romano, A.; Romero, J.; Ronchi, E.; Rosanvallon, S.; Roux, Ch.; Rowe, S.; Rubel, M.; Rubinacci, G.; Ruiz, M.; Ruset, C.; Russell, M.; Ruth, A.; Ryc, L.; Rydzy, A.; Rzadkiewicz, J.; Saarelma, S.; Sabathier, F.; Sabot, R.; Sadakov, S.; Sadvakassova, A.; Sadykov, A.; Sagar, P.; Saibene, G.; Saille, A.; Saint-Laurent, F.; Salewski, M.; Salmi, A.; Salzedas, F.; Samm, U.; Sanchez, P.; Sanders, S.; Sanders, S.G.; Sandford, G.; Sandland, K.; Sandquist, P.; Sands, D.E.G.; Santala, M.I.K.; Santra, P.; Sartori, F.; Sartori, R.; Sauter, O.; Savelyev, A.; Savtchkov, A.; Scales, S.C.; Scarabosio, A.; Schaefer, N.; Schmidt, V.; Schmidt, A.; Schmitz, O.; Schmuck, S.; Schneider, M.; Scholz, M.; Schöpf, K.; Schweer, B.; Schweinzer, J.; Seki, M.; Semeraro, L.; Semerok, A.; Sergienko, G.; Sertoli, M.; Shannon, M.M.J.; Sharapov, S.E.; Shaw, S.R.; Shevelev, A.; Sieglin, B.; Sievering, R.; Silva, C.A.; Simmons, P.A.; Simonetto, A.; Simpson, D.; Sipilä, S.K.; Sips, A.C.C.; Sirén, P.; Sirinelli, A.; Sjöstrand, H.; Skopintsev, D.; Slabkowska, K.; Smith, P.G.; Snipes, J.; Snoj, L.; Snyder, S.; Soare, S.; Solano, E.R.; Soleto, A.; Solomon, W.; Soltane, C.; Sonato, P.; Sopplesa, A.; Sorrentino, A.; Sousa, J.; Sowden, C.B.C.; Sozzi, C.; Späh, P.; Spelzini, T.; Spence, J.; Spineanu, F.; Spuig, P.; Stagg, R.D.; Stamp, M.F.; Stancalie, V.; Stangeby, P.; Stankiewicz, R.; Stan-Sion, C.; Starkey, D.E.; Stead, M.J.; Stejner, M.; Stephen, A.V.; Stephen, M.; Stevens, A.L.; Stokes, R.B.; Stork, D.; Stoyanov, D.; Strachan, J.; Strand, P.; Stransky, M.; Strauss, D.; Strintzi, D.; Studholme, W.; Su Na, Y.; Subba, F.; Summers, H.P.; Sun, Y.; Surdu-Bob, C.; Surrey, E.; Sutton, D.J.; Svensson, J.; Swain, D.; Syme, B.D.; Symonds, I.D.; Szabolics, T.; Szepesi, T.; Szydlowski, A.; Tabares, F.; Takalo, V.; Takenaga, H.; Tala, T.; Talbot, A.R.; Taliercio, C.; Tame, C.; Tardocchi, M.; Taroni, L.; Telesca, G.; Terra, A.; Terrington, A.O.; Testa, D.; Theis, J.M.; Thomas, J.D.; Thomas, P.D.; Thomas, P.R.; Thompson, V.K.; Thomser, C.; Thyagaraja, A.; Tigwell, P.A.; Tiseanu, I.; Tivey, R.; Todd, J.M.; Todd, T.N.; Tokar, M.Z.; Tosti, S.; Trabuc, P.; Travere, J.M.; Trimble, P.; Trkov, A.; Trukhina, E.; Tsalas, M.; Tsitrone, E.; Tskhakaya jun, D.; Tudisco, O.; Tugarinov, S.; Turner, M.M.; Tyrrell, S.G.J.; Umeda, N.; Unterberg, B.; Urano, H.; Urquhart, A.J.; Uytdenhouwen, I.; Vaccaro, A.; Vadgama, A.P.; Vagliasindi, G.; Valcarcel, D.; Valisa, M.; Vallory, J.; Valovic, M.; Van Eester, D.; van Milligen, B.; van Rooij, G.J.; Varandas, C.A.F.; Vartanian, S.; Vasava, K.; Vdovin, V.; Vega, J.; Verdoolaege, G.; Verger, J.M.; Vermare, L.; Verona, C.; Versloot, Th.; Vervier, M.; Vicente, J.; Villari, S.; Villedieu, E.; Villone, F.; Vince, J.E.; Vine, G.J.; Vinyar, I.; Viola, B.; Vitale, E.; Vitelli, R.; Vitins, A.; Vlad, M.; Voitsekhovitch, I.; Vrancken, M.; Vulliez, K.; Waldon, C.W.F.; Walker, M.; Walsh, M.J.; Waterhouse, J.; Watkins, M.L.; Watson, M.J.; Wauters, T.; Way, M.W.; Webb, C.R.; Weiland, J.; Weisen, H.; Weiszflog, M.; Wenninger, R.; West, A.T.; Weulersse, J.M.; Wheatley, M.R.; Whiteford, A.D.; Whitehead, A.M.; Whitehurst, A.G.; Widdowson, A.M.; Wiegmann, C.; Wiesen, S.; Wilson, A.; Wilson, D.; Wilson, D.J.; Wilson, H.R.; Wischmeier, M.; Witts, D.M.; Wolf, R.C.; Wolowski, J.; Woscov, P.; Wright, J.; Xu, G.S.; Yavorskij, V.; Yerashok, V.; Yoo, M.; Yorkshades, J.; Young, C.; Young, D.; Young, I.D.; Yuhong, X.; Yun, S.; Zabeo, L.; Zabolotny, W.; Zaccarian, L.; Zagorski, R.; Zaitsev, F.S.; Zakharov, L.; Zanino, R.; Zaroschi, V.; Zastrow, K.D.; Zatz, I.; Zefran, B.; Zeidner, W.; Zerbini, M.; Zhang, T.; Zhitlukin, A.; Zhu, Y.; Zimmermann, O.; Zoita, V.; Zoletnik, S.; Zwingman, W.

    2013-01-01

    Roč. 53, č. 10 (2013), s. 104002-104002. ISSN 0029-5515 Institutional support: RVO:61389021 Keywords : plasma-facing components * tokamak plasmas * performance * tungsten * divertor * regime Subject RIV: BL - Plasma and Gas Discharge Physics Impact factor: 3.243, year: 2013 http://iopscience.iop.org/0029-5515/53/10/104002/pdf/0029-5515_53_10_104002.pdf

  6. GRB Potential of ESA Gaia

    Czech Academy of Sciences Publication Activity Database

    Hudec, René; Šimon, Vojtěch

    Les Ulis : EDP Sciences, 2013, s. 239-243. ISBN 9782759810024. ISSN 1633-4760. - (EAS Publications Series. 61). [Fall Gamma Ray Burst Symposium on 15 years of Gamma-Ray Burst s afterglows. Malaga (ES), 08.10.2012-12.10.2012] Institutional support: RVO:67985815 Keywords : gamma-ray burst s * orphan afterglows * jet Subject RIV: BN - Astronomy, Celestial Mechanics, Astrophysics

  7. Drug: D03545 [KEGG MEDICUS

    Lifescience Database Archive (English)

    Full Text Available D03545 Drug Clodronic acid (USAN/INN) CH4Cl2O6P2 243.886 244.8924 D03545.gif Regulator [calcium] ... ATC code: M05BA02 map07047 Osteoporosis ... drugs Anatomical Therapeutic Chemical (ATC) classi ...

  8. Pregnancy loss after frozen-embryo transfer--a comparison of three protocols

    DEFF Research Database (Denmark)

    Tomás, Candido; Alsbjerg, Birgit; Martikainen, Hannu; Humaidan, Peter; Al Humaidan, Peter Samir Heskjær

    2012-01-01

    was similar in all groups (27.7%, 29.1%, and 24.3%, respectively). Moreover, no differences were seen between groups regarding the live-birth rate (20.1%, 23.5%, and 20.7%, respectively). A logistic regression analysis showed that the type of protocol was the only predictor of pregnancy loss, while...

  9. Existence of periodic solutions for the Lotka-Volterra type systems

    Science.gov (United States)

    Hirano, Norimichi; Rybicki, Sławomir

    In this paper we prove the existence of nonstationary periodic solutions of delay Lotka-Volterra equations. In the proofs we use the S-degree due to Dylawerski et al. [G. Dylawerski, K. Geba, J. Jodel, W. Marzantowicz, An S-equivariant degree and the Fuller index, Ann. Polon. Math. 63 (1991) 243-280].

  10. AcEST: DK962290 [AcEST

    Lifescience Database Archive (English)

    Full Text Available TST39A01NGRL0013_H15 645 Adiantum capillus-veneris mRNA. clone: TST39A01NGRL0013_H15. 5' end seq ... CGAGVARQTRECDHP--SPAHGGLFCTGERARYKT 243 Query: 299 CRM -----------------HDPGCGGGETYLWYEEGHVLRLHQQSAETMK 19 ... IASGVAHVSAEYQDAGTMEMNDHTSHQDQSHEAN 128 Query: 302 LCRM HDP 282 + + P Sbjct: 129 ISTLSPP 135 >tr|B1X8J6|B1X ...

  11. “Further Development“ of Mendel´s Legacy? Erich von tschermak-Seysenegg in the context of mendelian-biometry controversy, 1901-1906

    Czech Academy of Sciences Publication Activity Database

    Šimůnek, Michal V.; Hossfeld, U.; Breidbach, O.

    2012-01-01

    Roč. 131, č. 4 (2012), s. 243-252. ISSN 1431-7613 Institutional research plan: CEZ:AV0Z80630520 Keywords : origins of genetics * E. V. Tschermak-Seysenegg * biometry controversy Subject RIV: AB - History Impact factor: 0.925, year: 2012

  12. Selective production of xylenes from alkyl-aromatics and heavy reformates over dual-zeolite catalyst

    Czech Academy of Sciences Publication Activity Database

    Ali, S. A.; Aitani, A.; Čejka, Jiří; Al-Khattaf, S.

    2015-01-01

    Roč. 243, APR 2015 (2015), s. 118-127. ISSN 0920-5861 R&D Projects: GA ČR GBP106/12/G015 Institutional support: RVO:61388955 Keywords : transalkylation * mordenite * xylenes Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 3.893, year: 2014

  13. 16.5.Lymphatic system and lymphoma

    Institute of Scientific and Technical Information of China (English)

    1992-01-01

    920380 Primary Non-Hodgkin’s lymphomasof the brain:a clinic-pathological immuno-histochemical study and image analysis of 10cases.I,Immunohistochemical study,LIUKaifeng (刘开凤),et al.Dept Pathol,West-ChinMed Univ.Tumor 1991;11(6):243-245.

  14. Prevalence and pathogenicity of Cryptosporidium suis in pre- and post-weaned pigs

    Czech Academy of Sciences Publication Activity Database

    Vítovec, J.; Hamadejová, K.; Landová, L.; Kváč, Martin; Květoňová, Dana; Sak, Bohumil

    2006-01-01

    Roč. 53, č. 5 (2006), s. 239-243. ISSN 0931-1793 R&D Projects: GA ČR GA524/05/0992 Institutional research plan: CEZ:AV0Z60220518 Keywords : Cryptosporidium suis * piglets * pathogenicity Subject RIV: EG - Zoology Impact factor: 1.356, year: 2006

  15. Solubility of ammonium aluminum sulfate dodecahydrate in the aluminum sulfate plus ammonium sulfate plus sulfuric acid plus water system at (25, 30, 40, and 50) degrees C

    Czech Academy of Sciences Publication Activity Database

    Hostomská, Věra; Hostomský, Jiří

    2006-01-01

    Roč. 51, č. 1 (2006), s. 243-247. ISSN 0021-9568 R&D Projects: GA ČR(CZ) GA203/04/1574 Institutional research plan: CEZ:AV0Z40320502 Keywords : alums Subject RIV: CA - Inorganic Chemistry Impact factor: 1.642, year: 2006

  16. Rapid Automatized Naming and Immediate Memory Functions in Chinese Mandarin-Speaking Elementary Readers

    Science.gov (United States)

    Ding, Yi; Richman, Lynn C.; Yang, Ling-yan; Guo, Jian-peng

    2010-01-01

    The purpose of this study was to evaluate rapid automatized naming skills (RAN) and immediate memory processes in 243 Chinese Mandarin-speaking elementary readers (ranging from Grade 1 to Grade 5). For RAN subtests, the mean naming time decreased monotonically with grade level in good and average readers, and a similar trajectory was found in poor…

  17. 7 CFR 2.81 - Administrator, Grain Inspection, Packers and Stockyards Administration.

    Science.gov (United States)

    2010-01-01

    ... Agriculture contained in the Agricultural Marketing Act of 1946, as amended (7 U.S.C. 1621-1627), relating to... 12580, 3 CFR, 1987 Comp., p. 193, under the following provisions of the Comprehensive Environmental... section 1-601 of Executive Order 12088, 3 CFR, 1978 Comp., p. 243, to enter into an inter-agency...

  18. 7 CFR 2.48 - Administrator, Rural Business-Cooperative Service.

    Science.gov (United States)

    2010-01-01

    ... Loan program (7 U.S.C. 6616). (11) Administer programs authorized by the Cooperative Marketing Act of... Agricultural Marketing Act of 1946 (7 U.S.C. 1621-1627). (13) Work with institutions and international... Executive Order 12088, 3 CFR, 1978 Comp., p. 243, to enter into an inter-agency agreement with the...

  19. 7 CFR 2.53 - Administrator, Food Safety and Inspection Service.

    Science.gov (United States)

    2010-01-01

    ... of Agriculture contained in the Agricultural Marketing Act of 1946, as amended (7 U.S.C. 1621-1627...-601 of Executive Order 12088, 3 CFR, 1978 Comp., p. 243, to enter into an inter-agency agreement with... Act (42 U.S.C. 9604 (a), (b), and (c)(4)), with respect to removal and remedial actions in the...

  20. 7 CFR 2.42 - Administrator, Farm Service Agency.

    Science.gov (United States)

    2010-01-01

    ... to the Secretary by Executive Order 12580, 3 CFR, 1987 Comp., p. 193, under the following provisions... standards and section 1-601 of Executive Order 12088, 3 CFR, 1978 Comp., p. 243, to enter into an inter... thereto by the Attorney General and the Comptroller General (4 CFR chapter II), with respect to claims...

  1. 7 CFR 2.65 - Administrator, Agricultural Research Service.

    Science.gov (United States)

    2010-01-01

    ... pollution control standards and section 1-601 of Executive Order 12088, 3 CFR, 1978 Comp., p. 243, to enter... CFR, 1987 Comp., p. 193, under the following provisions of the Comprehensive Environmental Response... 7 Agriculture 1 2010-01-01 2010-01-01 false Administrator, Agricultural Research Service....

  2. 7 CFR 2.47 - Administrator, Rural Utilities Service.

    Science.gov (United States)

    2010-01-01

    ... Comptroller General (4 CFR chapter II), with respect to the claims of the Rural Utilities Service. (10... Secretary by Executive Order 12580, 3 CFR, 1987 Comp., p. 193, under the following provisions of the... standards and section 1-601 of Executive Order 12088, 3 CFR, 1978 Comp., p. 243, to enter into an...

  3. 7 CFR 2.49 - Administrator, Rural Housing Service.

    Science.gov (United States)

    2010-01-01

    ... joint regulations issued pursuant thereto by the Attorney General and the Comptroller General (4 CFR... Executive Order 12580, 3 CFR, 1987 Comp., p. 193, under the following provisions of the Comprehensive... section 1-601 of Executive Order 12088, 3 CFR, 1978 Comp., p. 243, to enter into an inter-agency...

  4. A Confirmatory Factor Analysis of Preservice Teachers' Responses to the Attitudes and Beliefs on Classroom Control Inventory.

    Science.gov (United States)

    Henson, Robin K.; Roberts, J. Kyle

    This study examined the factorial invariance of scores from the Attitudes and Beliefs on Classroom Control Inventory (ABCC) (Martin and others, 1998) for 243 undergraduate preservice teachers. Although the original ABCC was developed with inservice teachers, use of the instrument to study the classroom beliefs of preservice teachers had not been…

  5. Domain Modeling: NP_004604.2 [SAHG[Archive

    Lifescience Database Archive (English)

    Full Text Available NP_004604.2 chr20 Transglutaminase 2 undergoes large conformational change upon act...ivation c2q3za_ chr20/NP_004604.2/NP_004604.2_holo_1-683.pdb blast 169Q,176K,241W,243N,245Y,252M,276Q,277C,2

  6. 76 FR 34541 - Child and Adult Care Food Program Improving Management and Program Integrity

    Science.gov (United States)

    2011-06-13

    ... improve Program management and integrity in the Child and Adult Care Food Program (CACFP), at 67 FR 43447 (June 27, 2002) and at 69 FR 53501 (September 1, 2004). Section 243 of Public Law 106-224, the... rule was issued in proposed form on September 12, 2000 (65 FR 55101). In response to State and...

  7. Stress and Coping among Migrant and Local-Born Adolescents in Hong Kong

    Science.gov (United States)

    Tam, Vicky Chiu-Wan; Lam, Rebecca Siu-Yuk

    2005-01-01

    This study compared stress and coping among 243 migrant and 750 local-born Chinese adolescents in Hong Kong. Findings showed that compared to their local-born counterparts, migrants showed no difference in perceived stress, whereas they were less likely to use withdrawal coping and showed higher self-esteem and less delinquent behavior. Adjustment…

  8. Trh práce a plodnost: Bezdětní třicátníci a třicátnice na trhu práce

    Czech Academy of Sciences Publication Activity Database

    Hašková, Hana

    Praha: Sociologický ústav AV ČR, v.v.i, 2008 - (Dudová, R.), s. 243-292 ISBN 978-80-7330-138-5 R&D Projects: GA MPS 1J034/05-DP2 Institutional research plan: CEZ:AV0Z70280505 Keywords : fertility * labour market * childless Subject RIV: AO - Sociology, Demography

  9. Shifts in Soil Chemical Properties and Bacterial Communities Responding to Biotransformed Dry Olive Residue Used as Organic Amendment

    Czech Academy of Sciences Publication Activity Database

    Siles, J. A.; Cajthaml, Tomáš; Hernandez, P.; Perez-Mendoza, D.; Garcia-Romera, I.; Sampedro, I.

    2015-01-01

    Roč. 70, č. 1 (2015), s. 231-243. ISSN 0095-3628 R&D Projects: GA TA ČR TE01020218 Institutional support: RVO:61388971 Keywords : Bioremediation * Biotransformation * Mediterranean soil Subject RIV: EE - Microbiology, Virology Impact factor: 2.973, year: 2014

  10. An improvement of dimension-free Sobolev imbeddings in r spaces

    Czech Academy of Sciences Publication Activity Database

    Fiorenza, A.; Krbec, Miroslav; Schmeisser, H.-J.

    2014-01-01

    Roč. 267, č. 1 (2014), s. 243-261. ISSN 0022-1236 R&D Projects: GA ČR GAP201/10/1920 Institutional support: RVO:67985840 Keywords : imbedding theorem * small Lebesgue space * rearrangement-invariant Banach Subject RIV: BA - General Mathematics Impact factor: 1.322, year: 2014 http://www.sciencedirect.com/science/article/pii/S0022123614001724

  11. Historické povodně a jejich dokumentace

    Czech Academy of Sciences Publication Activity Database

    Munzar, Jan; Ondráček, Stanislav

    2012-01-01

    Roč. 21, č. 5 (2012), s. 30-32. ISSN 1210-3004 Institutional support: RVO:68145535 Keywords : historical floods * Czech lands * flood documentation Subject RIV: AB - History http://geography.cz/geograficke-rozhledy/obsah-215-udolni-niva-243/gr-2011-2012-21-5-udolni-niva/

  12. Identita/Alterita

    Czech Academy of Sciences Publication Activity Database

    Řezníková, Lenka

    Praha : Scriptorium, 2014 - (Storchová, L.), s. 233-243 ISBN 978-80-87271-87-2 R&D Projects: GA ČR(CZ) GAP410/11/1201 Institutional support: RVO:67985955 Keywords : identity * concepts of identity * historical writing since 1945 Subject RIV: AB - History

  13. 'Magic' Configurations of Three-Qubit Observables and Geometric Hyperplanes of the Smallest Split Cayley Hexagon

    Czech Academy of Sciences Publication Activity Database

    Saniga, M.; Planat, M.; Pracna, Petr; Levay, P.

    2012-01-01

    Roč. 8, č. 2012 (2012), 083. ISSN 1815-0659 Institutional support: RVO:61388955 Keywords : 'magic' configurations of observables * three-qubit Pauli group * split Cayley hexagon of order two Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 1.243, year: 2012

  14. Orthogonal polynomials, Laguerre Fock space, and quasi-classical asymptotics

    Czech Academy of Sciences Publication Activity Database

    Engliš, Miroslav; Twareque, A. S.

    2015-01-01

    Roč. 56, č. 7 (2015), 072109. ISSN 0022-2488 Institutional support: RVO:67985840 Keywords : Laguerre polynomials * Laguerre Fock space * Toeplitz operators Subject RIV: BA - General Math ematics Impact factor: 1.243, year: 2014 http://scitation.aip.org/content/aip/journal/jmp/56/7/10.1063/1.4927343

  15. Reactive oxygen species produced by irradiation of some phthalocyanine derivatives

    Czech Academy of Sciences Publication Activity Database

    Černý, J.; Karásková, M.; Rakušan, J.; Nešpůrek, Stanislav

    2010-01-01

    Roč. 210, č. 1 (2010), s. 82-88. ISSN 1010-6030 R&D Projects: GA AV ČR KAN400720701 Institutional research plan: CEZ:AV0Z40500505 Keywords : singlet oxygen * photosensitizer * phthalocyanine Subject RIV: CG - Electrochemistry Impact factor: 2.243, year: 2010

  16. 76 FR 71872 - Rescission of Outdated Rules and Forms, and Amendments To Correct References

    Science.gov (United States)

    2011-11-21

    ... Accountants, Accounting, Securities. 17 CFR Parts 229, 230, 232, 239, 240, 243, and 249 Reporting and... CONTENT OF AND REQUIREMENTS FOR FINANCIAL STATEMENTS, SECURITIES ACT OF 1933, SECURITIES EXCHANGE ACT OF... Act of 1935,'' from the third sentence of the introductory text; 0 b. Removing the phrase...

  17. The feasibility of independent observations and detections of GRBs in X rays

    Czech Academy of Sciences Publication Activity Database

    Hudec, René; Pína, L.; Maršíková, V.; Inneman, A.; Skulinová, Michaela

    Melville: American Institute of Physics, 2011 - (McEnery, J.), s. 423-426. (AIP Conference proceedings. 1358). ISBN 978-0-7354-0916-3. ISSN 0094-243X. [Gamma Ray Bursts 2010. Annapolis (US), 01.11.2010-04.11.2010] Institutional research plan: CEZ:AV0Z10030501 Keywords : luminosities * magnitudes * effective temperatures Subject RIV: BN - Astronomy, Celestial Mechanics, Astrophysics

  18. Mutant p53 is a transcriptional co-factor that binds to G-rich regulatory regions of active genes and generates transcriptional plasticity

    Czech Academy of Sciences Publication Activity Database

    Quante, T.; Otto, B.; Brázdová, Marie; Kejnovská, Iva; Deppert, W.; Tolstonog, G.V.

    2012-01-01

    Roč. 11, č. 17 (2012), s. 3290-3303. ISSN 1538-4101 R&D Projects: GA ČR(CZ) GAP301/10/2370 Institutional research plan: CEZ:AV0Z50040702 Keywords : mutant p53 * transcription * G-quadruplex Subject RIV: BO - Biophysics Impact factor: 5.243, year: 2012

  19. Socialization Preferences and Intentions: Does One Size Fit All?

    Science.gov (United States)

    Gruman, Jamie A.; Saks, Alan M.

    2011-01-01

    The purpose of this study was to investigate student preferences for socialization tactics and their intentions to be proactive when they begin a new job. We examined the relationship between the Five Factor Model of personality and proactive personality with socialization tactics preferences and proactive behavior intentions in a sample of 243

  20. Ani barbar ani mistr: Emil Filla a skytské umění

    Czech Academy of Sciences Publication Activity Database

    Lahoda, Vojtěch

    Praha : Artefactum, 2003 - (Bukovinská, B.; Konečný, L.), s. 243-258 ISBN 80-903230-6-5 R&D Projects: GA AV ČR IBS8033101 Institutional research plan: CEZ:AV0Z8033913 Keywords : Scythians * expressionism * chinese art Subject RIV: AL - Art, Architecture, Cultural Heritage

  1. Polyvinyl chloride catheters with repressed migration of plasticizers

    Czech Academy of Sciences Publication Activity Database

    Sedláček, T.; Polášková, M.; Kašpárková, V.; Filip, Petr; Sáha, P.

    Larnaca : Polymer Processing Society, 2009, s. 243. [Polymer Processing Society Europe/Africa Regional Meeting. Larnaca (GR), 18.10.2009-21.10.2009] Institutional research plan: CEZ:AV0Z20600510 Keywords : Polyvinyl chloride * catheter * repressed migration of plasticizers Subject RIV: BK - Fluid Dynamics

  2. Kvantitativní fonotaktická analýza názvů českých obcí a jejich částí

    Czech Academy of Sciences Publication Activity Database

    Bičan, Aleš

    2015-01-01

    Roč. 76, č. 4 (2015), s. 243-264. ISSN 0037-7031 R&D Projects: GA ČR GP13-15361P Institutional support: RVO:68378092 Keywords : oikonym * municipality * phonology * statistics * Czech phonotactics * phonological corpus Subject RIV: AI - Linguistics Impact factor: 0.375, year: 2014

  3. Magnetismus hornin a jeho aplikace při studiu znečištění životního prostředí

    Czech Academy of Sciences Publication Activity Database

    Kapička, Aleš; Petrovský, Eduard

    2004-01-01

    Roč. 54, č. 4 (2004), s. 240-243. ISSN 0009-0700 R&D Projects: GA AV ČR IBS3012354 Institutional research plan: CEZ:AV0Z3012916 Keywords : rock magnetism * environmental magnetism * magnetic properties Subject RIV: DE - Earth Magnetism, Geodesy, Geography

  4. New floristic records in the Balkans: 3

    DEFF Research Database (Denmark)

    2006-01-01

    ), Plantaginaceae (122), Poaceae (69-70, 108, 115, 116, 127), Polygalaceae (183), Polygonaceae (55), Pyrolaceae (184), Ranunculaceae (11, 83, 84, 113, 123, 185), Rhamnaceae (56), Rosaceae (130, 186-189, 222), Rubiaceae (57, 190, 223-225), Salicaceae (58), Salviniaceae (98), Santalaceae (191), Sapindaceae (243...

  5. Probing into the diversity of trypanosomatid flagellates parasitizing insect hosts in South-West China reveals both endemism and global dispersal

    Czech Academy of Sciences Publication Activity Database

    Votýpka, Jan; Maslov, D. A.; Yurchenko, V.; Jirků, Milan; Kment, P.; Lun, Z.-R.; Lukeš, Julius

    2010-01-01

    Roč. 54, č. 1 (2010), s. 243-253. ISSN 1055-7903 Institutional research plan: CEZ:AV0Z60220518 Keywords : trypanosomatids * phylogeny * diversity * insects Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 3.889, year: 2010

  6. On the weak solution to the Oseen-type problem arising from flow around a rotating rigid body in the whole space

    Czech Academy of Sciences Publication Activity Database

    Kračmar, S.; Nečasová, Šárka; Penel, P.

    2006-01-01

    Roč. 5, č. 3 (2006), s. 243-251. ISSN 1109-2769 R&D Projects: GA AV ČR(CZ) IAA100190505 Institutional research plan: CEZ:AV0Z10190503 Keywords : rigid rotating body * weak solution * existence Subject RIV: BA - General Mathematics

  7. On the application of a priori error estimates for Navier-Stokes equations

    Czech Academy of Sciences Publication Activity Database

    Burda, P.; Novotný, Jaroslav; Šístek, J.

    Liberec : TU Liberec, 2006, s. 243-250. [International conference presentation of mathematics. Liberec (CZ), 21.09.2005-23.09.2005] Institutional research plan: CEZ:AV0Z20760514 Keywords : apriori error estimates * Navier-Stokes equations * finite element method Subject RIV: BA - General Mathematics

  8. Organic carbon in the sediments of Mandovi estuary, Goa

    Digital Repository Service at National Institute of Oceanography (India)

    Alagarsamy, R.

    Total organic carbon (TOC) in surficial sediments in Mandovi Estuary, Goa, India varies widely from 0.1 to 3% (av. 1.05%). Highest values of TOC (2.4-3%) lie close to the mouth region and indicate no definite trend in its variation in the estuarine...

  9. Gclust Server: 32665 [Gclust Server

    Lifescience Database Archive (English)

    Full Text Available 32665 DPTM_GSPATP00000511001 Cluster Sequences Related Sequences(16) 243 no annotat...ion 3 1.00e-70 0.0 11.11 0.0 0.0 0.0 0.0 Show 32665 Cluster ID 32665 Sequence ID DPTM_GSPATP00000511001 Link

  10. The Neutrons for Science Facility at SPIRAL-2

    Czech Academy of Sciences Publication Activity Database

    Ledoux, X.; Chatillon, A.; Taieb, J.; Mrázek, Jaromír; Novák, Jan; Bém, Pavel; Majerle, Mitja; Šimečková, Eva

    Melville: AMER INST PHYSICS, 2011, s. 55-62. ISBN 978-0-7354-0986-6. ISSN 0094-243X. [11th International Conference on Applications of Nuclear Techniques. Crete (GR), 12.06.2011-18.06.2011] Institutional research plan: CEZ:AV0Z10480505 Keywords : Neutron beam * time-of-flight * fission Subject RIV: BE - Theoretical Physics

  11. Intervening to Improve Communication between Parents, Teachers, and Primary Care Providers of Children with ADHD or at High Risk for ADHD

    Science.gov (United States)

    Wolraich, Mark L.; Bickman, Leonard; Lambert, E. Warren; Simmons, Tonya; Doffing, Melissa A.

    2005-01-01

    This study examines interventions designed to improve communication between individuals who take care of children with ADHD. A teacher rating of 6,171 elementary school children identifies 1,573 children with ADHD or with high risk for ADHD. Parent interviews and information from teachers are collected on 243 children who are randomized into…

  12. Novověká matematizace, Heidegger a Kant

    Czech Academy of Sciences Publication Activity Database

    Kuneš, Jan

    Červený Kostelec: Pavel Mervart, 2011 - (Kůrka, P.; Matoušek, A.), s. 211-243 ISBN 978-80-7465-012-3 Institutional support: RVO:67985955 Keywords : Heidegger * Kant * philosophy of science Subject RIV: AA - Philosophy ; Religion

  13. Production of medically valuable stilbenes and emodin in knotweed

    Czech Academy of Sciences Publication Activity Database

    Frantík, Tomáš; Kovářová, M.; Koblihová, Helena; Bartůňková, Kristýna; Nývltová, Z.; Vosátka, Miroslav

    2013-01-01

    Roč. 50, oct.2013 (2013), s. 237-243. ISSN 0926-6690 R&D Projects: GA MŠk 1M0571 Institutional support: RVO:67985939 Keywords : knokweed * resveratrol * emodin Subject RIV: EF - Botanics Impact factor: 3.208, year: 2013

  14. EVALUATION OF MASS DRUG ADMINISTRATION FOR ELIMINATION OF LYMPHATIC FILARIASIS IN GUNTUR DISTRICT, ANDHRA PRADESH

    OpenAIRE

    Purnamma; Neelima,

    2015-01-01

    BACKGROUND : Lymphatic Filariasis (LF) is a serious Socio Economic and Public Health problem in the world. In India, it is estimated that 554.2 million populations are at risk of Lymphatic Filariasis infection, in 243 implementation units (Districts). National Health Policy, 2002 aims at elimination of transmission and prevention of disability ...

  15. 11Li structural information from inclusive break-up measurements

    DEFF Research Database (Denmark)

    Fernandez-Garcia, J. P.; Cubero, M.; Acosta, L.; Alcorta, M.; Alvarez, M. A. G.; Borge, M. J. G.; Buchmann, L.; Diget, C. A.; Falou, H. A.; Fulton, B. R.; Fynbo, H. O. U.; Galaviz, D.; Gomez-Camacho, J.; Kanungo, R.; Lay, J. A.; Madurga, M.; Martel, I.; Moro, A. M.; Mukha, I.; Nilsson, T.; Rodriguez-Gallardo, M.; Sanchez-Benitez, A. M.; Shotter, A.; Tengblad, O.; Walden, P.

    2015-01-01

    Structure information of Li-11 halo nucleus has been obtained from the inclusive break-up measurements of the Li-11+Pb-208 reactions at energies around the Coulomb barrier (E-lab = 24.3 and 29.8 MeV). The effective break-up energy and the slope of B(E1) distribution close to the threshold have be...

  16. Drug: D01010 [KEGG MEDICUS

    Lifescience Database Archive (English)

    Full Text Available of drugs in Japan [BR:br08301] 2 Agents affecting individual organs 24 Hormones 243 Thyroid and parathyroid ... [KO:K08362] Levothyroxine sodium [ATC:H03AA01] D01010 Levothyroxine sodium (USP) Antineoplastics [BR:br08308] Hormones

  17. Cerebrospinal fluid vasopressin in neurological and psychiatric disorders.

    OpenAIRE

    Sørensen, P S; Gjerris, A; Hammer, M.

    1985-01-01

    Vasopressin was determined in CSF and plasma of 243 patients with different neurological and psychiatric disorders, including control patients. CSF vasopressin was significantly higher in patients with high pressure hydrocephalus, intracranial tumour, benign intracranial hypertension, intracranial haemorrhage, ischaemic stroke, and craniocerebral trauma. In patients with primary degenerative dementia, CSF vasopressin was lower than in control patients. Among patients with psychiatric disorder...

  18. A new technique for inventory of permanent plots in tropical forests: a case study from lowland dipterocarp forest in Kuala Belalong, Brunei Darussalam

    Czech Academy of Sciences Publication Activity Database

    Hédl, Radim; Svátek, M.; Dančák, M.; Rodzay, A. W.; Salleh, A. B.; Kamariah, A. S.

    2009-01-01

    Roč. 54, 1-3 (2009), s. 124-130. ISSN 0006-5196 Institutional research plan: CEZ:AV0Z60050516 Keywords : forest inventory * structure of tropical forest * diversity of tropical forest Subject RIV: EF - Botanics Impact factor: 0.243, year: 2009

  19. Gender, Information and Communication Networks: Implications for Extension.

    Science.gov (United States)

    Subedi, A.; Garforth, Chr.

    1996-01-01

    In Nepal a study of 243 female and 179 male farmers showed that males demonstrated horizontal communication patterns among themselves; females actively sought information in both horizontal and heterogeneous patterns. Extension strategies that take advantage of gender-based networks were suggested to increase the flow of information. (SK)

  20. Zwei Briefromane eines gewitzten böhmischen Frauenzimmers im Reprint: Maria Anna Sagers Beiträge zur frühen Frauenliteratur

    Czech Academy of Sciences Publication Activity Database

    Wögerbauer, Michael

    2015-01-01

    Roč. 39, č. 2 (2015), s. 240-243. ISBN 978-3-8353-16-97-3. ISSN 0722-740X Institutional support: RVO:68378068 Keywords : enlightenment * prose * Sager, Maria Anna * female writer * German literature * Czech literature Subject RIV: AJ - Letters, Mass-media, Audiovision

  1. 8 CFR 250.1 - Application.

    Science.gov (United States)

    2010-01-01

    ... 8 Aliens and Nationality 1 2010-01-01 2010-01-01 false Application. 250.1 Section 250.1 Aliens and Nationality DEPARTMENT OF HOMELAND SECURITY IMMIGRATION REGULATIONS REMOVAL OF ALIENS WHO HAVE FALLEN INTO DISTRESS § 250.1 Application. Application for removal shall be made on Form I-243. No appeal shall lie...

  2. Categorizing Moving Objects into Film Genres: The Effect of Animacy Attribution, Emotional Response, and the Deviation from Non-Fiction

    Science.gov (United States)

    Visch, Valentijn T.; Tan, Ed S.

    2009-01-01

    The reported study follows the footsteps of Heider, and Simmel (1944) [Heider, F., & Simmel, M. (1944). An experimental study of apparent behavior. "American Journal of Psychology," 57, 243-249] and Michotte (1946/1963) [Michotte, A. (1963). "The perception of causality" (T.R. Miles & E. Miles, Trans.). London: Methuen (Original work published…

  3. Life Quality of Russian Immigrants to Israel: Patterns of Success and of Unsuccess

    Science.gov (United States)

    Benish-Weisman, Maya; Shye, Samuel

    2011-01-01

    Two different perspectives on immigration outcomes are employed and interrelated: Overall assessments of the success in immigration and systemic quality of life assessments (using SQOL model, Shye in Soc Indic Res, 21:243-378, 1989). Data were collected from a sample of 337 immigrants to Israel from the former USSR. Results reveal that quality of…

  4. 40 CFR 98.242 - GHGs to report.

    Science.gov (United States)

    2010-07-01

    ... process unit. Process emissions include CO2 generated by reaction in the process and by combustion of process off-gas in stationary combustion units and flares. (1) If you comply with § 98.243(b) or (d... source and flare that burns any amount of petrochemical process off-gas. (2) If you comply with §...

  5. Removing the Historical Town of Most – Technocratic and Humanistic Thought in the Practice of State Socialism

    Czech Academy of Sciences Publication Activity Database

    Spurný, Matěj

    2014-01-01

    Roč. 2, č. 4 (2014), s. 235-243. ISSN 2328-2134 R&D Projects: GA ČR GPP410/12/P596 Institutional support: RVO:68378114 Keywords : environmental history * coal mining * Czech borderlands Subject RIV: AB - History

  6. Study of the B-10(p,alpha)Be-7 Reaction through the Indirect Trojan Horse Method

    Czech Academy of Sciences Publication Activity Database

    Puglia, S. M. R.; Spitaleri, C.; Lamia, L.; Romano, S.; Burjan, Václav; Carlin, N.; Chengbo, L.; Kroha, Václav; Hons, Zdeněk; Mrázek, Jaromír

    Vol. 1645. Melville: American Institute of Physics, 2015, s. 382-386. ISBN 978-0-7354-1284-2. ISSN 0094-243X. [Carpathian Summer School of Physics. Sinaia (RO), 13.07.2014-26.07.2014] Institutional support: RVO:61389005 Keywords : Trojan Horse Method * B-10 * reactions Subject RIV: BN - Astronomy, Celestial Mechanics, Astrophysics

  7. Electrochemical evidence of catalysis of oxygen reduction at the polarized liquid–liquid interface by tetraphenylporphyrin monoacid and diacid

    Czech Academy of Sciences Publication Activity Database

    Trojánek, Antonín; Langmaier, Jan; Su, B.; Girault, H. H.; Samec, Zdeněk

    2009-01-01

    Roč. 11, č. 10 (2009), s. 1940-1943. ISSN 1388-2481 R&D Projects: GA ČR(CZ) GA203/07/1257; GA MŠk OC 177 Institutional research plan: CEZ:AV0Z40400503 Keywords : liquid-liquid interface * oxygen reduction * decamethylferrocene * catalysis Subject RIV: CG - Electrochemistry Impact factor: 4.243, year: 2009

  8. Frequencies as Proportions: Using a Teaching Model Based on Pirie and Kieren's Model of Mathematical Understanding

    Science.gov (United States)

    Wright, Vince

    2014-01-01

    Pirie and Kieren (1989 "For the learning of mathematics", 9(3)7-11, 1992 "Journal of Mathematical Behavior", 11, 243-257, 1994a "Educational Studies in Mathematics", 26, 61-86, 1994b "For the Learning of Mathematics":, 14(1)39-43) created a model (P-K) that describes a dynamic and recursive process by which…

  9. Learning Environments as Basis for Cognitive Achievements of Students in Basic Science Classrooms in Nigeria

    Science.gov (United States)

    Atomatofa, Rachel; Okoye, Nnamdi; Igwebuike, Thomas

    2016-01-01

    The nature of classroom learning environments created by teachers had been considered very important for learning to take place effectively. This study investigated the effect of creating constructivist and transmissive learning environments on achievements of science students of different ability levels. 243 students formed the entire study…

  10. Combination of micropreparative solution isoelectric focusing and high-performance liquid chromatography for differentiation of biofilm-positive and biofilm-negative Candida parapsilosis group from vascular catheter

    Czech Academy of Sciences Publication Activity Database

    Vykydalová, Marie; Horká, Marie; Růžička, F.; Duša, Filip; Moravcová, Dana; Kahle, Vladislav; Šlais, Karel

    2014-01-01

    Roč. 812, Feb (2014), s. 243-249. ISSN 0003-2670 R&D Projects: GA MV VG20112015021 Institutional support: RVO:68081715 Keywords : Candida parapsilosis group * biofilm * sonicate from vascular cathether * sIEF * HPLC Subject RIV: CB - Analytical Chemistry, Separation Impact factor: 4.513, year: 2014 http://hdl.handle.net/11104/0230766

  11. Význam základních zásad řízení pro naplnění principů dobré správy zejména v daňovém řízení.

    Czech Academy of Sciences Publication Activity Database

    Bauer, David

    Brno : Masarykova univerzita, 2006, 243-245. ISBN 80-210-4001-7 R&D Projects: GA ČR GA407/06/1467 Institutional research plan: CEZ:AV0Z70680506 Keywords : tax rules * tax administrator * tax law Subject RIV: AG - Legal Sciences

  12. Gas hydrate contribution to Late Permian global warming

    Czech Academy of Sciences Publication Activity Database

    Majorowicz, J.; Grasby, S. E.; Šafanda, Jan; Beauchamp, B.

    2014-01-01

    Roč. 393, May (2014), s. 243-253. ISSN 0012-821X Institutional support: RVO:67985530 Keywords : Latest Permian extinction * gas hydrates * carbon isotope shift Subject RIV: DC - Siesmology, Volcanology, Earth Structure Impact factor: 4.734, year: 2014

  13. Konrad Wallerstein

    Czech Academy of Sciences Publication Activity Database

    Šimůnek, Michal V.

    Červený Kostelec : Pavel Mervart, 2013 - (Šimůnek, M.; Kostlán, A.), s. 241-243 ISBN 978-80-7465-041-3. - (Studies in the History of Sciences and Humanities. 29) Institutional support: RVO:68378114 Keywords : holocaust * intellectual elite * history of science Subject RIV: AB - History

  14. Catalytic behavior of metal-organic frameworks and zeolites: Rationalization and comparative analysis

    Czech Academy of Sciences Publication Activity Database

    Opanasenko, Maksym

    2015-01-01

    Roč. 243, APR 2015 (2015), s. 2-9. ISSN 0920-5861 R&D Projects: GA ČR GA14-07101S Institutional support: RVO:61388955 Keywords : Metal-organic frameworks * Zeolites * heterogeneous catalysis Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 3.893, year: 2014

  15. Toward understanding of the role of Lewis acidity in aldol condensation of acetone and furfural using MOF and zeolite catalysts

    Czech Academy of Sciences Publication Activity Database

    Kikhtyanin, O.; Kubička, D.; Čejka, Jiří

    2015-01-01

    Roč. 243, APR 2015 (2015), s. 158-162. ISSN 0920-5861 R&D Projects: GA ČR GBP106/12/G015 Institutional support: RVO:61388955 Keywords : metal organic framework * aldol condensation * acidic catalysis Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 3.893, year: 2014

  16. Adsorption of pentane isomers on metal-organic frameworks Cu-BTC and Fe-BTC

    Czech Academy of Sciences Publication Activity Database

    Zukal, Arnošt; Opanasenko, Maksym; Rubeš, M.; Nachtigall, P.; Jagiello, J.

    2015-01-01

    Roč. 243, APR 2014 (2015), s. 69-75. ISSN 0920-5861 R&D Projects: GA ČR GA14-07101S Institutional support: RVO:61388955 Keywords : Cu-BTC * Fe-BTC * adsorption Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 3.893, year: 2014

  17. An Examination of Multiple Intelligence Domains and Learning Styles of Pre-Service Mathematics Teachers: Their Reflections on Mathematics Education

    Science.gov (United States)

    Ozgen, Kemal; Tataroglu, Berna; Alkan, Huseyin

    2011-01-01

    The present study aims to identify pre-service mathematics teachers' multiple intelligence domains and learning style profiles, and to establish relationships between them. Employing the survey model, the study was conducted with the participation of 243 pre-service mathematics teachers. The study used the "multiple intelligence domains inventory…

  18. 25 CFR 170.450 - What archeological and environmental requirements must the IRR Program meet?

    Science.gov (United States)

    2010-04-01

    ...-governance agreements for the IRR Program are in 25 CFR 900.125 and 1000.243. ... 25 Indians 1 2010-04-01 2010-04-01 false What archeological and environmental requirements must... Reservation Roads Program Facilities Environmental and Archeological Requirements § 170.450 What...

  19. 75 FR 31803 - Notice of Issuance of Final Determination Concerning a Lift Unit for an Overhead Patient Lift System

    Science.gov (United States)

    2010-06-04

    .... The unit is manufactured in 3 basic models: (1) 242, which has a lifting capacity up to 440 pounds; (2) 243, which has a lifting capacity up to 507 pounds; and (3) 250, which has a lifting capacity up to... lift system. The system is capable of lifting and transporting patients with limited mobility,...

  20. 76 FR 79560 - Airworthiness Directives; Airbus Airplanes

    Science.gov (United States)

    2011-12-22

    ... ``significant rule'' under the DOT Regulatory Policies and Procedures (44 FR 11034, February 26, 1979); and 3... Federal Aviation Administration 14 CFR Part 39 RIN 2120-AA64 Airworthiness Directives; Airbus Airplanes... airplanes; Model A330-223F and -243F airplanes; and Model A340-200, -300, -500, and -600 series...

  1. AcEST: BP917085 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000095_F11 176 Adiantum capillus-veneris mRNA. clone: YMU001_000095_F11. BP917085 - Show ... Leptospira biflexa serovar Patoc (strain Patoc 1 / Ames ) GN=ubiE PE=4 SV=1 Length = 243 Score = 33.1 bits ...

  2. 10 CFR 30.72 - Schedule C-Quantities of radioactive materials requiring consideration of the need for an...

    Science.gov (United States)

    2010-01-01

    ... consideration of the need for an emergency plan for responding to a release. 30.72 Section 30.72 Energy NUCLEAR... emergency plan for responding to a release. Radioactive material 1 Release fraction Quantity (curies... .01 200,000 Curium-242 .001 60 Curium-243 .001 3 Curium-244 .001 4 Curium-245 .001 2 Europium-152...

  3. EST Table: FY018575 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available FY018575 rbmov22l19 11/11/04 59 %/243 aa ref|XP_002432437.1| tyrosyl-tRNA synthetase, cytoplasmi ... 50 %/185 aa F58B3.5c#CE44546#WBGene00003415#locus:mars - 1#status:Confirmed#UniProt:D3YT56#protein_id:CBK1 ...

  4. 77 FR 76604 - Submission for OMB Review; Comment Request

    Science.gov (United States)

    2012-12-28

    ... following information collection request to the Office of Management and Budget (OMB) for review and...: Business or other for-profits. Estimated Total Burden Hours: 243,675. OMB Number: 1545-1069. Type of Review... Review: Extension without change. Title: Estimated Tax on Unrelated Business Taxable Income for...

  5. EST Table: NM_001043609 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available NM_001043609 hJHBP 10/09/29 93 %/243 aa ref|NP_001037074.2| hemolymph ... juvenile hormone binding p ... rotein [Bombyx mori] gb|AAF19268.1|AF098305_1 hemolymph ... juvenile hormone binding protein precursor [Bombyx ...

  6. Early Indications of Resilience and Their Relation to Experiences in the Home Environments of Low Birthweight, Premature Children Living in Poverty.

    Science.gov (United States)

    Bradley, Robert H.; And Others

    1994-01-01

    Examined caregiving environments for 243 premature, low birthweight infants living in poverty to determine effects on health and development. Found that children's health and development benefited significantly from six protective caregiving factors: (1) increased parental responsiveness; (2) availability of toys and learning materials; (3)…

  7. Modeling Irregularities in Solar Flux Ropes

    Czech Academy of Sciences Publication Activity Database

    Romashets, E.; Vandas, Marek

    2013-01-01

    Roč. 284, č. 1 (2013), s. 235-243. ISSN 0038-0938 R&D Projects: GA MŠk ME09032; GA ČR GA205/09/0170 Institutional support: RVO:67985815 Keywords : Sun * magnetic field * flares Subject RIV: BN - Astronomy, Celestial Mechanics, Astrophysics Impact factor: 3.805, year: 2013

  8. Presence of the KPC carbapenemase gene in Enterobacteriaceae causing bacteremia, and the correlation with in vitro carbapenem susceptibility

    Science.gov (United States)

    During six months, we obtained Enterobacteriaceae isolates from patients with Gram-negative bacteremia at a 1250-bed teaching hospital in St. Louis, Missouri, and compared carbapenem susceptibility with the presence of blaKPC, a transferable carbapenemase gene. Three (1.2%) out of 243 isolates were ...

  9. Bioavailability of Praziquantel Increases with Concomitant Administration of Food

    OpenAIRE

    Castro, Nelly; Medina, Roberto; Sotelo, Julio; Jung, Helgi

    2000-01-01

    In the present study we found that after a single oral dose of 1,800 mg of praziquantel, following a high-lipid diet and a high-carbohydrate diet, the maximum levels in plasma increased 243 and 515% and the area under the plasma concentration curve from 0 to 8 h increased 180 and 271%, respectively.

  10. Factors of human resource planning in metallurgical company

    OpenAIRE

    A. Samolejová; P. Wicher; M. Lampa; R. Lenort; J. Kutáč; A. Sikorová

    2015-01-01

    The objective of this article is to define the factors that have the most profound impact on the outputs of human resource (HR) plans and on the business plans they should be based on. The solution involved the Delphi and the Analytic Network Process (ANP) method and close cooperation with HR specialists from the Czech metallurgical branch. Web of Science 54 1 246 243

  11. Elemental mapping in fossil tooth root section of Ursus arctos by laser ablation inductively coupled plasma mass spectrometry (LA-ICP-MS)

    Czech Academy of Sciences Publication Activity Database

    Vašinová Galiová, M.; Nývltová Fišáková, Miriam; Kynický, J.; Prokeš, L.; Neff, H.; Mason, A. Z.; Gadas, P.; Košler, J.; Kanický, V.

    2013-01-01

    Roč. 105, 15 February 2013 (2013), s. 235-243. ISSN 0039-9140 Institutional research plan: CEZ:AV0Z80010507 Institutional support: RVO:68081758 Keywords : Diagenesis * Diet * Geochemical analysis * Laser ablation ICP-MS * Migration Subject RIV: AC - Archeology, Anthropology, Ethnology Impact factor: 3.511, year: 2013

  12. Naturally irradiated fluorite as a historic violet pigment: Raman spectroscopic and X-ray diffraction study

    Czech Academy of Sciences Publication Activity Database

    Čermáková, Zdeňka; Bezdička, Petr; Němec, I.; Hradilová, J.; Šrein, V.; Blažek, Jan; Hradil, David

    2015-01-01

    Roč. 46, č. 2 (2015), s. 236-243. ISSN 0377-0486 R&D Projects: GA ČR GAP103/12/2211 Institutional support: RVO:61388980 ; RVO:67985556 Keywords : fluorite * pigment * fluorescence bands * diffraction lines broadening * irradiation Subject RIV: CA - Inorganic Chemistry; JD - Computer Applications, Robotics (UTIA-B) Impact factor: 2.671, year: 2014

  13. 39 CFR 241.4 - Expansion, relocation, and construction of post offices.

    Science.gov (United States)

    2010-07-01

    ... only in accordance with 39 U.S.C. 404(b) and 39 CFR 243.1. In the event a facility action is subject to... ESTABLISHMENT CLASSIFICATION, AND DISCONTINUANCE § 241.4 Expansion, relocation, and construction of post offices.... Emergency situations include, but are not limited to, earthquakes, floods, fire, lease terminations,...

  14. 40 CFR 246.201-7 - Recommended procedures: Cost analysis.

    Science.gov (United States)

    2010-07-01

    ...) SOLID WASTES SOURCE SEPARATION FOR MATERIALS RECOVERY GUIDELINES Requirements and Recommended Procedures... Residential, Commercial and Institutional Solid Wastes (40 CFR part 243) and Thermal Processing and Land... residual solid waste have been established, an analysis should be conducted which compares the costs of...

  15. 40 CFR 246.202-6 - Recommended procedures: Cost analysis.

    Science.gov (United States)

    2010-07-01

    ...) SOLID WASTES SOURCE SEPARATION FOR MATERIALS RECOVERY GUIDELINES Requirements and Recommended Procedures... Residential, Commercial and Institutional Solid Wastes (40 CFR part 243) and Thermal Processing and Land... residual solid waste have been established, an analysis should be conducted which compares the costs of...

  16. 40 CFR 246.200-8 - Recommended procedures: Cost analysis.

    Science.gov (United States)

    2010-07-01

    ...) SOLID WASTES SOURCE SEPARATION FOR MATERIALS RECOVERY GUIDELINES Requirements and Recommended Procedures... Collection of Residential, Commercial and Institutional Solid Wastes (40 CFR part 243) and Thermal Processing... paper and residual solid waste have been established, an analysis should be conducted which compares...

  17. Pseudospectra in non-Hermitian quantum mechanics

    Czech Academy of Sciences Publication Activity Database

    Krejčiřík, David; Siegl, Petr; Tater, Miloš; Viola, J.

    2015-01-01

    Roč. 56, č. 10 (2015), s. 103513. ISSN 0022-2488 R&D Projects: GA ČR(CZ) GA14-06818S; GA MŠk 7AMB12FR020 Institutional support: RVO:61389005 Keywords : quadratic differential operators * magnetic field Subject RIV: BE - Theoretical Physics Impact factor: 1.243, year: 2014

  18. On the rank 1 convexity of stored energy functions of physically linear stress-strain relations

    Czech Academy of Sciences Publication Activity Database

    Šilhavý, Miroslav; Bertram, A.; Böhlke, T.

    2007-01-01

    Roč. 86, č. 3 (2007), s. 235-243. ISSN 0374-3535 Institutional research plan: CEZ:AV0Z10190503 Keywords : generalized linear elastic law s * generalized strain measures * rank 1 convexity Subject RIV: BA - General Mathematics Impact factor: 0.743, year: 2007

  19. Locality and nonlocality of classical restrictions of quantum spin systems with applications to quantum large deviations and entanglement

    Czech Academy of Sciences Publication Activity Database

    De Roeck, W.; Maes, C.; Netočný, Karel; Schütz, M.

    2015-01-01

    Roč. 56, č. 2 (2015), "023301-1"-"023301-30". ISSN 0022-2488 Institutional support: RVO:68378271 Keywords : quantum systems * quantum large deviations * entanglement * cluster expansions Subject RIV: BE - Theoretical Physics Impact factor: 1.243, year: 2014

  20. 77 FR 34961 - Agency Information Collection Activities: Submission for OMB Review; Comment Request

    Science.gov (United States)

    2012-06-12

    ............ 1081 3 1.00 3,243 649 Child and Family Outcome Study Caregiver Information Questionnaire, Caregiver 6... Questionnaire (CGSQ)..... Caregiver 6,561 5 0.17 5,478 1,096 Child Behavior Checklist 1\\1/2\\-5 (CBCL Caregiver 6... Questionnaire Caregiver 202 5 0.08 81 16 (ESCQ). Comparison and Sector Study: Child Welfare Electronic...

  1. INFLUENCE OF RUMINAL AND POSTRUMINAL CARBOHYDRATE INFUSION ON VISCERAL ORGAN MASS AND ADIPOSE TISSUE ACCRETION IN GROWING BEEF STEERS.

    Science.gov (United States)

    Forty beef steers (243 ± 2 kg BW) with ruminal and abomasal infusion catheters were used to determine the effects of site of carbohydrate (CHO) digestion on visceral organ mass and adipose accretion. Treatments included a pelleted basal diet fed at 0.162 (LE) or 0.215 Mcal ME/kg BW.75/d, LE plus ru...

  2. Longitudinal Test of Self-Determination Theory's Motivation Mediation Model in a Naturally Occurring Classroom Context

    Science.gov (United States)

    Jang, Hyungshim; Kim, Eun Joo; Reeve, Johnmarshall

    2012-01-01

    This study provides the first longitudinally designed, classroom-based empirical test of self-determination theory's motivation mediation model. Measures of perceived autonomy support, motivation (autonomy need satisfaction), engagement, and achievement were collected from 500 (257 females, 243 males) 8th-grade students in Korea in a 3-wave…

  3. Raman spectroelectrochemistry of index-identified metallic carbon nanotubes: the resonance rule revisited

    Czech Academy of Sciences Publication Activity Database

    Kavan, Ladislav; Kalbáč, Martin; Zukalová, Markéta; Dunsch, L.

    2006-01-01

    Roč. 243, č. 13 (2006), s. 3130-3133. ISSN 0370-1972 R&D Projects: GA MŠk LC510; GA AV ČR IAA4040306 Institutional research plan: CEZ:AV0Z40400503 Keywords : electrochemistry * Raman spectroelectrochemistry * radial breathing mode Subject RIV: CG - Electrochemistry Impact factor: 0.967, year: 2006

  4. Polarization signatures of strong gravity by reflection from accretion discs

    Czech Academy of Sciences Publication Activity Database

    Dovčiak, Michal; Goosmann, René; Karas, Vladimír; Matt, G.; Muleri, F.; Svoboda, Jiří

    Melville: American Institute of Physics, 2010 - (Zatloukal, M.), s. 419-420. (AIP Conference Proceedings. 1248). ISBN 978-0-7354-0795-4. ISSN 0094-243X. [X-ray astronomy 2009. Bologna (IT), 07.09.2009-11.09.2009] Institutional research plan: CEZ:AV0Z10030501 Keywords : black hole * accretion disc * polarization Subject RIV: BN - Astronomy, Celestial Mechanics, Astrophysics

  5. AcEST: DK954660 [AcEST

    Lifescience Database Archive (English)

    Full Text Available TST39A01NGRL0021_A13 626 Adiantum capillus-veneris mRNA. clone: TST39A01NGRL0021_A13. 5' end seq ... %) Frame = +3 Query: 243 PPPPNGKIVK-LRQRL-----ASEGIDAY IIPSEDPHQSEYSADCFMRRAYISEFTGSAG 404 PP ++++ LRQ + + ... Positives = 75/111 (67%) Frame = +3 Query: 291 SEGIDAY IIPSEDPHQSEYSADCFMRRAYISEFTGSAGTAVITKDSAALWTDGRYFLQ ...

  6. Biodegradace 17a-ethinylestradiolu pomocí ligninolytických hub - efekt polutantu na produkci enzymových aktivit hub

    Czech Academy of Sciences Publication Activity Database

    Svobodová, Kateřina; Křesinová, Zdena; Covino, S.; Cajthaml, Tomáš

    Chrudim : Vodní zdroje Ekomonitor spol. s.r.o, 2010. s. 243-245. ISBN 978-80-86832-51-7 R&D Projects: GA ČR GAP503/10/0408 Institutional research plan: CEZ:AV0Z50200510 Keywords : biodegradation Subject RIV: EE - Microbiology, Virology

  7. Science Teachers' and Senior Secondary Schools Students' Perceptions of Earth and Environmental Science Topics

    Science.gov (United States)

    Dawson, Vaille; Carson, Katherine

    2013-01-01

    This article presents an evaluation of a new upper secondary Earth and Environmental Science (EES) course in Western Australia. Twenty-seven EES teachers were interviewed and 243 students were surveyed about the degree of difficulty, relevance and interest of EES topics in the course. The impact of the course on students' views about EES…

  8. Dicty_cDB: AFA807 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available enopus laevis enolase 3, beta mus... 243 2e-63 DQ497988_1( DQ497988 |pid:none) Polypterus senegalus enolase ...( DQ497985 |pid:none) Polypterus senegalus enolase A mRN... 241 9e-63 (Q9W7L0) RecName: Full=Alpha-enolase;

  9. ARL Supplementary Statistics, 2006-2007

    Science.gov (United States)

    Bland, Les, Comp.; Kyrillidou, Martha, Comp.

    2009-01-01

    This report presents statistics on how Association of Research Libraries (ARL) member libraries spend money on electronic resources. This report indicates that 108 ARL libraries purchased 25,006,758 electronic books. In 2006-2007, there was an ARL median of 243,725 acquisitions of electronic books (this includes one institution that purchased…

  10. Odlučitelná předpona preč a prefix wot- ve starší hornolužické srbštině a jejich role při gramatikalizaci slovesného vidu

    Czech Academy of Sciences Publication Activity Database

    Brankatschk, Katja

    Hradec Králové : Gaudeamus, 2012, s. 1-11. ISBN 978-80-7435-243-0. [Gramatika a korpus 2012. Praha (CZ), 28.11.2012-30.11.2012] R&D Projects: GA ČR(CZ) GPP406/11/P424 Institutional support: RVO:68378017 Keywords : verbal prefix * verbal aspect * Upper Sorbian * language contact Subject RIV: AI - Linguistics

  11. An Exploratory Study of the Relationship between Collaboration and Mathematics and Game Outcomes. CRESST Report 797

    Science.gov (United States)

    Buschang, Rebecca E.; Chung, Gregory K. W. K.; Kim, Jinok

    2011-01-01

    This study is an exploratory study of the relationship between collaboration and mathematics and game outcomes in a video game aimed at teaching concepts related to rational numbers. The sample included 243 middle school students who played the video game either with one partner or individually for 40 minutes. Results suggest that participants…

  12. EST Table: FS905240 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available FS905240 E_FL_fufe_04G24_F_0 10/09/28 99 %/260 aa ref|NP_001138804.1| lipid storage droplet 2-li ... LIN [Bombyx mori] 10/09/12 38 %/243 aa FBpp0110268|Lsd -2-PB 10/08/29 n.h 10/09/10 39 %/261 aa AGAP000167- ...

  13. How a Sphagnum fuscum-dominated bog changed into a calcareous fen: the unique Holocene history of a Slovak spring-fed mire

    Czech Academy of Sciences Publication Activity Database

    Hájková, Petra; Grootjans, A.B.; Lamentowicz, M.; Rybníčková, E.; Madaras, M.; Opravilová, V.; Michaelis, D.; Hájek, Michal; Joosten, H.; Wolejko, L.

    2012-01-01

    Roč. 27, č. 3 (2012), s. 233-243. ISSN 0267-8179 Institutional research plan: CEZ:AV0Z60050516 Institutional support: RVO:67985939 Keywords : Holocene * succession * mire Subject RIV: EF - Botanics Impact factor: 2.939, year: 2012

  14. Search for WZ resonances in the fully leptonic channel using pp collisions at √s = 8 TeV with the ATLAS detector

    Czech Academy of Sciences Publication Activity Database

    Aad, G.; Abbott, B.; Abdallah, J.; Böhm, Jan; Chudoba, Jiří; Havránek, Miroslav; Hejbal, Jiří; Jakoubek, Tomáš; Kepka, Oldřich; Kupčo, Alexander; Kůs, Vlastimil; Lokajíček, Miloš; Lysák, Roman; Marčišovský, Michal; Mikeštíková, Marcela; Myška, Miroslav; Němeček, Stanislav; Šícho, Petr; Staroba, Pavel; Svatoš, Michal; Taševský, Marek; Vrba, Václav

    2014-01-01

    Roč. 737, Oct (2014), s. 223-243. ISSN 0370-2693 R&D Projects: GA MŠk(CZ) LG13009 Institutional support: RVO:68378271 Keywords : scattering * W' * model * ATLAS * CERN LHC Coll * triplet Subject RIV: BF - Elementary Particles and High Energy Physics Impact factor: 6.131, year: 2014

  15. Investigating the phenology of seaward migration of juvenile brown trout (Salmo trutta) in two European populations

    DEFF Research Database (Denmark)

    Winter, E R.; Tummers, J. S.; Aarestrup, Kim;

    2016-01-01

    , evidence that spring migrants were of better condition, travelled faster (autumn: 11.0 km day-1; spring: 24.3 km day-1) and were more likely to leave the Deerness suggests that autumn and spring migrant conspecifics respond to different behavioural motivations. Further investigation into the sex of autumn...

  16. Self-consistent simulation of plasma scenarios for ITER using a combination of 1.5D transport codes and free-boundary equilibrium codes

    Czech Academy of Sciences Publication Activity Database

    Parail, V.; Albanese, R.; Ambrosino, R.; Artaud, J.F.; Besseghir, K.; Cavinato, M.; Corrigan, G.; Garcia, J.; Garzotti, L.; Gribov, Y.; Imbeaux, F.; Koechl, F.; Labate, C.V.; Lister, J.; Litaudon, X.; Loarte, A.; Maget, P.; Mattei, M.; McDonald, D.; Nardon, E.; Saibene, G.; Sartori, R.; Urban, Jakub

    2013-01-01

    Roč. 53, č. 11 (2013), s. 113002-113002. ISSN 0029-5515 Institutional support: RVO:61389021 Keywords : operation * regimes * model * JET * ITER * plasma Subject RIV: BL - Plasma and Gas Discharge Physics Impact factor: 3.243, year: 2013 http://iopscience.iop.org/0029-5515/53/11/113002/

  17. Socio-economic demands, ecological conditions and the power of tradition: past woodland management decisions in a Central European landscape

    Czech Academy of Sciences Publication Activity Database

    Szabó, Péter; Hédl, Radim

    2013-01-01

    Roč. 38, č. 2 (2013), s. 243-261. ISSN 0142-6397 R&D Projects: GA AV ČR IAA600050812 Institutional support: RVO:67985939 Keywords : forest * management * decisionmaking Subject RIV: EF - Botanics Impact factor: 0.943, year: 2013

  18. Epoxidation of bulky organic molecules over pillared titanosilicates

    Czech Academy of Sciences Publication Activity Database

    Přech, Jan; Eliášová, Pavla; Aldhayan, D.; Kubů, Martin

    2015-01-01

    Roč. 243, APR 2014 (2015), s. 134-140. ISSN 0920-5861 R&D Projects: GA ČR GBP106/12/G015 Institutional support: RVO:61388955 Keywords : Cyclooctene * Epoxidation * Layered TS-1 zeolite Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 3.893, year: 2014

  19. Desilication of SSZ-33 zeolite – Post-synthesis modification of textural and acidic properties

    Czech Academy of Sciences Publication Activity Database

    Kubů, Martin; Opanasenko, Maksym; Vitvarová, Dana

    2015-01-01

    Roč. 243, APR 2015 (2015), s. 46-52. ISSN 0920-5861 R&D Projects: GA ČR GP13-17593P Institutional support: RVO:61388955 Keywords : SSZ-33 zeolite * desilication * hierarchical materials Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 3.893, year: 2014

  20. Effects of Benzalkonium Chloride, Proxel LV, P3 Hypochloran, Triton X-100 and DOWFAX 63N10 on anaerobic digestion processes

    DEFF Research Database (Denmark)

    Flores, German Antonio Enriquez; Fotidis, Ioannis; Karakashev, Dimitar Borisov;

    2015-01-01

    continuous (up-flow anaerobic sludge blanket, UASB) reactors with biochemical-industrial wastewater, as substrate. In batch experiments, half-maximal inhibitory concentrations (IC50) for the tested xenobiotics were found to be 13.1, 1003, 311.5 and 24.3 mg L1 for BKC, PRX, DWF and TRX, respectively while HPC...