WorldWideScience

Sample records for berkelium 237

  1. Chemistry of berkelium: a review

    International Nuclear Information System (INIS)

    Hobart, D.E.; Peterson, J.R.

    1985-01-01

    Element 97 was first produced in December 1949, by the bombardment of americium-241 with accelerated alpha particles. This new element was named berkelium (Bk) after Berkeley, California, the city of its discovery [Thompson, Ghiorso, and Seaborg, Phys. Rev. 77, 838 (1950); 80, 781 (1950)]. In the 36 years since the discovery of Bk, a substantial amount of knowledge concerning the physicochemical properties of this relatively scarce transplutonium element has been acquired. All of the Bk isotopes of mass numbers 240 and 242 through 251 are presently known, but only berkelium-249 (β - decay, 0.125 MeV, t/sub 1/2/ = 325 days) is available in sufficient quantities for bulk chemical studies. About 0.7 gram of this isotope has been isolated at the HFIR/TRU Complex in Oak Ridge, Tennessee in the last 18 years. Over the same time period, the scale of experimental work using berkelium-249 has increased from the tracer level to bulk studies at the microgram level to solution and solid state investigations with milligram quantities. Extended knowledge of the physicochemical behavior of berkelium is important in its own right, because Bk is the first member of the second half of the actinide series. In addition, such information should enable more accurate extrapolations to the predicted behavior of heavier elements for which experimental studies are severely limited by lack of material and/or by intense radioactivity

  2. Citric complexes of trivalent cerium and berkelium

    International Nuclear Information System (INIS)

    Boulhassa, S.

    1977-01-01

    The extraction by thenoyltrifluoroacetone (TTA) in benzene of trivalent cerium, berkelium and californium, at the indicator scale, hydrolysis and complexation by citric acid of these cations are studied. The radionuclides used were 144 Ce, 249 Bk and 249 Cf respectively γ, β and α emitters. The solvent extraction technique of the elements by TTA in benzene from a perchloric medium at the ionic stength 0.1 was employed. The distribution coefficients D were measured by the γ, β or α radiometry. Cerium and berkelium, which have a comparable redox behavior, show in solution a relatively stable valency IV. Therefore the study by solvent extraction of their trivalent form required the standing up of complete reducing conditions of these elements and their stabilization in solution at the valency III. The thermodynamic data obtained for berkelium and californium contribute to understand the chemistry of these elements and permit to complete the third 'tetrad branch' of 5f elements from Cm 3+ to Es 3+ . This tetrad effect is a manifestation of thermodynamic consequence of the 'nephelauxetic effect'. As for Ce(III), the data confirm the pronounced acid property and may be show no neglected ligand effect for f 1 configuration [fr

  3. Berkelium (4) and cerium (4) extraction with tertiary amines

    International Nuclear Information System (INIS)

    Milyukova, M.S.; Malikov, D.A.; Myasoedov, B.V.

    1978-01-01

    Oxidation of indicator quantities of berkelium and cerium by a mixture of silver nitrate and ammonium persulfate in the solutions of nitric and sulfuric acid has been examined. The stability of the elements in a tetravalent state and their extraction by the solutions of ternary amines have been investigated. It has been established that berkelium and cerium oxidation under these conditions occurs under the effect of ions of divalent silver which is formed owing to oxidation of monovalent silver by peroxide sulfate ions. The following supposition has been put forward: a difference in the behaviour of tetravalent berkelium and cerium during their extraction by ternary amines is explained by their different stability in this state, but not by the formation of complex compounds with nitrate ions

  4. Chelation and stabilization of berkelium in oxidation state +IV

    Science.gov (United States)

    Deblonde, Gauthier J.-P.; Sturzbecher-Hoehne, Manuel; Rupert, Peter B.; An, Dahlia D.; Illy, Marie-Claire; Ralston, Corie Y.; Brabec, Jiri; de Jong, Wibe A.; Strong, Roland K.; Abergel, Rebecca J.

    2017-09-01

    Berkelium (Bk) has been predicted to be the only transplutonium element able to exhibit both +III and +IV oxidation states in solution, but evidence of a stable oxidized Bk chelate has so far remained elusive. Here we describe the stabilization of the heaviest 4+ ion of the periodic table, under mild aqueous conditions, using a siderophore derivative. The resulting Bk(IV) complex exhibits luminescence via sensitization through an intramolecular antenna effect. This neutral Bk(IV) coordination compound is not sequestered by the protein siderocalin—a mammalian metal transporter—in contrast to the negatively charged species obtained with neighbouring trivalent actinides americium, curium and californium (Cf). The corresponding Cf(III)-ligand-protein ternary adduct was characterized by X-ray diffraction analysis. Combined with theoretical predictions, these data add significant insight to the field of transplutonium chemistry, and may lead to innovative Bk separation and purification processes.

  5. Possible stabilization of the tetravalent oxidation state of berkelium and californium in acetonitrile with triphenylarsine oxide

    International Nuclear Information System (INIS)

    Payne, G.F.; Peterson, J.R.

    1987-01-01

    It appears that we may have prepared Bk(IV) nitrate.nTPAs0 and Bk(IV) perchlorate.nTPAs0 complexes which formed the corresponding Cf(IV) complexes through the beta decay of Bk-249. Definitive proof should come from similar experiments with quantities of Bk-249 large enough to allow spectrophotometric detection of the characteristic f→f transitions in these berkelium and californium species. It is clear, however, that TPAs0 and acetonitrile can play a pivotal role in the stabilization of lanact(IV) species

  6. Peaceful berkelium

    Science.gov (United States)

    Trabesinger, Andreas

    2017-09-01

    The first new element produced after the Second World War has led a rather peaceful life since entering the period table -- until it became the target of those producing superheavy elements, as Andreas Trabesinger describes.

  7. 49 CFR 237.131 - Design.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 4 2010-10-01 2010-10-01 false Design. 237.131 Section 237.131 Transportation... TRANSPORTATION BRIDGE SAFETY STANDARDS Repair and Modification of Bridges § 237.131 Design. Each repair or... component of a bridge shall be designed by a railroad bridge engineer. The design shall specify the manner...

  8. 49 CFR 238.237 - Automated monitoring.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 4 2010-10-01 2010-10-01 false Automated monitoring. 238.237 Section 238.237 Transportation Other Regulations Relating to Transportation (Continued) FEDERAL RAILROAD ADMINISTRATION... Equipment § 238.237 Automated monitoring. (a) Except as further specified in this paragraph, on or after...

  9. 47 CFR 24.237 - Interference protection.

    Science.gov (United States)

    2010-10-01

    ... 47 Telecommunication 2 2010-10-01 2010-10-01 false Interference protection. 24.237 Section 24.237... SERVICES Broadband PCS § 24.237 Interference protection. (a) All licensees are required to coordinate their... protection criterion shall be such that the interfering signal will not produce more than 1.0 dB degradation...

  10. 48 CFR 237.7100 - Scope.

    Science.gov (United States)

    2010-10-01

    ... DEFENSE SPECIAL CATEGORIES OF CONTRACTING SERVICE CONTRACTING Laundry and Dry Cleaning Services 237.7100 Scope. This subpart— (a) Applies to contracts for laundry and dry cleaning services within the United...

  11. 48 CFR 237.7502 - Policy.

    Science.gov (United States)

    2010-10-01

    ... DEFENSE SPECIAL CATEGORIES OF CONTRACTING SERVICE CONTRACTING Acquisition and Management of Industrial Resources 237.7502 Policy. (a) Comply with DoD Directive 4275.5, Acquisition and Management of Industrial...

  12. Criticality of a 237Np sphere

    International Nuclear Information System (INIS)

    Sanchez, Rene G.; Loaiza, David J.; Kimpland, Robert H.; Hayes, David K.; Cappiello, Charlene C.; Myers, William L.; Jaegers, Peter J.; Clement, Steven D.; Butterfield, Kenneth B.

    2003-01-01

    A critical mass experiment using a 6-kg 237 Np sphere has been performed. The purpose of the experiment is to get a better estimate of the critical mass of 237 Np. To attain criticality, the 237 Np sphere was surrounded with 93 wt% 235 U shells. A 1/M as a function of uranium mass was performed. An MCNP neutron transport code was used to model the experiment. The MCNP code yielded a k eff of 0.99089 ± 0.0003 compared with a k eff 1.0026 for the experiment. Based on these results, it is estimated that the critical mass of 237 Np ranges from kilogram weights in the high fifties to low sixties. (author)

  13. Chemical aspects of 237 Np Moessbauer spectroscopy

    International Nuclear Information System (INIS)

    Karraker, D.G.

    1984-01-01

    The 237 Np Moessbauer effect has been especially useful in studies of neptunium chemistry, by virtue of its excellent resolution and straightforward experimental techniques. Neptunium can have valences from +3 to +7, and a broad range of compounds can be prepared that are analogous to those of other actinide elements. Studies on neptunium compounds, for example, have a ready application to the analogous compounds of uranium and plutonium. The emphasis in this paper will be on the application of the 237 Np Moessbauer effect to problems in neptunium chemistry

  14. 49 CFR 237.9 - Waivers.

    Science.gov (United States)

    2010-10-01

    ... TRANSPORTATION BRIDGE SAFETY STANDARDS General § 237.9 Waivers. (a) Any person subject to a requirement of this... compliance is in the public interest and is consistent with railroad safety, the Administrator may grant the... Administrator publishes a notice in the Federal Register containing the reasons for granting the waiver. ...

  15. 32 CFR 237a.4 - Procedures.

    Science.gov (United States)

    2010-07-01

    ...); (c) Industrial programs which are in support of Government policy (example—international exhibits..., authorized by part 237 of this subchapter to apprise defense contractors, trade associations and other... governing research, development and production, and the procurement of goods and services, and serve as a...

  16. 7 CFR 205.237 - Livestock feed.

    Science.gov (United States)

    2010-01-01

    ..., Inspections, Marketing Practices), DEPARTMENT OF AGRICULTURE (CONTINUED) ORGANIC FOODS PRODUCTION ACT PROVISIONS NATIONAL ORGANIC PROGRAM Organic Production and Handling Requirements § 205.237 Livestock feed. (a... specific stage of life; (3) Feed plastic pellets for roughage; (4) Feed formulas containing urea or manure...

  17. Criticality of a 237Np sphere

    International Nuclear Information System (INIS)

    Sanchez, Rene; Loaiza, David; Kimpland, Robert; Hayes, David; Cappiello, Charlene; Chadwick, Mark

    2006-01-01

    For the past five years, scientists at Los Alamos National Laboratory have mounted an unprecedented effort to get a better estimate of the critical mass of 237 Np. To accomplish this task, a 6-kg neptunium sphere was recently cast at the Chemical and Metallurgy Research (CMR) facility, which is part of the Los Alamos National Laboratory. The neptunium sphere was clad with tungsten and nickel to reduce the dose rates from the 310 keV gamma rays from the first daughter of neptunium, namely, 233 Pa. 237 Np is a byproduct of power production in nuclear reactors. It is primarily produced by successive neutron captures in 235 U or through the (n,2n) reaction in 238 U. These nuclear reactions lead to the production of 237 U, which decays by beta emission into 237 Np, namely, 235 U(n,γ) 236 U, 236 U(n,γ) 237 U→β→ 237 Np, 238 U (n,2n) 237 U→β→ 237 Np. It is estimated that a typical 1000 MW(e) produces on the order of 12 to 13 kg of neptunium in a year. Some of this neptunium in irradiated fuel elements has been separated and is presently stored in containers in a liquid form. This method of storage is quite adequate because the fission cross section for 237 Np at thermal energies is quite low and any moderation of the neutron population by diluting the configurations with water would increase the critical mass to infinity. However, for long term storage, the neptunium liquid solutions must be converted into oxides and metals because these form are less movable and less likely to leak out of containers. Metals and oxides made out of neptunium have finite critical masses but there is a great uncertainty about these values because of the lack of experimental criticality data. Knowing precisely the critical mass of neptunium not only will help to validate mass storage limits or optimize storage configurations for safe disposition of these materials, but will also save thousands of dollars in transportation and disposition costs. The experimental results presented in

  18. Neutron Data Evaluation of 237Np

    International Nuclear Information System (INIS)

    Maslov, V.M.; Tetereva, N.A.; Kolesov, A.M.; Pronyaev, V.G.; Zolotarev, K.I.; Granier, T.; Hambsch, F.-J.

    2010-11-01

    The diverse measured data base of n+ 237 Np was evaluated using a statistical theory and generalized least squares codes. Consistent description of the total, fission and partial inelastic scattering data in 1-3 MeV energy range provides an important constraint for the absorption cross section, which is quite important for the robust estimate of the capture cross section in the 0.5-500 keV energy range. Important constraints for the measured capture cross section come from the average radiative S0 and S1 strength functions. The evaluated inelastic cross sections of available evaluations are in severe disagreement with measured data on the inelastic scattering of neutrons with excitation of specific groups of levels. A change of the inelastic data shape at E n ∼1.5 MeV might be explained by the sharp increase of the level density of the residual odd-even nuclide 237 Np due to the onset of three-quasi-particle excitations. The influence of exclusive (n, xnf) pre-fission neutrons on prompt fission neutron spectra (PFNS) and (n, xn) spectra is modeled. Contributions of emissive/non-emissive fission and exclusive spectra of (n, xnf) reactions are defined by a consistent description of the 237 Np (n, F), 237 Np (n, 2n) 236s Np reactions and the ratio of the yields of short-lived (1 - ) and long-lived (6 - ) 236 Np states measured at 14 MeV. Excited levels of 236 Np are modeled using predicted Gallher-Moshkowski doublets. This work is performed under the project Agreement B-1604 with the International Science and Technology Center (Moscow). The financing party is EU. Partial support of International Atomic Energy Agency under Research Contract 14809 is acknowledged by JINER. (author)

  19. Np-237 in peat and lichen in Finland

    DEFF Research Database (Denmark)

    Salminen, S.; Paatero, J.; Roos, Per

    2009-01-01

    Activity concentrations of 237Np in peat and lichen samples in Finland were determined and contributions from nuclear weapons testing in 1950–1960s and the Chernobyl accident were estimated. 237Np was determined with ICP-MS using 235Np as a tracer. Activity concentrations of 237Np in peat samples...

  20. 48 CFR 1252.237-70 - Qualifications of contractor employees.

    Science.gov (United States)

    2010-10-01

    ... contractor employees. 1252.237-70 Section 1252.237-70 Federal Acquisition Regulations System DEPARTMENT OF....237-70 Qualifications of contractor employees. As prescribed in (TAR) 48 CFR 1237.110(a), insert the following clause: Qualifications of Contractor Employees (APR 2005) a. Definitions. As used in this clause...

  1. 14 CFR 23.237 - Operation on water.

    Science.gov (United States)

    2010-01-01

    ... 14 Aeronautics and Space 1 2010-01-01 2010-01-01 false Operation on water. 23.237 Section 23.237... STANDARDS: NORMAL, UTILITY, ACROBATIC, AND COMMUTER CATEGORY AIRPLANES Flight Ground and Water Handling Characteristics § 23.237 Operation on water. A wave height, demonstrated to be safe for operation, and any...

  2. Analysis list: nhr-237 [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available nhr-237 Embryo,Larvae + ce10 http://dbarchive.biosciencedbc.jp/kyushu-u/ce10/target.../nhr-237.1.tsv http://dbarchive.biosciencedbc.jp/kyushu-u/ce10/target/nhr-237.5.tsv http://dbarchive.bioscience...dbc.jp/kyushu-u/ce10/target/nhr-237.10.tsv http://dbarchive.biosciencedbc.jp/kyushu-u/ce10/colo/nhr-237.E...mbryo.tsv,http://dbarchive.biosciencedbc.jp/kyushu-u/ce10/colo/nhr-237.Larvae.tsv http://dbarchive.bioscie...ncedbc.jp/kyushu-u/ce10/colo/Embryo.gml,http://dbarchive.biosciencedbc.jp/kyushu-u/ce10/colo/Larvae.gml ...

  3. 48 CFR 252.237-7011 - Preparation history.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Preparation history. 252... Provisions And Clauses 252.237-7011 Preparation history. As prescribed in 237.7003(b), use the following clause: Preparation History (DEC 1991) For each body prepared, or for each casket handled in a group...

  4. 48 CFR 252.237-7007 - Termination for default.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Termination for default... of Provisions And Clauses 252.237-7007 Termination for default. As prescribed in 237.7003(b), use the following clause: Termination for Default (DEC 1991) (a) This clause supplements and is in addition to the...

  5. 48 CFR 1452.237-71 - Utilization of Woody Biomass.

    Science.gov (United States)

    2010-10-01

    ... Biomass. 1452.237-71 Section 1452.237-71 Federal Acquisition Regulations System DEPARTMENT OF THE INTERIOR... Utilization of Woody Biomass. As prescribed in § 1437.7202, insert the following clause: Utilization of Woody Biomass (MAY 2005) (a) The contractor may remove and utilize woody biomass, if: (1) Project work is...

  6. 43 CFR 23.7 - Approval of exploration plan.

    Science.gov (United States)

    2010-10-01

    ... measures to be taken to prevent or control fire, soil erosion, pollution of surface and ground water... 43 Public Lands: Interior 1 2010-10-01 2010-10-01 false Approval of exploration plan. 23.7 Section 23.7 Public Lands: Interior Office of the Secretary of the Interior SURFACE EXPLORATION, MINING AND...

  7. 48 CFR 252.237-7005 - Performance and delivery.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Performance and delivery... of Provisions And Clauses 252.237-7005 Performance and delivery. As prescribed in 237.7003(b), use the following clause: Performance and Delivery (DEC 1991) (a) The Contractor shall furnish the...

  8. Sorption and Migration Mechanisms of 237 Np through Sandy Soil

    International Nuclear Information System (INIS)

    Chantaraprachoom, Nanthavan; Tanaka, Tadao

    2003-06-01

    In order to evaluate migration behavior of radioactive nuclides in the disposal of low-level radioactive waste into a shallow land burial, the sorption characteristic and migration behavior of 237 Np through sandy soil was studied. Two experimental methods were performed by using batch and column systems. The distribution coefficients (K d ) obtained from the adsorption and desorption process are rather small about 16 and 21 cm 3 /g respectively. Size distribution of 237 Np species in the influent solution was measured by ultra-filtration technique. Migration mechanism of 237 Np was studied by column experiments. The experimental condition was the influence of volume of eluting solution; 100, 300, 500, 1000 and 2000 ml respectively. The result from five column experiments confirm that the sorption characteristics of 237 Np are mainly controlled by a reversible ion-exchange reaction and the migration of 237 Np in the sandy soil can be estimated by using the K d concept

  9. Biokinetics of 237Np in mussels and shrimp

    International Nuclear Information System (INIS)

    Guary, J.C.; Fowler, S.W.

    1977-01-01

    Neptunium-237 kinetics were studied in marine shrimp and mussels using a thick source alpha counting technique. Bioaccumulation of 237 Np from water was relatively slow in both species, reaching whole body concentration factors of only 15 to 20 after three months. Surface adsorption was implicated in the initial uptake. Both uptake and loss of the radioisotope were not significantly affected by temperature; this may be a reflection of the physical nature of the uptake. By virtue of the large amounts of accumulated 237 Np associated with the exoskeleton of shrimp, molting will play an important role in the biogeochemical cycling of this transuranic in the marine environment. Rapid growth of organisms like mussels acts to reduce the 237 Np concentration in tissues during a period of decontamination

  10. 32 CFR 237a.3 - Objective and policy.

    Science.gov (United States)

    2010-07-01

    ...) MISCELLANEOUS PUBLIC AFFAIRS LIAISON WITH INDUSTRY § 237a.3 Objective and policy. (a) It is important that...D. Such understanding can be achieved by (1) wide dissemination of information to the business community, consistent with national security, and (2) cooperation with industry in public relations...

  11. 49 CFR 237.155 - Documents and records.

    Science.gov (United States)

    2010-10-01

    ..., DEPARTMENT OF TRANSPORTATION BRIDGE SAFETY STANDARDS Documentation, Records, and Audits of Bridge Management Programs § 237.155 Documents and records. Each track owner required to implement a bridge management... protected by a security system that incorporates a user identity and password, or a comparable method, to...

  12. 48 CFR 1852.237-71 - Pension portability.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 6 2010-10-01 2010-10-01 true Pension portability. 1852... 1852.237-71 Pension portability. As prescribed at 1837.110-70(b), insert the following clause: Pension Portability (JAN 1997) (a) In order for pension costs attributable to employees assigned to this contract to...

  13. 48 CFR 352.237-70 - Pro-Children Act.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 4 2010-10-01 2010-10-01 false Pro-Children Act. 352.237...-Children Act. As prescribed in 337.103-70(a), the Contracting Officer shall insert the following clause: Pro-Children Act (January 2006) (a) Public Law 103-227, Title X, Part C, also known as the Pro...

  14. 48 CFR 1552.237-76 - Government-Contractor Relations.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 6 2010-10-01 2010-10-01 true Government-Contractor... 1552.237-76 Government-Contractor Relations. As prescribed in 1537.110(g), insert the following clause: Government-Contractor Relations (JUN 1999) (a) The Government and the Contractor understand and agree that...

  15. 48 CFR 2452.237-75 - Clearance of contractor personnel.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 6 2010-10-01 2010-10-01 true Clearance of contractor... Clauses 2452.237-75 Clearance of contractor personnel. As prescribed in 2437.110(e), insert the following clause in solicitations and contracts. Clearance of Contractor Personnel (OCT 1999) (a) General. This...

  16. 48 CFR 852.237-70 - Contractor responsibilities.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 5 2010-10-01 2010-10-01 false Contractor....237-70 Contractor responsibilities. As prescribed in 837.110, insert the following clause: Contractor Responsibilities (APR 1984) The contractor shall obtain all necessary licenses and/or permits required to perform...

  17. 48 CFR 2152.237-70 - Continuity of services.

    Science.gov (United States)

    2010-10-01

    ...-out services for up to 10 months after this contract expires and (2) negotiate in good faith a plan... contract. The Contractor also must, except if prohibited by applicable law, disclose necessary personnel... PROVISIONS AND CONTRACT CLAUSES Text of Provisions and Clauses 2152.237-70 Continuity of services. As...

  18. 48 CFR 237.7101 - Solicitation provisions and contract clauses.

    Science.gov (United States)

    2010-10-01

    ... contracts for laundry and dry cleaning services to be provided on a count-of-articles basis. (d) Use the clause at 252.237-7015, Loss or Damage (Weight of Articles), in solicitations and contracts for laundry... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Solicitation provisions...

  19. Updated and revised neutron reaction data for 237Np

    Directory of Open Access Journals (Sweden)

    Chen Guochang

    2017-01-01

    Full Text Available Nuclear data with high accuracy for minor actinides play an important role in nuclear technology applications, including reactor design and operation, fuel cycle, estimation of the amount of minor actinides in high burn-up reactors and the minor actinides transmutation. Based on the evaluated experimental data, the updated and revised evaluation of a full set of n+237Np nuclear data from 10−5 eV ∼ 20 MeV are carried out and recommended. Mainly revised quantities are neutron multiplicities from fission reaction, inelastic, fission, (n, 2n and (n, γ reaction cross sections as well as angular distribution and so on. The promising results are obtained when the renewal evaluated data of 237Np will be used to instead of the evaluated data in CENDL-3.1 database.

  20. Sorption of 237Pu by the diatom Asterionella formosa

    International Nuclear Information System (INIS)

    Conway, H.L.; Wahlgren, M.A.; Peterson, N.; Nelson, D.M.

    1976-01-01

    Knowledge of the behavior of the man-made radionuclide plutonium within aquatic environments is of fundamental importance in assessing its potential hazards and ecological impact. The sorption of plutonium by phytoplankton and other algae is the dominant factor in the biological transport of plutonium in the aquatic environment, and it has been suggested that sorption by phytoplankton may be responsible for the seasonal loss of plutonium from the epilimnion of Lake Michigan. A unialgal diatom culture was spiked with 237 Pu tracer solution in an attempt to simulate the behavior of fallout plutonium observed in field studies. The results were encouraging in that the 237 Pu in the filtered lake water medium exhibited strongly anionic properties similar to fallout plutonium in Lake Michigan, with limited sorption on container walls. The purpose of the present study was to extend the investigations of the sorption of plutonium by phytoplankton in a controlled environment using continuous culture techniques

  1. 48 CFR 2452.237-73 - Conduct of Work and Technical Guidance.

    Science.gov (United States)

    2010-10-01

    ... conditions of the contract. (c) The GTR will issue technical guidance in writing or, if issued orally, he/she... Technical Guidance. 2452.237-73 Section 2452.237-73 Federal Acquisition Regulations System DEPARTMENT OF... Provisions and Clauses 2452.237-73 Conduct of Work and Technical Guidance. As prescribed in 2437.110(d...

  2. Characterization of oxalate-based 237NpO2 powder

    International Nuclear Information System (INIS)

    Rankin, D.T.; Burney, G.A.; Smith, P.K.; Sisson, R.D.

    1976-01-01

    238 Pu, a radioisotope heat source, is produced by irradiating reactor targets containing 237 NpO 2 . The neptunium oxide is obtained by precipitating and calcining 237 Np(IV) oxalate. The effects of oxalate precipitation parameters on particle morphology and size distribution of 237 NpO 2 powder were established to provide process controls for fabricating reactor targets

  3. 48 CFR 1352.237-72 - Security processing requirements-national security contracts.

    Science.gov (United States)

    2010-10-01

    ... requirements-national security contracts. 1352.237-72 Section 1352.237-72 Federal Acquisition Regulations... Provisions and Clauses 1352.237-72 Security processing requirements—national security contracts. As prescribed in 48 CFR 1337.110-70(d), use the following clause: Security Processing Requirements—National...

  4. 48 CFR 352.237-71 - Crime Control Act-reporting of child abuse.

    Science.gov (United States)

    2010-10-01

    ...-reporting of child abuse. 352.237-71 Section 352.237-71 Federal Acquisition Regulations System HEALTH AND... Clauses 352.237-71 Crime Control Act—reporting of child abuse. As prescribed in 337.103-70(b), the Contracting Officer shall insert the following clause: Crime Control Act of 1990—Reporting of Child Abuse...

  5. Evaluation of nuclear data of 244Pu and 237Pu

    International Nuclear Information System (INIS)

    Nakagawa, Tsuneo; Konshin, V.A.

    1995-10-01

    The evaluation of nuclear data for 244 Pu and 237 Pu was made in the neutron energy region from 10 -5 eV to 20 MeV. For the both nuclides, the total, elastic and inelastic scattering, fission, capture, (n,2n) and (n,3n) reaction cross sections were evaluated on the basis of theoretical calculation. The resonance parameters were given for 244 Pu. The angular and energy distributions of secondary neutrons were also estimated for the both nuclides. The results were compiled in the ENDF-5 format and will be adopted in JENDL Actinoid File. (author)

  6. Biokinetics of 237Np in two marine benthic invertebrates

    International Nuclear Information System (INIS)

    Guary, J.C.; Fowler, S.W.

    1976-01-01

    The long-lived alpha-emitting actinide 237 Np (T 1/2 = 2.2 x 10 6 y) enters the aquatic environment directly from nuclear testing and reprocessing plant wastes as well as indirectly by in situ generation from 241 Am. Earlier studies on 239 Np in the Columbia river ecosystem demonstrated that neptunium accumulated in aquatic species such as algae, sponges and insect larvae but was not detectable in higher trophic level organisms. Based on these findings and the fact that neptunium is chemically similar to the rare earth elements, it has been suggested that this actinide would not easily become incorporated into aquatic biota

  7. 15 CFR 23.7 - Notice to Department of Commerce organizational units of implementation and procedures.

    Science.gov (United States)

    2010-01-01

    ... organizational units of implementation and procedures. 23.7 Section 23.7 Commerce and Foreign Trade Office of the... Department of Commerce organizational units of implementation and procedures. Following are roles and...) Otherwise determine and control the use of missing children materials and information by the Operating Unit...

  8. Preparation of /sup 237/Np samples by electrodeposition and its determination by alpha spectrometry

    Energy Technology Data Exchange (ETDEWEB)

    Mertzig, W; Matsuda, H T; Araujo, B.F. de; Araujo, J.A. de [Instituto de Pesquisas Energeticas e Nucleares, Sao Paulo (Brazil). Centro de Engenharia Quimica

    1980-01-01

    An analytical method followed by alpha spectrometry was developed for the determination of trace amounts of actinides. A technique for quantitative electrodeposition of /sup 237/Np, under optimal conditions, using a carrier, is presented. This method will be applied for the control of trace amounts of /sup 237/Np in the solutions from the reprocessing (Purex process) of irradiated uranium.

  9. Measurements of {sup 237}Np secondary neutron spectra

    Energy Technology Data Exchange (ETDEWEB)

    Kornilov, N.V.

    1997-03-01

    The activities carried out during the first year of the project are summarized. The main problems for Np spectra measurements arise from high intrinsic gamma-ray activity of the sample and admixture of the oxygen and iron nuclei. The inelastically scattered neutrons and the fission neutrons spectra for {sup 237}Np were measured by time-of-flight spectrometer of the IPPE at incident neutron energies {approx_equal}1.5 MeV, and {approx_equal}0.5 MeV. A solid tritium target and a Li-metallic target were used as neutron sources. The neutron scattering on C sample (C(n,n) standard reaction) was measured to normalize the Np data. The experimental data should be simulated by Monte Carlo method to correct the experimental data for oxygen and iron admixture as well as for multiple scattering of the neutrons in the sample. Therefore the response function of the spectrometer, and the neutron energy distribution from the source were investigated in detail. (author)

  10. Pigmented villonodular synovitis: a retrospective multicenter study of 237 cases.

    Directory of Open Access Journals (Sweden)

    Guo-ping Xie

    Full Text Available To review clinical characteristics of pigmented villonodular synovitis (PVNS in China.Electronic medical records (EMR of four Chinese institutes were queried for patients with histologically proven PVNS between January 2005 and February 2014. Their data were collected including gender, age at diagnosis, clinical presentation, affected site, symptom duration, comorbidities, treatment strategy, recurrence and routine laboratories.A total of 237 patients with biopsy-proven PVNS were investigated. The gender ratio was 1.35 for a female predominance (101 males and 136 females. The average age was 36 years (range, 2 to 83 years. The median delay from initial clinical symptom to diagnosis was 18 months. Main affected areas were the knee (73.84% and the hip (18.14%. Forty patients had a clear history of joint trauma. Six patients were concurrently diagnosed with PVNS and avascular necrosis (AVN. Five patients suffered from PVNS following implantation of orthopaedic devices including artificial prosthesis, plate and wire. One hundred and twenty-nine patients underwent arthroscopic synovectomy and 108 open synovectomy. Altogether 48 patients (26 males and 22 females had recurrence of disease. The relapse rate was 24% (knee and 6.98% (hip, 20.93% (open surgery and 19.44% (arthroscopy, respectively. Erythrocyte sedimentation rate (ESR and C-reactive protein (CRP rate were elevated in 45.83% and 38.41% of the patients respectively.To our knowledge, this study is the largest sample size of PVNS patients reported as well as the largest sample of PVNS with concurrent AVN reported to date. Our outcomes suggest that PVNS shows a female predominance, occurs mostly between 20-40 years and favors the knee and hip. Recurrence is frequent, particularly in the knee. Serum ESR and CRP may be elevated in some patients. Additionally, the present study supports the theory of an association between PVNS and orthopedic surgery, which is not limited to joint replacement.

  11. Early retention of 237Pu + 239Pu in mature beagles

    International Nuclear Information System (INIS)

    Lloyd, R.D.; McFarland, S.S.; Atherton, D.R.; Bruenger, F.W.; Taylor, G.N.; Mays, C.W.

    1978-01-01

    Five mature beagles, ranging in age from 57 to 84 months, were injected intravenously with about 0.05-0.1 μCi/kg of 239 Pu(IV) citrate to which tracer amounts of the photon-emitter 237 Pu had been added. Plutonium retention in liver and in non-liver tissue (mainly skeleton) was measured periodically in the living dogs for nearly 4 months after injection by a combination of total-body and partial-body counting. All excreta were collected during the first 21 days and analysed for their Pu content. One dog was sacrificed at 14 days and another at 118 days for distribution studies. About 17% (14-20%) of the injected Pu was excreted in the urine and feces in the first 3 weeks, about the same as that excreted in a corresponding time by beagles injected as young adults (14%), but substantially more than beagles injected as juveniles (11%). In contrasts to juvenile beagles injected at 3 months of age, in which early retention was about 12% in liver and 68% in the skeleton, mature beagles retained about 30% in liver and 50% in the skeleton. Retention in young adult beagles injected at 17 months of age was similar to that of mature dogs. Relative distribution of skeletal plutonium among various bones was similar in the mature animals to that seen previously in young adults, but quite different from that of juveniles. A notable exception was the humerus for which there was no significant difference (P>0.2) in the % of retained skeletal Pu represented by the humerus among the juvenile, young adult and mature dogs. (author)

  12. Neptunium-237 in the marine environment determination in animal and plant species in the English Channel

    International Nuclear Information System (INIS)

    Germian, P.

    1990-01-01

    The uptake of 237 Np was studied in marine plants and animals belonging to several phyla. Samples were collected from the end of January 1986 to March 1986 in a sampling station near the fuel reprocessing plant at La Hague. 237 Np was determined by neutron activation analysis. The transfer modes of 237 Np to the various species as a function of their trophic levels are discussed as well as the distribution among the organs in the species consumed and the radiological impact of human consumption. (author) 27 refs.; 2 figs.; 1 tab

  13. Conversion-electron experiment to characterize the decay of the 237Np shape isomer

    International Nuclear Information System (INIS)

    Henry, E.A.; Becker, J.A.; Bauer, R.W.; Gardner, D.G.; Decman, D.J.; Meyer, R.A.; Roy, N.; Sale, K.E.

    1987-01-01

    Conversion electrons from the decay of low-lying levels of 237 Np have been measured to detect the population of these levels by gamma-ray decay of the 237 Np shape isomer. Analysis of the 208-keV transition L conversion-electron peak gives an upper limit of about 17 μb for the population of the 3/2 - 267-keV level in 237 Np from the shape isomer decay. Model calculations are compared with the measured limit. Improvements are suggested for this experiment. 9 refs., 4 figs

  14. Distribution of global fallout 237Np, Pu isotopes, and 241Am in lake and sea sediments

    International Nuclear Information System (INIS)

    Yamamoto, Masayoshi; Yamauchi, Y.; Chatani, K.; Komura, K.; Ueno, Kaoru; Sakanoue, Masanobu

    1991-01-01

    In order to investigate the sedimentary behaviour of neptunium, 237 Np together with Pu isotopes and 241 Am were measured for the sediment cores collected from Lake Mikata (freshwater), from Lake Kugushi (brakish water) and from Nyu Bay (sea water). In all sediment core samples 237 Np was detected, and its concentrations were far below those of 239,240 Pu and 241 Am measured for the same samples. Inventories of 237 Np in the lakes were estimated to be 0.53, 0.29 and 0.34 MBq/km 2 , respectively. The activity ratios of 237 Np/ 239,240 Pu, except for Lake Mikata, are two or three times lower than the value of 0.3-0.4% observed for surface soils of 0-20 cm depth, suggesting that Np is more soluble compared with Pu. (author) 21 refs.; 6 figs.; 3 tabs

  15. 238U and 237Np nuclear fission by 90-270 MeV electrons

    International Nuclear Information System (INIS)

    Kuznetsov, V.L.; Nedorezov, V.G.; Nikitina, N.V.; Noga, V.I.; Ranyuk, Yu.N.; Telegin, Yu.N.; Smirnov, A.N.; Ehjsmont, V.P.

    1981-01-01

    A technique for measuring cross sections of 238 U and 237 Np nuclei fission caused by 90-270 MeV electrons is described. Measurement results are given. The results obtained are discussed on the basis of the virtual photon method. It is shown that the difference in cross sections of 238 U and 237 Np electrofission is due to the different contribution of the giant resonance [ru

  16. 237 Np analytical method using 239 Np tracers and application to a contaminated nuclear disposal facility

    Energy Technology Data Exchange (ETDEWEB)

    Snow, Mathew S.; Morrison, Samuel S.; Clark, Sue B.; Olson, John E.; Watrous, Matthew G.

    2017-06-01

    Environmental 237Np analyses are challenged by low 237Np concentrations and lack of an available yield tracer; we report a rapid, inexpensive 237Np analytical approach employing the short lived 239Np (t1/2 = 2.3 days) as a chemical yield tracer followed by 237Np quantification using inductively coupled plasma-mass spectrometry. 239Np tracer is obtained via separation from a 243Am stock solution and standardized using gamma spectrometry immediately prior to sample processing. Rapid digestions using a commercial, 900 watt “Walmart” microwave and Parr microwave vessels result in 99.8 ± 0.1% digestion yields, while chromatographic separations enable Np/U separation factors on the order of 106 and total Np yields of 95 ± 4% (2σ). Application of this method to legacy soil samples surrounding a radioactive disposal facility (the Subsurface Disposal Area at Idaho National Laboratory) reveal the presence of low level 237Np contamination within 600 meters of this site, with maximum 237Np concentrations on the order of 103 times greater than nuclear weapons testing fallout levels.

  17. 237Np analytical method using 239Np tracers and application to a contaminated nuclear disposal facility.

    Science.gov (United States)

    Snow, Mathew S; Morrison, Samuel S; Clark, Sue B; Olson, John E; Watrous, Matthew G

    2017-06-01

    Environmental 237 Np analyses are challenged by low 237 Np concentrations and lack of an available yield tracer; we report a rapid, inexpensive 237 Np analytical approach employing the short lived 239 Np (t 1/2  = 2.3 days) as a chemical yield tracer followed by 237 Np quantification using inductively coupled plasma-mass spectrometry. 239 Np tracer is obtained via separation from a 243 Am stock solution and standardized using gamma spectrometry immediately prior to sample processing. Rapid digestions using a commercial, 900 W "Walmart" microwave and Parr microwave vessels result in 99.8 ± 0.1% digestion yields, while chromatographic separations enable Np/U separation factors on the order of 10 6 and total Np yields of 95 ± 4% (2σ). Application of this method to legacy soil samples surrounding a radioactive disposal facility (the Subsurface Disposal Area at Idaho National Laboratory) reveal the presence of low level 237 Np contamination within 600 m of this site, with maximum 237 Np concentrations on the order of 10 3 times greater than nuclear weapons testing fallout levels. Copyright © 2017 Elsevier Ltd. All rights reserved.

  18. Integral test for Np237 and Am241 cross sections in JENDL, ENDF and JEF libraries

    International Nuclear Information System (INIS)

    Iwasaki, Tomohiko; Unesaki, Hironobu; Kitada, Takanori

    2002-01-01

    Experiments using Kyoto University critical assembly (KUCA) were performed for measuring the capture and fission reaction rates of 237 Np and 241 Am. A back-to-back fission chamber was employed for the measurement of the fission rate of 237 Np and 241 Am relative to 235 U. The capture rate of 237 Np relative to 197 Au was measured by using activation method. Eleven cores, of which the spectra were changed systematically, were mocked up for the present measurements. Five cores among the eleven were utilized for the fission reaction rate measurement. The experiment was analyzed using the Monte Carlo code MVP, the transport code TWOTRAN and the diffusion code CITATION using the libraries based on JENDL3.2, ENDF/B-VI and JEF2.2. As the results, for 237 Np, JENDL3.2 showed good agreement for both capture and fission. However, for the fission rate of 241 Am, JENDL3.2 underestimates 15-20%. On the other hand, ENDF/B-VI and JEF2.2 show different C/Es for 237 Np and 241 Am. (author)

  19. Neutron induced fission of 237Np – status, challenges and opportunities

    Directory of Open Access Journals (Sweden)

    Ruskov Ivan

    2018-01-01

    Full Text Available Nowadays, there is an increased interest in a complete study of the neutron-induced fission of 237Np. This is due to the need of accurate and reliable nuclear data for nuclear science and technology. 237Np is generated (and accumulated in the nuclear reactor core during reactor operation. As one of the most abundant long-lived isotopes in spent fuel (“waste”, the incineration of 237Np becomes an important issue. One scenario for burning of 237Np and other radio-toxic minor actinides suggests they are to be mixed into the fuel of future fast-neutron reactors, employing the so-called transmutation and partitioning technology. For testing present fission models, which are at the basis of new generation nuclear reactor developments, highly accurate and detailed neutron-induced nuclear reaction data is needed. However, the EXFOR nuclear database for 237Np on neutron-induced capture cross-section, σγ, and fission cross-section, σf, as well as on the characteristics of capture and fission resonance parameters (Γγ, Γf, σoΓf, fragments mass-energy yield distributions, multiplicities of neutrons vn and γ-rays vγ, has not been updated for decades.

  20. Analysis of Np-237 ENDF for the theortical interpretation of critical assembly experiments.

    Energy Technology Data Exchange (ETDEWEB)

    Mihaila, B. (Bogdan); Chadwick, M. B. (Mark B.); MacFarlane, R. E. (Robert E.); Kawano, T. (Toshihiko)

    2004-01-01

    We report on the present status of our effort toward an improved Np-237 evaluated nuclear data file (ENDF). The aim here is to bridge the gap between calculated and observed k-eff values, as measured at the Np-U critical assembly at LANL, TA-18. As such, we perform a critical analysis of the existing body of experimental data and recommended evaluations. We are targeting in principal the fission nu-bar and cross section in Np-237, as well as the inelastic scattering which is particularly important since Np-237 is a threshold fissioner. This analysis will be employed in a future sensitivity study of the calculated k-eff with respect to variations of the afore mentioned nuclear data.

  1. Role of transitional levels in 237Np (γ,f): Perspectives for studying highly deformed systems

    International Nuclear Information System (INIS)

    Arruda-Neto, J. D. T.; Mesa, J.; Garcia, F.; Rodriguez, O.; Geraldo, L. P.; Garcia, C.; Guzman, F.; Rodrigues, T. E.; Shtejer, K.; Semmler, R.

    2006-01-01

    The transition levels at the top of the two 237 Np fission barriers were obtained for the first time by means of the so-called semimicroscopic combined method, which we have developed and implemented. To overcome the difficulties in dealing with large nuclear deformations, we used our developed BARRIER code, which calculates single-particle spectra in a deformed Woods-Saxon potential using a coordinate system based on Cassini ovaloids as nuclear shape parametrization. The results enabled us to describe the experimentally observed near-barrier photofission cross-section structures for 237 Np, as well as a subbarrier shelf, the latter being consistently interpreted in terms of the accumulation of levels at the top of the inner and outer double fission barrier of 237 Np

  2. Role of ser-237 in the substrate specificity of the carbapenem-hydrolyzing class A beta-lactamase Sme-1.

    Science.gov (United States)

    Sougakoff, W; Naas, T; Nordmann, P; Collatz, E; Jarlier, V

    1999-08-17

    The role of the serine residue found at position 237 in the carbapenemase Sme-1 has been investigated by constructing a mutant in which Ser-237 was replaced by an alanine. The S237A mutant showed a catalytic behavior against penicillins and aztreonam very similar to that of Sme-1. By contrast, S237A was characterized by a reduced catalytic efficiency against cephems, such as cephalothin and cephaloridine. In addition, the weak activity of Sme-1 against the cephamycin cefoxitin was hardly detectable with the mutant enzyme. Finally, the Ser-237-->Ala mutation resulted in a marked decrease in catalytic activity against imipenem, showing that Ser-237 contributes to the carbapenemase activity of the class A beta-lactamase Sme-1.

  3. 27 CFR 24.237 - Spirits added to juice or concentrated fruit juice.

    Science.gov (United States)

    2010-04-01

    ... AND TRADE BUREAU, DEPARTMENT OF THE TREASURY LIQUORS WINE Spirits § 24.237 Spirits added to juice or... fruit juice to which spirits have been added will be included in the appropriate tax class of any wine inventory and will be properly identified. Juice or concentrated juice to which wine spirits are added will...

  4. Transmutation of 129I, 237Np, 238Pu, 239Pu, and 241Am using ...

    Indian Academy of Sciences (India)

    Results of transmutation studies of 129I, 237Np, 238Pu, 239Pu and 241Am are presented. Keywords. ... J Adam et al. Table 1. Samples properties for 0.7 and 1 GeV experiments. ..... If we suppose that this conclusion is true also for ratios in ...

  5. A study of the multipolar composition of the electrofission cross section of 237Np

    International Nuclear Information System (INIS)

    Paschoal, S.L.

    1987-01-01

    The electrofission cross section for 237 Np was measured over the energy range from 0,6 to 60,0 MeV. The multipolar composition of this cross section was investigated using the virtual photons formalism with three different techniques of analysis: unfolding and two versions of multiple parameter regression. (A.C.A.S.) [pt

  6. LOFT CIS analysis 4''-WH-237-E inside containment penetration S-17B

    International Nuclear Information System (INIS)

    Nitzel, M.E.

    1978-01-01

    The stress analysis performed on the 4''-WH-237-E piping system inside containment penetration S-17B is presented. Deadweight, thermal expansion, and seismic loads were considered. Results of this analysis show that the subject piping system will meet ASME Code, Section III, Class 2 requirements

  7. 50 CFR 23.7 - What office do I contact for CITES information?

    Science.gov (United States)

    2010-10-01

    ... 50 Wildlife and Fisheries 6 2010-10-01 2010-10-01 false What office do I contact for CITES... FAUNA AND FLORA (CITES) Introduction § 23.7 What office do I contact for CITES information? Contact the following offices to receive information about CITES: Type of information Office to contact (a) CITES...

  8. 40 CFR 81.237 - Northeast Georgia Intrastate Air Quality Control Region.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 17 2010-07-01 2010-07-01 false Northeast Georgia Intrastate Air... Air Quality Control Regions § 81.237 Northeast Georgia Intrastate Air Quality Control Region. The Northeast Georgia Intrastate Air Quality Control Region consists of the territorial area encompassed by the...

  9. Multimode approach to Am-241 and Np-237 fission induced by 660-MeV protons

    Czech Academy of Sciences Publication Activity Database

    Karapetyan, G. S.; Balabekyan, A. R.; Demekhina, N. A.; Adam, Jindřich

    2009-01-01

    Roč. 72, č. 6 (2009), s. 911-916 ISSN 1063-7788 R&D Projects: GA MŠk(CZ) LA08002 Institutional research plan: CEZ:AV0Z10480505 Keywords : FISSION * Am-241 * Np-237 Subject RIV: BG - Nuclear, Atomic and Molecular Physics, Colliders Impact factor: 0.539, year: 2009

  10. Role of once-daily glycopyrronium bromide (NVA237 in the management of COPD

    Directory of Open Access Journals (Sweden)

    D’Urzo A

    2013-08-01

    Full Text Available Anthony D'UrzoDepartment of Family and Community Medicine, University of Toronto, Toronto, ON, CanadaAbstract: Progressive airflow limitation is a hallmark feature of chronic obstructive pulmonary disease (COPD that ultimately leads to breathlessness, impaired quality of life, and reduced exercise capacity. Pharmacotherapy is used in patients with COPD to prevent and control symptoms, reduce both the frequency and severity of exacerbations, improve health status, and increase exercise tolerance. These strategies are intended to address management issues which promote both current disease control and a reduction in the risk of disease deterioration in the future. At the present time, long-acting β2-agonists (LABAs and long-acting muscarinic antagonists (LAMAs are available for maintenance therapy in patients with persistent symptoms. Tiotropium was the first LAMA to be approved for management of COPD, and many studies have described its beneficial effects on multiple clinically relevant outcomes. Glycopyrronium bromide (NVA237, a new LAMA, has been developed and received regulatory approval for management of COPD in a number of countries around the world. Results from pivotal Phase III trials suggest that NVA237 is safe and well tolerated in patients with moderate to severe COPD, and provides rapid and sustained improvements in lung function. Further, these changes are associated with statistically and clinically meaningful improvements in dyspnea, health-related quality of life, and exercise tolerance. Treatment with NVA237 also results in a significant reduction in risk of exacerbations and the need for rescue medication, and has been comparable with tiotropium with respect to safety and efficacy outcomes. Finally, emerging data indicate that NVA237 is efficacious both as monotherapy and in combination with indacaterol.Keywords: glycopyrronium bromide, NVA237, chronic obstructive pulmonary disease, inhaled long-acting bronchodilators

  11. 29 CFR 779.237 - Enterprise engaged in commerce or in the production of goods for commerce.

    Science.gov (United States)

    2010-07-01

    ... 29 Labor 3 2010-07-01 2010-07-01 false Enterprise engaged in commerce or in the production of goods for commerce. 779.237 Section 779.237 Labor Regulations Relating to Labor (Continued) WAGE AND... commerce or in the production of goods for commerce. Under section 3(s) the “enterprise” to be covered must...

  12. Np-237 incineration study in various beams in ADS setup QUINTA

    Directory of Open Access Journals (Sweden)

    Kilim Stanisław

    2018-03-01

    Full Text Available Neptunium-237 samples were irradiated in a spallation neutron field produced in accelerator-driven system (ADS setup QUINTA. Five experiments were carried out on the accelerators at the JINR in Dubna - one in carbon (C6+, three in deuteron, and one in a proton beam. The energy in carbon was 24 GeV, in deuteron 2, 4 and 8 GeV, respectively, and 660 MeV in the proton beam. The incineration study method was based on gamma-ray spectrometry. During the analysis of the spectra several fission products and one actinide were identified. Fission product activities yielded the number of fissions. The actinide (Np-238, a result of neutron capture by Np-237, yielded the number of captures. The main goal of this work was to find out if and how the incineration rate depended on parameters of the accelerator beam.

  13. Transmutation of actinide 237Np with a fusion reactor and a hybrid reactor

    International Nuclear Information System (INIS)

    Feng, K.M.; Huang, J.H.

    1994-01-01

    The use of fusion reactors to transmute fission reactor wastes to stable species is an attractive concept. In this paper, the feasibility of transmutation of the long-lived actinide radioactive waste Np-237 with a fusion reactor and a hybrid reactor has been investigated. A new waste management concept of burning HLW (High Level Waste), utilizing released energy and converting Np-237 into fissile fuel Pu-239 through transmutation has been adopted. The detailed neutronics and depletion calculation of waste inventories was carried out with a modified version of one-dimensional neutron transport and burnup calculation code system BISON1.5 in this study. The transmutation rate of Np with relationship to neutron wall loading, Pu and Np with relationship to neutron wall load, Pu and Np concentration in the transmutation zone have been explored as well as relevant results are also given

  14. The 'overlooked trio' of hypothetical terrorist nuclear weapons - reactor grade plutonium, neptunium-237 and tritium

    International Nuclear Information System (INIS)

    Sholly, S.

    2002-01-01

    Full text: Considerations revolving around physical protection of nuclear material are quite commonly and naturally focused on protecting weapons-grade plutonium (WGPu) and highly enriched uranium (HEU) from theft and diversion. These two materials are the center of attention because of their well-known (and demonstrated) potential for use in first-generation nuclear explosive devices of which potential terrorists are widely thought to be capable. They are also the center of attention because of retirements of these materials from military use as the Russian Federation and the United States reduce the number of nuclear weapons in their arsenals. Three other materials - an 'overlooked trio' - must also be borne in mind within this context: (1) reactor-grade plutonium (RGPu); (2) neptunium-237 (Np-237); and (3) tritium (H-3). Although there are still some authorities who either contend that RGPu cannot be used in a nuclear explosive or that there are (for a terrorist) insurmountable difficulties in doing so, the knowledgeable scientific and technical community, recognizes the potential utility of RGPu for hypothetical terrorist nuclear devices. A much smaller community of experts recognizes the usefulness of Np-237 for nuclear devices, but Np-237 is as straight-forwardly and easily usable as HEU and similarly abundant (but not often in separated form). Tritium can be used (with a modest increase in design sophistication) in a conventional first-generation nuclear device with any of the weapons-usable materials (WGPu, HEU, RGPu or Np-237) to increase the yield and/or increase the reliability of a non-fizzle yield. Given the presence of RGPu and Np-237 in abundant quantities in spent commercial reactor fuel, widely available knowledge of how to separate these materials, and a world-wide total of more than 400 nuclear power plants, spent reactor fuel also requires stringent controls. This is especially true of old spent fuel which has far less radiation dose

  15. Quality control for measurement of soil samples containing 237Np and 241Am as radiotracer

    International Nuclear Information System (INIS)

    Sha Lianmao; Zhang Caihong; Song Hailong; Ren Xiaona; Han Yuhu; Zhang Aiming; Chu Taiwei

    2003-01-01

    This paper reports quality control (QC) for the measurement of soil samples containing 237 Np and 241 Am as radiotracers in migration test of transuranic nuclides. All of the QC were done independently by the QA members of analytical work. It mainly included checking 5%-10% of the total analyzed samples; preparing blank samples, blind replicate sample and spiked samples used as quality control samples to check the quality of analytical work

  16. (237)Np(n,f) Cross Section: New Data and Present Status

    CERN Document Server

    Paradela, C; Carrapico, C; Eleftheriadis, C; Leeb, H; Calvino, F; Herrera-Martinez, A; Savvidis, I; Vlachoudis, V; Haas, B; Vannini, G; Le Naour, C; Gramegna, F; Wiescher, M; Pigni, M T; Audouin, L; Mengoni, A; Quesada, J; Becvar, F; Plag, R; Cennini, P; Mosconi, M; Duran, I; Rauscher, T; Couture, A; Capote, R; Sarchiapone, L; Vlastou, R; Domingo-Pardo, C; Dillmann, I; Pavlopoulos, P; Karamanis, D; Krticka, M; Jericha, E; Ferrari, A; Martinez, T; Trubert, D; Oberhummer, H; Karadimos, D; Plompen, A; Isaev, S; Terlizzi, R; Kaeppeler, F; Cortes, G; Cox, J; Voss, F; Pretel, C; Colonna, N; Berthoumieux, E; Vaz, P; Heil, M; Lopes, I; Lampoudis, C; Walter, S; Calviani, M; Gonzalez-Romero, E; Embid-Segura, M; Stephan, C; Igashira, M; Papachristodoulou, C; Aerts, G; Tavora, L; Berthier, B; Rudolf, G; Andrzejewski, J; Villamarin, D; Ferreira-Marques, R; Tain, J L; O'Brien, S; Gunsing, F; Reifarth, R; Perrot, L; Lindote, A; Neves, F; Poch, A; Kerveno, M; Rubbia, C; Koehler, P; Dahlfors, M; Wisshak, K; Salgado, J; Dridi, W; Ventura, A; Andriamonje, S; Assimakopoulos, P; Santos, C; Ferrant, L; Lozano, M; Patronis, N; Chiaveri, E; Guerrero, C; Kadi, Y; Vicente, M C; Praena, J; Baumann, P; Oshima, M; Rullhusen, P; Furman, W; David, S; Marrone, S; Tassan-Got, L; Cano-Ott, D; Pavlix, A; Alvarez-Velarde, F; Massimi, C; Mastinu, P; Pancin, J; Papadopoulos, C; Tagliente, G; Haight, R; Chepel, V; Kossionides, E; Badurek, G; Marganiec, J; Lukic, S; Tarrio, D; Alvarez, H

    2011-01-01

    In this document, we present the final result obtained at the n_TOF experiment; for the neutron-induced fission cross section of the (237)Np, from the fission threshold up to 1 GeV. The method applied to get tins result is briefly discussed. n_TOF data are compared to the last experimental measurements using other TOF facilities or the surrogate method, reported experiments performed with monoenergetic sources and the FISCAL systematic, including a discussion about the existing discrepancies.

  17. 'n Nota oor die vertaling van Jeremia 2:37 ("Met jou hande op jou hoof"

    Directory of Open Access Journals (Sweden)

    H.F. Stander

    1998-08-01

    Full Text Available A note on the translation of Jeremiah 2:37 ("With your hands on your head" In Jeremiah 2:37 God says to Israel: "You will leave that place (= Egypt with your hands upon your head". In this article various Bible translations and commentaries are scrutinized to determine how modem exegetes interpret this phrase. Thereafter the author discusses Egyptian depictions of mourners in funeral processions with their hands on their heads. He shows how an exploration of Egyptian Art can contribute to a better understanding of Jeremiah 2:37. This study also shows that the two dynamic Afrikaans translations of the Bible ("Die Lewende Bybel" and "Die Nuwe Afrikaanse Vertaling" are wide off the mark in their interpretation of the phrase "with your hands on your head". The author also argues that exegetes should not only rely on written texts when they study the ancient world in which the Scriptures originated, but that they should also explore works of art.

  18. Distribution of global fallout sup 237 Np, Pu isotopes, and sup 241 Am in lake and sea sediments

    Energy Technology Data Exchange (ETDEWEB)

    Yamamoto, Masayoshi; Yamauchi, Y; Chatani, K; Komura, K; Ueno, Kaoru; Sakanoue, Masanobu [Kanazawa Univ., Ishikawa (Japan). Low Level Radioactivity Lab.; Igarashi, Syuiti [Fukui Prefectural Inst. of Public Health (Japan)

    1991-01-01

    In order to investigate the sedimentary behaviour of neptunium, {sup 237}Np together with Pu isotopes and {sup 241}Am were measured for the sediment cores collected from Lake Mikata (freshwater), from Lake Kugushi (brakish water) and from Nyu Bay (sea water). In all sediment core samples {sup 237}Np was detected, and its concentrations were far below those of {sup 239,240}Pu and {sup 241}Am measured for the same samples. Inventories of {sup 237}Np in the lakes were estimated to be 0.53, 0.29 and 0.34 MBq/km{sup 2}, respectively. The activity ratios of {sup 237}Np/{sup 239,240}Pu, except for Lake Mikata, are two or three times lower than the value of 0.3-0.4% observed for surface soils of 0-20 cm depth, suggesting that Np is more soluble compared with Pu. (author) 21 refs.; 6 figs.; 3 tabs.

  19. New radiochemical methods for determination of 237Np a 241Pu using extraction chromatography (Presentation)

    International Nuclear Information System (INIS)

    Strisovska, J.

    2013-01-01

    Thesis was focused on the development of a new methodology for the separation of anthropogenic transuranium radionuclides 237 Np a 241 Pu from different kinds of matrices. The analytical methods used in this study were based on extraction chromatography and were optimized according to the sample type. The proposed radiochemical procedure is a combination of two algorithms, which represent the separation of radionuclides by using extraction chromatographic sorbents TEVA resin and TRU resin supplied by Eichrom Technologies LLC. 239 Np a 237 Np were selectively captured on sorbent TEVA resin in oxidation state 4+. TRU resin was used for purification of plutonium fraction from interfering americium radionuclide. 242 Pu and 239 Np radionuclides as tracers have been used to monitor the radiochemical yields of separation. Before every radiochemical separation tracer radionuclide 239 Np was obtained by separation from the parent radionuclide 2 43 Am, which is in radioactive equilibrium to 239 Np. The average yield of chemical separation was 69,3% for 239 Np at 277 keV energy line and 65,9% at 228 keV energy line. The NPL AH-B08069 (2008) samples which consist of the mixture of alpha-radionuclides were used for the modification and optimization of separation method used for separation of Np and Pu in model samples. This method provided high radiochemical yields of 239,240 Pu (95,0 ± 3,5)% and 237 Np (87,9 ± 3,0)%.. Reliability of the method was verified by applying our modified separation procedures on reference materials IAEA-375 and IAEA-414 supplied by International Atomic Energy Agency. A good agreement between the results is obtained by this procedure and the certified values were found. Samples of contaminated soils from the area of Nuclear power plant A-1 Jaslovske Bohunice which is stored temporarily before disposal were analyzed using developed separation procedure. Specific activity of investigated radionuclides was determined in these samples. (author)

  20. Transuranium element chalcogenides. Crystallochemistry and Moessbauer spectrometry of neptunium 237 chalcogenides

    International Nuclear Information System (INIS)

    Thevenin, T.; Pages, M.; Damien, D.

    1981-09-01

    To study actinide compounds , neptunium 237 has been studied by Moessbauer resonance. The different oxidation degrees of neptunium (7, 6, 5, 4 and 3) have a very important effect on isomeric displacements. In the study of chalcogenides, the isomeric displacement value of NpS 3 confirms the valency 4+ of neptunium in this compound. Results obtained with Np 3 S 5 show two valency state +3 and +4 in this compound. There is a good agreement with the two crystalline sites determined by crystallography [fr

  1. Rapid separation method for {sup 237}Np and Pu isotopes in large soil samples

    Energy Technology Data Exchange (ETDEWEB)

    Maxwell, Sherrod L., E-mail: sherrod.maxwell@srs.go [Savannah River Nuclear Solutions, LLC, Building 735-B, Aiken, SC 29808 (United States); Culligan, Brian K.; Noyes, Gary W. [Savannah River Nuclear Solutions, LLC, Building 735-B, Aiken, SC 29808 (United States)

    2011-07-15

    A new rapid method for the determination of {sup 237}Np and Pu isotopes in soil and sediment samples has been developed at the Savannah River Site Environmental Lab (Aiken, SC, USA) that can be used for large soil samples. The new soil method utilizes an acid leaching method, iron/titanium hydroxide precipitation, a lanthanum fluoride soil matrix removal step, and a rapid column separation process with TEVA Resin. The large soil matrix is removed easily and rapidly using these two simple precipitations with high chemical recoveries and effective removal of interferences. Vacuum box technology and rapid flow rates are used to reduce analytical time.

  2. α-decay chain and associated cluster emission from neutron deficient 237Cf nucleus

    International Nuclear Information System (INIS)

    Jain, Deepika; Sharma, Manoj K.

    2015-01-01

    We have studied the α-decay chain of 237 Cf nucleus, which has been observed in the 3n evaporation channel when the semi-magic projectile 36 S strikes on 204 Pbv nucleus. The calculations are carried out by using preformed cluster model (PCM), with choices of spherical and quadruple deformation with in cold optimum orientation approach. The calculated half-lives of α-decay chain find relatively in nice agreement with experimental data for the deformed fragmentation approach. Along with α emission, the possibility of heavier clusters is also worked out and corresponding half-lives are predicted. (author)

  3. Evaluation of nuclear data of {sup 244}Pu and {sup 237}Pu

    Energy Technology Data Exchange (ETDEWEB)

    Nakagawa, Tsuneo; Konshin, V.A. [Japan Atomic Energy Research Inst., Tokai, Ibaraki (Japan). Tokai Research Establishment

    1995-10-01

    The evaluation of nuclear data for {sup 244}Pu and {sup 237}Pu was made in the neutron energy region from 10{sup -5} eV to 20 MeV. For the both nuclides, the total, elastic and inelastic scattering, fission, capture, (n,2n) and (n,3n) reaction cross sections were evaluated on the basis of theoretical calculation. The resonance parameters were given for {sup 244}Pu. The angular and energy distributions of secondary neutrons were also estimated for the both nuclides. The results were compiled in the ENDF-5 format and will be adopted in JENDL Actinoid File. (author).

  4. Evaluation of methods for retention of radioiodine during processing of irradiated 237Np

    International Nuclear Information System (INIS)

    Thompson, G.H.; Kelley, J.A.

    1975-06-01

    Methods of removing radioiodine from 237 Np-- 238 Pu dissolver solution and process off-gas were investigated. This program is part of a continuing effort to reduce releases of radionuclides from plant operations. Experimental data show: Greater than 99.9 percent of the radioiodine in dissolver solution can be removed by precipitation, in situ, of manganese dioxide. Silver zeolite will sorb greater than 99.9 percent of radioiodine in process off-gas. Other solid sorbents and nitric acid-mercuric nitrate scrubber solutions do not remove appreciable amounts of radioiodine from process off-gas, because radioiodine is present principally as relatively unreactive organic iodine compounds. (U.S.)

  5. Numerical simulation of CALIBAN reactivity perturbation experiments using neptunium-237 samples

    International Nuclear Information System (INIS)

    Humbert, Philippe; Mechitoua, Boukhmes

    2003-01-01

    In order to contribute to the validation of nuclear data used in critical mass computation, reactivity perturbation experiments using 237 Np samples have been performed at CEA-Valduc using the fast pulsed reactor CALIBAN operated in continuous mode. In this paper we report these experiments together with the numerical calculations. The calculations were carried out using PANDA, a S N code developed at CEA-Bruyeres-le-Chatel for classic criticality and stochastic neutronics applications and with MCNP4C which is a commonly used Monte Carlo code. A good agreement was found between experimental and deterministic results. (author)

  6. Helicobacter pylori and primary gastric lymphoma. A histopathologic and immunohistochemical analysis of 237 patients.

    Science.gov (United States)

    Nakamura, S; Yao, T; Aoyagi, K; Iida, M; Fujishima, M; Tsuneyoshi, M

    1997-01-01

    Few previous articles have analyzed the relation between infection with Helicobacter pylori (H. pylori) and primary gastric lymphoma in a large number of patients. Resected and biopsied specimens from 237 patients with primary gastric lymphoma were investigated for H. pylori using hematoxylin and eosin stain, modified Giemsa stain, and immunohistochemistry. These specimens were compared with specimens from 29 patients with chronic active gastritis, 33 with peptic ulcers, and 41 with gastric carcinoma. H. pylori was detected in 145 of 237 patients (61%) with gastric lymphoma. The frequency of H. pylori positivity was higher in patients with lymphoma restricted to the mucosa and submucosa (76%) than in those with lymphoma invading beyond the submucosa (48%) (P gastritis (100%) (P gastritis and peptic ulcer. The H. pylori grading score for patients with lymphoma (0.9 +/- 1.0) was lower than for those with chronic active gastritis (1.9 +/- 0.8) (P < 0.001), peptic ulcers (2.2 +/- 1.0) (P < 0.001), or gastric carcinoma (1.2 +/- 1.1) (P < 0.05). These results suggest that H. pylori is more likely to be associated with early states of primary gastric lymphoma than with advanced states. Thus, H. pylori may disappear during the progression of primary gastric lymphoma.

  7. Field study of the migration of 237Np, 238Pu and 241Am in a weak loess aquifer

    International Nuclear Information System (INIS)

    Liu, C.L.; Wang, Z.M.; Li, S.S.; Yang, Y.E.; Li, B.; Jiang, H.; Jiang, L.; Wang, L.; Li, D.

    2004-01-01

    The migration of 237 Np, 238 Pu and 241 Am in a weak loess aquifer was investigated in-situ in an Underground Research Facility. Quartz containing 237 Np, 238 Pu, 241 Am and 3 H was introduced into the aquifer with a stainless steel tube. The local water flow in the aquifer was monitored using a 3-dimensional sampling system. The contaminated area of the aquifer was obtained wholly with the help of a pre-installed stainless steel frame and cut into small pieces (samples) 3-dimensionally and analyzed. 3 H in the water samples was determined with a liquid scintillation analyzer (Tri-Camb 2250). Radioactivity of 237 Np and 241 Am in the soil samples were determined with a low energy photon detector (HPGe), 238 Pu was analyzed with a low background αandβ detector after chemical separation. The result of the 3-year experiment indicated that 237 Np, 238 Pu and 241 Am were strongly absorbed by the loess aquifer. The retardation factor of 237 Np in the loess aquifer was 1.54 x 10 4 . (author)

  8. A Single Recessive Mutated Gene (Sd237-1) Controlling Semi-Dwarf Plant Stature of Rice

    International Nuclear Information System (INIS)

    Sobrizal

    2009-01-01

    Dwarfism is a valuable trait in crop breeding, because it increases lodging resistance and decreases damages due to wind and rain. During the course of this study, a semi-dwarf mutant was successfully induced through 200 Gy gamma ray irradiated KI 237 seeds. KI 237 is a pure line with high yield potency, developed through an Indica-Japonica cross of IR36 / Koshihikari. The selected semi-dwarf plant reached 60 - 62 % of plant height of original plant KI 237 at the mature stage. The length of inter nodes, panicle, and seed were also compared between these two plants. The retardation of the 1 st (uppermost) inter nodes was 24 %, moreover, the retardation of panicle and seed length were only 10 % and 2 %, respectively. The elongation pattern of the inter nodes in this mutant was almost the same as sd1 (Dee-geo-woo-gen), the original parent of the first release modern rice variety, but their performances were different. Based on the segregation analysis in M 2 and M 3 generation it was concluded that this mutant was controlled by a single recessive mutated gene. This gene was designated as sd 237-1 . This mutant should be useful as a genetic resource for the improvement of KI 237 line through back-cross breeding as well as be developed further in breeding program directly to be a new high yielding mutant variety. (author)

  9. Use of the electrodeposition technique in the preparation of samples of 237Np and its determination by alpha spectrometry

    International Nuclear Information System (INIS)

    Mertzig, W.; Matsuda, H.T.; Araujo, B.F. de; Araujo, J.A. de.

    1981-05-01

    The electroplating technique to prepare 237 Np source and its determination by alpha spectrometry is presented. The samples were prepared using a lucite-eletrolitic cell manufactured at IPEN, specially to trace amounts of actinides. A polished brass disk coated with Ni film has been used as cathodo and a fixed Pt wire as anode. The electroplated samples were alpha counted using a surface barrier detector. The optimum conditions to obtain the quantitative deposition of 237 Np have been achieved by studying the effects of some parameters as current density, pH and concentration of eletrolitic solution and time of eletrodeposition, using a carrier technique. After preliminary purification, the method is applied to control trace amounts of 237 Np in the Purex process solutions. (Author) [pt

  10. Savannah River Plant 200 Area technical manual. Part SP. Processing of Np/sup 237/ and Pu/sup 238/

    Energy Technology Data Exchange (ETDEWEB)

    Hill, A.J. (comp.)

    1963-01-03

    This manual covers the technology involved in the 200 Area process for the recovery of Np/sup 237/ from certain aqueous waste streams in the separations plants, for the recovery of NP/sup 237/ and Pu/sup 238/ from irradiated NpO/sub 2/-Al slugs and for the fabrication of NpO/sub 2/-Al slugs. The manual contains sections on the fundamental chemistry, the primary recovery of Np by ion exchange, the decontamination of Np by ion exchange, the processing of NpO/sub 2/-Al targets, the separation and purification of Np/sup 237/ and Pu/sup 238/, the finishing of Np, the preparation of NpO/sub 2/, the disposal of spent resin, and the safety aspects of the handling of hydrazine. The section on the fabrication of NpO/sub 2/-Al slugs will be added later. 76 refs., 22 figs.

  11. 239Np application as tracer of 237Np in liquid effluents and nuclear wastes

    International Nuclear Information System (INIS)

    Diodati, Jorge M; Sartori, F.M.

    2003-01-01

    In this paper a technique to separate and measure 237 Np using 239 Np as a tracer, is presented. After the radiochemical separation, a liquid scintillation measurement with pulse decay discrimination and a γ measurement on the same vial is performed. The method also allows an electrodeposition for an α and γ measurement. The chemical recoveries obtained by LSC and γ spectrometry in vial are similar to those obtained by α and γ spectrometry on electroplated disc. The MDA is 0.08 Bq/l by α spectrometry and 0.22 Bq/l by LSC, with 2 σconfidence interval, and 93.7 % measurement efficiency and 98.0% chemical recovery. (author)

  12. Measurement and analysis of reactivity worth of 237Np sample in cores of TCA and FCA

    International Nuclear Information System (INIS)

    Sakurai, Takeshi; Mori, Takamasa; Okajima, Shigeaki; Tani, Kazuhiro; Suzaki, Takenori; Saito, Masaki

    2009-01-01

    The reactivity worth of 22.87 grams of 237 Np oxide sample was measured and analyzed in seven uranium cores in the Tank-Type Critical Assembly (TCA) and two uranium cores in the Fast Critical Assembly (FCA) at the Japan Atomic Energy Agency. The TCA cores provided a systematic variation in the neutron spectrum between the thermal and resonance energy regions. The FCA cores, XXI and XXV, provided a hard neutron spectrum of the fast reactor and a soft one of the resonance energy region, respectively. Analyses were carried out using the JENDL-3.3 nuclear data library with a Monte Carlo method for the TCA cores and a deterministic method for the FCA cores. The ratios of calculated to experimental (C/E) reactivity worth were between 0.97 and 0.91, and showed no apparent dependence on the neutron spectrum. (author)

  13. Identification of Nilsson orbitals in the superdeformed minimum of {sup 237}Pu

    Energy Technology Data Exchange (ETDEWEB)

    Morgan, Thomas James

    2008-03-31

    In this thesis, a spectroscopy experiment in the second minimum of the double humped fission barrier of {sup 237}Pu is presented, in which, for the first time, single - particle states for a neutron - rich shape isomer with odd neutron number were identified and characterised by their Nilsson quantum numbers. While rotational ({sup 236f}U and {sup 240f}Pu) and vibrational excitations ({sup 240f}Pu) had already been identified earlier in the even-even neighbouring nuclei, now the fission isomers in {sup 237}Pu (t{sub 1/2}=115 ns/1.12 {mu}s) were investigated in a {gamma}-spectroscopy experiment at the Cologne Tandem accelerator. Using the {sup 235}U({alpha},2n) reaction with a pulsed R beam, states in the second minimum were populated. Following the prompt decay of excited states into the ground states of the two shape isomers, the nucleus decays with its halflife, the resulting fission fragments were detected in a specially built 4{pi} parallel plate detector. The extremely rare isomeric {gamma} decays were measured in coincidence with the fission fragments using the highly efficient MINIBALL spectrometer. The background-subtracted {gamma}-ray spectrum was disentangled into contributions from the two shape isomers and 9 excited rotational bands were identified built on the ground states of the two isomers. The ground state spins of the two shape isomers were determined to be I=5/2 (115 ns isomer) and I=9/2 (1120 ns isomer). From the 149 identified {gamma} transitions, independent level schemes were constructed for the two fission isomers in {sup 237}Pu. The consistency of these level schemes was supported by the connecting {gamma} transitions between rotational bands. Furthermore, both level schemes could be combined to a common level scheme, in which the ground state of the long-lived 9/2 isomer was placed 54.0(3) keV above the ground state of the short-lived 5/2 isomer. The resulting level scheme was compared to Hartree-Fock-Bogolyubov single

  14. Identification of Nilsson orbitals in the superdeformed minimum of 237Pu

    International Nuclear Information System (INIS)

    Morgan, Thomas James

    2008-01-01

    In this thesis, a spectroscopy experiment in the second minimum of the double humped fission barrier of 237 Pu is presented, in which, for the first time, single - particle states for a neutron - rich shape isomer with odd neutron number were identified and characterised by their Nilsson quantum numbers. While rotational ( 236f U and 240f Pu) and vibrational excitations ( 240f Pu) had already been identified earlier in the even-even neighbouring nuclei, now the fission isomers in 237 Pu (t 1/2 =115 ns/1.12 μs) were investigated in a γ-spectroscopy experiment at the Cologne Tandem accelerator. Using the 235 U(α,2n) reaction with a pulsed R beam, states in the second minimum were populated. Following the prompt decay of excited states into the ground states of the two shape isomers, the nucleus decays with its halflife, the resulting fission fragments were detected in a specially built 4π parallel plate detector. The extremely rare isomeric γ decays were measured in coincidence with the fission fragments using the highly efficient MINIBALL spectrometer. The background-subtracted γ-ray spectrum was disentangled into contributions from the two shape isomers and 9 excited rotational bands were identified built on the ground states of the two isomers. The ground state spins of the two shape isomers were determined to be I=5/2 (115 ns isomer) and I=9/2 (1120 ns isomer). From the 149 identified γ transitions, independent level schemes were constructed for the two fission isomers in 237 Pu. The consistency of these level schemes was supported by the connecting γ transitions between rotational bands. Furthermore, both level schemes could be combined to a common level scheme, in which the ground state of the long-lived 9/2 isomer was placed 54.0(3) keV above the ground state of the short-lived 5/2 isomer. The resulting level scheme was compared to Hartree-Fock-Bogolyubov single-particle calculations, Nilsson model and Woods-Saxon potential calculations. This

  15. Measurements of fast neutron-induced fission data of Np-237

    Energy Technology Data Exchange (ETDEWEB)

    Win, Than; Saito, Keiichiro; Baba, Mamoru; Iwasaki, Tomohiko; Ibaraki, Masanobu; Miura, Takako; Sanami, Toshiya; Nauchi, Yasushi; Hirakawa, Naohiro [Tohoku Univ., Sendai (Japan). Faculty of Engineering

    1998-03-01

    We have performed the following measurements for {sup 237}Np using the 4.5 MV Dynamitron accelerator of Tohoku University as the pulsed neutron source: (1) Prompt fission neutron spectrum for 0.62 MeV incident neutrons, and (2) Neutron-Induced fission cross-section between 10 and 100 keV. The prompt fission neutron spectrum was measured using TOF method with a heavily shielded NE213 scintillation detector. The Maxwellian temperature T{sub m} derived is 1.28 MeV, which is lower than that of 1.38 MeV in JENDL-3.2. The fission cross sections were measured between 10 - 100 keV. The results are between JENDL-3.2 and ENDF/B-VI. (author)

  16. Study of the excited levels of 233Pa by the 237Np alpha decay

    International Nuclear Information System (INIS)

    Gonzalez, J.; Gaeta, R.; Vano, E.; Los Arcos, J. M.

    1978-01-01

    The excited levels in 233 P a following the 237 N p alpha decay have been studied, by performing different experiences to complete available data and supply new information. Thus, two direct alpha spectrum measurement, one alpha-gamma bidimensional coincidence experiment, three gamma-gamma and gamma-X ray coincidences and some other measurements of the gamma spectrum, direct and coincident with alpha-particles have been made. These last experiences have allowed to obviate usual radiochemical separation methods, the 233 P a radioactive descendent interferences being eliminated by means of the coincidence technic. As a result, a primary decay scheme has been elaborated, including 15 new gamma transitions and two new levels, not observed in the most recent works. (Author) 60 refs

  17. Improvement of evaluated neutron nuclear data for {sup 237}Np and {sup 241}Am

    Energy Technology Data Exchange (ETDEWEB)

    Nakagawa, Tsuneo; Iwamoto, Osamu; Hasegawa, Akira [Japan Atomic Energy Research Inst., Tokai, Ibaraki (Japan). Tokai Research Establishment

    2002-01-01

    The nuclear data of {sup 237}Np and {sup 241}Am that are particularly important among the minor actinides were investigated by comparing JENDL-3.2 with the recent evaluated data and available experimental data. As a result of the study, several defects of JENDL-3.2 data were revealed. They were improved on the basis of experimental data or recent evaluated data. For the both nuclides, main quantities revised in the present work were the resonance parameters, cross sections, angular and energy distributions of secondary neutrons, number of neutrons per fission. The data were given in the neutron energy range from 10{sup -5} eV to 20 MeV, and compiled in the ENDF-6 format. (author)

  18. A comparative study of the carcinogenetic effects of 241Am, 239Pu and 237Np

    International Nuclear Information System (INIS)

    Wang Yumin; Wei Zhikang; Chen Xueyi; Yao Yongheng; Liu Peibin; Xu Lin; Lun Mingyao

    1984-01-01

    In this experiment, 420 wistar rats were used to study the comparative carcinogenetic effects of 241 Am, 239 Pu and 237 Np. These nuclides were injected to animals intravenously, subcutaneously or directly into the lung (Stansen's lung puncture method) in doses of 1.0, 5.0 and 8.5 μCi/kg, respectively. As soluble nitrate, the nuclides were rapidly transfered from the site of injection into the bone and the liver. Osteosarcomas were found in some animals 8 months to one year after intoxication. Diagnosis of osteosarcoma is based on the histopatological examination and X-ray photography. In the Am-poisoned rats the incidence of osteosarcoma is about 31-74%, varied with different doses and different routes of intoxication; in Pu-poisoned rats, the incidence of osteosarcoma is about 55-66%. while in Np-poisoned rats, it is about 36-53%. Primary lung cancers were also found in those animals poisoned by means of Stansen's lung puncture method with the above three nuclides. The incidence of primary lung cancers is about 6% in Am-and Pu-poisoned rats and 13% in Np-poisoned rats. The incidence of metastasis of osteosarcoma in lung is about 25-65% for Am-poisoned rats, 45-55% for Pu-poisoned rats and 41-80% for Np-poisoned rats. The life-span of above poisoned rats was significantly shorter than that of the normal control animals. The chemical weight for 241 Am, 239 Pu and 237 Np in same unit of radioactivity (1.0 μCi) equals to 0.308 μg, 15.9 μg and 1418.7 μg, respectively. For this reason, we have to pay more attention to the chemical mass effect in carcinogenesis of the above three nuclides

  19. Transfer of 241Am and 237Pu from euphausiid moults to a carbonate-rich marine sediment

    International Nuclear Information System (INIS)

    Hargrave, B.T.

    1986-01-01

    Concentrations of 241 Am and 237 Pu adsorbed onto moulted exoskeletons from the euphausiid Meganyctiphanes norvegica decreased exponentially with 50% retention times of 3-7 d when moults were incubated in filtered seawater with small amounts of carbonate-rich sediment. Over 95% of sediment weight was present as -2 ) was greatest in the medium-fine sand fraction which had the highest carbonate content. These particles constituted -2 surface: atoms μm -3 in solution) was 10 3 -10 4 times higher than similar quotients for 241 Am and 237 Pu sorbed to surfaces of organic particles are transferred to sediments. (author)

  20. The inhalation of insoluble iron oxide particles in the sub-micron ranges. Part II - Plutonium-237 labelled aerosols

    International Nuclear Information System (INIS)

    Waite, D.A.; Ramsden, D.

    1971-10-01

    The results of a series of inhalation studies using iron oxide particles in the size range 0.1 to 0.3 um (count median diameter) are described. In this series the aerosols were labelled with plutonium 237. In vivo detection, excretion analysis and crude location studies were obtainable and the results compared to the earlier studies using chromium 51 labelled aerosols. Plutonium 237 can be considered as a simulator for plutonium 239 and attempts are made to extrapolate the results to the problem of the estimation of plutonium 239 in the human lung. (author)

  1. Measurement of fast neutron induced fission cross sections of 232Th, 238U, 237Np and 243Am

    International Nuclear Information System (INIS)

    Kanda, Kazutaka; Sato, Osamu; Yoshida, Kazuo; Imaruoka, Hiromitsu; Terayama, Hiromichi; Yoshida, Masashi; Hirakawa, Naohiro

    1984-01-01

    Neutron induced fission cross sections of 232 Th, 238 U, 237 Np and 243 Am relative to 235 U were measured in the energy range from 1.5 to 6.6 MeV. The present results are compared with experimental results of others and evaluated data in JENDL-2 and ENDF/B-IV. (author)

  2. 49 CFR 237.73 - Protection of bridges from over-weight and over-dimension loads.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 4 2010-10-01 2010-10-01 false Protection of bridges from over-weight and over... (Continued) FEDERAL RAILROAD ADMINISTRATION, DEPARTMENT OF TRANSPORTATION BRIDGE SAFETY STANDARDS Capacity of Bridges § 237.73 Protection of bridges from over-weight and over-dimension loads. (a) Each track owner...

  3. Determination of traces of 237Np in environmental samples by ICP-MS after separation using TOA extraction chromatography

    International Nuclear Information System (INIS)

    Ji, Y.Q.; Li, J.Y.; Luo, S.G.; Wu, T.; Liu, J.L.

    2001-01-01

    A simple, rapid, cost-efficient, and robust method for separation of 237 Np with an extraction chromatographic column (TOA: tri-n-octylamine on Teflon powder) is outlined in detail and further improved for direct ICP-MS analysis. The column efficiently retained 237 Np in 2 mol L -1 HNO 3 medium and all of the 237 Np was easily eluted with 0.02 mol L -1 oxalic acid in 0.16 mol L -1 HNO 3 at 95 C. The separated solutions were free from most matrix elements and were aspirated into the ICP-MS directly. The decontamination factor for 238 U is more than 10 4 . The instrumental detection limit for 237 Np was 0.46 pg mL -1 , which corresponds to 1.2 x 10 -5 Bq mL -1 . The method is more rapid than traditional radiometric techniques. It is also considered to be more suitable for environmental monitoring than existing methods based on TOA. (orig.)

  4. Determination of traces of 237Np in environmental samples by ICP-MS after separation using TOA extraction chromatography.

    Science.gov (United States)

    Ji, Y Q; Li, J Y; Luo, S G; Wu, T; Liu, J L

    2001-09-01

    A simple, rapid, cost-efficient, and robust method for separation of 237Np with an extraction chromatographic column (TOA: tri-n-octylamine on Teflon powder) is outlined in detail and further improved for direct ICP-MS analysis. The column efficiently retained 237Np in 2 mol L(-1) HNO3 medium and all of the 237Np was easily eluted with 0.02 mol L(-1) oxalic acid in 0.16 mol L(-1) HNO3 at 95 degrees C. The separated solutions were free from most matrix elements and were aspirated into the ICP-MS directly. The decontamination factor for 238U is more than 10(4). The instrumental detection limit for 237Np was 0.46 pg mL(-1), which corresponds to 1.2 x 10(-5) Bq mL(-1). The method is more rapid than traditional radiometric techniques. It is also considered to be more suitable for environmental monitoring than existing methods based on TOA.

  5. Development of ionization technique for measurement of fast neutron induced fission products yields of {sup 237}Np

    Energy Technology Data Exchange (ETDEWEB)

    Goverdovski, A.A.; Khryachkov, V.A.; Ketlerov, V.V.; Mitrofanov, V.F.; Ostapenko, Yu.B.; Semenova, N.N.; Fomichev, A.N.; Rodina, L.F. [Institute of Physics and Power Engineering, Obninsk (Russian Federation)

    1997-03-01

    Twin gridded ionization chamber and corresponding software was designed for measurements of masses, kinetic energies and nuclear charges of fission fragments from fast neutron induced fission of {sup 237}Np. The ionization detector design, electronics, data acquisition and processing system and the test results are presented in this paper. (J.P.N.)

  6. Measurement of the fission cross-section ratio for 237Np/235U around 14 MeV neutron energies

    International Nuclear Information System (INIS)

    Desdin, L.; Szegedy, S.; Csikai, J.

    1989-01-01

    Fission cross-section ratio was determined for 237 Np/ 235 U around 14 MeV neutron energies with a back-to-back ionization chamber. Neutrons were produced by a 180 KV accelerator using T(d,n) 4 He reaction. No significant energy dependence was found in the cross section ratio

  7. Post-Irradiation Examination of 237Np Targets for 238Pu Production

    Energy Technology Data Exchange (ETDEWEB)

    Morris, Robert Noel [ORNL; Baldwin, Charles A [ORNL; Hobbs, Randy W [ORNL; Schmidlin, Joshua E [ORNL

    2015-01-01

    Oak Ridge National Laboratory is recovering the US 238Pu production capability and the first step in the process has been to evaluate the performance of a 237Np target cermet pellet encased in an aluminum clad. The process proceeded in 3 steps; the first step was to irradiate capsules of single pellets composed of NpO2 and aluminum power to examine their shrinkage and gas release. These pellets were formed by compressing sintered NpO2 and aluminum powder in a die at high pressure followed by sintering in a vacuum furnace. Three temperatures were chosen for sintering the solution precipitated NpO2 power used for pellet fabrication. The second step was to irradiate partial targets composed of 8 pellets in a semi-prototypical arrangement at the two best performing sintering temperatures to determine which temperature gave a pellet that performed the best under the actual planned irradiation conditions. The third step was to irradiate ~50 pellets in an actual target configuration at design irradiation conditions to assess pellet shrinkage and gas release, target heat transfer, and dimensional stability. The higher sintering temperature appeared to offer the best performance after one cycle of irradiation by having the least shrinkage, thus keeping the heat transfer gap between the pellets and clad small minimizing the pellet operating temperature. The final result of the testing was a target that can meet the initial production goals, satisfy the reactor safety requirements, and can be fabricated in production quantities. The current focus of the program is to verify that the target can be remotely dissembled, the pellets dissolved, and the 238Pu recovered. Tests are being conducted to examine these concerns and to compare results to code predictions. Once the performance of the full length targets has been quantified, the pellet 237Np loading will be revisited to determine if it can be

  8. Joint Institute for Nuclear Research Data Analysis Guide - Berkelium Edition

    International Nuclear Information System (INIS)

    Henderson, R.A.

    2009-01-01

    This is a data analysis guide to the JINR system developed by Roger Henderson. It is intended as a complete guide to the data format and the calibration parameters utilized for the analysis of the data. This guide will provide the basic structure of the data files, the description of the individual data items, and the basic equations developed for the calculation of the results. Currently (7/17/2009), calculation of the calibration parameters is not a covered topic. It is intended that this will be covered in a future update

  9. Chelation and stabilization of berkelium in oxidation state +IV

    Czech Academy of Sciences Publication Activity Database

    Deblonde, G. J.-P.; Sturzbecher-Hoehne, M.; Rupert, P. B.; An, D. D.; Illy, M.-C.; Ralston, C. Y.; Brabec, Jiří; de Jong, W. A.; Strong, R. K.; Abergel, R. J.

    2017-01-01

    Roč. 9, č. 9 (2017), s. 843-849 ISSN 1755-4330 Institutional support: RVO:61388955 Keywords : bioorganic chemistry * chemical bonding * mass spectrometry Subject RIV: CF - Physical ; Theoretical Chemistry OBOR OECD: Physical chemistry Impact factor: 25.870, year: 2016

  10. Standard Test Method for Measuring Reaction Rates by Radioactivation of Neptunium-237

    CERN Document Server

    American Society for Testing and Materials. Philadelphia

    2008-01-01

    1.1 This test method covers procedures for measuring reaction rates by assaying a fission product (F.P.) from the fission reaction 237Np(n,f)F.P. 1.2 The reaction is useful for measuring neutrons with energies from approximately 0.7 to 6 MeV and for irradiation times up to 30 to 40 years. 1.3 Equivalent fission neutron fluence rates as defined in Practice E 261 can be determined. 1.4 Detailed procedures for other fast-neutron detectors are referenced in Practice E 261. 1.5 The values stated in SI units are to be regarded as standard. No other units of measurement are included in this standard. 1.6 This standard does not purport to address all of the safety concerns, if any, associated with its use. It is the responsibility of the user of this standard to establish appropriate safety and health practices and determine the applicability of regulatory limitations prior to use.

  11. The z = 1.6748 C I Absorber Toward the QSO PKS 1756+237

    Science.gov (United States)

    Roth, Katherine C.; Bauer, James M.; Jim, Kevin T. C.

    We have detected C I ground-state absorption at zabs = 1.6748 toward the QSO PKS 1756+237 (zem = 1.725), making this only the fourth known C I QSO absorber. The absence of excited-state fine-structure C I lines is compatible with the redshifted Cosmic Microwave Background Radiation at an expected temperature of TCMBR (1+z) = 7.291 K (Mather et al. 1994, ApJ, 354, L37). We find a 2 σ upper-limit on the C I excitation temperature of Tex <= 7.73(+0.53, -0.46) K (Roth & Bauer 1999, ApJ, submitted). Our Keck HIRES spectra (8.3 km s-1 FWHM) obtained in May 1997 also reveal the existence of Ni II and Fe II lines with a sub-solar Ni/Fe abundance ratio, presumably indicative of dust. We have obtained deep, high resolution (0.3'' FWHM) images in H+K' with the UH 2.2m Tip-Tilt system of the QSO field in order to identify the system responsible for the zabs = 1.6748 absorption. We detect two faint candidate systems within 1.5'' and 3'' (≅ 15 and 30 kpc, Hcirc = 65) of the QSO.

  12. Fission mode analysis of the reaction 237Np(n,f) - possibilities and perspectives

    International Nuclear Information System (INIS)

    Siegler, P.

    1996-01-01

    Fission fragment properties for the reaction 237 Np(n,f) have been measured at the Van de Graaff Laboratory of the IRMM. Using a double gridded ionization chamber the mass, kinetic energy and the angular distribution for both fission fragments could be determined simultaneously for an incident neutron energy range from E n =0.3 MeV upto E n =5.5 MeV. Complete datasets have been acquired for 13 different neutron energies covering sub barrier fission as well as fission in the plateau region. A detailed analysis of the fragment distributions and the respective momenta has been carried out, checking the coherence against the excitation energy of the compound nucleus. The consideration of multi-modal fission offers an improved possibility for the description of the fragment distributions backed up by theoretical calculations on the basis of the multi-model random-neck rupture model of Brosa, Grossmann and Mueller. The changes of the fission fragment properties under investigation are completely described and an interpretation of the findings is presented. (author)

  13. New experimental determination of the neutronic resonance parameters of {sup 237}Np below 500 eV; Nouvelle determination experimentale des parametres de resonances neutroniques de {sup 237}Np en dessous de 500 eV

    Energy Technology Data Exchange (ETDEWEB)

    Gressier, V

    1999-10-01

    For studies of future nuclear reactors dedicated to nuclear waste transmutation, an improvement of the accuracy of the neutron radiative capture cross section of {sup 237}Np appears necessary. In the framework of a collaboration between the Commissariat a l'Energie atomique (CEA) and Institute for Reference Materials and Measurement (IRMM, Geel, Bergium), a new determination of the resonance parameters of {sup 237}Np has been performed. Two types of experiments are carried out at GELINA, the IRMM pulsed neutron source, using the time of flight method: a transmission experiment which is related to the neutron total cross section and a capture experiment which gives the neutron radiative capture cross section. The resonance parameters presented in this work are extracted from the transmission data between 0 and 500 eV with the least square code REFIT, using the Reich-Moore formalism. In parallel, the Doppler effect is investigated. The commonly used free gas model appears inadequate below 20 eV for neptunium dioxide at room temperature. By the use of the program DOPUSH, which calculates the Doppler broadening with a harmonic crystal model according to Lamb's theory, we are able to produce abetter fit of the experimental data for the resonances of {sup 237}Np in NpO{sub 2} at low energy or temperatures. In addition to the resonance parameters, a study of their mean value and distribution is included in this work. (authors)

  14. Independent Yields of Kr and Xe Fragments at Photofission of Odd Nuclei ^{237}Np and ^{243}Am

    CERN Document Server

    Gangrsky, Yu P; Myshinskii, G V; Penionzhkevich, Yu E

    2004-01-01

    he independent yields of fragments Kr (A=89-93) and Xe (A=135-142) at photofission of odd nuclei 237Np and 243Am are presented. The experiments were performed using the bremsstrahlung of 25 MeV electrons on the microtron of FLNR, JINR. A technique was used that included the transportation of fragments which escaped from the target with the gas flow through a capillary and the condensation of inert gases in a cryostat at the temperature of liquid nitrogen. Kr and Xe isotopes were identified by the spectra of their daughter products. The mass number distributions of the independent yields of Kr and Xe isotopes and of the complementary fragments (Y and La at the photofission of ^{237}Np and Nb and Pr at the photofission of ^{243}Am) were obtained.

  15. 242Pu as tracer for simultaneous determination of 237Np and 239,240Pu in environmental samples

    DEFF Research Database (Denmark)

    Chen, Q.J.; Dahlgaard, H.; Nielsen, S.P.

    2002-01-01

    A procedure has been developed using Pu-242 as tracer for simultaneous determination of Np-237 and Pu-239,Pu-240 in environmental samples. The validity of the method has been demonstrated by ICPMS and alpha-spectroscopy for up to 10 gram soil and sediment, seawater up to 200 litres. The paper...... from Np and Pu) R-before/R-after = 1.004 +/- 3.3% (S.D n = 20) and 1 litre seawater R-before/R-after = 1.019+/-1.9% (S.D., n = 12). Results from the intercomparison samples LAEA-135, LAEA-381 and from environmental samples are presented....... describes a suitable chemical procedure for Np and Pu including a quantitative pre-concentration of neptunium and plutonium, preparation of Np4+ and Pu4+, NP(NO3)(6)(2-) and Pu(NO3)(6)(2-), The ratio of Np-237/Pu-242 (or Np-237/Pu-239) before and after the procedure has been determined using 10 g soil (free...

  16. Osteosarcoma induction by plutonium-239, americium-241 and neptunium-237 : the problem of deriving risk estimates for man

    International Nuclear Information System (INIS)

    Taylor, D.M.

    1988-01-01

    Spontaneous bone cancer (osteosarcoma) represents only about 0.3% of all human cancers, but is well known to be inducible in humans by internal contamination with radium-226 and radium-224. plutonium-239, americium-241 and neptunium-237 form, or will form, the principal long-lived alpha particle emitting components of high activity waste and burnt-up nuclear fuel elements. These three nuclides deposit extensively in human bone and although, fortunately, no case of a human osteosarcoma induced by any of these nuclides is known, evidence from animal studies suggests that all three are more effective than radium-226 in inducing osteosarcoma. The assumption that the ratio of the risk factors, the number of osteosarcoma expected per 10000 person/animal Gy, for radium-226 and any other bone-seeking alpha-emitter will be independent of animal species has formed the basis of all the important studies of the radiotoxicity of actinide nuclides in experimental animals. The aim of this communication is to review the risk factors which may be calculated from the various animal studies carried out over the last thirty years with plutonium-237, americium-241 and neptunium-237 and to consider the problems which may arise in extrapolating these risk factors to homo sapiens

  17. A novel Meloidogyne graminicola effector, MgMO237, interacts with multiple host defence-related proteins to manipulate plant basal immunity and promote parasitism.

    Science.gov (United States)

    Chen, Jiansong; Hu, Lili; Sun, Longhua; Lin, Borong; Huang, Kun; Zhuo, Kan; Liao, Jinling

    2018-02-27

    Plant-parasitic nematodes can secrete effector proteins into the host tissue to facilitate their parasitism. In this study, we report a novel effector protein, MgMO237, from Meloidogyne graminicola, which is exclusively expressed within the dorsal oesophageal gland cell and markedly up-regulated in parasitic third-/fourth-stage juveniles of M. graminicola. Transient expression of MgMO237 in protoplasts from rice roots showed that MgMO237 was localized in the cytoplasm and nucleus of the host cells. Rice plants overexpressing MgMO237 showed an increased susceptibility to M. graminicola. In contrast, rice plants expressing RNA interference vectors targeting MgMO237 showed an increased resistance to M. graminicola. In addition, yeast two-hybrid and co-immunoprecipitation assays showed that MgMO237 interacted specifically with three rice endogenous proteins, i.e. 1,3-β-glucan synthase component (OsGSC), cysteine-rich repeat secretory protein 55 (OsCRRSP55) and pathogenesis-related BetvI family protein (OsBetvI), which are all related to host defences. Moreover, MgMO237 can suppress host defence responses, including the expression of host defence-related genes, cell wall callose deposition and the burst of reactive oxygen species. These results demonstrate that the effector MgMO237 probably promotes the parasitism of M. graminicola by interacting with multiple host defence-related proteins and suppressing plant basal immunity in the later parasitic stages of nematodes. © 2018 BSPP AND JOHN WILEY & SONS LTD.

  18. Differences in the behavior of 233Pa, 237Np and 239 Pu in bentonite contaminated by sulfate-reducing bacteria

    International Nuclear Information System (INIS)

    Kudo, A.; Fujikawa, Y.; Takigami, H.; Zheng, J.; Asano, H.; Arai, K.; Yoshikawa, H.; Ito, M.

    1998-01-01

    The behaviors of 233 Pa, 237 Np and 239 Pu in high level radioactive wastes from nuclear fuel reprocessing were investigated by a laboratory experiment. Radioactive wastes are glassified and disposed of in geological repositories encased in bentonite as an additional artificial barrier to protect the environment. There is, however, the possibility that some anaerobic bacteria, especially sulfate-reducing bacteria, may flourish within the bentonite during the long disposal period (more than a century). The effects of sulfate-reducing bacteria on the behavior of the radionuclides within bentonite were investigated using the distribution coefficient (Kd) of 233 Pa, 237 Np and 239 Pu. The Kd was obtained with a 0.22 m membrane filter separating radionuclide contents in solid and liquid phases. The anaerobic bacteria, including sulfate-reducing bacteria, used for this investigation originated from the anaerobic treatment of pulp and paper waste and operated for more than one year at Eh around -85 mV. The bentonite used for this study was produced in Japan. The active anaerobic bacteria clearly accumulates considerable amounts of 233 Pa and 239 Pu by producing high Kd values of nearly 100,000, while Kds of 233 Pa and 239 Pu for the sterilized anaerobic bacteria were less than 10,000. In other words, live anaerobic bacteria can hold considerably higher amounts of the radionuclides compared to dead bacteria. Furthermore, high Kd values were obtained for anaerobic bacteria at pH 5-9. In contrast, Kd values for the radionuclide 237 Np were not influenced by the anaerobic bacteria but were controlled by chemical environmental conditions such as like pH. Another comparison was conducted for the radionuclides for mixtures of non-sterilized bacteria with bentonite. (author)

  19. Sequential Injection Method for Rapid and Simultaneous Determination of 236U, 237Np, and Pu Isotopes in Seawater

    DEFF Research Database (Denmark)

    Qiao, Jixin; Hou, Xiaolin; Steier, Peter

    2013-01-01

    An automated analytical method implemented in a novel dual-column tandem sequential injection (SI) system was developed for simultaneous determination of 236U, 237Np, 239Pu, and 240Pu in seawater samples. A combination of TEVA and UTEVA extraction chromatography was exploited to separate and purify...... target analytes, whereupon plutonium and neptunium were simultaneously isolated and purified on TEVA, while uranium was collected on UTEVA. The separation behavior of U, Np, and Pu on TEVA–UTEVA columns was investigated in detail in order to achieve high chemical yields and complete purification...

  20. Depth profiling of residual activity of ^{237}U fragments as a range verification technique for ^{238}U primary ion beam

    Directory of Open Access Journals (Sweden)

    I. Strašík

    2012-07-01

    Full Text Available Experimental and simulation data concerning fragmentation of ^{238}U ion beam in aluminum, copper, and stainless-steel targets with the initial energy 500 and 950  MeV/u are collected in the paper. A range-verification technique based on depth profiling of residual activity is presented. The irradiated targets were constructed in the stacked-foil geometry and analyzed using gamma-ray spectroscopy. One of the purposes of these experiments was depth profiling of residual activity of induced nuclides and projectile fragments. Among the projectile fragments, special attention is paid to the ^{237}U isotope that has a range very close to the range of the primary ^{238}U ions. Therefore, the depth profiling of the ^{237}U isotope can be utilized for experimental verification of the ^{238}U primary-beam range, which is demonstrated and discussed in the paper. The experimental data are compared with computer simulations by FLUKA, SRIM, and ATIMA, as well as with complementary experiments.

  1. Neutron induced fission cross sections for 232Th, 235,238U, 237Np, and 239Pu

    International Nuclear Information System (INIS)

    Lisowski, P.W.; Ullmann, J.L.; Balestrini, S.J.; Hill, N.W.; Carlson, A.D.; Wasson, O.A.

    1989-01-01

    Neutron-induced fission cross section ratios for samples of 232 Th, 235,238 U, 237 Np and 239 Pu have been measured from 1 to 400 MeV. The fission reaction rate was determined for all samples simultaneously using a fast parallel plate ionization chamber at a 20-m flight path. A well characterized annular proton recoil telescope was used to measure the neutron fluence from 3 to 30 MeV. Those data provided the shape of the 235 U(n,f) cross section relative to the hydrogen scattering cross section. That shape was then normalized to the very accurately known value for 235 U(n,f) at 14.178 MeV. From 30 to 400 MeV cross section values were determined using the neutron fluence measured with a plastic scintillator. Cross section values of 232 Th, 235,238 U, 237 Np and 239 Pu were computed from the ratio data using the authors' values for 235 U(n,f). In addition to providing new results at high neutron energies, these data highlight several areas of deficiency in the evaluated nuclear data files and provide new information for the 235 U(n,f) standard

  2. NKS-Norcmass reference material for analysis of Pu-isotopes and 237Np by mass spectrometry

    International Nuclear Information System (INIS)

    Ross, P.; Nygren, U.; Appelblad, P.; Skipperud, L.; Sjoegren, A.

    2006-04-01

    The aim of the reference material in the Norcmass-project was to produce a low-level ( 239 Pu) sample of sufficient amount to allow individual laboratories to perform several tests without risk of using up the material. Although there are several reference materials available (eg IAEA) few have 239 Pu/ 240 Pu data and almost none have 237 Np/ 239 Pu-data. Those who have (eg IAEA-384) have very high concentrations and are not useful for testing analytical methods designed for low-level measurements where a large sample mass may be required. The reference material consist of the top 10cm of 2mm sieved soil pooled together from 12 different Danish locations collected during 2003. The Soil was blended and sieved through 0.6 and finally through a 0.4 mm sieve. A total amount of 17 kg soil was produced. Several aliquots of the material was subject to analysis by alpha spectrometry and ICP-MS. The material contain 239 + 240 Pu at a concentration of 0.24 ± 0.01 mBq/g and a 240 Pu/ 239 Pu atom ratio of 0.19 ± 0.006. The ratio 237 Np/ 239 Pu was determined to 0.32 ± 0.01. (au)

  3. Efficacy and safety of once-daily NVA237 in patients with moderate-to-severe COPD: the GLOW1 trial

    Directory of Open Access Journals (Sweden)

    D'Urzo Anthony

    2011-12-01

    Full Text Available Abstract Background NVA237 is a once-daily dry-powder formulation of the long-acting muscarinic antagonist glycopyrronium bromide in development for the treatment of chronic obstructive pulmonary disease (COPD. The glycopyrronium bromide in COPD airways clinical study 1 (GLOW1 evaluated the efficacy, safety and tolerability of NVA237 in patients with moderate-to-severe COPD. Methods Patients with COPD with a smoking history of ≥ 10 pack-years, post-bronchodilator forced expiratory volume in 1 second (FEV1 1/forced vital capacity 1 antagonists permitted in patients stabilized on them prior to study entry. The primary outcome measure was trough FEV1 at Week 12. Results A total of 822 patients were randomized to NVA237 (n = 552 or placebo (n = 270. Least squares mean (± standard error trough FEV1 at Week 12 was significantly higher in patients receiving NVA237 (1.408 ± 0.0105 L, versus placebo (1.301 ± 0.0137 L; treatment difference 108 ± 14.8 mL, p 1 were apparent at the end of Day 1 and sustained through Week 26. FEV1 was significantly improved in the NVA237 group versus placebo throughout the 24-hour periods on Day 1 and at Weeks 12 and 26, and at all other visits and timepoints. Transition dyspnoea index focal scores and St. George's Respiratory Questionnaire scores were significantly improved with NVA237 versus placebo at Week 26, with treatment differences of 1.04 (p Conclusions Once-daily NVA237 was safe and well tolerated and provided rapid, sustained improvements in lung function, improvements in dyspnoea, and health-related quality of life, and reduced the risk of exacerbations and the use of rescue medication. Trial registration ClinicalTrials.gov: NCT01005901

  4. Photofission Cross Sections for 237Np in the Energy Interval from 5.27 to 10.83 MeV

    International Nuclear Information System (INIS)

    Geraldo, L.P.; Semmler, R.; Goncalez, O. L.; Mesa, J.; Arruda-Neto, J.D.T.; Garcia, F.; Rodriguez, O.

    2000-01-01

    Photofission cross sections for 237 Np have been measured as a function of energy, in the interval from 5.27 to 10.83 MeV. The gamma-ray spectra were those produced by thermal neutron capture, in 30 different target materials, at a tangential beam hole of the Instituto de Pesquisas Energeticas e Nucleares IEA-R1 2-MW research reactor. The set of experimental data has been unfolded employing least-squares methods and the covariance matrix methodology. The determined photofission cross sections for 237 Np, together with the complete correlation matrix for the involved errors, are presented and are compared with previous measurements reported in the literature. A statistical calculation for the 237 Np photofission cross sections was performed, and the results are compared with the experimental data

  5. First experiments on transmutation studies of iodine-129 and neptunium-237 using relativistic protons of 3.7 GeV

    International Nuclear Information System (INIS)

    Krivopustov, M.I.; Adam, J.; Bradnova, V.

    1997-01-01

    First experiments on the transmutation of long-lived 129 I and 237 Np using relativistic protons of 3.7 GeV are described. Relativistic protons generate in extended Pb-targets substantial neutron fluences. These neutrons get moderated in paraffin and are used for transmutation as follows: 129 (n, γ) 130 I(β - ) → 130 Xe(stable) and 237 Np(n, γ) 238 Np(β - ) →. The isotopes 130 I (T 1/2 =12.36 h) and 238 Np (T 1/2 =2.117 days) were identified radiochemically. One can estimate the transmutation cross section (n, γ) in the given neutron field as σ( 129 I(n, γ))=(10±2)b and σ( 237 Np(n, γ))=(140±30)b. The experiments were carried out in November 1996 at the Synchrophasotron, Laboratory of High Energies (LHE), Dubna, Russia

  6. Montecarlo calculation of the isomeric cross sections ratio for the reaction 237Np(n,2n)236Np

    International Nuclear Information System (INIS)

    Cleri, F.

    1988-01-01

    A Montecarlo calculation of the isomeric cross section ratio for the (n,2n) reaction on 237 Np has been carried out based on the Hauser-Feshbach formulation. A standard energy-dependent optical model potential was used, with zero deformation parameters and no spin-orbit coupling. Investigation was made about the role of the energy cut-off value, of the higher multipole (E2) transition, of the gamma-ray versus second neutron emission, of the value of the spin cutt-off parameter. The results give the correct qualitative energy dependence of the branching ratio, with the assumption that the 1 - level is the ground state. The spin cut-off value obtained indicates a less pronounced deviation of the nuclear moment of inertia from the rigid-body value, with respect to older evaluations for high-mass nuclei. (author)

  7. Ultra-trace determination of neptunium-237 and plutonium isotopes in urine samples by compact accelerator mass spectrometry

    Energy Technology Data Exchange (ETDEWEB)

    Dai, X.; Christl, M.; Kramer-Tremblay, S., E-mail: sheila.kramer-tremblay@cnl.ca [Canadian Nuclear Laboratories, Chalk River, Ontario (Canada); Synal, H-A. [ETH Zurich, Lab. of Ion Beam Physics, Zurich (Switzerland)

    2015-12-15

    Ultra-trace analysis of actinides, such as Pu isotopes and {sup 237}Np, in bioassay samples is often needed for radiation protection programs at nuclear facilities. Accelerator mass spectrometry (AMS), particularly the compact ETH Zurich system “Tandy”, has evolved over the years as one of the most sensitive, selective, and robust techniques for actinide analysis. Employment of the AMS technique can reduce the demands on sample preparation chemistry and increase sample analysis throughput, due to very low instrumental detection limit, high rejection of interferences, and low susceptibility to adverse sample matrices. Initial research and development tests were performed to explore and demonstrate the analytical capability of AMS for Pu and Np urine bioassay. In this study, urine samples spiked with femtogram levels of Np and Pu isotopes were prepared and measured using compact ETH AMS system and the results showed excellent analytical capability for measuring Np and Pu isotopes at femtogram/litre levels in urine. (author)

  8. Review of fission product yields and delayed neutron data for the actinides NP-237, PU-242, AM-242M, AM-243, CM-243 and CM-245

    International Nuclear Information System (INIS)

    Mills, R.W.

    1990-07-01

    A review of fission product yields and delayed neutron data for Np-237, Pu-242, Am-242m, Am-243, Cm-243 and Cm-245 has been undertaken. Gaps in understanding and inconsistencies in existing data were identified and priority areas for further experimental, theoretical and evaluation investigation detailed

  9. High resolution measurement of the 237Np(n,f) cross section from 100keV to 2MeV

    International Nuclear Information System (INIS)

    Plattard, S.; Pranal, Y.; Blons, J.

    1975-01-01

    237 Np fission is one of the reactions utilized in the threshold detector method of neutron spectrometry for the determination of fast neutron spectra in nuclear reactors. Therefore, an accurate knowledge of the energy-dependent fission cross section is essential for a precise generation of the spectral indices of this method. A high resolution measurement of the fission cross section is presented [fr

  10. Localization of the X-linked ocular albinism gene (OA1) between DXS278/DXS237 and DXS143/DXS16 by linkage analysis

    NARCIS (Netherlands)

    Bergen, A. A.; Samanns, C.; van Dorp, D. B.; Ferguson-Smith, M. A.; Gal, A.; Bleeker-Wagemakers, E. M.

    1990-01-01

    Linkage analysis was performed in six families segregating for X-linked ocular albinism of the Nettleship-Falls type using four polymorphic DNA markers from the distal Xp. Linkage was found between the disease locus (OA1) and the loci DXS237 (theta max = 0.06, Zmax = 2.82), DXS278 (theta max = 0.03,

  11. Measurement of 237Np fission rate ratio relative to 235U fission rate in cores with various thermal neutron spectrum at the Kyoto University Critical Assembly

    International Nuclear Information System (INIS)

    Unesaki, Hironobu; Shiroya, Seiji; Iwasaki, Tomohiko; Fujiwara, Daisuke; Kitada, Takanori; Kuroda, Mitsuo; Kohashi, Akio; Kato, Takeshi; Ikeuchi, Yoshitaka

    2000-01-01

    Integral measurements of 237 Np fission rate ratio relative to 235 U fission rate have been performed at Kyoto University Citrical Assembly. The fission rates have been measured using the back-to back type double fission chamber at five thermal cores with different H/ 235 U ratio so that the neutron spectra of the cores were systematically varied. The measured fission rate ratio per atom was 0.00439 to 0.0298, with a typical uncertainty of 2 to 3%. The measured data were compared with the calculated results using SRAC/TWOTRAN and MVP based on JENDL-3.2, which gave the averaged C/E values of 0.93 and 0.95, respectively. Obtained results of C/E using 237 Np cross sections from JENDL-3/2, ENDF/B-VI.5 and JEF2.2 show that the latter two gave smaller results than JENDL-3.2 by about 4%, which clearly reflects the discrepancy in the evaluated cross section among the libraries. This difference arises from both fast fission and resonance region. Although further improvement is recommended, 237 Np fission cross section in JENDL-3.2 is considered to be superior to those in the other libraries and can be adopted for use in design calculations for minor actinide transmutation system using thermal reactors with prediction precision of 237 Np fission rate with in 10%. (author)

  12. Measurement of the neutron-induced fission cross section of 237Np relative to 235U from 0.02 to 30 MeV

    International Nuclear Information System (INIS)

    Behrens, J.W.; Magana, J.W.; Browne, J.C.

    1977-01-01

    The 237 Np/ 235 U fission cross section ratio has been measured from 0.02 to 30 MeV. Using the threshold method, a value of 1.294 +- 0.019 is obtained for the average cross section ratio in the interval from 1.75 to 4.00 MeV

  13. The Synergistic Effect of Valsartan and LAF237 [(S)-1-[(3-Hydroxy-1-Adamantyl)Ammo]acetyl-2-Cyanopyrrolidine] on Vascular Oxidative Stress and Inflammation in Type 2 Diabetic Mice

    Science.gov (United States)

    Shen, Min; Sun, Dongdong; Li, Weijie; Liu, Bing; Wang, Shenxu; Zhang, Zheng; Cao, Feng

    2012-01-01

    Aim. To investigate the combination effects and mechanisms of valsartan (angiotensin II type 1 receptor blocker) and LAF237 (DPP-IV inhibitor) on prevention against oxidative stress and inflammation injury in db/db mice aorta. Methods. Db/db mice (n = 40) were randomized to receive valsartan, LAF237, valsartan plus LAF237, or saline. Oxidative stress and inflammatory reaction in diabetic mice aorta were examined. Results. Valsartan or LAF237 pretreatment significantly increased plasma GLP-1 expression, reduced apoptosis of endothelial cells isolated from diabetic mice aorta. The expression of NAD(P)H oxidase subunits also significantly decreased resulting in decreased superoxide production and ICAM-1 (fold change: valsartan : 7.5 ± 0.7, P valsartan : 5.2 ± 1.2, P valsartan: 3.2 ± 0.6, LAF237: 4.7 ± 0.8; P valsartan and LAF237 resulted in a more significant increase of GLP-1 expression. The decrease of the vascular oxidative stress and inflammation reaction was also higher than monotherapy with valsartan or LAF237. Conclusion. These data indicated that combination treatment with LAF237 and valsartan acts in a synergistic manner on vascular oxidative stress and inflammation in type 2 diabetic mice. PMID:22474415

  14. Numerical methods to analyze alpha spectra and application to the study of neptunium 237 and neptunium 236

    International Nuclear Information System (INIS)

    Garcia-Torano, E.

    1990-01-01

    A set of numerical methods to analize alpha spectra measured with semiconductor detectors are presented. The methods can be divided in two groups, the first being based in the X 2 minimization ands the second in the use of the Fourier Transform. The methods based in the minimization of X 2 can, in turn, be divided according to the model used to fit the spectra. Some of them use a monoenergetic line for the intercomparison with the other peaks in the same spectrum. The others take into account the analytical function developed to represent an alpha line. Both allow the determination of positions and areas of the components, as well as the uncertainties of the results. The Fast Fourier Transform is applied to the second group of methods, which include the smoothing of experimental data, and the deconvolution of spectra. Examples are given of the application of these methods to real spectra. The alpha spectra of 237 Np and 236 Np are studied by using some of the methods described in this work. (Author)

  15. The quadrupole moment and strong interaction parameters from muonic and pionic X-ray studies of 237Np

    International Nuclear Information System (INIS)

    Laat, C.T.A.M. de; Taal, A.; Duinker, W.; Konijn, J.; Petitjean, C.; Reist, H.W.; Mueller, W.; Commission of the European Communities, Geel

    1987-01-01

    The X-ray spectrum of muonic and pionic 237 Np has been investigated with muons and pions stopped in a NpO 2 target. The nuclear spectroscopic quadrupole moment was determined to be Q=3.886±0.006 b from the splittings of the muonic 5g→4f hyperfine complexes. The B(E2)↓-values for the first and second excited states were evaluated as 3.17±0.08 and 2.77±0.10 e 2 b 2 , respectively. A comparison between the muonic and pionic 5g→4f hyperfine complexes yields the strong interaction parameter for the pionic 4f state. For the first time a change of sign as function of Z for the strong interaction quadrupole shift ε 2 (4f) has been observed. The standard optical model predictions agree reasonably well with the measured strong interaction monopole shift, ε 0 (4f), and width, Γ 0 (4f), while they disagree with the experimental value for ε 2 . A stronger s-wave repulsion in the optical potential could explain this effect. (orig.)

  16. Precise 238U(n,2n)237U reaction cross-section measurements using the activation facility at TUNL

    Science.gov (United States)

    Krishichayan, Fnu; Bhike, M.; Tornow, W.

    2014-09-01

    Accurate neutron-induced 238U(n,2n)237U reaction data are required for many practical applications, especially in the field of nuclear energy, including advanced heavy water reactors, where 238U is used as the breeding material to regenerate the fissile material 239Pu. Precise (n,2n) cross-section measurements of 238U are underway at TUNL with mono-energetic neutrons in the 8.0 to 14.0 MeV energy range in steps of 0.25 MeV using the activation technique. After activation of the 0.5 inch diameter and 442 mg 238U foil, the activity of the 208 keV characteristic γ-line is tracked for 6 weeks with a high efficient HPGe clover detector to determine the initial activity needed for the cross-section determination. Results of the cross-section measurements, determined relative to 27Al and 197Au neutron activation monitor foils, and the comparison with theoretical models will be presented during the meeting.

  17. Fragment properties in the fission of 237Np with fast neutrons - an experimental investigation of fission dynamics

    International Nuclear Information System (INIS)

    Naqvi, A.A.

    1980-03-01

    Fission fragment properties such as mass distribution, kinetic energy distribution or number of prompt emitted neutrons as a function of fragment mass can be used to characterize the scission point configuration. The present experiment allows for the first time to investigate these quantities for neutron induced fission in the MeV range. In this way the influence of excitation energy of the saddle point deformation of the fissioning system ( 237 Np + n) can be studied. Neutrons with energies of 0.8 and 5.5 MeV were produced by the Karlsruhe pulsed 3MV Van de Graaff accelerator. Kinetic energies and velocities of correlated fragments were determined by solid state detectors using the time-of-flight technique. The experimentally determined distributions of fragment properties were compared to a recent model suggested by Wilkins et al. which assumes only relatively weak coupling between internal and collective degrees of freedom. At least qualitative agreement is found for most of the results. (orig.) [de

  18. First simultaneous measurement of fission and gamma probabilities of 237U and 239Np via surrogate reactions

    Directory of Open Access Journals (Sweden)

    Marini P.

    2016-01-01

    Full Text Available Fission and gamma decay probabilities of 237U and 239Np have been measured, for the first time simultaneously in dedicated experiments, via the surrogate reactions 238U(3He, 4He and 238U(3He,d, respectively. While a good agreement between our data and neutron-induced data is found for fission probabilities, gamma decay probabilities are several times higher than the corresponding neutron-induced data for each studied nucleus. We study the role of the different spin distributions populated in the surrogate and neutron-induced reactions. The compound nucleus spin distribution populated in the surrogate reaction is extracted from the measured gamma-decay probabilities, and used as input parameter in the statistical model to predict fission probabilities to be compared to our data. A strong disagreement between our data and the prediction is obtained. Preliminary results from an additional dedicated experiment confirm the observed discrepancies, indicating the need of a better understanding of the formation and decay processes of the compound nucleus.

  19. The Synergistic Effect of Valsartan and LAF237 [(S-1-[(3-Hydroxy-1-AdamantylAmmo]acetyl-2-Cyanopyrrolidine] on Vascular Oxidative Stress and Inflammation in Type 2 Diabetic Mice

    Directory of Open Access Journals (Sweden)

    Min Shen

    2012-01-01

    Full Text Available Aim. To investigate the combination effects and mechanisms of valsartan (angiotensin II type 1 receptor blocker and LAF237 (DPP-IV inhibitor on prevention against oxidative stress and inflammation injury in db/db mice aorta. Methods. Db/db mice (n=40 were randomized to receive valsartan, LAF237, valsartan plus LAF237, or saline. Oxidative stress and inflammatory reaction in diabetic mice aorta were examined. Results. Valsartan or LAF237 pretreatment significantly increased plasma GLP-1 expression, reduced apoptosis of endothelial cells isolated from diabetic mice aorta. The expression of NAD(PH oxidase subunits also significantly decreased resulting in decreased superoxide production and ICAM-1 (fold change: valsartan : 7.5 ± 0.7, P<0.05; LAF237: 10.2 ± 1.7, P<0.05, VCAM-1 (fold change: valsartan : 5.2 ± 1.2, P<0.05; LAF237: 4.8 ± 0.6, P<0.05, and MCP-1 (fold change: valsartan: 3.2 ± 0.6, LAF237: 4.7 ± 0.8; P<0.05 expression. Moreover, the combination treatment with valsartan and LAF237 resulted in a more significant increase of GLP-1 expression. The decrease of the vascular oxidative stress and inflammation reaction was also higher than monotherapy with valsartan or LAF237. Conclusion. These data indicated that combination treatment with LAF237 and valsartan acts in a synergistic manner on vascular oxidative stress and inflammation in type 2 diabetic mice.

  20. Comment: 237 [Taxonomy Icon

    Lifescience Database Archive (English)

    Full Text Available for Life Science licensed under CC Attribution2.1 Japan 絵や写真の投稿もできます。右は、没になったティラノザウルス(目がかわいい)です。 ttamura 2008/11/11 12:11:40 2011/09/14 21:10:36 ...

  1. The field migration tests of 237Np, 238Pu, 241Am and 90Sr in aerated loess, aquifer and engineering barrier materials

    International Nuclear Information System (INIS)

    Li Shushen; Wang Zhiming; Zhao Yingjie; Fan Zhiwen; Liu Chunli; An Yongfeng; Yang Yue'e; Wu Qinghua

    2003-01-01

    This paper introduces the field migration tests of 237 Np, 238 Pu, 241 Am and 90 Sr in aerated loess, aquifer and engineering barrier materials. The tests in the aerated loess and engineering barrier materials were carried out under both natural and artificial sprinkling (15 mm/d) conditions. The tests in aquifer were carried out in both assemblies packed with undisturbed aquifer media and a definite undisturbed area. The results indicate that after 3 years tests no significant migrations were seen for all nuclides in engineering barrier materials under two kinds of conditions and in aerated loess under natural conditions. For the aerated loess under artificial sprinkling conditions, 2.7 cm (center of mass) migration in the area directly below the sand tracer layer (named as area 1) and 13 cm (peak) migration in the area outside the area 1 for 90 Sr were observed; There was no migration for 237 Np, 238 Pu and 241 Am. It was discovered that the sand layer used as carrier of nuclide tracer has barrier effect on unsaturated water and an influence on nuclide migration. This has been demonstrated by the inter comparison experiment with both sand and loess as tracer carrier. In the tracer tests of undisturbed aquifer area there was no significant migration of 237 Np, 238 Pu, 241 Am and 90 Sr after 1023 days. In the assembly 8 there was no significant migration for 238 Pu and 241 Am and a small backward migration 0.95 cm for 237 Np and 4.7 cm migration (center of mass) for 90 Sr were observed. The tests also indicate that there is no significant difference of nuclide migration in ordinary and degraded cement

  2. Coulex fission of 234U, 235U, 237Np, and 238Np studied within the SOFIA experimental program

    International Nuclear Information System (INIS)

    Martin, Julie-Fiona

    2014-01-01

    SOFIA (Studies On FIssion with Aladin) is an experimental project which aims at systematically measuring the fission fragments' isotopic yields as well as their total kinetic energy, for a wide variety of fissioning nuclei. The PhD work presented in this dissertation takes part in the SOFIA project, and covers the fission of nuclei in the region of the actinides: 234 U, 235 U, 237 Np and 238 Np. The experiment is led at the heavy-ion accelerator GSI in Darmstadt, Germany. This facility provides intense relativistic primary beam of 238 U. A fragmentation reaction of the primary beam permits to create a secondary beam of radioactive ions, some of which the fission is studied. The ions of the secondary beam are sorted and identified through the FR-S (Fragment Separator), a high resolution recoil spectrometer which is tuned to select the ions of interest.The selected - fissile - ions then fly further to Cave-C, an experimental area where the fission experiment itself takes place. At the entrance of the cave, the secondary beam is excited by Coulomb interaction when flying through an target; the de-excitation process involves low-energy fission. Both fission fragments fly forward in the laboratory frame, due to the relativistic boost inferred from the fissioning nucleus.A complete recoil spectrometer has been designed and built by the SOFIA collaboration in the path of the fission fragments, around the existing ALADIN magnet. The identification of the fragments is performed by means of energy loss, time of flight and deviation in the magnet measurements. Both fission fragments are fully (in mass and charge) and simultaneously identified.This document reports on the analysis performed for (1) the identification of the fissioning system, (2) the identification of both fission fragments, on an event-by-event basis, and (3) the extraction of fission observables: yields, TKE, total prompt neutron multiplicity. These results, concerning the actinides, are discussed, and

  3. Probing the dynamic interface between trimethylamine dehydrogenase (TMADH) and electron transferring flavoprotein (ETF) in the TMADH-2ETF complex: role of the Arg-alpha237 (ETF) and Tyr-442 (TMADH) residue pair.

    Science.gov (United States)

    Burgess, Selena G; Messiha, Hanan Latif; Katona, Gergely; Rigby, Stephen E J; Leys, David; Scrutton, Nigel S

    2008-05-06

    We have used multiple solution state techniques and crystallographic analysis to investigate the importance of a putative transient interaction formed between Arg-alpha237 in electron transferring flavoprotein (ETF) and Tyr-442 in trimethylamine dehydrogenase (TMADH) in complex assembly, electron transfer, and structural imprinting of ETF by TMADH. We have isolated four mutant forms of ETF altered in the identity of the residue at position 237 (alphaR237A, alphaR237K, alphaR237C, and alphaR237E) and with each form studied electron transfer from TMADH to ETF, investigated the reduction potentials of the bound ETF cofactor, and analyzed complex formation. We show that mutation of Arg-alpha237 substantially destabilizes the semiquinone couple of the bound FAD and impedes electron transfer from TMADH to ETF. Crystallographic structures of the mutant ETF proteins indicate that mutation does not perturb the overall structure of ETF, but leads to disruption of an electrostatic network at an ETF domain boundary that likely affects the dynamic properties of ETF in the crystal and in solution. We show that Arg-alpha237 is required for TMADH to structurally imprint the as-purified semiquinone form of wild-type ETF and that the ability of TMADH to facilitate this structural reorganization is lost following (i) redox cycling of ETF, or simple conversion to the oxidized form, and (ii) mutagenesis of Arg-alpha237. We discuss this result in light of recent apparent conflict in the literature relating to the structural imprinting of wild-type ETF. Our studies support a mechanism of electron transfer by conformational sampling as advanced from our previous analysis of the crystal structure of the TMADH-2ETF complex [Leys, D. , Basran, J. , Sutcliffe, M. J., and Scrutton, N. S. (2003) Nature Struct. Biol. 10, 219-225] and point to a key role for the Tyr-442 (TMADH) and Arg-alpha237 (ETF) residue pair in transiently stabilizing productive electron transfer configurations. Our work

  4. Data Evaluation of Actinide Cross Sections: 238Pu, 237Pu, and 236Pu

    Energy Technology Data Exchange (ETDEWEB)

    Guaglioni, S. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States); Jurgenson, E. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States); Descalle, M. A. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States); Thompson, I. J. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States); Ormand, E. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States); Escher, J. E. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States); Younes, W. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States); Mattoon, C. M. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States); Beck, B. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States); Burke, J. T. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States); Bailey, T. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States)

    2017-10-04

    This report documents the recent evaluation of the 236Pu, 237Pu, and 238Pu cross section sets. Nuclear data evaluation is the fundamental interface that takes measured nuclear cross section data and turns them into a continuous curve that 1) is consistent with other measurements and nuclear reaction theory/models, and 2) is required by down-stream users. All experiments that generate nuclear data need to include an evaluation step for their data to be broadly useful to the end users.

  5. The bioavailability of the transuranic elements 237Pu and 241Am for the pond snail, Lymnaea stagnalis L., and their behaviour in selected natural surface waters

    International Nuclear Information System (INIS)

    Thiels, G.M.

    1983-01-01

    An attempt was made to characterise the bioavailability of 237 Pu and 241 Am for the pond snail Lymnaea stagnalis L. in selected surface waters. The uptake, distribution and retention patterns were studied through the contamination route water-snail. The effects of a number of parameters, such as seasonal variation, water type (pH, conductivity, ionic composition) and presence of food, on the bioavailability of the transuranics were evaluated. Finally, an assessment was made concerning the chemical speciation of plutonium and americium in the selected freshwaters

  6. The evaluation of the 237Np fission cross section in the 20 KeV - 20 MeV energy range

    International Nuclear Information System (INIS)

    Dushin, V.N.; Kalinin, V.A.; Shpakov, V.I.

    1997-01-01

    The results of the development of nuclear data evaluation based on the generalized least squares method is presented. The method to interpolate experimental data measured at arbitrary energy points, and their transfer to a fixed energy grid is described. The results of the 237 Np fission cross section measurements performed until 1988 were critically analyzed. A 781 x 781 covariant matrix was derived from the correlation analysis of the experimental results. The results of the evaluation, and the associated correlation matrix was obtained using the generalized least square method. (author). 34 refs, 4 figs, 2 tabs

  7. Neutron induced fission cross sections for /sup 232/Th, /sup 235,238/U, /sup 237/Np and /sup 239/Pu from 1 to 400 MeV

    Energy Technology Data Exchange (ETDEWEB)

    Lisowski, P.W.; Ullmann, J.L.; Balestrini, S.J.; Carlson, A.D.; Wasson, O.A.; Hill, N.W.

    1988-01-01

    Neutron-induced fission cross section ratios for samples of /sup 232/Th, /sup 235,238/U, /sup 237/Np and /sup 239/Pu have been measured from 1 to 400 MeV. The fission reaction rate was determined for all samples simultaneously using a fast parallel plate ionization chamber at a 20-m flight path. A well characterized annular proton recoil telescope was used to measure the neutron fluence up to 30 MeV. These data provided the shape of the /sup 235/U(n,f) cross section relative to the hydrogen scattering cross section. That shape was then normalized to the very accurately known values were determined using the neutron fluence measured with a second proton recoil telescope. Cross section values for /sup 232/Th, /sup 238/U, /sup 237/Np, and /sup 239/Pu were computed from the ratio data using our values for /sup 235/U(n,f). In addition to providing new results at high neutron energies, these data resolve long standing discrepancies among different data sets. 1 ref., 1 fig.

  8. Adsorption-desorption characteristics of plutonium and americium with sediment particles in the estuarine environment: studies using plutonium-237 and americium-241

    International Nuclear Information System (INIS)

    Murray, C.N.; Fukai, R.

    1975-01-01

    The particle formation of plutonium and americium, their adsorption onto fresh water sediments and the desorption from the sediments in sea water were studied in the Laboratory under simulated river-estuary conditions, using γ-emitting plutonium-237 and americium-241. The results of the experiments show that the particle formation of plutonium depends on its valence states, on pH and on the salinity of the medium. For river water at pH4, some 25%, 20% and 30% of the added 237 Pu was in particulate form, larger than 0.45 μm, for Pu (III), Pu (IV) and Pu (VI), respectively, while 65%, 90% and 50% of the respective valence states was associated with particles at pH 8. In sea water the general pattern remains similar, although Pu (VI) is more soluble in sea water owing to higher ligand concentrations for carbonate and bicarbonate complexes. The pH-dependency of particle formation of Am (III) is more steep than that of plutonium and seems to be influenced by colloidal substances occurring in the experimental media. The adsorption-desorption characteristics of plutonium and americium with the sediment in river water as well as sea water reflect the characteristics of their particle formation, being dependent upon such properties as valence states, the pH and salinity of the medium. A sewage effluent added to the media has small but measurable effects on the adsorption-desorption processes of plutonium. (author)

  9. Standard practice for the determination of 237Np, 232Th, 235U and 238U in urine by inductively coupled plasma-Mass spectrometry (ICP-MS) and gamma ray spectrometry.

    CERN Document Server

    American Society for Testing and Materials. Philadelphia

    2005-01-01

    1.1 This practice covers the separation and preconcentration of neptunium-237 (237Np), thorium-232 (232Th), uranium-235 (235U) and uranium-238 (238U) from urine followed by quantitation using ICP-MS. 1.2 This practice can be used to support routine bioassay programs. The minimum detectable concentrations (MDC) for this method, taking the preconcentration factor into account, are approximately 1E-2Bq for 237Np (0.38ng), 2E-6Bq for 232Th (0.50ng), 4E-5Bq for 235U (0.50ng) and 6E-6Bq for 238U (0.48ng). 1.3 This standard does not purport to address all of the safety problems, if any, associated with its use. It is the responsibility of the user of this standard to establish appropriate safety and health practices and determine the applicability of regulatory limitations prior to use.

  10. Transmutation of 129I and 237Np using spallation neutrons produced by 1.5, 3.7 and 7.4 GeV protons

    International Nuclear Information System (INIS)

    Ochs, M.; Schmidt, Th.; Wan, J.-S.

    1999-01-01

    Small samples of approximately 1 g of 129 I and 237 Np, two long-lived radioactive waste nuclides, were exposed to spallation neutron fluences from relatively small metal targets of lead or uranium, surrounded with a paraffin moderator 6 cm thick irradiated with 1.5, 3.7 and 7.4 GeV protons. The (n, γ) transmutation rates have been determined for the two radioactive waste nuclides. Conventional radiochemical La and U sensors and a variety of solid-state nuclear track detectors were irradiated simultaneously with secondary neutrons. The observed secondary neutron fluences appear to be systematically larger, as compared to the calculations with the well-known cascade codes (LAHET from Los Alamos and DCM-CEM from Dubna)

  11. Transmutation of 129I and 237Np using spallation neutrons produced by 1.5, 3.7 and 7.4 GeV protons

    International Nuclear Information System (INIS)

    Wan, J.-S.; Schmidt, T.Th.; Langrock, E.-J.; Vater, P.; Brandt, R.; Adam, J.; Bradnova, V.; Bamblevski, V.P.; Gelovani, L.; Gridnev, T.D.; Kalinnikov, V.G.; Krivopustov, M.I.; Kulakov, B.A.; Sosnin, A.N.; Perelygin, V.P.; Pronskikh, V.S.; Stegailov, V.I.; Tsoupko-Sitnikov, V.M.; Modolo, G.; Odoj, R.; Phlippen, P.-W.; Zamani-Valassiadou, M.; Adloff, J.C.; Debeauvais, M.; Hashemi-Nezhad, S.R.; Guo, S.-L.; Li, L.; Wang, Y.-L.; Dwivedi, K.K.; Zhuk, I.V.; Boulyga, S.F.; Lomonossova, E.M.; Kievitskaja, A.F.; Rakhno, I.L.; Chigrinov, S.E.; Wilson, W.B.

    2001-01-01

    Small samples of 129 I and 237 Np, two long-lived radwaste nuclides, were exposed to spallation neutron fluences from relatively small metal targets of lead and uranium, that were surrounded with a 6 cm thick paraffin moderator, and irradiated with 1.5, 3.7 and 7.4 GeV protons. The (n,γ) transmutation rates were determined for these nuclides. Conventional radiochemical La- and U-sensors and a variety of solid-state nuclear track detectors were irradiated simultaneously with secondary neutrons. Compared with results from calculations with well-known cascade codes (LAHET from Los Alamos and DCM/CEM from Dubna), the observed secondary neutron fluences are larger

  12. Transmutation of {sup 129}I and {sup 237}Np using spallation neutrons produced by 1.5, 3.7 and 7.4 GeV protons

    Energy Technology Data Exchange (ETDEWEB)

    Wan, J.-S.; Schmidt, T.Th.; Langrock, E.-J.; Vater, P.; Brandt, R. E-mail: brandtr@mailer.uni-marburg.de; Adam, J.; Bradnova, V.; Bamblevski, V.P.; Gelovani, L.; Gridnev, T.D.; Kalinnikov, V.G.; Krivopustov, M.I.; Kulakov, B.A.; Sosnin, A.N.; Perelygin, V.P.; Pronskikh, V.S.; Stegailov, V.I.; Tsoupko-Sitnikov, V.M.; Modolo, G.; Odoj, R.; Phlippen, P.-W.; Zamani-Valassiadou, M.; Adloff, J.C.; Debeauvais, M.; Hashemi-Nezhad, S.R.; Guo, S.-L.; Li, L.; Wang, Y.-L.; Dwivedi, K.K.; Zhuk, I.V.; Boulyga, S.F.; Lomonossova, E.M.; Kievitskaja, A.F.; Rakhno, I.L.; Chigrinov, S.E.; Wilson, W.B

    2001-05-11

    Small samples of {sup 129}I and {sup 237}Np, two long-lived radwaste nuclides, were exposed to spallation neutron fluences from relatively small metal targets of lead and uranium, that were surrounded with a 6 cm thick paraffin moderator, and irradiated with 1.5, 3.7 and 7.4 GeV protons. The (n,{gamma}) transmutation rates were determined for these nuclides. Conventional radiochemical La- and U-sensors and a variety of solid-state nuclear track detectors were irradiated simultaneously with secondary neutrons. Compared with results from calculations with well-known cascade codes (LAHET from Los Alamos and DCM/CEM from Dubna), the observed secondary neutron fluences are larger.

  13. Transmutation of 129I and 237Np using spallation neutrons produced by 1.5, 3.7 and 7.4 GeV protons

    Science.gov (United States)

    Wan, J.-S.; Schmidt, Th.; Langrock, E.-J.; Vater, P.; Brandt, R.; Adam, J.; Bradnova, V.; Bamblevski, V. P.; Gelovani, L.; Gridnev, T. D.; Kalinnikov, V. G.; Krivopustov, M. I.; Kulakov, B. A.; Sosnin, A. N.; Perelygin, V. P.; Pronskikh, V. S.; Stegailov, V. I.; Tsoupko-Sitnikov, V. M.; Modolo, G.; Odoj, R.; Phlippen, P.-W.; Zamani-Valassiadou, M.; Adloff, J. C.; Debeauvais, M.; Hashemi-Nezhad, S. R.; Guo, S.-L.; Li, L.; Wang, Y.-L.; Dwivedi, K. K.; Zhuk, I. V.; Boulyga, S. F.; Lomonossova, E. M.; Kievitskaja, A. F.; Rakhno, I. L.; Chigrinov, S. E.; Wilson, W. B.

    2001-05-01

    Small samples of 129I and 237Np, two long-lived radwaste nuclides, were exposed to spallation neutron fluences from relatively small metal targets of lead and uranium, that were surrounded with a 6 cm thick paraffin moderator, and irradiated with 1.5, 3.7 and 7.4 GeV protons. The (n,γ) transmutation rates were determined for these nuclides. Conventional radiochemical La- and U-sensors and a variety of solid-state nuclear track detectors were irradiated simultaneously with secondary neutrons. Compared with results from calculations with well-known cascade codes (LAHET from Los Alamos and DCM/CEM from Dubna), the observed secondary neutron fluences are larger.

  14. Neutron induced fission cross section ratios for 232Th, 235,238U, 237Np and 239Pu from 1 to 400 MeV

    International Nuclear Information System (INIS)

    Lisowski, P.W.; Ullmann, J.L.; Balestrini, S.J.; Carlson, A.D.; Wasson, O.A.; Hill, N.W.

    1988-01-01

    Time-of-flight measurements of neutron induced fission cross section ratios for 232 Th, 235,238 U, 237 Np, and 239 Pu, were performed using the WNR high intensity spallation neutron source located at Los Alamos National Laboratory. A multiple-plate gas ionization chamber located at a 20-m flight path was used to simultaneously measure the fission rate for all samples over the energy range from 1 to 400 MeV. Because the measurements were made with nearly identical neutron fluxes, we were able to cancel many systematic uncertainties present in previous measurements. This allows us to resolve discrepancies among different data sets. In addition, these are the first neutron-induced fission cross section values for most of the nuclei at energies above 30 MeV. (author)

  15. Neutron induced fission cross section ratios for 232Th, /sup 235,238/U, 237Np, and 239Pu from 1 to 400 MeV

    International Nuclear Information System (INIS)

    Lisowski, P.W.; Ullmann, J.L.; Balestrini, S.J.; Carlson, A.D.; Wasson, O.A.; Hill, N.W.

    1988-01-01

    Time-of-flight measurements of neutron induced fission cross section ratios for 232 Th, /sup 235,238/U, 237 Np, and 239 Pu, were performed using the WNR high intensity spallation neutron source located at Los Alamos National Laboratory. A multiple-plate gas ionization chamber located at a 20-m flight path was used to simultaneously measure the fission rate for all samples over the energy range from 1 to 400 MeV. Because the measurements were made with nearly identical neutron fluxes, we were able to cancel many systematic uncertainties present in previous measurements. This allows us to resolve discrepancies among different data sets. In addition, these are the first neutron-induced fission cross section values for most of the nuclei at energies above 30 MeV. 8 refs., 3 figs

  16. A correlation between isomer shifts of 237Np Moessbauer spectra and coordination numbers of Np atoms in neptunyl(V) compounds

    International Nuclear Information System (INIS)

    Saeki, M.; Nakada, M.; Nakamoto, T.; Yamashita, T.; Masaki, N.M.; Krot, N.N.

    1999-01-01

    Five neptunyl(V) compounds were synthesized and studied by 237 Np Moessbauer spectroscopy. The isomer shifts (δ) of the Moessbauer spectra ranged from -18.6 to -19.1 mm/s for the compounds with Np atoms surrounded by 7 oxygen atoms (coordination number (CN) 7). On the other hand, the larger value of δ was obtained for the compound with CN 8. From the comparison of the present results with those reported on neptunyl(V) and (VI) compounds, it is concluded that there is a correlation between the δ and the CN for neptunyl(V) compounds, and the distribution of δ is narrower for neptunyl(V) compounds than that of neptunyl(VI) compounds. (author)

  17. Evaluation of the 237Np neutron cross sections in the energy range from 10-5 eV to 5 MeV

    International Nuclear Information System (INIS)

    Derrien, H.; Fort, E.

    1979-01-01

    The 237 Np neutron cross-sections have been evaluated in the energy range from thermal to 5 MeV. A set of resonance parameters including a negative level, is recommanded after examination of the available experimental data. This set is used 1) to calculate the cross-sections from the thermal region to 150 ev, and 2) to provide the statistical parameters suitable to the calculations in the unresolved region. At higher energies, the transmission coefficients Te are calculated by the coupled channel optical model code ECIS. They are then used as input in the statistical model code FISINGA. The optical model parameters, including the deformation parameters, are those used by Lagrange for the Pu isotopes, slightly modified to reproduce at 40 KeV the total cross-sections obtained from the pure statistical parameters. The recommendations of Lynn concerning the level density parameters have been used. In this paper we describe the various steps of the evaluation

  18. Absolute and relative cross section measurements of 237Np(n,f and 238U(n,f at the National Physical Laboratory

    Directory of Open Access Journals (Sweden)

    Salvador-Castiñeira Paula

    2017-01-01

    Full Text Available Cross section measurements in the fast energy region are being demanded as one of the key ingredients for modelling Generation-IV nuclear power plants. However, in facilities where there are no time-of-flight possibilities or it is not convenient to use them, using the 235U(n,f cross section as a benchmark would require a careful knowledge of the room scatter in the experimental area. In this paper we present measurements of two threshold reactions, 238U(n,f and 237Np(n,f, that could become a standard between their fission threshold and 2.5 MeV, if the discrepancies shown in the evaluations and in some experimental data can be solved. The preliminary results are in agreement with the present ENDF/B-VII.1 evaluation.

  19. Poor adherence to medication as assessed by the Morisky Medication Adherence Scale-8 and low satisfaction with treatment in 237 psoriasis patients.

    Science.gov (United States)

    Saeki, Hidehisa; Imafuku, Shinichi; Abe, Masatoshi; Shintani, Yoichi; Onozuka, Daisuke; Hagihara, Akihito; Katoh, Norito; Murota, Hiroyuki; Takeuchi, Satoshi; Sugaya, Makoto; Tanioka, Miki; Kaneko, Sakae; Masuda, Koji; Hiragun, Takaaki; Inomata, Naoko; Kitami, Yuki; Tsunemi, Yuichiro; Abe, Shinya; Kobayashi, Miwa; Morisky, Donald E; Furue, Masutaka

    2015-04-01

    Previously we assessed the medication adherence for oral and topical remedies by a translated Japanese version of the Morisky Medication Adherence Scale-8 (MMAS-8) together with socioeconomic backgrounds in 3096 Japanese dermatological patients, and found the medication adherence, especially to topical drugs, was poor in these patients. In order to elucidate the disease-specific sociomedical factors, we further sub-analyzed the medication adherence in 237 psoriasis patients and compared it with that in other dermatological diseases such as atopic dermatitis, urticaria or tinea. This study was conducted among patients registered in monitoring system and 3096 eligible patients were enrolled. Our web-based questionnaire included the following items such as age, sex, annual income, main health-care institution, experience of effectiveness by oral or topical medication, overall satisfaction with treatment, and MMAS-8 for oral or topical medication. Mean adherence score by MMAS-8 was 5.2 for oral and 4.3 for topical medication. More patients with psoriasis used a university hospital and fewer used a private clinic compared with those with the other skin disease patients. Experience of drug effectiveness by oral medication and overall satisfaction with treatment was lower in psoriasis patients than in other patients. In oral medication, significantly better adherence was observed in those of higher age and with higher annual income. The adherence to medication, especially to topical drugs, was poor in 237 psoriasis patients. We speculated that some severe psoriasis patients were not sufficiently treated systemically and were resistant to topical therapy, leading to poor adherence. © 2015 Japanese Dermatological Association.

  20. Remarkably High Stability of Late Actinide Dioxide Cations: Extending Chemistry to Pentavalent Berkelium and Californium.

    Science.gov (United States)

    Dau, Phuong D; Vasiliu, Monica; Peterson, Kirk A; Dixon, David A; Gibson, John K

    2017-12-06

    Actinyl chemistry is extended beyond Cm to BkO 2 + and CfO 2 + through transfer of an O atom from NO 2 to BkO + or CfO + , establishing a surprisingly high lower limit of 73 kcal mol -1 for the dissociation energies, D[O-(BkO + )] and D[O-(CfO + )]. CCSD(T) computations are in accord with the observed reactions, and characterize the newly observed dioxide ions as linear pentavalent actinyls; these being the first Bk and Cf species with oxidation states above IV. Computations of actinide dioxide cations AnO 2 + for An=Pa to Lr reveal an unexpected minimum for D[O-(CmO + )]. For CmO 2 + , and AnO 2 + beyond EsO 2 + , the most stable structure has side-on bonded η 2 -(O 2 ), as An III peroxides for An=Cm and Lr, and as An II superoxides for An=Fm, Md, and No. It is predicted that the most stable structure of EsO 2 + is linear [O=Es V =O] + , einsteinyl, and that FmO 2 + and MdO 2 + , like CmO 2 + , also have actinyl(V) structures as local energy minima. The results expand actinide oxidation state chemistry, the realm of the distinctive actinyl moiety, and the non-periodic character towards the end of the periodic table. © 2017 Wiley-VCH Verlag GmbH & Co. KGaA, Weinheim.

  1. Total neutron cross sections of berkelium-249 and californium-249 below 100 eV

    International Nuclear Information System (INIS)

    Benjamin, R.W.; Harvey, J.A.; Hill, N.W.; Pandey, M.S.; Carlton, R.F.

    1979-01-01

    The neutron total cross sections of 249 Bk and 249 Cf have been measured from 0.03 to 100 eV using the Oak Ridge Electron Linear Accelerator (ORELA) as a source of pulsed neutrons. The 1.6 mm dia. cylindrical transmission samples contained initially up to 5.3 mg of 98% 249 Bk and 2% 249 Cf: 4.5 years later, when the final measurements were made, the composition of the samples had become 2.5% 249 Bk, 96.9% 249 Cf, and 0.6% 245 Cm. Samples were cooled with liquid nitrogen to reduce Doppler broadening. Thirty-nine resonances were identified in 249 Bk and analyzed using a single-level Breit-Wigner formalism. Fifty-five resonances were identified in 249 Cf and analyzed using an R-matrix multilevel formalism. Fifty-five resonances were identified in 249 Cf and analyzed using an R-matrix multilevel formalism. The resonance parameters obtained have been used to determine the average level spacings and the s-wave neutron and fission strength functions. Where possible, bound-level parameters were derived to fit the thermal neutron total cross section data

  2. Capture and Fission rate of 232-Th, 238-U, 237-Np and 239-Pu from spallation neutrons in a huge block of lead.

    CERN Document Server

    Vlachoudis, Vasilis

    2000-01-01

    The study is centered on the research of the incineration possibility of nuclear waste, by the association of a particle accelerator with a multiplying medium of neutrons, in the project "Energy Amplifier" of C. Rubbia. It consists of the experimental determination of the rates of capture and fission of certain elements (232-Th, 238-U, 237-Np and 239-Pu) subjected to a fluence of fast spallation neutrons. These neutrons are produced by the interaction of high kinetic energy protons (several GeV) provided by the CERN-PS accelerator, on a large lead solid volume. The measurement techniques used in this work, are based on the activation of elements in the lead volume and the subsequent gamma spectroscopy of the activated elements, and also by the detection of fission fragment traces. The development, of a Monte Carlo code makes it possible, on one hand, to better understand the relevant processes, and on the other hand, to validate the code, by comparison with measurements, for the design and the construction of...

  3. Criticality Data for Spherical 235U, 239Pu, and 237Np Systems Reflector-Moderated by Low Capturing-Moderator Materials

    International Nuclear Information System (INIS)

    Loaiza, David J.; Stratton, William

    2004-01-01

    The critical dimensions of spherical systems moderated and reflected by low-capturing materials such as D 2 O, BeO, Be, and C were investigated. A parametric study of the critical mass of enriched uranium, plutonium, and neptunium is examined and tabulated. The results obtained expand on the understanding of reflector-moderated critical systems, and they show regions of unstable criticality for 235 U and 239 Pu reflected cores at intermediate densities. This instability is illustrated by calculations of the positive reactivity coefficient of volume expansion. The coefficient is positive, not negative, in the intermediate density region for 235 U and 239 Pu systems. For 237 Np cores reflected by the same moderator, the effect is negligible. The critical dimensions were calculated with the DANTSYS codes using the Hansen-Roach cross-section libraries. This study is both a summary of mostly unpublished calculations and new calculations. Experimental data for these configurations are extremely limited. These are examined in the text when applicable

  4. Accurate 238U(n , 2 n )237U reaction cross-section measurements from 6.5 to 14.8 MeV

    Science.gov (United States)

    Krishichayan, Bhike, M.; Tornow, W.; Tonchev, A. P.; Kawano, T.

    2017-10-01

    The cross section for the 238U(n ,2 n )237U reaction has been measured in the incident neutron energy range from 6.5 to 14.8 MeV in small energy steps using an activation technique. Monoenergetic neutron beams were produced via the 2H(d ,n )3He and 3H(d ,n )4He reactions. 238U targets were activated along with Au and Al monitor foils to determine the incident neutron flux. The activity of the reaction products was measured in TUNL's low-background counting facility using high-resolution γ -ray spectroscopy. The results are compared with previous measurements and latest data evaluations. Statistical-model calculations, based on the Hauser-Feshbach formalism, have been carried out using the CoH3 code and are compared with the experimental results. The present self-consistent and high-quality data are important for stockpile stewardship and nuclear forensic purposes as well as for the design and operation of fast reactors.

  5. Elastic and Raman scattering of 8.5-11.4 MeV photons from 159Tb, 165Ho, and 237Np

    International Nuclear Information System (INIS)

    Bar-Noy, T.; Moreh, R.

    1977-01-01

    Differential cross sections for elastic and inelastic Raman scattering from the deformed heavy nuclei 159 Tb, 165 Ho and 237 Np were measured at five energies between 8.5 and 11.4 MeV. Angular distributions at four angles between 90 0 and 140 0 for both elastic and inelastic scattering at 9.0 and 11.4 MeV were also measured. The monoenergetic photons were obtained from thermal neutron capture in Ni and Cr. All the angular distributions and the elastic and Raman scattering at the higher energies are in good overall agreement with theoretical predictions. The theory is based on a modified simple rotator model of the giant resonance in which the effect of Delbrueck scattering was included. A trend of both the elastic and Raman scattering at lower energies to be stronger than expected are suggested by the data. However, the ratio between the Raman and elastic scattering seem to be in good agreement with theory throughout the whole energy range. This shows that there is no need to introduce a direct nonresonant component to the imaginary part of the elastic scattering amplitude to explain the experimental data. (Auth.)

  6. Determination of neutron resonance parameters of Neptunium 237 between 0 and 500 eV. The covariance matrices of statistical and of systematic origin, relating the resonance parameters, are also given; Determination des parametres des resonances neutroniques du neptunium 237, en dessous de 500eV, et obtention des matrices de covariances statistiques et systematiques entre les parametres de ces resonances

    Energy Technology Data Exchange (ETDEWEB)

    Lepretre, A.; Herault, N. [CEA Saclay, Dept. d' Astrophysique de Physique des Particules, de Physique Nucleaire et de l' Instrumentation Associee, 91- Gif sur Yvette (France); Brusegan, A.; Noguere, G.; Siegler, P. [Institut des Materiaux et des Metrologies - IRMM, Joint Research Centre, Gell (Belgium)

    2002-12-01

    This report is a follow up of the report CEA DAPNIA/SPHN-99-04T of Vincent Gressier. In the frame of a collaboration between the 'Commissariat a l'Energie Atomique (CEA)' and the Institute for Reference Materials and Measurement (IRMM, Geel, Belgique), the resonance parameters of neptunium 237 have been determined in the energy interval between 0 and 500 eV. These parameters have been obtained by using the Refit code in analysing simultaneously three transmission experiments. The covariance matrix of statistical origin is provided. A new method, based on various sensitivity studies is proposed for determining also the covariance matrix of systematic origin, relating the resonance parameters. From an experimental viewpoint, the study indicated that, with a large probability, the background spectrum has structure. A two dimensional profiler for the neutron density has been proved feasible. Such a profiler could, among others, demonstrate the existence of the structured background. (authors)

  7. Study of the excited levels of 233{sup P}a by the 237{sup N}p alpha decay; Estudio de los niveles excitados en el 233{sup P}a por la desintegracion alfa del 237{sup N}p

    Energy Technology Data Exchange (ETDEWEB)

    Gonzalez, J; Gaeta, R; Vano, E; Los Arcos, J M

    1978-07-01

    The excited levels in 233{sup P}a following the 237{sup N}p alpha decay have been studied, by performing different experiences to complete available data and supply new information. Thus, two direct alpha spectrum measurement, one alpha-gamma bidimensional coincidence experiment, three gamma-gamma and gamma-X ray coincidences and some other measurements of the gamma spectrum, direct and coincident with alpha-particles have been made. These last experiences have allowed to obviate usual radiochemical separation methods, the 233{sup P}a radioactive descendent interferences being eliminated by means of the coincidence technic. As a result, a primary decay scheme has been elaborated, including 15 new gamma transitions and two new levels, not observed in the most recent works. (Author) 60 refs.

  8. 234 - 237_Uduma_Elementall

    African Journals Online (AJOL)

    pc

    risks from exposure to geological materials associa with mining ... alue both to the mining industry and to the health of the commun cal exploitation ... ent production, ceramics petroleum .... controls can minimize exposures to workers and.

  9. The Effect of Radiation Dose and Chemotherapy on Overall Survival in 237 Patients With Stage III Non-Small-Cell Lung Cancer

    International Nuclear Information System (INIS)

    Wang Li; Correa, Candace R.; Zhao Lujun; Hayman, James; Kalemkerian, Gregory P.; Lyons, Susan; Cease, Kemp; Brenner, Dean; Kong Fengming

    2009-01-01

    Purpose: To study the effects of radiation dose, chemotherapy, and their interaction in patients with unresectable or medically inoperable Stage III non-small-cell lung cancer (NSCLC). Methods and Materials: A total of 237 consecutive Stage III NSCLC patients were evaluated. Median follow-up was 69.0 months. Patients were treated with radiation therapy (RT) alone (n = 106), sequential chemoradiation (n = 69), or concurrent chemoradiation (n = 62). The primary endpoint was overall survival (OS). Radiation dose ranged from 30 to 102.9 Gy (median 60 Gy), corresponding to a bioequivalent dose (BED) of 39 to 124.5 Gy (median 72 Gy). Results: The median OS of the entire cohort was 12.6 months, and 2- and 5-year survival rates were 22.4% and 10.0%, respectively. Multivariable Cox regression model demonstrated that Karnofsky performance status (p = 0.020), weight loss < 5% (p = 0.017), chemotherapy (yes vs. no), sequence of chemoradiation (sequential vs. concurrent; p < 0.001), and BED (p < 0.001) were significant predictors of OS. For patients treated with RT alone, sequential chemoradiation, and concurrent chemoradiation, median survival was 7.4, 14.9, and 15.8 months, and 5-year OS was 3.3%, 7.5%, and 19.4%, respectively (p < 0.001). The effect of higher radiation doses on survival was independent of whether chemotherapy was given. Conclusion: Radiation dose and use of chemotherapy are independent predictors of OS in Stage III NSCLC, and concurrent chemoradiation is associated with the best survival. There is no interaction between RT dose and chemotherapy.

  10. Theoretical analyses of (n,xn) reactions on sup 235 U, sup 238 U, sup 237 Np, and sup 239 Pu for ENDF/B-VI

    Energy Technology Data Exchange (ETDEWEB)

    Young, P.G.; Arthur, E.D.

    1991-01-01

    Theoretical analyses were performed of neutron-induced reactions on {sup 235}U, {sup 238}U, {sup 237}Np, and {sup 239}Pu between 0.01 and 20 MeV in order to calculate neutron emission cross sections and spectra for ENDF/B-VI evaluations. Coupled-channel optical model potentials were obtained for each target nucleus by fitting total, elastic, and inelastic scattering cross section data, as well as low-energy average resonance data. The resulting deformed optical model potentials were used to calculate direct (n,n{prime}) cross sections and transmission coefficients for use in Hauser-Feshbach statistical theory analyses. A fission model with multiple barrier representation, width fluctuation corrections, and preequilibrium corrections were included in the analyses. Direct cross sections for higher-lying vibrational states were calculated using DWBA theory, normalized using B(E{ell}) values determined from (d,d{prime}) and Coulomb excitation data, where available, and from systematics otherwise. Initial fission barrier parameters and transition state density enhancements appropriate to the compound systems involved were obtained from previous analyses, especially fits to charged-particle fission probability data. The parameters for the fission model were adjusted for each target system to obtain optimum agreement with direct (n,f) cross section measurements, taking account of the various multichance fission channels, that is, the different compound systems involved. The results from these analyses were used to calculate most of the neutron (n,n), (n,n{prime}), and (n,xn) cross section data in the ENDF/B/VI evaluations for the above nuclei, and all of the energy-angle correlated spectra. The deformed optical model and fission model parameterizations are described. Comparisons are given between the results of these analyses and the previous ENDF/B-V evaluations as well as with the available experimental data. 14 refs., 3 figs., 1 tab.

  11. Evaluation and improvement of cross section accuracy for most important dosimetry reactions 27Al(n,p), 56Fe(n,p) and 237Np(n,f) including covariance data

    International Nuclear Information System (INIS)

    Zolotarev, K.I.

    2004-02-01

    New evaluations of cross sections and their uncertainties for dosimetry reactions 27 Al(n,p) , 56 Fe(n,p) and 237 Np(n,f) have been carried out in the frame work of IAEA Research Contract No. 11372/RB. Data files prepared for this reactions in the ENDF-6 format may be consider as candidates for the new International Reactor Dosimetry File: IRDF-2002. (author)

  12. Evaluation and improvement of cross section accuracy for most important dosimetry reactions 27Al(n,p), 56Fe(n,p) and 237Np(n,f) including covariance data

    Energy Technology Data Exchange (ETDEWEB)

    Zolotarev, K I [Institute of Physics and Power Engineering, Obninsk (Russian Federation)

    2004-02-01

    New evaluations of cross sections and their uncertainties for dosimetry reactions {sup 27}Al(n,p) , {sup 56}Fe(n,p) and {sup 237}Np(n,f) have been carried out in the frame work of IAEA Research Contract No. 11372/RB. Data files prepared for this reactions in the ENDF-6 format may be consider as candidates for the new International Reactor Dosimetry File: IRDF-2002. (author)

  13. Prevalence, distribution and functional significance of the -237C to T polymorphism in the IL-12Rβ2 promoter in Indian tuberculosis patients.

    Directory of Open Access Journals (Sweden)

    Vikas Kumar Verma

    Full Text Available Cytokine/cytokine receptor gene polymorphisms related to structure/expression could impact immune response. Hence, the -237 polymorphic site in the 5' promoter region of the IL-12Rβ2 (SNP ID: rs11810249 gene associated with the AP-4 transcription motif GAGCTG, was examined. Amplicons encompassing the polymorphism were generated from 46 pulmonary tuberculosis patients, 35 family contacts and 28 miscellaneous volunteers and sequenced. The C allele predominated among patients, (93.4%, 43/46, and in all volunteers and contacts screened, but the T allele was exclusively limited to patients, (6.5%, 3/46. The functional impact of this polymorphism on transcriptional activity was assessed by Luciferase-reporter and electrophoretic mobility shift assays (EMSA. Luciferase-reporter assays showed a significant reduction in transcriptional efficiency with T compared to C allele. The reduction in transcriptional efficiency with the T allele construct (pGIL-12Rb2-T, in U-87MG, THP-1 and Jurkat cell lines, were 53, 37.6, and 49.8% respectively, compared to the C allele construct (pGIL-12Rb2-C. Similarly, densitometric analysis of the EMSA assay showed reduced binding of the AP-4 transcription factor, to T compared to the C nucleotide probe. Reduced mRNA expression in all patients (3/3 harboring the T allele was seen, whereas individuals with the C allele exhibited high mRNA expression (17/25; 68%, p = 0.05. These observations were in agreement with the in vitro assessment of the promoter activity by Luciferase-reporter and EMSA assays. The reduced expression of IL-12Rβ2 transcripts in 8 patients despite having the C allele was attributed to the predominant over expression of the suppressors (IL-4 and GATA-3 and reduced expression of enhancers (IFN-α of IL-12Rβ2 transcripts. The 17 high IL-12Rβ2 mRNA expressers had significantly elevated IFN-α mRNA levels compared to low expressers and volunteers. Notwithstanding the presence of high levels of IL-12R

  14. Measurement of neutron-induced fission cross-sections of Th232, U238, U233 and Np237 relative to U235 from 1 MeV to 200 MeV

    Energy Technology Data Exchange (ETDEWEB)

    Shcherbakov, O.A.; Laptev, A.B.; Petrov, G.A. [Petersburg Nuclear Physics Inst., Gatchina, Leningrad district (Russian Federation); Fomichev, A.V.; Donets, A.Y.; Osetrov, O.I.

    1998-11-01

    The measurements of neutron-induced cross-section ratios for Th232, U238, U233 and Np237 relative to U235 have been carried out in the energy range from 1 MeV up to 200 MeV using the neutron time-of-flight spectrometer GNEIS based on 1 GeV proton synchrocyclotron. Below 20 MeV, the results of present measurements are roughly in agreement with evaluated data though there are some discrepances to be resolved. (author)

  15. 16 CFR 23.7 - Misuse of the words “platinum,” “iridium,” “palladium,” “ruthenium,” “rhodium,” and “osmium.”

    Science.gov (United States)

    2010-01-01

    ... 16 Commercial Practices 1 2010-01-01 2010-01-01 false Misuse of the words âplatinum,â âiridium,â... § 23.7 Misuse of the words “platinum,” “iridium,” “palladium,” “ruthenium,” “rhodium,” and “osmium.” (a) It is unfair or deceptive to use the words “platinum,” “iridium,” “palladium,” “ruthenium,” “rhodium...

  16. Measurement of the Neutron Capture Cross Sections of $^{233}$U, $^{237}$Np, $^{240,242}$Pu, $^{241,243}$Am and $^{245}$Cm with a Total Absorption Calorimeter at n_TOF

    CERN Multimedia

    Beer, H; Wiescher, M; Cox, J; Rapp, W; Embid, M; Dababneh, S

    2002-01-01

    Accurate and reliable neutron capture cross section data for actinides are necessary for the poper design, safety regulation and precise performance assessment of transmutation devices such as Fast Critical Reactors or Accelerator Driven Systems (ADS). The goal of this proposal is the measurement of the neutron capture cross sections of $^{233}$U, $^{237}$Np, $^{240,242}$Pu, $^{241,243}$Am and $^{245}$Cm at n_TOF with an accuracy of 5~\\%. $^{233}$U plays an essential role in the Th fuel cycle, which has been proposed as a safer and cleaner alternative to the U fuel cycle. The capture cross sections of $^{237}$Np,$^{240,242}$Pu, $^{241,243}$Am and $^{245}$Cm play a key role in the design and optimization of a strategy for the Nuclear Waste Transmutation. A high accuracy can be achieved at n_TOF in such measurements due to a combination of features unique in the world: high instantaneous neutron fluence and excellent energy resolution of the facility, innovative Data Acquisition System based on flash ADCs and t...

  17. Evaluation of thermal neutron cross-sections and resonance integrals of protactinium, americium, curium, and berkelium isotopes

    International Nuclear Information System (INIS)

    Belanova, T.S.

    1994-12-01

    Data on the thermal neutron fission and capture cross-sections as well as their corresponding resonance integrals are reviewed and analysed. The data are classified according to the form of neutron spectra under investigation. The weighted mean values of the cross-sections and resonance integrals for every type of neutron spectra were adopted as evaluated data. (author). 87 refs, 2 tabs

  18. Oxidation-reduction properties of americium, curium, berkelium, californium, einsteinium and fermium, and thermodynamic consequences for the 5f series

    International Nuclear Information System (INIS)

    Samhoun, K.

    1976-01-01

    The amalgamation of 5f elements from Am to Fm has been studied by using 241 Am, 244 Cm, 249 Bk, 249 Cf, 252 Cf, 253 Es, 254 Es, 252 Fm and 255 Fm with two electrochemical methods, radiocoulometry and radiopolarography, perfectly adapted to investigate extremely diluted solutions when the concentration of electroactive species is as low as 10 -16 M. The theory of radiocoulometry has been developed in the general cases of reversible and irreversible electrode process. It has been used to interpret the experimental data on the kinetic curves of amalgamation, and to estimate the standard rate constant of the electrode process in complexing medium (citric). On the other hand the radiopolarographic method has been applied to study the mechanism of reduction at the dropping mercury electrode of cations M 3+ in aqueous medium to the metal M with formation of amalgam. The results are exploited into two directions: 1- Acquisition of some data concerning the oxidation-reduction properties of elements from Am to Fm. Therefore the standard electrode E 0 [M(III-0)] potentials for Bk, Cf and Es, and the standard electrode E 0 [M(II-0)] potential for Fm are estimated and the relative stability of each oxidation state (from II to VII) of 5f elements is discussed; 2- Acquisition of unknown thermodynamic data on transcalifornium elements. Correlations between 4f and 5f elements are precised and some divergences appear for the second half of 4f and 5f series (i.e. for 65 [fr

  19. The fission cross sections of 230Th, 232Th, 233U, 234U, 236U, 238U, 237Np, 239Pu and 242Pu relative 235U at 14.74 MeV neutron energy

    International Nuclear Information System (INIS)

    Meadows, J.W.

    1986-12-01

    The measurement of the fission cross section ratios of nine isotopes relative to 235 U at an average neutron energy of 14.74 MeV is described with particular attention to the determination of corrections and to sources of error. The results are compared to ENDF/B-V and to other measurements of the past decade. The ratio of the neutron induced fission cross section for these isotopes to the fission cross section for 235 U are: 230 Th - 0.290 +- 1.9%; 232 Th - 0.191 +- 1.9%; 233 U - 1.132 +- 0.7%; 234 U - 0.998 +- 1.0%; 236 U - 0.791 +- 1.1%; 238 U - 0.587 +- 1.1%; 237 Np - 1.060 +- 1.4%; 239 Pu - 1.152 +- 1.1%; 242 Pu - 0.967 +- 1.0%. 40 refs., 11 tabs., 9 figs

  20. Determination of neutron resonance parameters of Neptunium 237 between 0 and 500 eV. The covariance matrices of statistical and of systematic origin, relating the resonance parameters, are also given

    International Nuclear Information System (INIS)

    Lepretre, A.; Herault, N.; Brusegan, A.; Noguere, G.; Siegler, P.

    2002-12-01

    This report is a follow up of the report CEA DAPNIA/SPHN-99-04T of Vincent Gressier. In the frame of a collaboration between the 'Commissariat a l'Energie Atomique (CEA)' and the Institute for Reference Materials and Measurement (IRMM, Geel, Belgique), the resonance parameters of neptunium 237 have been determined in the energy interval between 0 and 500 eV. These parameters have been obtained by using the Refit code in analysing simultaneously three transmission experiments. The covariance matrix of statistical origin is provided. A new method, based on various sensitivity studies is proposed for determining also the covariance matrix of systematic origin, relating the resonance parameters. From an experimental viewpoint, the study indicated that, with a large probability, the background spectrum has structure. A two dimensional profiler for the neutron density has been proved feasible. Such a profiler could, among others, demonstrate the existence of the structured background. (authors)

  1. Neutron induced fission cross section ratios for /sup 232/Th, /sup 235,238/U, /sup 237/Np, and /sup 239/Pu from 1 to 400 MeV

    Energy Technology Data Exchange (ETDEWEB)

    Lisowski, P.W.; Ullmann, J.L.; Balestrini, S.J.; Carlson, A.D.; Wasson, O.A.; Hill, N.W.

    1988-01-01

    Time-of-flight measurements of neutron induced fission cross section ratios for /sup 232/Th, /sup 235,238/U, /sup 237/Np, and /sup 239/Pu, were performed using the WNR high intensity spallation neutron source located at Los Alamos National Laboratory. A multiple-plate gas ionization chamber located at a 20-m flight path was used to simultaneously measure the fission rate for all samples over the energy range from 1 to 400 MeV. Because the measurements were made with nearly identical neutron fluxes, we were able to cancel many systematic uncertainties present in previous measurements. This allows us to resolve discrepancies among different data sets. In addition, these are the first neutron-induced fission cross section values for most of the nuclei at energies above 30 MeV. 8 refs., 3 figs.

  2. Wind-tunnel investigation of longitudinal and lateral-directional stability and control characteristics of a 0.237-scale model of a remotely piloted research vehicle with a thick, high-aspect-ratio supercritical wing

    Science.gov (United States)

    Byrdsong, T. A.; Brooks, C. W., Jr.

    1980-01-01

    A 0.237-scale model of a remotely piloted research vehicle equipped with a thick, high-aspect-ratio supercritical wing was tested in the Langley 8-foot transonic tunnel to provide experimental data for a prediction of the static stability and control characteristics of the research vehicle as well as to provide an estimate of vehicle flight characteristics for a computer simulation program used in the planning and execution of specific flight-research mission. Data were obtained at a Reynolds number of 16.5 x 10 to the 6th power per meter for Mach numbers up to 0.92. The results indicate regions of longitudinal instability; however, an adequate margin of longitudinal stability exists at a selected cruise condition. Satisfactory effectiveness of pitch, roll, and yaw control was also demonstrated.

  3. Investigation of Neutron Spectra and Transmutation of ^{129}I, ^{237}Np and Other Nuclides with 1.5 GeV Protons from the Dubna Nuclotron Using the Electronuclear Setup "Energy plus Transmutation"

    CERN Document Server

    Krivopustov, M I; Balabekyan, A R; Batusov, Yu A; Bielewicz, M; Brandt, R; Chaloun, P; Chultem, D; Dwivedi, K K; Elishev, A F; Fragopoulou, M; Henzl, V; Henzlová, D; Kalinnikov, V G; Kievets, M K; Krása, A; Krizek, F; Kugler, A; Manolopoulou, Metaxia; Mariin, I I; Nourreddine, A; Odoj, R; Pavliouk, A V; Pronskikh, V S; Robotham, H; Siemon, K; Szuta, M; Stegailov, V I; Solnyshkin, A A; Sosnin, A N; Stoulos, S; Tsoupko-Sitnikov, V M; Tumendelger, T; Wojecehowski, A; Wagner, V; Wan, J S; Westmeier, W; Zamani-Valasiadou, M; Kumawat, H; Kumar, V; Zaverioukha, O S; Zhuk, I V

    2004-01-01

    Experiments which are part of the scientific program "Investigations of physical aspects of electronuclear method of energy production and transmutation for radioactive waste of atomic energetics using relativistic beams from the JINR Synchrophasotron/Nuclotron" (project "Energy plus Transmutation") are described. A large lead target surrounded by a four-section uranium blanket with total weight of 206.4 kg natural uranium was irradiated with 1.5 GeV protons from the new cryogenic accelerator Nuclotron. Radiochemical sensors were exposed to the secondary particle fluences inside and on top of the target assembly. Two long-lived radioactive waste of atomic energetics sensors ^{129}I and ^{237}Np (approximately 1 g weight each) and stable nuclides ^{27}Al, ^{59}Co, ^{127}I, ^{139}La, ^{197}Au and ^{209}Bi as well as natural and enriched uranium were used. In addition, various solid state nuclear track detectors and nuclear emulsions were exposed simultaneously. The experimental results confirm the theoretical e...

  4. About the first experiment on investigation of 129I, 237Np, 238Pu and 239Pu transmutation at the nuclotron 2.52 GeV deuteron beam in neutron field generated in U/Pb-assembly 'Energy plus transmutation'

    International Nuclear Information System (INIS)

    Krivopustov, M.I.; Pavliouk, A.V.; Malakhov, A.I.

    2008-01-01

    Preliminary results of the first experiment with energy 2.52 GeV at the electronuclear setup which consists of Pb-target (diameter 8.4 cm, length 45.6 cm) and nat U-blanket (206.4 kg), transmutation samples of 129 I, 237 Np, 238 Pu and 239 Pu (radioecological aspect) are described. Hermetically sealed samples in notable amounts are gathered in atomic reactors and setups of industries which use nuclear materials and nuclear technologies were irradiated in the field of neutrons produced in the Pb-target and propagated in the nat U-blanket. Estimates of transmutations were obtained as a result of measurements of gamma activities of the samples. The information about the space and energy distribution of neutrons in the volume of the lead target and the uranium blanket was obtained with the help of sets of activation threshold detectors (Al, Co, Y, I, Au, Bi and others), solid-state nuclear track detectors, 3 He neutron detectors and nuclear emulsion. Comparison of the experimental data with the results of simulation with the MCNPX program was performed

  5. 237 MORAL AND PSYCHOLOGICAL FILICIDE: EXAMINING THE ...

    African Journals Online (AJOL)

    Fr. Ikenga

    Nigerian campuses of higher learning or the like that engage in sex for .... children and causing various risks to the child safety… ... their babies with them for up to 18months gives room for bonding of mother and child, .... be likely to adversely affect his physical, mental, spiritual, moral or social development or employed as.

  6. 33 CFR 117.237 - Christina River.

    Science.gov (United States)

    2010-07-01

    ... five short blasts, and an audio voice warning stating, “Attention, Attention. Norfolk Southern Railroad... infrared detectors, until green lights are displayed on the swing span. (c) The draw of the Third Street...

  7. TMFunction data: 237 [TMFunction[Archive

    Lifescience Database Archive (English)

    Full Text Available HC. J Biol Chem. 2000 Jul 14;275(28):21017-24 mutagenesis ... affinity chromatography 1AJJ ... LDLR_HUMAN (P01130) Helix ... ligand binding site; surface exposed; acidic residue; conserved

  8. 237 MORAL AND PSYCHOLOGICAL FILICIDE: EXAMINING THE ...

    African Journals Online (AJOL)

    Fr. Ikenga

    no good hospital, employment opportunity or social infrastructure and where poverty level is over. 300%, how will you expect a family to reject the gains from anti-social ..... Likewise, every child has the right to maintenance by his parents or guardians in accordance with the extent of their means, and the child has the right, ...

  9. Publications | Page 237 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    ... the agro-pastoral systems of Tanzania : a gendered analysis (open access) ... This paper deals with the ways in which gender and caste identities marginalise particular groups from access to water in a village in periurban Hyderabad, India.

  10. 48 CFR 237.7301 - Definitions.

    Science.gov (United States)

    2010-10-01

    ... means any public or private post-secondary school, junior college, college, university, or other degree... of study at any level beyond high school. (b) Nonprofit organization means any organization described... good standing in a curriculum designed to lead to the granting of a recognized degree, during the term...

  11. Publications | Page 237 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    ... we aim to widen the impact of our investment and advance development research. ... from place to place; this is mainly due to social and economic influences. ... with reference to specific technologies: the computer and the cell phone.

  12. 50 CFR 648.237 - Framework provisions.

    Science.gov (United States)

    2010-10-01

    ... Committee composition and process; description and identification of essential fish habitat; description and identification of habitat areas of particular concern; overfishing definition and related thresholds and targets... measures must come from one or more of the following categories: Minimum fish size; maximum fish size; gear...

  13. Human Leukocyte Antigen-A, B, C, DRB1, and DQB1 Allele and Haplotype Frequencies in a Subset of 237 Donors in the South African Bone Marrow Registry

    Directory of Open Access Journals (Sweden)

    Mqondisi Tshabalala

    2018-01-01

    Full Text Available Human leukocyte antigen- (HLA- A, HLA-B, HLA-C, HLA-DRB1, and HLA-DQB1 allele and haplotype frequencies were studied in a subset of 237 volunteer bone marrow donors registered at the South African Bone Marrow Registry (SABMR. Hapl-o-Mat software was used to compute allele and haplotype frequencies from individuals typed at various resolutions, with some alleles in multiple allele code (MAC format. Four hundred and thirty-eight HLA-A, 235 HLA-B, 234 HLA-DRB1, 41 HLA-DQB1, and 29 HLA-C alleles are reported. The most frequent alleles were A∗02:02g (0.096, B∗07:02g (0.082, C∗07:02g (0.180, DQB1∗06:02 (0.157, and DRB1∗15:01 (0.072. The most common haplotype was A∗03:01g~B∗07:02g~C∗07:02g~DQB1∗06:02~DRB1∗15:01 (0.067, which has also been reported in other populations. Deviations from Hardy-Weinberg equilibrium were observed in A, B, and DRB1 loci, with C~DQB1 being the only locus pair in linkage disequilibrium. This study describes allele and haplotype frequencies from a subset of donors registered at SABMR, the only active bone marrow donor registry in Africa. Although the sample size was small, our results form a key resource for future population studies, disease association studies, and donor recruitment strategies.

  14. Modelling of the radioactive daughter elements in soil to assess radiation impact due to contaminated irrigation water by parents of 231Pa, 226Ra, 238U, 237Np and 239Pu

    International Nuclear Information System (INIS)

    Bela Kanyar; Katalin Eged; Tunde Katona; Gerhard Proehl; Ulla Bergstroem; Bengt Hallberg; Shelly Mobbs; Geert Olyslaegers; Theo Zeevaert; Palome Pinedo; Inmaculade Simon

    2004-01-01

    Radioactive wastes may contain both parent and daughter radionuclides. In some cases the transfer parameters of the daughter radio-elements differ significantly from that of the parent ones and therefore the dose contributions in the different pathways might be important to assess separately. The present work has compared 5 different site specific models by a scenario, using contaminated water for drinking and irrigation. Altogether 5 radionuclides from the investigated 10 ones contained radioactive daughter elements. In general, for long term studies in biosphere the steady-state formulations of processes are adequate to assess the contamination, except the infiltration into the deeper soil and sediment layers. According to the results of the modelling and computer simulations, the following daughters are to be assessed separately from their parents with respect to the radiation impact: for parent 231 Pa the daughter 227 Ac, for parent 226 Ra the daughters 222 Rn, 210 Pb and 210 Po and for parent 237 Np the daughter 233 Pa. The dose contributions of the daughters from parents 238 U and 239 Pu are less significant during the considered 100-10000 years. In case of contamination of irrigation water with 1 Bq x m -3 of the parent radionuclide 231 Pa, more than 90% of the external dose from soil exposure comes from the daughter 227 Ac (annually 15 nSv). By a similar contamination with 226 Ra as a parent radionuclide, 60% of the ingestion dose is due to food contamination with the daughters 210 Pb and 210 Po (approximately 150 nSv x a -1 ). (author)

  15. Correction to: Kürti, László. “Review Article: Documenting Immigrants, Boarding Houses and Ethnographers. Burdosház Amerikából – Balogh Balázs néprajzkutató nyomában ('A Boarding House from America - in the Footsteps of Ethnographer Balázs Balogh'. Directed by Dezső Zsigmond, produced by Dunatáj Alapítvány, Camera: Arthur Bálint, 2015, 50:39 minutes.” Hungarian Cultural Studies. e-Journal of the American Hungarian Educators Association, Volume 9 (2016 DOI: 10.5195/ahea.2016.237

    Directory of Open Access Journals (Sweden)

    László Kürti

    2017-09-01

    Full Text Available Changing the incorrect word “script” to “scrip”. The word “scrip” refers to the method of payment used in companies instead of legal tender. The original article can be found via the DOI: http://doc.doi.org/10.5195/ahea.2016.237

  16. The fission cross sections of /sup 230/Th, /sup 232/Th, /sup 233/U, /sup 234/U, /sup 236/U, /sup 238/U, /sup 237/Np, /sup 239/Pu and /sup 242/Pu relative /sup 235/U at 14. 74 MeV neutron energy

    Energy Technology Data Exchange (ETDEWEB)

    Meadows, J.W.

    1986-12-01

    The measurement of the fission cross section ratios of nine isotopes relative to /sup 235/U at an average neutron energy of 14.74 MeV is described with particular attention to the determination of corrections and to sources of error. The results are compared to ENDF/B-V and to other measurements of the past decade. The ratio of the neutron induced fission cross section for these isotopes to the fission cross section for /sup 235/U are: /sup 230/Th - 0.290 +- 1.9%; /sup 232/Th - 0.191 +- 1.9%; /sup 233/U - 1.132 +- 0.7%; /sup 234/U - 0.998 +- 1.0%; /sup 236/U - 0.791 +- 1.1%; /sup 238/U - 0.587 +- 1.1%; /sup 237/Np - 1.060 +- 1.4%; /sup 239/Pu - 1.152 +- 1.1%; /sup 242/Pu - 0.967 +- 1.0%. 40 refs., 11 tabs., 9 figs.

  17. 48 CFR 237.102-72 - Contracts for management services.

    Science.gov (United States)

    2010-10-01

    ... development or production of the major system ensures that Federal employees are responsible for determining— (1) Courses of action to be taken in the best interest of the Government; and (2) Best technical performance for the warfighter; and (c) The contract requires that the prime contractor for the contract may...

  18. Vocational Education in Corrections. Information Series No. 237.

    Science.gov (United States)

    Day, Sherman R.; McCane, Mel R.

    Vocational education programs in America's correctional institutions have been financially handicapped, since security demands the greatest portion of resource allocations. Four eras in the development of the correctional system are generally identified: era of punishment and retribution, era of restraint or reform, era of rehabilitation and…

  19. 48 CFR 1852.237-73 - Release of sensitive information.

    Science.gov (United States)

    2010-10-01

    ... technology system for NASA that contains sensitive information, the service provider's contract shall include the clause at 1852.204-76, Security Requirements for Unclassified Information Technology Resources. The Security Requirements clause requires the service provider to implement an Information Technology...

  20. 30 CFR 23.7 - Specific requirements for approval.

    Science.gov (United States)

    2010-07-01

    ... adequate instructions for the installation and connection of telephones and signal devices in order that the safety of these devices and other circuits shall not be diminished by improper installation. MSHA reserves the right to require the attachment of wiring diagrams to the cases of telephones and signal...

  1. 48 CFR 237.104 - Personal services contracts.

    Science.gov (United States)

    2010-10-01

    ... intelligence component or counter-intelligence organization of DoD; or (iii) Directly support the mission of... travel between home or place of business and official duty station. (iii) Coordinate with the civilian... SYSTEM, DEPARTMENT OF DEFENSE SPECIAL CATEGORIES OF CONTRACTING SERVICE CONTRACTING Service Contracts...

  2. 48 CFR 252.237-7016 - Delivery tickets.

    Science.gov (United States)

    2010-10-01

    ...), and (e) to the basic clause: (c) Before the Contractor picks up articles for service under this... of serviced laundry on the delivery ticket. The Contracting Officer will ensure that this weight and... articles for service under this contract, the Contracting Officer will ensure that each bag is weighed and...

  3. 48 CFR 252.237-7017 - Individual laundry.

    Science.gov (United States)

    2010-10-01

    ... clause: Individual Laundry (DEC 1991) (a) The Contractor shall provide laundry service under this... services. (c) Charges for individual laundry will be on a per unit bundle or a piece-rate basis. The... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Individual laundry. 252...

  4. 48 CFR 1552.237-71 - Technical direction.

    Science.gov (United States)

    2010-10-01

    .... (d) Technical direction will be issued in writing or confirmed in writing within five (5) days after... 48 Federal Acquisition Regulations System 6 2010-10-01 2010-10-01 true Technical direction. 1552... Technical direction. As prescribed in 1537.110, insert a clause substantially the same as the following...

  5. 48 CFR 1852.237-72 - Access to Sensitive Information.

    Science.gov (United States)

    2010-10-01

    ... position in another procurement. (2) Safeguard sensitive information coming into its possession from... relating to ethics, conflicts of interest, corruption, and other criminal or civil matters relating to the...

  6. 7 CFR 2.37 - Chief Information Officer.

    Science.gov (United States)

    2010-01-01

    ... acquisition; (iii) Approve the appointment of the program manager for each major information technology... recommendations to Agency Heads for the removal or replacement of information technology project managers, when... regarding information technology matters. (2) Overseeing all information technology and information resource...

  7. Neptunium 237 behaviour in subcellular fractions of rat kidneys

    International Nuclear Information System (INIS)

    Kreslov, V.V.; Maksutova, A.Ya.; Mushkacheva, G.S.

    1978-01-01

    Subcellular distribution of intravenously injected (1 and 0.5 μCi/rat) neptunium nitrate (5- and 6-valent) in kidneys of rat males and females has been investigated. It has been shown that the radionuclide was unevenly distributed within the cell. As early as 24 hours after administration, about 50 per cent of neptunium were concentrated in the mitochondrial fraction. The data are presented on variations in neptunium behaviour within subcellular fractions of rat kidneys depending on the sex of animals, valency and dose of the isotope

  8. All projects related to | Page 237 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Impact of Tobacco Tax Increases in Latin America. Project. Raising taxes ... Region: North and Central America, South America, Argentina, Bolivia, Brazil, Chile, Colombia, Mexico, Peru. Program: Food, Environment, and Health. Total Funding: ...

  9. 48 CFR 652.237-71 - Identification/Building Pass.

    Science.gov (United States)

    2010-10-01

    ..., Information Security Programs Division, Industrial Security Branch (DS/ISP/INB) on its cleared employees..., Information Security Programs Division, Industrial Security Branch (DS/ISP/INB): (i) SF-85P, Questionnaire for... Pass (APR 2004) (a) Contractors working in domestic facilities who already possess a security clearance...

  10. 48 CFR 1252.237-72 - Prohibition on advertising.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 5 2010-10-01 2010-10-01 false Prohibition on advertising... Prohibition on advertising. As prescribed in (TAR) 48 CFR 1213.7101 and 1237.7003, insert the following clause: Prohibition on Advertising (JAN 1996) The contractor or its representatives (including training instructors...

  11. 237 Missionary Historiography: A Factor for the Emergence of ...

    African Journals Online (AJOL)

    User

    2012-01-24

    Jan 24, 2012 ... Nmah, P. E. - Department of Religion and Human Relations, Nnamdi ... It is also the identification of a people with the aspirations and interests of their .... edifices where they congregate for worship, and yet cannot say from their ... robot- like worshippers of the prophet Isaiah's description ( Isaiah 29: 13), or.

  12. 29 CFR 1952.237 - Changes to approved plans.

    Science.gov (United States)

    2010-07-01

    ... 1910.142) in agriculture (except for agricultural temporary labor camps associated with egg, poultry or red meat production, or the post-harvest processing of agricultural or horticultural commodities.) The... Regulations Relating to Labor (Continued) OCCUPATIONAL SAFETY AND HEALTH ADMINISTRATION, DEPARTMENT OF LABOR...

  13. 48 CFR 1252.237-71 - Certification of data.

    Science.gov (United States)

    2010-10-01

    ... (Public Law 104-106, 41 U.S.C. 425, note) and DOT Memorandum dated July 17, 1996. (a) The offeror...., company profile; qualifications; background statements; brochures) submitted with its offer is current, accurate, and complete as of the date of its offer. (b) The offeror understands that any inaccurate data...

  14. 237 Interrogating Nollywood and its Sources of Funding: The Case ...

    African Journals Online (AJOL)

    The problem of funding continues to haunt start-ups in Africa and there seems to be ... hospitality business where funding, which catalyses the efforts of independent ..... find her testimony too easy, but Emem Isong made the above statement in ...

  15. 49 CFR 237.71 - Determination of bridge load capacities.

    Science.gov (United States)

    2010-10-01

    ... capacity shall be determined. (g) Bridge load capacity may be expressed in terms of numerical values related to a standard system of bridge loads, but shall in any case be stated in terms of weight and...) Bridge load capacity may be expressed in terms of both normal and maximum load conditions. Operation of...

  16. 48 CFR 1552.237-70 - Contract publication review procedures.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 6 2010-10-01 2010-10-01 true Contract publication review... journal article to the Project Officer, and one copy to the Contracting Officer. (d) If the Government has... AGENCY CLAUSES AND FORMS SOLICITATION PROVISIONS AND CONTRACT CLAUSES Texts of Provisions and Clauses...

  17. Selective localization of neptunium-237 in the nuclei of mammalian cells. Localisation selective du neptunium-237 au sein des noyaux des cellules de mammiferes

    Energy Technology Data Exchange (ETDEWEB)

    Galle, P.; Boulahdour, H. (Faculte de Medecine, 94 - Creteil (FR)); Metivier, H. (CEA Centre d' Etudes Nucleaires de Fontenay-aux-Roses, 92 (FR). Inst. de Protection et de Surete Nucleaire)

    1992-01-01

    After injection in the rat of soluble neptunium salt, the distribution of this element was studied at the subcellular level by electron microscopy and electron probe microanalysis. Abnormal structures have been observed by electron microscopy in the nuclei of hepatocytes, and the same structures have also been observed in the nuclei of the proximal tubules cells of the kidney. These structures are formed of clusters of very small and dense particles, several nanometers in diameter. The clusters are localized in the central part of the nuclei and they are separate from nucleoli and heterochromatin. Electron probe X-ray analysis of this cluster have shown that they contain neptunium associated with phosphorus. In the cell containing neptunium inclusions, other non specific lesions are also observed (nuclear pycnosis, mitochondrial depletion).

  18. 48 CFR 252.237-7023 - Continuation of Essential Contractor Services.

    Science.gov (United States)

    2010-10-01

    ... provide a written plan for continuing the performance of essential contractor services identified in...; and (v) The approach for communicating expectations to contractor employees regarding their roles and... or other designated representative as expeditiously as possible and use its best efforts to cooperate...

  19. Natural Disasters and Adaptive Capacity. OECD Development Centre Working Paper No. 237

    Science.gov (United States)

    Dayton-Johnson, Jeff

    2004-01-01

    Natural disasters (droughts, earthquakes, epidemics, floods, wind storms) damage wellbeing, both in their immediate and long-term aftermath, and because the insecurity of exposure to disasters is in itself harmful to risk-averse people. As such, mitigating and coping with the risk of natural disasters is a pressing issue for economic development.…

  20. Standardized UXO Technology Demonstration Site, Blind Grid Scoring Record No. 237

    National Research Council Canada - National Science Library

    Overbay, Larry, Jr; Robitaille, George; Boutin, Matthew; Fling, Rick; McClung, Christina

    2005-01-01

    ...) utilizing the APG Standardized UXO Technology Demonstration Site Blind Grid. The scoring record was coordinated by Larry Overbay and the Standardized UXO Technology Demonstration Site Scoring Committee...

  1. Yeast Interacting Proteins Database: YGL237C, YOR047C [Yeast Interacting Proteins Database

    Lifescience Database Archive (English)

    Full Text Available ene expression; interacts with protein kinase Snf1p, glucose sensors Snf3p and Rgt2p, and TATA-binding prote... expression; interacts with protein kinase Snf1p, glucose sensors Snf3p and Rgt2p, and TATA-binding protein

  2. 48 CFR 237.7204 - Format and clauses for educational service agreements.

    Science.gov (United States)

    2010-10-01

    ... order, official Government order, or other written communication). The (insert type of request, such as, delivery order, official Government order, or other written communication) will contain the number of this... completion. (j) “Curriculum” means a series of courses having a unified purpose and belonging primarily to...

  3. 48 CFR 252.237-7013 - Instruction to offerors (bulk weight).

    Science.gov (United States)

    2010-10-01

    ...) Offers shall be submitted on a unit price per pound of serviced laundry. Unit prices shall include all costs to the Government of providing the service, including pickup and delivery charges. (b) The Contracting Officer will evaluate bids based on the estimated pounds of serviced laundry stated in the...

  4. 48 CFR 252.237-7015 - Loss or damage (weight of articles).

    Science.gov (United States)

    2010-10-01

    ... shall— (1) Be liable for return of the articles furnished for service under this contract; and (2... in servicing the laundry is ____ percent of the weight recorded on delivery tickets when the laundry...

  5. Sexospécificités | Page 237 | CRDI - Centre de recherches pour le ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    The word is out: smoking tobacco through a waterpipe — a narghile or hookah — is as dangerous, or more so than smoking cigarettes. So says the World Health Organization, which issued an advisory in 2005 that made news around the world. It noted that "waterpipe smoking is associated with many of the same risks as ...

  6. Determination of 237Np in environmental and nuclear samples: A review of the analytical method

    International Nuclear Information System (INIS)

    Thakur, P.; Mulholland, G.P.

    2012-01-01

    A number of analytical methods has been developed and used for the determination of neptunium in environmental and nuclear fuel samples using alpha, ICP–MS spectrometry, and other analytical techniques. This review summarizes and discusses development of the radiochemical procedures for separation of neptunium (Np), since the beginning of the nuclear industry, followed by a more detailed discussion on recent trends in the separation of neptunium. This article also highlights the progress in analytical methods and issues associated with the determination of neptunium in environmental samples. - Highlights: ► Determination of Np in environmental and nuclear samples is reviewed. ► Various analytical methods used for the determination of Np are listed. ► Progress and issues associated with the determination of Np are discussed.

  7. 48 CFR 52.237-4 - Payment by Government to Contractor.

    Science.gov (United States)

    2010-10-01

    ... Officer shall retain 10 percent of the estimated payment until final completion and acceptance of the... full, without retaining a percentage. Also, on completion and acceptance of each unit or division for which the price is stated separately, the Contracting Officer may authorize full payment for that unit...

  8. Vapour pressure of D2O - Ice at temperatures below 237 K

    International Nuclear Information System (INIS)

    Heras, J.M.; Asensio, M.C.; Estiu, G.; Viscido, L.

    1984-01-01

    Accurate measurements of heavy water ice vapour pressures between 193 and 253 K have been carried out and an equation based on thermodynamic data has been derived in order to calculate the D 2 O-ice vapour pressures between 173 and 273 K. The agreement between our calculated vapour pressures and the available experimental data including those in this paper, is very good. The comparison between the theoretical calculations of H 2 O-ice and D 2 O-ice vapour pressures confirms the experimental evidence that H 2 O-ice is more volatile than D 2 O-ice at all temperatures in agreement with the vapour isotopic effect theory (VPIE).(author)

  9. Pin cell discontinuity factors in the transient 3-D discrete ordinates code TORT-TD - 237

    International Nuclear Information System (INIS)

    Seubert, A.

    2010-01-01

    This paper describes the application of generalized equivalence theory to the time-dependent 3-D discrete ordinates neutron transport code TORT-TD. The introduction of pin cell discontinuity factors into the discrete ordinates transport equation is described by assuming a linear dependence of the homogenized neutron angular flux within a pin cell which may be discontinuous at the interfaces to adjacent cells. The homogenized flux discontinuity at cell interfaces is expressed by pin cell discontinuity factors which in turn are determined from fuel assembly lattice calculations using HELIOS. Application of TORT-TD to the all rods in state of the PWR MOX/UO 2 Core Transient Benchmark with pin cell homogenized nuclear cross sections demonstrate the potential of pin cell discontinuity factors to reduce pin cell homogenization errors. (authors)

  10. 34 CFR 237.1 - What is the Christa McAuliffe Fellowship Program?

    Science.gov (United States)

    2010-07-01

    ... to reward excellence in teaching by encouraging outstanding teachers to continue their education, to develop innovative programs, to consult with or assist LEAs, private schools, or private school systems...

  11. 48 CFR 52.237-8 - Restriction on Severance Payments to Foreign Nationals.

    Science.gov (United States)

    2010-10-01

    ... ACQUISITION REGULATION (CONTINUED) CLAUSES AND FORMS SOLICITATION PROVISIONS AND CONTRACT CLAUSES Text of... 2003) (a) The Federal Acquisition Regulation (FAR), at 31.205-6(g)(6), limits the cost allowability of...

  12. SU-E-J-237: Image Feature Based DRR and Portal Image Registration

    Energy Technology Data Exchange (ETDEWEB)

    Wang, X; Chang, J [NY Weill Cornell Medical Ctr, NY (United States)

    2014-06-01

    Purpose: Two-dimensional (2D) matching of the kV X-ray and digitally reconstructed radiography (DRR) images is an important setup technique for image-guided radiotherapy (IGRT). In our clinics, mutual information based methods are used for this purpose on commercial linear accelerators, but with often needs for manual corrections. This work proved the feasibility that feature based image transform can be used to register kV and DRR images. Methods: The scale invariant feature transform (SIFT) method was implemented to detect the matching image details (or key points) between the kV and DRR images. These key points represent high image intensity gradients, and thus the scale invariant features. Due to the poor image contrast from our kV image, direct application of the SIFT method yielded many detection errors. To assist the finding of key points, the center coordinates of the kV and DRR images were read from the DICOM header, and the two groups of key points with similar relative positions to their corresponding centers were paired up. Using these points, a rigid transform (with scaling, horizontal and vertical shifts) was estimated. We also artificially introduced vertical and horizontal shifts to test the accuracy of our registration method on anterior-posterior (AP) and lateral pelvic images. Results: The results provided a satisfactory overlay of the transformed kV onto the DRR image. The introduced vs. detected shifts were fit into a linear regression. In the AP image experiments, linear regression analysis showed a slope of 1.15 and 0.98 with an R2 of 0.89 and 0.99 for the horizontal and vertical shifts, respectively. The results are 1.2 and 1.3 with R2 of 0.72 and 0.82 for the lateral image shifts. Conclusion: This work provided an alternative technique for kV to DRR alignment. Further improvements in the estimation accuracy and image contrast tolerance are underway.

  13. 237 Impacts socio-sanitaires et environnementaux de la gestion des ...

    African Journals Online (AJOL)

    SWEET

    pollution des eaux, érosion des berges des mayo et alluvionnement des drains, amènent à suggérer des ... D'après TUCCI [1], les principaux défis de la gestion des inondations sont liés à l'occupation des ... populations aux impacts des inondations de plaine est due, d'après TUCCI [1], au manque de connaissance.

  14. 27 CFR 19.237 - Disapproval of bonds or consents of surety.

    Science.gov (United States)

    2010-04-01

    ..., prohibiting the manufacture, sale, importation, or transportation of spirits, wine, beer, or other... States, if such provision related to internal revenue or customs taxation of spirits, wines, or beer, or...

  15. SU-E-J-237: Real-Time 3D Anatomy Estimation From Undersampled MR Acquisitions

    Energy Technology Data Exchange (ETDEWEB)

    Glitzner, M; Lagendijk, J; Raaymakers, B; Crijns, S [University Medical Center Utrecht, Utrecht (Netherlands); Senneville, B Denis de [University Medical Center Utrecht, Utrecht (Netherlands); Mathematical Institute of Bordeaux, University of Bordeaux, Talence Cedex (France)

    2015-06-15

    Recent developments made MRI guided radiotherapy feasible. Performing simultaneous imaging during fractions can provide information about changing anatomy by means of deformable image registration for either immediate plan adaptations or accurate dose accumulation on the changing anatomy. In 3D MRI, however, acquisition time is considerable and scales with resolution. Furthermore, intra-scan motion degrades image quality.In this work, we investigate the sensitivity of registration quality on imageresolution: potentially, by employing spatial undersampling, the acquisition timeof MR images for the purpose of deformable image registration can be reducedsignificantly.On a volunteer, 3D-MR imaging data was sampled in a navigator-gated manner, acquiring one axial volume (360×260×100mm{sup 3}) per 3s during exhale phase. A T1-weighted FFE sequence was used with an acquired voxel size of (2.5mm{sup 3}) for a duration of 17min. Deformation vector fields were evaluated for 100 imaging cycles with respect to the initial anatomy using deformable image registration based on optical flow. Subsequently, the imaging data was downsampled by a factor of 2, simulating a fourfold acquisition speed. Displacements of the downsampled volumes were then calculated by the same process.In kidneyliver boundaries and the region around stomach/duodenum, prominent organ drifts could be observed in both the original and the downsampled imaging data. An increasing displacement of approximately 2mm was observed for the kidney, while an area around the stomach showed sudden displacements of 4mm. Comparison of the motile points over time showed high reproducibility between the displacements of high-resolution and downsampled volumes: over a 17min acquisition, the componentwise RMS error was not more than 0.38mm.Based on the synthetic experiments, 3D nonrigid image registration shows little sensitivity to image resolution and the displacement information is preserved even when halving the resolution. This can be employed to greatly reduce image acquisition times for interventional applications in real-time. This work was funded by the SoRTS consortium, which includes the industry partners Elekta, Philips and Technolution.

  16. 48 CFR 1352.237-70 - Security processing requirements-high or moderate risk contracts.

    Science.gov (United States)

    2010-10-01

    ... background inquiries pertaining to verification of name, physical description, marital status, present and... undergo security processing by the Department's Office of Security before being eligible to work on the.... citizens must have: (1) Official legal status in the United States; (2) Continuously resided in the United...

  17. 28 CFR 2.37 - Disclosure of information concerning parolees; Statement of policy.

    Science.gov (United States)

    2010-07-01

    ...) pursuant to a request under 18 U.S.C. 4203(e). (c) Information deemed to be “public sector” information may be disclosed to third parties without the consent of the file subject. Public sector information...

  18. 48 CFR 252.237-7000 - Notice of special standards of responsibility.

    Science.gov (United States)

    2010-10-01

    ..., of “Government Auditing Standards.” (1) Qualifications; (2) Independence; and (3) Quality Control. (b) “Government Auditing Standards” is issued by the Comptroller General of the United States and is available for... Contracting Officer evidence that it is licensed by the cognizant licensing authority in the state or other...

  19. P2-37: Processing Affordance Information from Invisible Tool Images

    Directory of Open Access Journals (Sweden)

    Shinho Cho

    2012-10-01

    Full Text Available A recent study showed that viewing manipulable objects such as images of tools induces the neural activation of posterior parietal areas. This neural activation is observed even when visual awareness of the image is visually suppressed. (Fang and He, 2005 Nature Neuroscience 10 1380–1385; Almeida et al, 2010 Psychological Science 21 772–778. However, the specific visuomotor information in tool images that drives the activation of dorsal areas is still unclear. We measured priming effect of invisible tool prime (left or right handed orientation. Observers distinguished the orientation of target tools (appropriate for left vs right handed grip briefly presented following visually suppressed primes (Experiment1. Also we measured the suppression time of tool images whose handle direction was presented in a left- or right-handed orientation. A dynamic noise pattern was presented to one of the observer's eyes at full contrast, while images of tools (left or right handed were simultaneously presented to the left or right visual field of the other eye. The subjects were asked to respond to the appearance of any partial or full part of the test image (Experiment 2. Results showed that (1 observers responded faster in the congruent condition (the same orientation between prime and target and (2 tool images shown in the right visual field took less time to gain dominance against the dynamic noise. These results suggest that even without overt recognition of presented tools, an object's affordance can be registered and processed in the brain. A recent study showed that viewing manipulable objects such as images of tools induces the neural activation of posterior parietal areas. This neural activation is observed even when visual awareness of the image is visually suppressed (Almeida et al., 2010 Psychological Science 21 772–778; Fang and He, 2005 Nature Neuroscience 10 1380–1385. However, the specific visuomotor information in tool images that drives the activation of dorsal areas is still unclear. We measured the priming effect of invisible tool prime (left or right handed orientation. Observers distinguished the orientation of target tools (appropriate for left vs. right handed grip briefly presented following visually suppressed primes (Experiment 1. Also we measured the suppression time of tool images whose handle direction was presented in a left- or right-handed orientation. A dynamic noise pattern was presented to one of the observer's eyes at full contrast, while images of tools (left or right handed were simultaneously presented to the left or right visual field of the other eye. The subjects were asked to respond to the appearance of any partial or full part of the test image (Experiment 2. Results showed that (1 observers responded faster in the congruent condition (the same orientation between prime and target and (2 tool images shown in the right visual field took less time to gain dominance against the dynamic noise. These results suggest that even without overt recognition of presented tools, an object's affordance can be registered and processed in the brain.

  20. 48 CFR 52.237-11 - Accepting and Dispensing of $1 Coin.

    Science.gov (United States)

    2010-10-01

    ... REGULATION (CONTINUED) CLAUSES AND FORMS SOLICITATION PROVISIONS AND CONTRACT CLAUSES Text of Provisions and... premises owned by the United States or under the control of any agency or instrumentality of the United...

  1. Transmutation experiments ion I-129, La-139 and Np-237 using the Nuclotron accelerator

    Czech Academy of Sciences Publication Activity Database

    Westmeier, W.; Brandt, B. A.; Langrock, E. J.; Odoj, R.; Adam, Jindřich; Bradnova, V.; Golovatyuk, VM.; Krasnov, VA.; Krivopustov, M. I.; Pronskikh, V. S.; Sosnin, A. N.; Tsoupko-Sitnikov, V. M.; Vladimirova, NM.; Hashemi-Nezhad, R. S.; Zamani-Valasiadou, M.

    2005-01-01

    Roč. 93, č. 2 (2005), s. 65-73 ISSN 0033-8230 R&D Projects: GA MŠk(CZ) 1P04LA213 Keywords : transmutation * relativistic proton beam * moderator Subject RIV: BG - Nuclear, Atomic and Molecular Physics, Colliders Impact factor: 0.846, year: 2005

  2. Farmland biodiversity and agriculture management on 237 farms in 13 European and two African regions

    NARCIS (Netherlands)

    Lüscher, G.; Ammari, Y.; Andriets, A.; Angelova, Siyka; Arndorfer, Michaela; Bailey, D.; Balázs, Katalin; Bogers, M.M.B.; Lange, de H.J.; Kats, van R.J.M.

    2016-01-01

    Farmland is a major land cover type in Europe and Africa and provides habitat for numerous species. The severe decline in farmland biodiversity of the last decades has been attributed to changes in farming practices, and organic and low-input farming are assumed to mitigate detrimental effects of

  3. Farmland biodiversity and agricultural management on 237 farms in 13 European and two African regions

    NARCIS (Netherlands)

    Lüscher, G.; Ammari, Y.; Andriets, A.; Angelova, Siyka; Arndorfer, Michaela; Bailey, D.; Balázs, K.; Bogers, M.M.B.; Bunce, R.G.H.; Choisis, Jean Philippe; Dennis, P.; Díaz, M.; Dyman, T.; Eiter, Sebastian; Fjellstad, W.; Fraser, M.; Friedel, Jürgen K.; Garchi, S.; Geijzendorffer, I.R.; Gomiero, Tiziano; González-Bornay, G.; Guteva, Y.; Herzog, F.; Jeanneret, P.; Jongman, R.H.G.

    2016-01-01

    Farmland is a major land cover type in Europe and Africa and provides habitat for numerous species. The severe decline in farmland biodiversity of the last decades has been attributed to changes in farming practices, and organic and low-input farming are assumed to mitigate detrimental effects of

  4. 48 CFR 252.237-7018 - Special definitions of Government property.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Special definitions of... ACQUISITION REGULATIONS SYSTEM, DEPARTMENT OF DEFENSE CLAUSES AND FORMS SOLICITATION PROVISIONS AND CONTRACT...) Articles delivered to the Contractor to be laundered or dry-cleaned, including any articles which are...

  5. 77 FR 237 - Protection of Stratospheric Ozone: Adjustments to the Allowance System for Controlling HCFC...

    Science.gov (United States)

    2012-01-04

    ... for servicing existing equipment? 2. Can servicing needs be met with virgin and recovered material? 3...-month period thereafter, its calculated level of consumption of the controlled substances in Group I of... calculated level of production of the controlled substances in Group I of Annex C does not exceed, annually...

  6. Integrated plant safety assessment, Systematic Evaluation Program: Dresden Nuclear Power Station, Unit 2 (Docket No. 50-237)

    International Nuclear Information System (INIS)

    1989-10-01

    The US Nuclear Regulatory Commission (NRC) has prepared Supplement 1 to the final Integrated Plant Safety Assessment Report (IPSAR) (NUREG-0823), under the scope of the Systematic Evaluation Program (SEP), for the Commonwealth Edison Company (CECo) Dresden Nuclear Power Station, Unit 2 located in Grundy County, Illinois. The NRC initiated the SEP to provide the framework for reviewing the design of older operating nuclear reactor plants to reconfirm and document their safety. This report documents the review completed by means of the SEP for those issues that required refined engineering evaluations or the continuation of ongoing evaluations subsequent to issuing the final IPSAR for Dresden Unit 2. The review was provided for (1) an assessment of the significance of differences between current technical positions on selected issues and those that existed when Dresden Unit 2 was licensed, (2) a basis for deciding on how these differences should be resolved in an integrated plant review, and (3) a documented evaluation of plant safety. The final IPSAR and this supplement forms part of the bases for considering the conversion of the existing provisional operating license to a full-term operating license. 83 refs., 9 tabs

  7. 17 CFR 230.237 - Exemption for offers and sales to certain Canadian tax-deferred retirement savings accounts.

    Science.gov (United States)

    2010-04-01

    ... laws of Canada, the laws of any province or territory of Canada, and the rules or regulations of any federal, provincial, or territorial regulatory authority, or any self-regulatory authority, of Canada. (2... “Registered Retirement Savings Plan” or “Registered Retirement Income Fund” administered under Canadian law...

  8. Investigation of the soil-to-plant transfer of Np-237, Pu-238, Am-241 and Cm-244

    International Nuclear Information System (INIS)

    Pimpl, M.

    1988-08-01

    Inside a greenhouse for radioecological studies the root uptake of Np, Pu, Am, and Cm from 5 different soils into 19 crop plants have been measured. The soils have been artificially contaminated with the 4 nuclides in range from 1-20 Bq/g dry soil. Within 7 vegetation periods about 380 transfer measurements have been performed. The obtained results show that the soil-to-plant transfer is mainly influenced by the following parameters: physical and chemical properties of the different radionuclides, plant species and variety, soil type, time of soil utilization and soil management. The transfer factors measured are compared with those data which are proposed for the calculation of the long term radiation burden of the population by ingestion of contaminated food inside the Federal Republic of Germany. The experiments have been performed from the beginning of 1983 to the end of 1986. The results summarized within this report have already been published in annual reports or as contributions to scientific meetings. (orig.) [de

  9. Cusculium (Plin. XVI 22, coscus (Chiron 237 and coccolubis (Colum. III 2.19: Mediterranean substrate and Latin form

    Directory of Open Access Journals (Sweden)

    Benjamín García-Hernández

    2014-12-01

    Full Text Available Cusculium, a hapax used by Pliny in its accusative form, has a Pre-Roman base (cuscu- that is found throughout western Mediterranean countries; the same root appears in coscus, referring to certain types of worm. Given its Latin ending, the word could be used to designate both the tree (cusculius «kermes oak» and its acorns (cusculium. Coccolubis is a compound adjective, the first element of which is the diminutive of coccum («grain of kermes», which carries the same Mediterranean root as the previous word. Given its use as an epithet for a type of vine, its second element may be seen to contain the base of the noun uua. Its original form may have therefore been coccoluuis («of red grape». The Navarran term cuzculubita («oak apple», however, suggests that a Pre-Roman compound may have existed.

  10. Neutron-induced transmutation reactions in Np-237, Pu-238, and Pu-239 at the massive natural uranium spallation target

    Czech Academy of Sciences Publication Activity Database

    Závorka, L.; Adam, Jindřich; Baldin, A. A.; Čaloun, Pavel; Chilap, V. V.; Furman, W.; Kadykov, M. G.; Khushvaktov, J.; Pronskikh, V. S.; Solnyshkin, A. A.; Sotnikov, V.; Stegailov, V. I.; Suchopár, Martin; Tsoupko-Sitnikov, V. M.; Tyutyunnikov, S. I.; Voronko, V.; Vrzalová, Jitka

    2015-01-01

    Roč. 349, APR (2015), s. 31-38 ISSN 0168-583X R&D Projects: GA MŠk LG14004 Institutional support: RVO:61389005 Keywords : ADS * spent nuclear fuel * transmutation reaction * spallation neutrons Subject RIV: BG - Nuclear , Atomic and Molecular Physics, Colliders Impact factor: 1.389, year: 2015

  11. Measurements of periods, relative abundances and absolute yields of delayed neutrons from fast neutron induced fission of {sup 237}Np

    Energy Technology Data Exchange (ETDEWEB)

    Piksaikine, V. [Institute of Physics and Power Engineering, Obninsk (Russian Federation)

    1997-03-01

    The experimental method for measurements of the delayed neutron yields and period is presented. The preliminary results of the total yield, relative abundances and periods are shown comparing with the previously reported values. (J.P.N.)

  12. Study of an automatic dosing of neptunium in the industrial process of separation neptunium 237-plutonium 238

    International Nuclear Information System (INIS)

    Ros, Pierre

    1973-01-01

    The objective is to study and to adapt a method of automatic dosing of neptunium to the industrial process of separation and purification of plutonium 238, while taking the information quality and economic aspects into account. After a recall of some generalities on the production of plutonium 238, and the process of separation plutonium-neptunium, the author addresses the dosing of neptunium. The adopted measurement technique is spectrophotometry (of neptunium, of neptunium peroxide) which is the most flexible and economic to adapt to automatic control. The author proposes a project of chemical automatic machine, and discusses the complex (stoichiometry, form) and some aspects of neptunium dosing (redox reactions, process control) [fr

  13. Challenges to Persian Gulf Security: How Should the United States Respond? (Strategic Forum, Number 237, November 2008)

    National Research Council Canada - National Science Library

    Yaphe, Judith S

    2008-01-01

    .... Iran's quest for regional preeminence, driven by the impulses of exceptionalism and self-sufficiency that are deeply engrained in the country's political psyche, will not slacken any time soon...

  14. 48 CFR 652.237-73 - Statement of Qualifications for Preference as a U.S. Person.

    Science.gov (United States)

    2010-10-01

    ... price of an offer. U.S. person means a company, partnership, or joint venture that the Government... or financial resources of another organization or individual, including parent companies... headquarters staff. The named location must be a United States jurisdiction in which the prospective offeror...

  15. Global determination of alpha emitters (241Am, 237Np, 239Pu, 232Th) in biological media (urine and feces)

    International Nuclear Information System (INIS)

    Bataller, Georges; Vasson, Olivier de; Bazin, Roger; Bonnard, Danielle; Morello, Marcel.

    1979-01-01

    A technique is described in this paper which permits the determination of the gross alpha activity emitted by a mixture of specially radiotoxic elements in urine and feces. After reduction and adjustment of the solution at pH 5,0, the radionuclides are adsorbed on glass marbles. The elution is made in acid medium (HCl 6N). Under these conditions the chemical yields are very satisfying: 96+-6% for urine and 68+-9% for feces. In case of significant results at the end of the manipulation, the radioactive source quality is sufficient to allow the identification of the contaminating radionuclide(s) by alpha spectrometry [fr

  16. 49 CFR Appendix A to Part 237 - Supplemental Statement of Agency Policy on the Safety of Railroad Bridges

    Science.gov (United States)

    2010-10-01

    ... incorporate recognized principles of structural design and analysis to provide for the safe and economic... railroad bridge rating reference system. The most common standard bridge rating reference system... systems may be used where convenient, provided their effects can be defined in terms of shear, bending and...

  17. Moessfit [Hyperfine Interactions, ISSN 0304-3843, Dec 2016, v. 237(1), p. 1-10

    Energy Technology Data Exchange (ETDEWEB)

    Kamusella, Sirko, E-mail: sirko.kamusella@tu-dresden.de; Klauss, Hans-Henning [TU Dresden, Institute of Solid State Physics (Germany)

    2016-12-15

    A free data analysis program for Mössbauer spectroscopy was developed to solve commonly faced problems such as simultaneous fitting of multiple data sets, Maximum Entropy Method and a proper error estimation. The program is written in C++ using the Qt application framework and the Gnu Scientific Library. Moessfit makes use of multithreading to reasonably apply the multi core CPU capacities of modern PC. The whole fit is specified in a text input file issued to simplify work flow for the user and provide a simple start in the Mössbauer data analysis for beginners. However, the possibility to define arbitrary parameter dependencies and distributions as well as relaxation spectra makes Moessfit interesting for advanced user as well.

  18. Moessfit [Hyperfine Interactions, ISSN 0304-3843, Dec 2016, v. 237(1), p. 1-10

    International Nuclear Information System (INIS)

    Kamusella, Sirko; Klauss, Hans-Henning

    2016-01-01

    A free data analysis program for Mössbauer spectroscopy was developed to solve commonly faced problems such as simultaneous fitting of multiple data sets, Maximum Entropy Method and a proper error estimation. The program is written in C++ using the Qt application framework and the Gnu Scientific Library. Moessfit makes use of multithreading to reasonably apply the multi core CPU capacities of modern PC. The whole fit is specified in a text input file issued to simplify work flow for the user and provide a simple start in the Mössbauer data analysis for beginners. However, the possibility to define arbitrary parameter dependencies and distributions as well as relaxation spectra makes Moessfit interesting for advanced user as well.

  19. Quality of life of women submitted to myocardial revascularization surgery in a public hospital - doi:10.5020/18061230.2010.p237

    Directory of Open Access Journals (Sweden)

    Rafaela Melo de Oliveira

    2012-01-01

    Full Text Available Objective: To analyze the sociodemografic profile, risck factors and the quality of life of women submitted to myocardial revascularization surgery. Methods: We conducted a qualitative study by applying a questionnaire on lifestyle and risk factors and an interview with four guiding questions to 15 revascularized inpatients of cardiology units of a referral public hospital and who had no manifestations of depression prior to surgery. Results: The patients profile showed that 9 (60% were Caucasian, 8 (54% had incomplete primary education, 4(27% were housewives, 9 (60% lived in urban area, 10 (67% were married, all had a family income lower than three minimum wages and 4(27% had only two kids. From the content analysis of the interviews, the following categories aroused: religiosity, disruption with everyday life, family and quality of life. Conclusion: We found out that the knowledge about the psychosocial structure of each patient helps in the treatment of the individual submitted to myocardial revascularization. By identifying the lifestyle and risk factors, women promote self-knowledge, which can avoid habits that lead to cardiovascular diseases. We suggest the development of strategies for prevention and health promotion involving the patients and their families so that there is an extension of hospital care at home and a better adaptation to the new condition.

  20. SU-F-T-237: The Imaging and Radiation Oncology Core (IROC) Cooperatives Activities Supporting the NCI’s National Clinical Trial Network

    Energy Technology Data Exchange (ETDEWEB)

    Followill, D [UT MD Anderson Cancer Center, Houston, TX (United States); Galvin, J [Thomas Jefferson University Hospital, Newtown, PA (United States); Michalski, J [Washington University in St. Louis, St. Louis, MO (United States); Rosen, M [University of Pennsylvania Medical Center, Philadelphia, PA (United States); FitzGerald, T [University of Massachusetts Medical School, Lincoln, RI (United States); Knopp, M [The Ohio State University, Columbus, OH (United States)

    2016-06-15

    Purpose: The Imaging and Radiation Oncology Core (IROC) Cooperative has been active for the past two years supporting the National Clinical Trial Network and the details of that support are reported. Methods: There are six QA centers (Houston, Ohio, Philadelphia-RT, Philadelphia-DI, Rhode Island, St. Louis) providing an integrated RT and DI quality control program in support of the NCI’s clinical trials. The QA Center’s efforts are focused on assuring high quality data for clinical trials designed to improve the clinical outcomes for cancer patients worldwide. This program is administered through five core services: site qualification, trial design support, credentialing, data management, and case review. Results: IROC currently provides core support for 172 NCTN trials with RT, DI and RT/DI components. Many of these trials were legacy trial from the previous cooperative group program. IROC monitors nearly 1800 RT photon and 20 proton institutions. Over 28,000 beams outputs were monitored with 8% of the sites requiring repeat audits due to beam out of criteria. As part of credentialing, 950 QA phantoms have been irradiated, 515 imaging modalities evaluated and almost 4000 credentialing letters have been issued. In just year 2, 5290 RT and 4934 DI patient datasets were received (many using TRIAD) by IROC QA Centers to be prepared for review. During the past 2 years, a total of 6300 RT cases and 19,000 DI image sets were reviewed by IROC technical staff. To date, IROC has published 36 manuscripts. Conclusion: The QA services provided by IROC are numerous and are continually being evaluated for effectiveness, harmonized across all NCTN Groups and administered in an efficient and timely manner to enhance accurate and per protocol trial data submission. These efforts increase each NCTN Group’s ability to derive meaningful outcomes from their clinical trials. This work was supported by DHHS NIH grant 5U24CA180803.

  1. Investigation of the formation of residual nuclei from the radiactive .sup.237 Np and .sup.241 Am targets in the reaction with 660-MeV protons

    Czech Academy of Sciences Publication Activity Database

    Adam, Jindřich; Balabekyan, A. R.; Brandt, R.; Dzhelepov, V. P.; Gustov, S. A.; Kalinnikov, V. G.; Krivopustov, M. I.; Mirokhin, I. V.; Mrázek, Jaromír; Odoj, R.

    2002-01-01

    Roč. 65, č. 5 (2002), s. 797-809 ISSN 0044-0027 R&D Projects: GA AV ČR KSK1048102 Keywords : protons * spallation * target activation * radionuclides Subject RIV: BG - Nuclear, Atomic and Molecular Physics, Colliders

  2. Safety Evaluation Report related to the full-term operating license for Dresden Nuclear Power Station, Unit 2 ( Docket No. 50-237)

    International Nuclear Information System (INIS)

    1990-10-01

    The Safety Evaluation Report for the full-term operating license application filed by Commonwealth Edison Company for the Dresden Nuclear Power Station, Unit 2, has been prepared by the Office of Nuclear Regulation of the US Nuclear Regulatory Commission. The facility is located in Grundy County, Illinois. Subject to favorable resolution of the items discussed in this report, the staff concludes that the facility can continue to be operated without endangering the health and safety of the public. 72 refs

  3. Evaluation of the excitation function of the 238U(n,2n)237U reaction for neutron energies from threshold to 19 MeV

    International Nuclear Information System (INIS)

    Kornilov, N.V.; Vinogradov, V.N.; Gay, E.V.; Rabotnov, N.S.; Salnikov, O.A.; Raics, P.; Daroczy, S.; Nagy, S.; Csikai, J.

    1983-01-01

    Experimental results for the 238 U(n,2n) reaction were collected from the literature and evaluated. The normalisation of the measured cross sections was carried out using recent values for the cross sections of standard monitor reactions as well as new nuclear decay data. The evaluated excitation function was then obtained by the Pade-approximation. (Auth.)

  4. Exercise-induced TBC1D1 Ser237 phosphorylation and 14-3-3 protein binding capacity in human skeletal muscle

    DEFF Research Database (Denmark)

    Frøsig, Christian; Pehmøller, Christian; Birk, Jesper Bratz

    2010-01-01

    muscle (EDL) from whole-body a1 or a2 AMPK knock-out and wild-type mice were stimulated to contract in vitro. In wild-type and a1 knock-out mice, contractions resulted in a similar ~100% increase (Pknock-out mice were characterized by reduced...

  5. Integrated-plant-safety assessment Systematic Evaluation Program. Dresden Nuclear Power Station, Unit 2, Commonwealth Edison Company, Docket No. 50-237

    International Nuclear Information System (INIS)

    1982-10-01

    The Systematic Evaluation Program was initiated in February 1977 by the US Nuclear Regulatory Commission to review the designs of older operating nuclear reactor plants to reconfirm and document their safety. The review provides: (1) an assessment of how these plants compare with current licensing safety requirements relating to selected issues; (2) a basis for deciding on how these differences should be resolved in an integrated plant review; and (3) a documented evaluation of plant safety. This report documents the review of Dresden Nuclear Generating Station, Unit 2 owned and operated by the Commonwealth Edison Company and located in Grundy County, Illinois. Dresden Unit 2 is one of ten plants reviewed under Phase II of this program, which indicates how 137 topics selected for review under Phase I of the program were addressed. Equipment and procedural changes have been identified as a result of the review. It is expected that this report will be one of the bases in considering the issuance of a full-term operating license in place of the existing provisional operating license

  6. Monte Carlo simulation of γ and fission transfer-induced probabilities using extended -matrix theory: Application to the 237U∗ system

    Directory of Open Access Journals (Sweden)

    Bouland Olivier

    2017-01-01

    Full Text Available This paper deals with simultaneous neutron-induced average partial cross sections and surrogate-like probability simulations over several excitation and de-excitation channels of the compound nucleus. Present calculations, based on one-dimensional fission barrier extended -matrix theory using Monte Carlo samplings of both first and second well resonance parameters, avoid the surrogate-reaction method historically taken for surrogate data analyses that proved to be very poor in terms of extrapolated neutron-induced capture cross sections. Present theoretical approach is portrayed and subsequent results can be compared for the first time with experimental γ-decay probabilities; thanks to brand new simultaneous 238U(3He,4Heγ and 238U(3He,4He f surrogate measurements. Future integration of our strategy in standard neutron cross section data evaluation remains tied to the developments made in terms of direct reaction population probability calculations.

  7. Protocolo Nacional para la Evaluacion de Disturbios en Suelos Forestales; Volumen II: Metodos complementarios, estad&#237stica y recoleccion de datos

    Science.gov (United States)

    Deborah S. Page-Dumroese; Ann M. Abbott; Thomas M. Rice

    2013-01-01

    Este documento-El Volumen II: Métodos complementarios, estadística y recolección de datos- define las bases, los métodos estadísticos y de almacenamiento de datos de un Protocolo Nacional para la Evaluación de Disturbios en Suelos Forestales. Esta guía técnica proporciona las bases de un método consistente, con definiciones comunes, para generar datos de alta calidad,...

  8. Multibeam collection for TN237: Multibeam data collected aboard Thomas G. Thompson from 2009-07-11 to 2009-07-28, Apia, Samoa to Seattle, WA

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — This data set is part of a larger set of data called the Multibeam Bathymetry Database (MBBDB) where other similar data can be found at...

  9. 237. Malformación hamartomatosa de la aurícula izquierda como causa infrecuente de ataque isquémico transitorio de repetición

    Directory of Open Access Journals (Sweden)

    O. Leal

    2012-04-01

    Conclusiones: Ante la presencia de AIT, en primer lugar debemos considerar el origen cardioembólico, excluidos éstos, la patología tumoral aunque infrecuente debe tenerse en cuenta, y su tratamiento generalmente es quirúrgico.

  10. Study of fission mechanism with the reactions 230Th, 231Pa, 235U, 237Np(n,f) and 252Cf(fs)

    International Nuclear Information System (INIS)

    Benfoughal, T.

    1983-01-01

    In this work, the different stages of the nuclear fission process have been investigated. The analysis of fission cross-section and fission fragment angular distribution measurements are made using the hypothesis of asymmetrically deformed states. From the correlation between fissioning nucleus excitation energy and fragment total kinetic energy measurement for several fissioning systems, it is shown that the nuclear viscosity is relatively strong during the saddle-point to scission-point transition. The study of the spontaneous fission of 252 Cf shows that the fragment mass and kinetic energy distributions are mainly determinated by the nucleon shell effects and pairing correlations [fr

  11. Safety analysis report for packaging: neutron shipping cask, model 0.5T

    International Nuclear Information System (INIS)

    Peterson, R.T.

    1976-01-01

    The Safety Analysis Report for Packaging demonstrates that the neutron shipping cask can safely transport, in solid or powder form, all isotopes of uranium, plutonium, americium, curium, berkelium, californium, einsteinium, and fermium. The shipping cask and its contents are described. It also evaluates transport conditions, structural parameters (e.g., load resistance, pressure and impact effects, lifting and tiedown devices), and shielding. Finally, it discusses compliance with Chapter 0529 of the Energy Research and Development Administration Manual

  12. Directed evolution of the periodic table: probing the electronic structure of late actinides.

    Science.gov (United States)

    Marsh, M L; Albrecht-Schmitt, T E

    2017-07-25

    Recent investigations of the coordination chemistry and physical properties of berkelium (Z = 97) and californium (Z = 98) have revealed fundamental differences between post-curium elements and lighter members of the actinide series. This review highlights these developments and chronicles key findings and concepts from the last half-century that have helped usher in a new understanding of the evolution of electronic structure in the periodic table.

  13. First results studying the transmutation of 129I, 237Np, 238Pu, and 239Pu in the irradiation of an extended natU/Pb-assembly with 2.52 GeV deuterons

    Czech Academy of Sciences Publication Activity Database

    Krivopustov, M. I.; Pavljuk, A. V.; Kovalenko, A.D.; Mariin, I.I.; Elishev, A.F.; Adam, Jindřich; Kovalík, Alojz; Batusov, Yu, A.; Kalinnikov, V. G.; Brudanin, V. B.; Čaloun, Pavel; Tsoupko-Sitnikov, V. M.; Solnyshkin, A. A.; Stegailov, V. I.; Gerbish, Sh.; Svoboda, Ondřej; Dubnická, Z.; Kala, M.; Kloc, M.; Krása, Antonín; Kugler, Andrej; Majerle, Mitja; Wagner, Vladimír; Brandt, R.; Westmeier, W.; Robotham, H.; Siemon, K.; Bielewicz, M.; Kilim, S.; Szuta, M.; Strugalska-Gola, E.; Wojeciechowski, A.; Hashemi-Nezhad, R. S.; Manolopoulou, M.; Fragopolou, M.; Stoulos, S.; Zamani-Valasiadou, M.; Jokic, S.; Katovsky, K.; Schastny, O.; Zhuk, I. V.; Potapenko, A.S.; Safronova, A.A.; Lukashevich, Zh.A.; Voronko, V.A.; Sotnikov, V.V.; Sidorenko, V.V.; Ensinger, W.; Severin, H.D.; Batsev, S.; Kostov, L.; Protokhristov, Kh.; Stoyanov, Ch,.; Yordanov, O.; Zhivkov, P.K.; Kumar, A.V.; Sharma, M.; Khilmanovich, A.M.; Marcinkevich, B.A.; Korneev, S.V.; Damdinsuren, Ts.; Togoo, Ts.; Kumawat, H.

    2009-01-01

    Roč. 279, č. 2 (2009), s. 567-584 ISSN 0236-5731 R&D Projects: GA AV ČR IAA100480803; GA MŠk LC07050 Institutional research plan: CEZ:AV0Z10480505 Keywords : MCNPX. * GeV Subject RIV: BG - Nuclear, Atomic and Molecular Physics, Colliders Impact factor: 0.631, year: 2009

  14. ADS-HE: Evaluated Nuclear Data Library up to 1 GeV for 202Hg, 208Pb, 209Bi, 232Th, 235U, 238U, 237Np, 239Pu, 242Am and 245Cm

    International Nuclear Information System (INIS)

    Lopez Aldama, Daniel

    2013-12-01

    Accelerator Driven Systems (ADS) are being developed for power generation and the transmutation of actinide and fission product waste, and well-defined cross-section libraries suitable for their transport calculations are required. Transport of high energy neutrons and protons near the target assembly requires an extension of the library for incident energies up to 1 GeV. An ADS-HE library for incident neutrons on selected target elements has been developed to meet this request, and assist benchmarking studies linked to ADS experiments and design concepts. New evaluations of high-energy data from 20 MeV up to 1 GeV have been carried out by S.G. Yavshits and O.T. Grudzevich (see INDC(NDS)-0615). The ADS- HE library has been prepared from these high-energy evaluations combined with evaluations below 20 MeV selected from the ENDF/B-VII.1, the JEFF-3.1.2 and the JENDL-4u2 libraries. The ADS-HE library was processed in suitable forms for Monte Carlo transport codes used in the analysis of ADS. ADS-HE is freely available from the IAEA Nuclear Data Section, and is readily accessible on the web site: http://www-nds.iaea.org/ads/adshe.html. (author)

  15. Leopoldo Lugones. El ángel de la sombra, estudio preliminar de María Teresa Gramuglio : Buenos Aires, Editorial Losada, 1994, 237 páginas

    OpenAIRE

    Dalmaroni, Miguel Ángel

    1996-01-01

    Fechado en octubre de 1994 y distribuido durante el año pasado, el libro del que nos ocupamos aquí puede considerarse un acontecimiento de cierta importancia en la bibliografía lugoniana: se trata de la primera reedición de la única novela que escribiera el autor de La guerra gaucha. Con El ángel de la sombra, publicado por primera y única vez en 1926 bajo el sello editorial de Manuel Gleizer, Lugones conoció su más rotundo fracaso de lectores y de crítica. Luego, aquel llamado de atención de...

  16. Procedures for determination of 239,240Pu, 241Am, 237Np, 234,238U, 228,230,232Th, 99Tc and 210Pb-210Po in environmental material

    International Nuclear Information System (INIS)

    Kolstad, A. K.; Lind, B.; QingJiang Chen; Aarkrog, A.; Nielsen, S.P.; Dahlgaard, H.; Yixuan Yu

    2001-12-01

    Since 1987, the Department of Nuclear Safety Research, Risoe National Laboratory has developed procedures for analysis of low-level amounts of radioactivity in large samples of 200 liters seawater, 10 gram sediment, soil and other environmental materials. These analytical procedures provide high chemical yields, good resolution and excellent decontamination factors for large environmental samples analysed by alpha spectrometry and mass spectrometry (ICPMS). The procedures have been checked through practical analysis work and are used in Norway, the Netherlands, Germany, Spain, France and Denmark. (au)

  17. CTD data of the Hawaii Ocean Time-series (HOT) program in the North Pacific 100 miles north of Oahu, Hawaii for cruises HOT228-237 during 2011 (NODC Accession 0101727)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — The HOT program makes repeated observations of the physics, biology and chemistry at a site approximately 100 km north of Oahu, Hawaii. Two stations are visited...

  18. PROCEEDINGS OF THE SYMPOSIUM COMMEMORATING THE 25th ANNIVERSARY OF ELEMENTS 97 and 98 HELD ON JAN. 20, 1975

    Energy Technology Data Exchange (ETDEWEB)

    Seaborg, Glenn T.; Street Jr., Kenneth; Thompson, Stanley G.; Ghiorso, Albert

    1976-07-01

    This volume includes the talks given on January 20, 1975, at a symposium in Berkeley on the occasion of the celebration of the 25th anniversary of the discovery of berkelium and californium. Talks were given at this symposium by the four people involved in the discovery of these elements and by a number of people who have made significant contributions in the intervening years to the investigation of their nuclear and chemical properties. The papers are being published here, without editing, in the form in which they were submitted by the authors in the months following the anniversary symposium, and they reflect rather faithfully the remarks made on that occasion.

  19. Radiological safety considerations in the design and operation of the ORNL Transuranium Research Laboratory (TRL)

    International Nuclear Information System (INIS)

    Haynes, C.E.

    1976-01-01

    The Transuranium Research Laboratory (TRL) is the central facility at Oak Ridge National Laboratory (ORNL) for chemical and physical research involving transuranium elements. Transuranium Research Laboratory investigations are about equally divided between studies of inorganic and structural chemistry of the heavy elements and nuclear structure and properties of their isotopes. Elements studied include neptunium, plutonium, americium, curium, berkelium, californium, and einsteinium, each in microgram-to-gram quantities depending upon availability and experimental requirements. This paper describes an eight-step safety procedure followed in planning and approving individual research projects. This procedure should provide an optimum margin of safety and should permit the accomplishment of successful research

  20. Composition containing transuranic elements for use in the homeopathic treatment of aids

    International Nuclear Information System (INIS)

    Lustig, D.

    1996-01-01

    A homeopathic remedy consisting of a composition containing one or more transuranic elements, particularly plutonium, for preventing and treating acquired immunodeficiency syndrome (AIDS) in humans, as well as seropositivity for human immunodeficiency virus (HIV). Said composition is characterized in that it uses any chemical or isotopic form of one or more transuranic elements (neptunium, plutonium, americium, curium, berkelium, californium or einsteinium), particularly plutonium, said form being diluted and dynamized according to conventional homeopathic methods, particularly the so-called Hahnemann and Korsakov methods, and provided preferably but not exclusively in the form of lactose and/or saccharose globules or granules impregnated with the active principle of said composition. (author)

  1. Actinides

    International Nuclear Information System (INIS)

    Martinot, L.; Fuger, J.

    1985-01-01

    The oxidation behavior of the actinides is explained on the basis of their electronic structure. The actinide elements, actinium, thorium, protactinium, uranium, neptunium, plutonium, americium, curium, berkelium, californium, einsteinium, fermium, mendelevium, nobelium, and laurencium are included. For all except the last three elements, the points of discussion are oxidation states, Gibbs energies and potentials, and potential diagram for the element in acid solution; and thermodynamic properties of these same elements are tabulated. References are cited following discussion of each element with a total of 97 references being cited. 13 tables

  2. Safety analysis report for packaging: neutron shipping cask, model 4T

    International Nuclear Information System (INIS)

    Peterson, R.T.

    1977-01-01

    This Safety Analysis Report for Packaging demonstrates that the neutron shipping cask can safely transport, in solid or powder form, all isotopes of uranium, plutonium, americium, curium, berkelium, californium, einsteinium, and fermium. The cask and its contents are described. It also evaluates transport conditions, structural parameters (e.g., load resistance, pressure and impact effects, lifting and tiedown devices), and shielding. Finally, it discusses compliance with Chapter 0529 of the Energy Research and Development Administration Manual, Safety Standards for the Packaging of Fissile and Other Radioactive Materials

  3. TOWARD AN IMPROVED UNDERSTANDING OF STRUCTURE AND MAGNETISM IN NEPTUNIUM AND PLUTONIUM PHOSPHONATES AND SULFONATES

    Energy Technology Data Exchange (ETDEWEB)

    Albrecht-Schmitt, Thomas

    2012-03-01

    This grant supported the exploratory synthesis of new actinide materials with all of the actinides from thorium to californium with the exceptions of protactinium and berkelium. We developed detailed structure-property relationships that allowed for the identification of novel materials with selective ion-exchange, selective oxidation, and long-range magnetic ordering. We found novel bonding motifs and identified periodic trends across the actinide series. We identified structural building units that would lead to desired structural features and novel topologies. We also characterized many different spectroscopic trends across the actinide series. The grant support the preparation of approximately 1200 new compounds all of which were structurally characterized.

  4. ORF Alignment: NC_002977 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available ... Length = 112 ... Query: 237 RIELHGVNFKYDSAELTDSAKRILDETAENLILFPEKRDIEVAGHTSTEGT...NEYNMRLSI 296 ... RIELHGVNFKYDSAELTDSAKRILDETAENLILFPEKRDIEVAGHTSTEGTNEYNMRLSI Sbjct: 1 ... RIELHGVNFKYDSAELTDSAKRILDETAENLILFPEKRDIEVAGHTSTEGTNEYNMRLSI 60 ...

  5. ORF Alignment: NC_000854 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available ... Length = 237 ... Query: 64 ... LLVVVTFPGLKSDVELIACSGDRVIEIYNPGVDPHEAQLDPRAARMVAEAD...IVVTGGHTP 123 ... LLVVVTFPGLKSDVELIACSGDRVIEIYNPGVDPHEAQLDPRAARMVAEADIVVTGGHTP Sbjct: 1 ... LLVVVTFPGLKSDVELIACSGDRVIEIYNPGVDPHE

  6. ORF Alignment: NC_006348 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available 98 ... Query: 237 IVAAARDYVLAHRSRPVGVPELCEQLHVSRRTLQYCFQDVLGMAPATYLRALRLNGVRRD 296 ... IVAAARDYVLAHRSRP...VGVPELCEQLHVSRRTLQYCFQDVLGMAPATYLRALRLNGVRRD Sbjct: 1 ... IVAAARDYVLAHRSRPVGVPELCEQLHVSRRTLQYCFQDVLGMAPATYLRALRLNGVRRD 60 ...

  7. Comment on Spracklandus Hoser, 2009 (Reptilia, Serpentes, ELAPIDAE): request for confirmation of availability of the generic name and for the nomenclatural validation of the journal in which it was published (Case 3601; BZN 70:234–237; 71:30–38; 133-135,181-182 ,252-253)

    Science.gov (United States)

    Rhodin, Anders G.J.; Kaiser, Hinrich; van Dijk, Peter Paul; Wüster, Wolfgang; O’Shea, Mark; Archer, Michael; Auliya, Mark; Boitani, Luigi; Bour, Roger; Clausnitzer, Viola; Contreras-MacBeath, Topiltzin; Crother, Brian I.; Daza, Juan M.; Driscoll, Carlos A.; Flores-Villela, Oscar; Frazier, Jack; Fritz, Uwe; Gardner, Alfred L.; Gascon, Claude; Georges, Arthur; Glaw, Frank; Grazziotin, Felipe G.; Groves, Colin P.; Haszprunar, Gerhard; Havaš, Peter; Hero, Jean-Marc; Hoffmann, Michael; Hoogmoed, Marinus S.; Horne, Brian D.; Iverson, John B.; Jäch, Manfred; Jenkins, Christopher L.; Jenkins, Richard K.B.; Kiester, A. Ross; Keogh, J. Scott; Lacher, Thomas E.; Lovich, Jeffrey E.; Luiselli, Luca; Mahler, D. Luke; Mallon, David P.; Mast, Roderic; McDiarmid, Roy W.; Measey, John; Mittermeier, Russell A.; Molur, Sanjay; Mosbrugger, Volker; Murphy, Robert W.; Naish, Darren; Niekisch, Manfred; Ota, Hidetoshi; Parham, James F.; Parr, Michael J.; Pilcher, Nicolas J.; Pine, Ronald H.; Rylands, Anthony B.; Sanderson, James G.; Savage, Jay M.; Schleip, Wulf; Scrocchi, Gustavo J.; Shaffer, H. Bradley; Smith, Eric N.; Sprackland, Robert; Stuart, Simon N.; Vetter, Holger; Vitt, Laurie J.; Waller, Tomás; Webb, Grahame; Wilson, Edward O.; Zaher, Hussam; Thomson, Scott

    2015-01-01

    In Case 3601 Raymond Hoser has asked the Commission to validate for the purposes of nomenclature the name Spracklandus Hoser, 2009, and ‘the journal in which it was published,’ issue 7 of the Australasian Journal of Herpetology (AJH). We note that the entire run of AJH has been written, edited, and published solely by Hoser. Although his requests to the Commission were presented as narrow and, in his words, ‘routine matters,’ we are convinced that they represent an important tipping-point with broad implications of major concern for zoological taxonomy and nomenclature as a whole and, by extension, the greater scientific community. Since Hoser’s actions and works have failed to follow scientific best practices (e.g. Turtle Taxonomy Working Group, 2007, 2014; Kaiser et al., 2013; Kaiser, 2014) and both the Commission’s general Recommendations and Code of Ethics in Appendix A, the global herpetological community has widely rejected his taxonomic decisions and resultant nomenclature. This has unfortunately caused a confusing dual nomenclature to develop in the herpetological community, with most boycotting or ignoring Hoser’s 700+ new names coined in the AJH, while he and a few personal followers actively promote their usage. We believe that suppression of the name Spracklandus, and all issues of AJH, is the only effective way to bring this contentious and confusing issue to resolution. The plenary power available under Article 81.1 of the Code exist specifically to allow the Commission to make rulings in individual cases that disturb stability and cause confusion, whether the works are Code-compliant or not. We maintain that it is in the interest of nomenclatural stability, not only for herpetology, but for all of zoological taxonomy, that the plenary power be invoked to declare the works in AJH unavailable, regardless of any narrow interpretation of their technical Code-compliance. We present our arguments for rejection of the validity of AJH in the following commentary. In view of the wide-reaching implications of this case for all of zoology, and reflecting the deep and broad-based community concern over these issues, our contributing authors include 70 global scientific leaders and accomplished amateurs from a wide variety of zoological disciplines.

  8. Safety assessment of poloxamers 101, 105, 108, 122, 123, 124, 181, 182, 183, 184, 185, 188, 212, 215, 217, 231, 234, 235, 237, 238, 282, 284, 288, 331, 333, 334, 335, 338, 401, 402, 403, and 407, poloxamer 105 benzoate, and poloxamer 182 dibenzoate as used in cosmetics.

    Science.gov (United States)

    Singh-Joy, Subhashni D; McLain, Valerie C

    2008-01-01

    Poloxamers are polyoxyethlyene, polyoxypropylene block polymers. The impurities of commercial grade Poloxamer 188, as an example, include low-molecular-weight substances (aldehydes and both formic and acetic acids), as well as 1,4-dioxane and residual ethylene oxide and propylene oxide. Most Poloxamers function in cosmetics as surfactants, emulsifying agents, cleansing agents, and/or solubilizing agents, and are used in 141 cosmetic products at concentrations from 0.005% to 20%. Poloxamers injected intravenously in animals are rapidly excreted in the urine, with some accumulation in lung, liver, brain, and kidney tissue. In humans, the plasma concentration of Poloxamer 188 (given intravenously) reached a maximum at 1 h, then reached a steady state. Poloxamers generally were ineffective in wound healing, but were effective in reducing postsurgical adhesions in several test systems. Poloxamers can cause hypercholesterolemia and hypertriglyceridemia in animals, but overall, they are relatively nontoxic to animals, with LD(50) values reported from 5 to 34.6 g/kg. Short-term intravenous doses up to 4 g/kg of Poloxamer 108 produced no change in body weights, but did result in diffuse hepatocellular vacuolization, renal tubular dilation in kidneys, and dose-dependent vacuolization of epithelial cells in the proximal convoluted tubules. A short-term inhalation toxicity study of Poloxamer 101 at 97 mg/m(3) identified slight alveolitis after 2 weeks of exposure, which subsided in the 2-week postexposure observation period. A short-term dermal toxicity study of Poloxamer 184 in rabbits at doses up to 1000 mg/kg produced slight erythema and slight intradermal inflammatory response on histological examination, but no dose-dependent body weight, hematology, blood chemistry, or organ weight changes. A 6-month feeding study in rats and dogs of Poloxamer 188 at exposures up to 5% in the diet produced no adverse effects. Likewise, Poloxamer 331 (tested up to 0.5 g/kg day(-1)), Poloxamer 235 (tested up to 1.0 g/kg day(-1)), and Poloxamer 338 (at 0.2 or 1.0 g/kg day(-1)) produced no adverse effects in dogs. Poloxamer 338 (at 5.0 g/kg day(-1)) produced slight transient diarrhea in dogs. Poloxamer 188 at levels up to 7.5% in diet given to rats in a 2-year feeding study produced diarrhea at 5% and 7.5% levels, a small decrease in growth at the 7.5% level, but no change in survival. Doses up to 0.5 mg/kg day(-1) for 2 years using rats produced yellow discoloration of the serum, high serum alkaline phosphatase activity, and elevated serum glutamicpyruvic transaminase and glutamic-oxalacetic transaminase activities. Poloxamers are minimal ocular irritants, but are not dermal irritants or sensitizers in animals. Data on reproductive and developmental toxicity of Poloxamers were not found. An Ames test did not identify any mutagenic activity of Poloxamer 407, with or without metabolic activation. Several studies have suggested anticarcinogenic effects of Poloxamers. Poloxamers appear to increase the sensitivity to anticancer drugs of multidrug-resistant cancer cells. In clinical testing, Poloxamer 188 increased the hydration of feces when used in combination with a bulk laxative treatment. Compared to controls, one study of angioplasty patients receiving Poloxamer 188 found a reduced myocardial infarct size and a reduced incidence of reinfarction, with no evidence of toxicity, but two other studies found no effect. Poloxamer 188 given to patients suffering from sickle cell disease had decreased pain and decreased hospitilization, compared to controls. Clinical tests of dermal irritation and sensitization were uniformly negative. The Cosmetic Ingredient Review (CIR) Expert Panel stressed that the cosmetic industry should continue to use the necessary purification procedures to keep the levels below established limits for ethylene oxide, propylene oxide, and 1,4-dioxane. The Panel did note the absence of reproductive and developmental toxicity data, but, based on molecular weight and solubility, there should be little skin penetration and any penetration of the skin should be slow. Also, the available data demonstrate that Poloxamers that are introduced into the body via routes other than dermal exposure have a rapid clearance from the body, suggesting that there would be no risk of reproductive and/or developmental toxicity. Overall, the available data do not suggest any concern about carcinogenesis. Although there are gaps in knowledge about product use, the overall information available on the types of products in which these ingredients are used, and at what concentration, indicates a pattern of use. Based on these safety test data and the information that the manufacturing process can be controlled to limit unwanted impurities, the Panel concluded that these Poloxamers are safe as used.

  9. Chemical consequences of radioactive decay. 1. Study of 249Cf ingrowth into crystalline 249BkBr3: a new crystalline phase of CfBr3

    International Nuclear Information System (INIS)

    Young, J.P.; Haire, R.G.; Peterson, J.R.; Ensor, D.D.; Fellows, R.L.

    1980-01-01

    Spectrophotometric and x-ray powder diffraction methods have been applied to a study of the ingrowth of californium-249 by β - decay of berkelium-249 in crystalline 249 BkBr 3 . It was found that the Cf daughter grows in with the same oxidation state and crystal structure as the parent. Thus, six-coordinate BkBr 3 (AlCl 3 -type monoclinic structure) generates six-coordinate CfBr 3 , and eight-coordinate BkBr 3 (PuBr 3 -type orthorhombic structure) generates eight-coordinate CfBr 3 , a previously unknown form of CfBr 3 . It was also found that the daughter Cf(III) in the BkBr 3 parent compound can be reduced to Cf(II) by treatment with H 2 , as it can in pure CfBr 3 . 5 figures

  10. Reactor production of 252Cf and transcurium isotopes

    International Nuclear Information System (INIS)

    Alexander, C.W.; Halperin, J.; Walker, R.L.; Bigelow, J.E.

    1990-01-01

    Berkelium, californium, einsteinium, and fermium are currently produced in the High Flux Isotope Reactor (HFIR) and recovered in the Radiochemical Engineering Development Center (REDC) at the Oak Ridge National Laboratory (ORNL). All the isotopes are used for research. In addition, 252 Cf, 253 Es, and 255 Fm have been considered or are used for industrial or medical applications. ORNL is the sole producer of these transcurium isotopes in the western world. A wide range of actinide samples were irradiated in special test assemblies at the Fast Flux Test Facility (FFTF) at Hanford, Washington. The purpose of the experiments was to evaluate the usefulness of the two-group flux model for transmutations in the special assemblies with an eventual goal of determining the feasibility of producing macro amounts of transcurium isotopes in the FFTF. Preliminary results from the production of 254g Es from 252 Cf will be discussed. 14 refs., 5 tabs

  11. Nuclear fission and the transuranium elements

    International Nuclear Information System (INIS)

    Seaborg, G.T.

    1989-02-01

    Many of the transuranium elements are produced and isolated in large quantities through the use of neutrons furnished by nuclear fission reactions: plutonium (atomic number 94) in ton quantities; neptunium (93), americium (95), and curium (96) in kilogram quantities; berkelium (97) in 100 milligram quantities; californium (98) in gram quantities; and einsteinium (99) in milligram quantities. Transuranium isotopes have found many practical applications---as nuclear fuel for the large-scale generation of electricity, as compact, long-lived power sources for use in space exploration, as means for diagnosis and treatment in the medical area, and as tools in numerous industrial processes. Of particular interest is the unusual chemistry and impact of these heaviest elements on the periodic table. This account will feature these aspects. 9 refs., 5 figs

  12. Nuclear fission and the transuranium elements

    Energy Technology Data Exchange (ETDEWEB)

    Seaborg, G.T.

    1989-02-01

    Many of the transuranium elements are produced and isolated in large quantities through the use of neutrons furnished by nuclear fission reactions: plutonium (atomic number 94) in ton quantities; neptunium (93), americium (95), and curium (96) in kilogram quantities; berkelium (97) in 100 milligram quantities; californium (98) in gram quantities; and einsteinium (99) in milligram quantities. Transuranium isotopes have found many practical applications---as nuclear fuel for the large-scale generation of electricity, as compact, long-lived power sources for use in space exploration, as means for diagnosis and treatment in the medical area, and as tools in numerous industrial processes. Of particular interest is the unusual chemistry and impact of these heaviest elements on the periodic table. This account will feature these aspects. 9 refs., 5 figs.

  13. ORF Alignment: NC_006274 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available kinase ... [Bacillus cereus ATCC 14579] ... Length = 81 ... Query: 237 MRKKLKESIEMQTQYEENRKELISNISHDLKTPITSIIGYVEGIKDGVANT...PEKMDKYLT 296 ... MRK+LKESIEMQTQYEENRKELISNISHDLKTPITSIIGYVEGIKDGVANT...PEKMDKYLT Sbjct: 1 ... MRKRLKESIEMQTQYEENRKELISNISHDLKTPITSIIGYVEGIKDGVANTPEKMDKYLT 60 ...

  14. ORF Alignment: NC_004722 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available kinase ... [Bacillus cereus ATCC 14579] ... Length = 81 ... Query: 237 MRKRLKESIEMQTQYEENRKELISNISHDLKTPITSIIGYVEGIKDGVANT...PEKMDKYLT 296 ... MRKRLKESIEMQTQYEENRKELISNISHDLKTPITSIIGYVEGIKDGVANT...PEKMDKYLT Sbjct: 1 ... MRKRLKESIEMQTQYEENRKELISNISHDLKTPITSIIGYVEGIKDGVANTPEKMDKYLT 60 ...

  15. Characterization of a Viking Blade Fabricated by Traditional Forging Techniques

    Science.gov (United States)

    Vo, H.; Frazer, D.; Bailey, N.; Traylor, R.; Austin, J.; Pringle, J.; Bickel, J.; Connick, R.; Connick, W.; Hosemann, P.

    2016-12-01

    A team of students from the University of California, Berkeley, participated in a blade-smithing competition hosted by the Minerals, Metals, and Materials Society at the TMS 2015 144th annual meeting and exhibition. Motivated by ancient forging methods, the UC Berkeley team chose to fabricate our blade from historical smithing techniques utilizing naturally-occurring deposits of iron ore. This approach resulted in receiving the "Best Example of a Traditional Blade Process/Ore Smelting Technique" award for our blade named "Berkelium." First, iron-enriched sand was collected from local beaches. Magnetite (Fe3O4) was then extracted from the sand and smelted into individual high- and low-carbon steel ingots. Layers of high- and low-carbon steels were forge-welded together, predominantly by hand, to form a composite material. Optical microscopy, energy dispersive spectroscopy, and Vickers hardness mechanical testing were conducted at different stages throughout the blade-making process to evaluate the microstructure and hardness evolution during formation. It was found that the pre-heat-treated blade microstructure was composed of ferrite and pearlite, and contained many nonmetallic inclusions. A final heat treatment was performed, which caused the average hardness of the blade edge to increase by more than a factor of two, indicating a martensitic transformation.

  16. Nuclear Chemistry Institute, Mainz University. Annual Report 1995

    International Nuclear Information System (INIS)

    Denschlag, H.O.

    1996-03-01

    The annual report of the Institut fuer Kernchemie addresses inter alia three main research activities. The first belongs to the area of basic research, covering studies in the fields of nuclear fission, chemistry of the super-heavy elements and of heavy-ion reactions extending from the Coulomb barrier to relativistic energies, and nuclear astrophysics in connection with the ''r process''. By means of laser technology, high-precision data could be measured of the ionization energies of berkelium and californium. Studies of atomic clusters in the vacuum of an ionization trap revealed interesting aspects. The second major activity was devoted to the analysis of environmental media, applying inter alia neutron activation analysis and resonance ionization mass spectroscopy (RIMS). The third activity resulted in the development of novel processes, or the enhancement of existing processes or methods, for applications in basic research work and in environmental analytics. Another item of interest is the summarizing report on the operation of the TRIGA research reactor. (orig./SR) [de

  17. The Transplutonium. The superheavy nuclei found in the micas of Madagascar and their interests

    International Nuclear Information System (INIS)

    Raoelina Andriambololona

    1976-01-01

    Since June 1976, evidence for the existence of superheavy elements is discussed about. After having recalled artificial elements with atomic numbers Z of wich go from Z=95 (Americium) to Z=107 (built in 1976), superheavy elements having Z greater than 110 are considered. They have been discovered by american searchers in giant halos seen in Madagascar micas. The samples have been recoked in the Fort-Dauphin region (Haut Mandrare). The corresponding numbers Z are 114, 115, 116, 124, 125, 125, 126, 127. It seems that the existence of Z=126 element should be accepted with a greater degree of confidence. But different experiences done by other groups seem to show the evidence of superheavy elements in micas looks weaker. Nevertheless, it is interesting to investigate the evidence or the non-evidence of those elements. We estimate the mass numbers A of those superheavy elements in the liquid drop model if we assume that they are stable versus β. The results thus obtained agree with the shell-model ones within 4 % approximation. We propose if the evidence of superheavies is confirmed to give the name of madagascarium to one of them (Z=126) by similitude with francium, lutetium, polonium, berkelium, americium, europium, ...Their evidence was first conjectured in Madagascar micas in 1976. Superheavy nuclei are to be distinguished from hypernuclei. [fr

  18. Identification of the new isotope sup 2 sup 4 sup 1 Bk

    CERN Document Server

    Asai, M; Ichikawa, S; Nagame, Y; Nishinaka, I; Akiyama, K; Toyoshima, A; Kaneko, T; Sakama, M; Haba, H; Oura, Y; Kojima, Y; Shibata, M

    2003-01-01

    A new neutron-deficient berkelium isotope sup 2 sup 4 sup 1 Bk produced in the sup 2 sup 3 sup 9 Pu( sup 6 Li, 4n) reaction has been identified using a gas-jet coupled on-line isotope separator. Cm K and L X-rays associated with the EC decay of sup 2 sup 4 sup 1 Bk were observed in the mass-241 fraction, and three gamma transitions were attributed to the EC decay of sup 2 sup 4 sup 1 Bk through X-gamma coincidences. The half-life of sup 2 sup 4 sup 1 Bk was determined to be 4.6+-0.4 min which is 1/2-1/4 of that of theoretical predictions. The half-life value and the observed gamma transitions can be consistently explained as a consequence of the allowed EC transition of pi 7/2 sup + [633] -> nu 7/2 sup + [624]. (orig.)

  19. The creation of new nuclei

    International Nuclear Information System (INIS)

    Armbruster, P.; Hessberger, F.P.

    1998-01-01

    In the last 60 years physicists have created 20 artificial elements beyond uranium. In 1934 Enrico Fermi predicted the creation of new elements by bombarding atoms with neutrons. This method led to the discovery of neptunium (Z=93), plutonium, americium, curium, berkelium, californium, einsteinium and fermium (Z=100). In fact the capture of a neutron is followed by a beta-decay which increases the atomic number (Z) by one unit. Beyond Z=100 beta-decay no more occurs so a new approach was necessary. Between the American Lawrence Berkeley Laboratory and the Russian Dubna Institute a fierce competition broke out to produce new elements by bombarding transuranium nuclei with light elements such as helium, carbon, nitrogen. This new method required heavy equipment: ion accelerator and detectors but led to the creation of all the elements from Z=101 to Z=106. A new idea was to provoke the fusion of heavy nuclei such as lead and bismuth with colliding argon, nickel or zinc ion beams. This method called 'cold fusion' opened the way to reach the nuclei beyond Z=107. In 1996 the element Z=112 was the last discovered. The next step could be the element Z=114 for which a particular stability is expected. (A.C.)

  20. Actinide metals

    Energy Technology Data Exchange (ETDEWEB)

    Brown, Paul L. [Geochem Australia, Kiama, NSW (Australia); Ekberg, Christian [Chalmers Univ. of Technology, Goeteborg (Sweden). Nuclear Chemistry/Industrial Materials Recycling

    2016-07-01

    All isotopes of actinium are radioactive and exist in aqueous solution only in the trivalent state. There have been very few studies on the hydrolytic reactions of actinium(III). The hydrolysis reactions for uranium would only be important in alkaline pH conditions. Thermodynamic parameters for the hydrolysis species of uranium(VI) and its oxide and hydroxide phases can be determined from the stability and solubility constants. The hydrolytic behaviour of neptunium(VI) is quite similar to that of uranium(VI). The solubility constant of NpO{sub 2}OH(am) has been reported a number of times for both zero ionic strength and in fixed ionic strength media. Americium can form four oxidation states in aqueous solution, namely trivalent, tetravalent, pentavalent and hexavalent. Desire, Hussonnois and Guillaumont determined stability constants for the species AmOH{sup 2+} for the actinides, plutonium(III), americium(III), curium(III), berkelium(III) and californium(III) using a solvent extraction technique.

  1. Management of nuclear materials in an R ampersand D environment at the Los Alamos National Laboratory

    International Nuclear Information System (INIS)

    Behrens, R.G.; Roth, S.B.; Jones, S.R.

    1991-01-01

    Los Alamos National Laboratory is a multidisciplinary R ampersand D organization and, as such, its nuclear materials inventory is diverse. Accordingly, major inventories of isotopes such as Pu-238, Pu-239, Pu-242, U-235, Th, tritium, and deuterium, and lesser amounts of isotopes of Am, Cm, Np and exotic isotopes such as berkelium must be managed in accordance with Department of Energy Orders and Laboratory policies. Los Alamos also acts as a national resource for many one-of-a-kind materials which are supplied to universities, industry, and other government agencies within the US and throughout the world. Management of these materials requires effective interaction and communication with many nuclear materials custodians residing in over forty technical groups as well as effective interaction with numerous outside organizations. This paper discusses the role, philosophy, and organizational structure of Nuclear Materials Management at Los Alamos and also briefly presents results of two special nuclear materials management projects: 1- Revision of Item Description Codes for use in the Los Alamos nuclear material data base and 2- The recommendation of new economic discard limits for Pu-239. 2 refs., 1 fig

  2. Extraction of transplutonium elements from carbonate solutions by alkylpyrocatechol

    International Nuclear Information System (INIS)

    Karalova, Z.K.; Myasoedov, B.F.; Rodionova, L.M.; Kuznetsova, V.S.

    1983-01-01

    Extraction of americium, berkelium as well as Ce, Eu, Th, U, Zr, Cs, Fe with solution of 4(α, α-dioctylethyl)pyrocatechol (DOP) in toluene from carbonate solutions to determine conditions of their separation has been studied. It is established that americium extraction is quite sensitive to the changes of potassium carbonate concentration. The maximum extraction of americium (R >90%) is observed in the case of 0.1-0.5 mol/l of K 2 CO 3 solutions and the minimum one (R=2.5%) - in the case of 8 mol/l K 2 CO 3 . Americium extraction increases sharply when sodium hydroxide is introduced in carbonate solutions. It is shown that varying sodium hydroxide concentration it is possible to achieve qualitative extraction of americium even from saturated solution of potassium carbonate. Reextraction of TPE is easily realized with 3 mol/l HCl solution. The system K 2 CO 3 (KOH)-DOP proved to be perspective for Am separation from Bk, Ce, Cs, actinoid elements as well as from Fe

  3. Actinide metals

    International Nuclear Information System (INIS)

    Brown, Paul L.; Ekberg, Christian

    2016-01-01

    All isotopes of actinium are radioactive and exist in aqueous solution only in the trivalent state. There have been very few studies on the hydrolytic reactions of actinium(III). The hydrolysis reactions for uranium would only be important in alkaline pH conditions. Thermodynamic parameters for the hydrolysis species of uranium(VI) and its oxide and hydroxide phases can be determined from the stability and solubility constants. The hydrolytic behaviour of neptunium(VI) is quite similar to that of uranium(VI). The solubility constant of NpO 2 OH(am) has been reported a number of times for both zero ionic strength and in fixed ionic strength media. Americium can form four oxidation states in aqueous solution, namely trivalent, tetravalent, pentavalent and hexavalent. Desire, Hussonnois and Guillaumont determined stability constants for the species AmOH 2+ for the actinides, plutonium(III), americium(III), curium(III), berkelium(III) and californium(III) using a solvent extraction technique.

  4. Paul Scherrer Institute Scientific Report 1999. Volume I: Particles and Matter

    International Nuclear Information System (INIS)

    Gobrecht, J.; Gaeggeler, H.; Herlach, D.; Junker, K.; Kettle, P.-R.; Kubik, P.; Zehnder, A.

    2000-01-01

    Although originally planned for fundamental research in nuclear physics, the particle beams of pions, muons, protons and neutrons are now used in a large variety of disciplines in both natural science and medicine. The beams at PSI have the world's highest intensities and therefore allow certain experiments to be performed, which would not be possible elsewhere. The highlight of research this year was the first-ever determination of the chemical properties of the superheavy element 107 Bohrium. This was undertaken, by an international team led by H. Gaeggeler of PSI's Laboratory for Radiochemistry. Bohrium was produced by bombarding a Berkelium target with Neon ions from the Injector I cyclotron and six atoms were detected after having passed through an online gas chromatography device. At the Laboratory for Particle Physics the focus has shifted from nuclear physics to elementary particle physics with about a fifty-fifty split between investigations of rare processes or particle decays using the high intensity muon, pion and recently also polarized neutron beams of PSI, and research at the highest energy frontier at CERN (Geneva) and DESY (Hamburg). Important space instrumentation has been contributed by the Laboratory for Astrophysics to the European Space Agency and NASA satellite programmes. The Laboratory for Micro and Nanotechnology continued to focus on research into molecular nanotechnology and SiGeC nanostructures, the latter with the aim of producing silicon based optoelectronics. Progress in 1999 in these topical areas is described in this report. A list of scientific publications in 1999 is also provided

  5. Paul Scherrer Institute Scientific Report 1999. Volume I: Particles and Matter

    Energy Technology Data Exchange (ETDEWEB)

    Gobrecht, J; Gaeggeler, H; Herlach, D; Junker, K; Kettle, P -R; Kubik, P; Zehnder, A [eds.

    2000-07-01

    lthough originally planned for fundamental research in nuclear physics, the particle beams of pions, muons, protons and neutrons are now used in a large variety of disciplines in both natural science and medicine. The beams at PSI have the world's highest intensities and therefore allow certain experiments to be performed, which would not be possible elsewhere. The highlight of research this year was the first-ever determination of the chemical properties of the superheavy element {sup 107} Bohrium. This was undertaken, by an international team led by H. Gaeggeler of PSI's Laboratory for Radiochemistry. Bohrium was produced by bombarding a Berkelium target with Neon ions from the Injector I cyclotron and six atoms were detected after having passed through an online gas chromatography device. At the Laboratory for Particle Physics the focus has shifted from nuclear physics to elementary particle physics with about a fifty-fifty split between investigations of rare processes or particle decays using the high intensity muon, pion and recently also polarized neutron beams of PSI, and research at the highest energy frontier at CERN (Geneva) and DESY (Hamburg). Important space instrumentation has been contributed by the Laboratory for Astrophysics to the European Space Agency and NASA satellite programmes. The Laboratory for Micro and Nanotechnology continued to focus on research into molecular nanotechnology and SiGeC nanostructures, the latter with the aim of producing silicon based optoelectronics. Progress in 1999 in these topical areas is described in this report. A list of scientific publications in 1999 is also provided.

  6. Investigations for the influence of geochemical parameters on the sorption and desorption of lanthanides and uranium onto opalinus clay as potential host rock for a repository

    International Nuclear Information System (INIS)

    Moeser, Christina

    2010-01-01

    The development of a disposal in deep geological formations for radioactive waste is a very important task for the future. The safety assessment for more than a hundred thousand years needs a full understanding of all processes of interaction between the radioactive waste and the surrounded formations. This work contributes to this understanding. The interaction between lanthanides (homologues of the actinides americium, curium and berkelium) / uranium and the host rock opalinus clay under influence of organic substances (NOM) have been analyzed and discussed. The complex system was split into 3 binary basic systems with the following interactions - Interactions between lanthanides / uranium and NOM - Interactions between lanthanides / uranium and the opalinus clay - Interactions between NOM and opalinus clay All binary systems can be influenced by geological parameters like pH, ion strength and competing cations. The sorption / desorption of the lanthanides onto the opalinus clay is analyzed via inductively coupled plasma mass spectrometry. For the investigation of the complexation behavior of metals with NOM we used capillary electrophoresis coupled with inductively coupled plasma mass spectrometry. Under these conditions the chosen model organic humic acid affected the sorption of the lanthanides onto opalinus clay favorably. The smaller organic compounds, which dominate in the composition of the clay organics, remobilized the metals after sorption onto clay and the sorption can be inhibited by NOM. Due to the reduced metal sorption onto Opalinus clay by NOM, a migration through the clay may be possible.

  7. Fluorescence and excitation spectra of Bk3+, Cf3+, and Es3+ ions in single crystals of LaCl3

    International Nuclear Information System (INIS)

    Hessler, J.P.; Caird, J.A.; Carnall, W.T.; Crosswhite, H.M.; Sjoblom, R.K.; Wagner, F. Jr.

    1978-01-01

    Dye laser techniques have been used to study the energy level structure of the heavier actinides in single crystals of lanthanum chloride. In the case of einsteinium, fluorescence was detected and measured from the following manifolds: J = 5 at 0.984 μm -1 , J = 4 at 1.572 μm -1 , J = 6 at 2.930 μm -1 . This fluorescence was observed to the five lowest manifolds: J = 8, 5, 7, 2, 6. For californium, fluorescence has been detected from the manifolds: J = 11/2 at 1.190 μm -1 , J = 7/2 at 1.389 μm -1 , J = 5/2 at 1.977 μm -1 . This fluorescence was observed to the three lowest manifolds: J = 15/2, 9/2, 11/2. The fluorescence manifolds of berkelium are J = 6 at 1.540 μm -1 , and J = 4 at 1.953 μm -1 . The three lowest manifolds, J = 6, 5, and 4, have been observed in fluorescence. Absorption spectra data have yielded crystal-field splitting measurements in the higher manifolds of Es + . The location of the manifolds in general confirmed earlier approximate free-ion level structure calculations based on assumed regularities in the energy level parameters derived from spectra of the actinide ions through Cf + . 2 figures

  8. Method for Determination of Neptunium in Large-Sized Urine Samples Using Manganese Dioxide Coprecipitation and 242Pu as Yield Tracer

    DEFF Research Database (Denmark)

    Qiao, Jixin; Hou, Xiaolin; Roos, Per

    2013-01-01

    A novel method for bioassay of large volumes of human urine samples using manganese dioxide coprecipitation for preconcentration was developed for rapid determination of 237Np. 242Pu was utilized as a nonisotopic tracer to monitor the chemical yield of 237Np. A sequential injection extraction chr...... and rapid analysis of neptunium contamination level for emergency preparedness....

  9. Quantum helimagnetism of the frustrated spin-1/2 chain LiCuVO.sub.4./sub..

    Czech Academy of Sciences Publication Activity Database

    Enderle, M.; Mukherjee, C.; Fak, B.; Kremer, R. K.; Broto, J.-M.; Rosner, H.; Drechsler, S.-L.; Richter, J.; Málek, Jiří; Prokofiev, A.; Assmus, W.; Pujol, S.; Raggazzoni, J.-L.; Rakato, H.; Rheinstädter, M.; Ronnow, H.M.

    2005-01-01

    Roč. 70, č. 2 (2005), s. 237-243 ISSN 0295-5075 Institutional research plan: CEZ:AV0Z10100520 Keywords : inelastic neutron scattering * magnetic quantum helix Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 2.237, year: 2005

  10. New records of Ascaridia platyceri (Nematoda) in parrots (Psittaciformes)

    Czech Academy of Sciences Publication Activity Database

    Kajerová, V.; Baruš, Vlastimil; Literák, I.

    2004-01-01

    Roč. 49, č. 7 (2004), s. 237-241 ISSN 0375-8427 R&D Projects: GA ČR GA524/03/0061 Institutional research plan: CEZ:AV0Z6093917 Keywords : ascarids * morphology * Nematoda Subject RIV: EG - Zoology Impact factor: 0.790, year: 2004 http://www.vri.cz/docs/vetmed/49-7-237.pdf

  11. The accumulation of plutonium by the European lobster (Homarus gammarus L.)

    International Nuclear Information System (INIS)

    Swift, D.J.

    1992-01-01

    For 237 Pu accumulation from seawater, the whole body concentration factors (CFs) for juvenile lobsters at 18 o C did not exceed 250 over the 49 days of the study. Most 237 Pu was accumulated by the gills and exoskeleton. Since homarid lobsters eat their exuviae after ecdysis, the whole body 237 Pu content of recently moulted lobsters was also a function of the amount of 237 Pu ingested with the exuviae. Consequently, organ/tissue content and CF values for individual lobsters reflected both the time since their last moult and their exposure time to 237 Pu. These factors precluded the calculation of mean whole body CF values or the accurate estimate of a mean steady state (C ss ) CF value. Juvenile lobsters retained significantly more 237 Pu from labelled food at 7-10 o C than at 18 o C. At 7 o C, the biological half time for assimilated 237 Pu was about 28 days, at 10 o C about 15 days and at 18 o C about 8 days. Very little 237 Pu was transported from the gut to the internal tissues (about 1%); most was retained in the hepatopancreas. (author)

  12. The study of prompt and delayed muon induced fission III. The ratios of prompt to delayed fission yields

    NARCIS (Netherlands)

    Rösel, Ch.; Hänscheid, H.; Hartfiel, J.; Mutius, von R.; Achard van Enschut, d' J.F.M.; David, P; Janszen, H.; Johansson, T.; Konijn, J.; Krogulski, T.; Laat, de C.T.A.M.; Paganetti, H.; Petitjean, C.; Polikanov, S.M.; Reist, H.W.; Risse, F.; Schaller, L.A.; Schrieder, W.; Sinha, A.K.; Taal, A.; Theobald, J.P.; Tibell, G.; Trautmann, N.

    1993-01-01

    The ratios of prompt to delayed fission yields for the isotopes U-233, U-234, U-235, U-236, U-238, Np-237, Pu-242, and Pu-244 and the fission probabilities relative to each other have been investigated experimentally. Using the value of the total fission probability for Np-237 the absolute

  13. Determination of neptunium in soil by ICP-MS

    International Nuclear Information System (INIS)

    Ayranov, M.; Kraehenbuehl, U.

    2005-01-01

    A fast and simple method for the determination of 237 Np in soil is presented. The borate fusion decreases the sample pre-treatment time and a TEVA extraction chromatography separates neptunium from uranium and the interfering matrix components. A comparison of the sensitivities of alpha spectrometry and sector field ICP-MS for determination of 237 Np is presented. (orig.)

  14. Gastrointestinal absorption and retention of plutonium-238 in neonatal rats and swine

    International Nuclear Information System (INIS)

    Sullivan, M.F.

    1978-01-01

    Neonatal rats gavaged with 237 Pu or 238 Pu retained a substantial quantity in gut mucosa for a week but absorbed only 2.9% of the 237 Pu. After 140 days the amount retained fell to half that initially deposited. Newborn swine also retained large amounts in the gut and absorbed about 40% of the dose

  15. Dicty_cDB: Contig-U12507-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 129S1/SvImJ Mus musculus STS genomi... 58 0.001 1 ( BV434071 ) S237P6227RB12.T0 PortugueseWaterDog Canis fam...ilia... 58 0.001 1 ( BV424860 ) S237P6196FC6.T0 PortugueseWaterDog Canis familiar

  16. Dicty_cDB: Contig-U03903-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available A sequence from clone DKEYP-86F8 in l... 52 0.023 1 ( BV433213 ) S237P6285FG10.T0 Portuguese...6 1 ( BV438906 ) S237P6374FA9.T0 PortugueseWaterDog Canis familiar... 44 5.6 1 ( AM456273 ) Vitis vinifera c

  17. EFFECT OF HYDROPHOBIC ORGANIC POLLUTANTS BIOAVAILABILITY ON ECOTOXICITY OF HISTORICALLY CONTAMINATED SOILS

    Czech Academy of Sciences Publication Activity Database

    Čvančarová, Monika; Innemanová, P.; Cajthaml, Tomáš

    2012-01-01

    Roč. 11, č. 3 (2012), s. 237-237 ISSN 1843-3707. [Environmental Microbiology and Biotechnology. 10.04.2012-12.04.2012, Bologna] R&D Projects: GA TA ČR TA01020804 Institutional research plan: CEZ:AV0Z50200510 Keywords : Supercritical fluid extraction Subject RIV: EE - Microbiology, Virology

  18. Browse Title Index

    African Journals Online (AJOL)

    Items 201 - 237 of 237 ... Vol 59 (2015), The IFAA Sunday Forum: Youth Dialogue on the TRC - Reflections and Possibilities, Abstract. CA Lester. Vol 58 (2015), The IMF's advice on fiscal policy, Abstract. A Schimmelpfennig. Vol 67, No 1 (2017), The national health insurance and traditional healing in South Africa, Abstract.

  19. The accumulation of plutonium by the European lobster (Homarus gammarus L. )

    Energy Technology Data Exchange (ETDEWEB)

    Swift, D J [Ministry of Agriculture, Fisheries and Food, Lowestoft (United Kingdom). Directorate of Fisheries Research

    1992-01-01

    For {sup 237}Pu accumulation from seawater, the whole body concentration factors (CFs) for juvenile lobsters at 18{sup o}C did not exceed 250 over the 49 days of the study. Most {sup 237}Pu was accumulated by the gills and exoskeleton. Since homarid lobsters eat their exuviae after ecdysis, the whole body {sup 237}Pu content of recently moulted lobsters was also a function of the amount of {sup 237}Pu ingested with the exuviae. Consequently, organ/tissue content and CF values for individual lobsters reflected both the time since their last moult and their exposure time to {sup 237}Pu. These factors precluded the calculation of mean whole body CF values or the accurate estimate of a mean steady state (C{sub ss}) CF value. Juvenile lobsters retained significantly more {sup 237}Pu from labelled food at 7-10{sup o}C than at 18{sup o}C. At 7{sup o}C, the biological half time for assimilated {sup 237}Pu was about 28 days, at 10{sup o}C about 15 days and at 18{sup o}C about 8 days. Very little {sup 237}Pu was transported from the gut to the internal tissues (about 1%); most was retained in the hepatopancreas. (author).

  20. Structural analysis within the Rožná and Olší uranium deposits (Strážek Moldanubicum) for the estimation of deformation and stress conditions of underground gas storage

    Czech Academy of Sciences Publication Activity Database

    Ptáček, Jiří; Melichar, R.; Hájek, Antonín; Koníček, Petr; Souček, Kamil; Staš, Lubomír; Kříž, P.; Lazárek, J.

    2013-01-01

    Roč. 10, č. 2 (2013), s. 237-246 ISSN 1214-9705 Institutional support: RVO:68145535 Keywords : structural analysis * deformation * stress * underground gas storage Subject RIV: DH - Mining, incl. Coal Mining Impact factor: 0.667, year: 2013 http://www.irsm.cas.cz/materialy/acta_content/2013_02/acta_170_13_Ptacek_237-246.pdf

  1. 78 FR 73109 - Radio Broadcasting Services; Benjamin and Cisco, TX; De Beque, CO; Port Lions, AK; Rule and...

    Science.gov (United States)

    2013-12-05

    ... Broadcasting Services; Benjamin and Cisco, TX; De Beque, CO; Port Lions, AK; Rule and Shamrock, TX AGENCY... 237C3 at Benjamin, Texas; Channel 261C3 at Cisco, Texas; Channel 288C2 at Rule, Texas; and Channel 225C2..., Channel 237C3; by removing Cisco, Channel 261C3; by removing Channel 288C2 at Rule; and by removing...

  2. Dicty_cDB: Contig-U04716-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ( BV429027 ) S237P6215FG6.T0 PortugueseWaterDog Canis familiar... 38 6e-04 2 ( CE020668 ) tigr-gss-dog-1700...AFT ... 48 0.034 2 ( CE733596 ) tigr-gss-dog-17000315432205 Dog Library Canis lup... 38 0.034 2 ( BV431612 ) S237P656RA1.T0 Portugues...library Mus ... 38 0.13 2 ( BV431707 ) S237P6458FA8.T0 PortugueseWaterDog Canis familiar... 38 0.13 2 ( BV25... ( BV437326 ) S237P6229FG2.T0 PortugueseWaterDog Canis familiar... 38 0.13 2 ( CE358139 ) tigr-gss-dog-17000... Canis lup... 38 0.14 2 ( BV432826 ) S237P6430RB9.T0 PortugueseWaterDog Canis familiar... 36 0.14 2 ( CE4742

  3. Capability to Recover Plutonium-238 in H-Canyon/HB-Line - 13248

    Energy Technology Data Exchange (ETDEWEB)

    Fuller, Kenneth S. Jr.; Smith, Robert H. Jr.; Goergen, Charles R. [Savannah River Nuclear Solutions, LLC, Savannah River Site, Aiken, SC 29802 (United States)

    2013-07-01

    Plutonium-238 is used in Radioisotope Thermoelectric Generators (RTGs) to generate electrical power and in Radioisotope Heater Units (RHUs) to produce heat for electronics and environmental control for deep space missions. The domestic supply of Pu-238 consists of scrap material from previous mission production or material purchased from Russia. Currently, the United States has no significant production scale operational capability to produce and separate new Pu-238 from irradiated neptunium-237 targets. The Department of Energy - Nuclear Energy is currently evaluating and developing plans to reconstitute the United States capability to produce Pu-238 from irradiated Np-237 targets. The Savannah River Site had previously produced and/or processed all the Pu-238 utilized in Radioisotope Thermoelectric Generators (RTGs) for deep space missions up to and including the majority of the plutonium for the Cassini Mission. The previous full production cycle capabilities included: Np- 237 target fabrication, target irradiation, target dissolution and Np-237 and Pu-238 separation and purification, conversion of Np-237 and Pu-238 to oxide, scrap recovery, and Pu-238 encapsulation. The capability and equipment still exist and could be revitalized or put back into service to recover and purify Pu-238/Np-237 or broken General Purpose Heat Source (GPHS) pellets utilizing existing process equipment in HB-Line Scrap Recovery, and H-Canyon Frame Waste Recovery processes. The conversion of Np-237 and Pu-238 to oxide can be performed in the existing HB-Line Phase-2 and Phase- 3 Processes. Dissolution of irradiated Np-237 target material, and separation and purification of Np-237 and Pu-238 product streams would be possible at production rates of ∼2 kg/month of Pu-238 if the existing H-Canyon Frames Process spare equipment were re-installed. Previously, the primary H-Canyon Frames equipment was removed to be replaced: however, the replacement project was stopped. The spare equipment

  4. Holdup Measures on an SRNL Mossbauer Spectroscopy Instrument

    Energy Technology Data Exchange (ETDEWEB)

    Dewberry, R.; Brown, T.; Salaymeh, S.

    2010-05-05

    Gamma-ray holdup measurements of a Mossbauer spectroscopy instrument are described and modeled. In the qualitative acquisitions obtained in a low background area of Savannah River National Laboratory, only Am-241 and Np-237 activity were observed. The Am-241 was known to be the instrumental activation source, while the Np-237 is clearly observed as a source of contamination internal to the instrument. The two sources of activity are modeled separately in two acquisition configurations using two separate modeling tools. The results agree well, demonstrating a content of (1980 {+-} 150) {mu}Ci Am-241 and (110 {+-} 50) {mu}Ci of Np-237.

  5. Mutual emergency assistance for radiation accidents

    International Nuclear Information System (INIS)

    1983-03-01

    A revised document on ''Mutual Emergency Assistance for Radiation Accidents'' jointly prepared by the Agency with the participation of the World Health Organization (WHO), the Food and Agricultural Organization of the United Nations (FAO), the International Labour Organisation (ILO) and the Office of the United Nations Disaster Relief Co-ordinator (UNDRO) was issued in 1980 as TECDOC-237. The present document lists the additional information received after publication of the 1980 edition and is issued as a Supplement to TECDOC-237 (1980 Edition). Some useful information contained in TECDOC-237 such as the IAEA arrangement and the WHO Collaborating Centres for Radiation Emergency Assistance are reprinted for ready reference

  6. Comparison of fission and capture cross sections of minor actinides

    International Nuclear Information System (INIS)

    Nakagawa, Tsuneo; Iwamoto, Osamu

    2003-01-01

    The fission and capture cross sections of minor actinides given in JENDL-3.3 are compared with other evaluated data and experimental data. The comparison was made for 32 nuclides of Th-227, 228, 229, 230, 233, 234, Pa-231, 232, 233, U-232, 234, 236, 237, Np-236, 237, 238, Pu-236, 237, 238, 242, 244, Am-241, 242, 242m, 243, Cm-242, 243, 244, 245, 246, 247 and 248. Given in the present report are figures of these cross sections and tables of cross sections at 0.0253 eV and resonance integrals. (author)

  7. Attenuation of Foot-and-Mouth Disease Virus by Engineered Viral Polymerase Fidelity.

    Science.gov (United States)

    Rai, Devendra K; Diaz-San Segundo, Fayna; Campagnola, Grace; Keith, Anna; Schafer, Elizabeth A; Kloc, Anna; de Los Santos, Teresa; Peersen, Olve; Rieder, Elizabeth

    2017-08-01

    Foot-and-mouth disease virus (FMDV) RNA-dependent RNA polymerase (RdRp) (3D pol ) catalyzes viral RNA synthesis. Its characteristic low fidelity and absence of proofreading activity allow FMDV to rapidly mutate and adapt to dynamic environments. In this study, we used the structure of FMDV 3D pol in combination with previously reported results from similar picornaviral polymerases to design point mutations that would alter replication fidelity. In particular, we targeted Trp237 within conserved polymerase motif A because of the low reversion potential inherent in the single UGG codon. Using biochemical and genetic tools, we show that the replacement of tryptophan 237 with phenylalanine imparts higher fidelity, but replacements with isoleucine and leucine resulted in lower-fidelity phenotypes. Viruses containing these W237 substitutions show in vitro growth kinetics and plaque morphologies similar to those of the wild-type (WT) A 24 Cruzeiro strain in BHK cells, and both high- and low-fidelity variants retained fitness during coinfection with the wild-type virus. The higher-fidelity W237F (W237F HF ) mutant virus was more resistant to the mutagenic nucleoside analogs ribavirin and 5-fluorouracil than the WT virus, whereas the lower-fidelity W237I (W237I LF ) and W237L LF mutant viruses exhibited lower ribavirin resistance. Interestingly, the variant viruses showed heterogeneous and slightly delayed growth kinetics in primary porcine kidney cells, and they were significantly attenuated in mouse infection experiments. These data demonstrate, for a single virus, that either increased or decreased RdRp fidelity attenuates virus growth in animals, which is a desirable feature for the development of safer and genetically more stable vaccine candidates. IMPORTANCE Foot-and-mouth disease (FMD) is the most devastating disease affecting livestock worldwide. Here, using structural and biochemical analyses, we have identified FMDV 3D pol mutations that affect polymerase

  8. Actinide production in the reaction of heavy ions with curium-248

    International Nuclear Information System (INIS)

    Moody, K.J.

    1983-07-01

    Chemical experiments were performed to examine the usefulness of heavy ion transfer reactions in producing new, neutron-rich actinide nuclides. A general quasi-elastic to deep-inelastic mechanism is proposed, and the utility of this method as opposed to other methods (e.g. complete fusion) is discussed. The relative merits of various techniques of actinide target synthesis are discussed. A description is given of a target system designed to remove the large amounts of heat generated by the passage of a heavy ion beam through matter, thereby maximizing the beam intensity which can be safely used in an experiment. Also described is a general separation scheme for the actinide elements from protactinium (Z=91) to mendelevium (Z=101), and fast specific procedures for plutonium, americium and berkelium. The cross sections for the production of several nuclides from the bombardment of 248 Cm with 18 O, 86 Kr and 136 Xe projectiles at several energies near and below the Coulomb barrier were determined. The results are compared with yields from 48 Ca and 238 U bombardments of 248 Cm. Simple extrapolation of the product yields into unknown regions of charge and mass indicates that the use of heavy ion transfer reactions to produce new, neutron-rich above-target species is limited. The substantial production of neutron-rich below-target species, however, indicates that with very heavy ions like 136 Xe and 238 U the new species 248 Am, 249 Am and 247 Pu should be produced with large cross sections from a 248 Cm target. A preliminary, unsuccessful attempt to isolate 247 Pu is outlined. The failure is probably due to the half life of the decay, which is calculated to be less than 3 minutes. The absolute gamma ray intensities from 251 Bk decay, necessary for calculating the 251 Bk cross section, are also determined

  9. Radiochemical studies of neutron deficient actinide isotopes

    International Nuclear Information System (INIS)

    Williams, K.E.

    1978-04-01

    The production of neutron deficient actinide isotopes in heavy ion reactions was studied using alpha, gamma, x-ray, and spontaneous fission detection systems. A new isotope of berkelium, 242 Bk, was produced with a cross-section of approximately 10 μb in reactions of boron on uranium and nitrogen on thorium. It decays by electron capture with a half-life of 7.0 +- 1.3 minutes. The alpha-branching ratio for this isotope is less than 1% and the spontaneous fission ratio is less than 0.03%. Studies of (Heavy Ion, pxn) and (Heavy Ion, αxn) transfer reactions in comparison with (Heavy ion, xn) compound nucleus reactions revealed transfer reaction cross-sections equal to or greater than the compound nucleus yields. The data show that in some cases the yield of an isotope produced via a (H.I.,pxn) or (H.I.,αxn) reaction may be higher than its production via an xn compound nucleus reaction. These results have dire consequences for proponents of the ''Z 1 + Z 2 = Z/sub 1+2/'' philosophy. It is no longer acceptable to assume that (H.I.,pxn) and (H.I.,αxn) product yields are of no consequence when studying compound nucleus reactions. No evidence for spontaneous fission decay of 228 Pu, 230 Pu, 232 Cm, or 238 Cf was observed indicating that strictly empirical extrapolations of spontaneous fission half-life data is inadequate for predictions of half-lives for unknown neutron deficient actinide isotopes

  10. Radiochemical studies of neutron deficient actinide isotopes

    Energy Technology Data Exchange (ETDEWEB)

    Williams, K.E.

    1978-04-01

    The production of neutron deficient actinide isotopes in heavy ion reactions was studied using alpha, gamma, x-ray, and spontaneous fission detection systems. A new isotope of berkelium, /sup 242/Bk, was produced with a cross-section of approximately 10 ..mu..b in reactions of boron on uranium and nitrogen on thorium. It decays by electron capture with a half-life of 7.0 +- 1.3 minutes. The alpha-branching ratio for this isotope is less than 1% and the spontaneous fission ratio is less than 0.03%. Studies of (Heavy Ion, pxn) and (Heavy Ion, ..cap alpha..xn) transfer reactions in comparison with (Heavy ion, xn) compound nucleus reactions revealed transfer reaction cross-sections equal to or greater than the compound nucleus yields. The data show that in some cases the yield of an isotope produced via a (H.I.,pxn) or (H.I.,..cap alpha..xn) reaction may be higher than its production via an xn compound nucleus reaction. These results have dire consequences for proponents of the ''Z/sub 1/ + Z/sub 2/ = Z/sub 1+2/'' philosophy. It is no longer acceptable to assume that (H.I.,pxn) and (H.I.,..cap alpha..xn) product yields are of no consequence when studying compound nucleus reactions. No evidence for spontaneous fission decay of /sup 228/Pu, /sup 230/Pu, /sup 232/Cm, or /sup 238/Cf was observed indicating that strictly empirical extrapolations of spontaneous fission half-life data is inadequate for predictions of half-lives for unknown neutron deficient actinide isotopes.

  11. Paul Scherrer Institute Scientific Report 1999. Volume I: Particles and Matter

    Energy Technology Data Exchange (ETDEWEB)

    Gobrecht, J.; Gaeggeler, H.; Herlach, D.; Junker, K.; Kettle, P.-R.; Kubik, P.; Zehnder, A. [eds.

    2000-07-01

    lthough originally planned for fundamental research in nuclear physics, the particle beams of pions, muons, protons and neutrons are now used in a large variety of disciplines in both natural science and medicine. The beams at PSI have the world's highest intensities and therefore allow certain experiments to be performed, which would not be possible elsewhere. The highlight of research this year was the first-ever determination of the chemical properties of the superheavy element {sup 107} Bohrium. This was undertaken, by an international team led by H. Gaeggeler of PSI's Laboratory for Radiochemistry. Bohrium was produced by bombarding a Berkelium target with Neon ions from the Injector I cyclotron and six atoms were detected after having passed through an online gas chromatography device. At the Laboratory for Particle Physics the focus has shifted from nuclear physics to elementary particle physics with about a fifty-fifty split between investigations of rare processes or particle decays using the high intensity muon, pion and recently also polarized neutron beams of PSI, and research at the highest energy frontier at CERN (Geneva) and DESY (Hamburg). Important space instrumentation has been contributed by the Laboratory for Astrophysics to the European Space Agency and NASA satellite programmes. The Laboratory for Micro and Nanotechnology continued to focus on research into molecular nanotechnology and SiGeC nanostructures, the latter with the aim of producing silicon based optoelectronics. Progress in 1999 in these topical areas is described in this report. A list of scientific publications in 1999 is also provided.

  12. Minor Actinides Recycling in PWRs

    International Nuclear Information System (INIS)

    Delpech, M.; Golfier, H.; Vasile, A.; Varaine, F.; Boucher, L.; Greneche, D.

    2006-01-01

    Recycling of minor actinides in current and near future PWR is considered as one of the options of the general waste management strategy. This paper presents the analysis of this option both from the core physics and fuel cycle point of view. A first indicator of the efficiency of different neutron spectra for transmutation purposes is the capture to fission cross sections ratio which is less favourable by a factor between 5 to 10 in PWRs compared to fast reactors. Another indicator presented is the production of high ranking isotopes like Curium, Berkelium or Californium in the thermal or epithermal spectrum conditions of PWR cores by successive neutron captures. The impact of the accumulation of this elements on the fabrication process of such PWR fuels strongly penalizes this option. The main constraint on minor actinides loadings in PWR (or fast reactors) fuels are related to their direct impact (or the impact of their transmutation products) on the reactivity coefficients, the reactivity control means and the core kinetics parameters. The main fuel cycle physical parameters like the neutron source, the alpha decay power, the gamma and neutrons dose rate and the criticality aspects are also affected. Recent neutronic calculations based on a reference core of the Evolutionary Pressurized Reactor (EPR), indicates typical maximum values of 1 % loadings. Different fuel design options for minor actinides transmutation purposes in PWRs are presented: UOX and MOX, homogeneous and heterogeneous assemblies. In this later case, Americium loading is concentrated in specific pins of a standard UOX assembly. Recycling of Neptunium in UOX and MOX fuels was also studied to improve the proliferation resistance of the fuel. The impact on the core physics and penalties on Uranium enrichment were underlined in this case. (authors)

  13. Transuranium Processing Plant semiannual report of production, status, and plans for period ending December 31, 1975

    International Nuclear Information System (INIS)

    King, L.J.; Bigelow, J.E.; Collins, E.D.

    1976-10-01

    Between July 1, 1975, and December 31, 1975, maintenance was conducted at TRU for a period of three months, 295 g of curium oxide (enough for approximately 26 HFIR targets) were prepared, 100 mg of high-purity 248 Cm, were separated from 252 Cf that had been purified during earlier periods, 11 HFIR targets were fabricated, and 28 product shipments were made. No changes were made in the chemical processing flowsheets normally used at TRU during this report period. However, three equipment racks were replaced (with two new racks) during this time. In Cubicle 6, the equipment replaced was that used to decontaminate the transplutonium elements from rare earth fission products and to separate curium from the heavier elements by means of the LiCl-based anion-exchange process. In Cubicle 5, the equipment used to separate the transcurium elements by high-pressure ion exchange and to purify berkelium by batch solvent extraction was replaced. Two neutron sources were fabricated, bringing the total fabricated to 79. One source that had been used in a completed project was returned to the TRU inventory and is available for reissue. Three sources, for which no further use was foreseen, were processed to isolate and recover the ingrown 248 Cm and the residual 252 Cf. Eight pellets, each containing 100 μg of high-purity 248 Cm were prepared for irradiation in HFIR to study the production of 250 Cm. The values currently being used for transuranium element decay data and for cross-section data in planning irradiation-processing cycles, calculating production forecasts, and assaying products are tabulated

  14. Schattenboxen

    Directory of Open Access Journals (Sweden)

    Johannes Berchtold

    2011-01-01

    Full Text Available Rezensiertes Werk: Turan Kayaoğlu, Legal Imperialism. Sovereignty and Extraterritoriality in Japan, the Ottoman Empire, and China, New York: Cambridge University Press 2010, VIII, 237 p., ISBN 978-0-521-76591-6

  15. E3 Testing of Directed Energy Systems: A Challenging Future

    National Research Council Canada - National Science Library

    Brown, Lyndell R

    2009-01-01

    .... Compatibility testing and susceptibility to electromagnetic radiation is required. Standards, such as MIL-STD-464 and MIL-STD-237D, are being revised to include HPM levels and frequencies for E3 tests...

  16. risk factors and sero-prevalence of hepatitis b surface antigen

    African Journals Online (AJOL)

    2014-02-01

    Feb 1, 2014 ... Medicine, University of Ilorin, PMB 1515, Ilorin, Kwara State, Nigeria ... Results: High prevalence rate 10.9% was recorded. All the ... school graduate, tertiary school graduate and illiterate respectively with 36.8%, 23.7%,.

  17. 76 FR 27563 - Margin and Capital Requirements for Covered Swap Entities

    Science.gov (United States)

    2011-05-11

    ... Comptroller of the Currency 12 CFR Part 45 Board of Governors of the Federal Reserve System 12 CFR Part 237... Housing Finance Agency 12 CFR Part 1221 Margin and Capital Requirements for Covered Swap Entities...; [[Page 27564

  18. Urinary Tract Infections (For Kids)

    Medline Plus

    Full Text Available ... Feelings Expert Answers Q&A Movies & More for Teens Teens site Sitio para adolescentes Body Mind Sexual Health ... 237 milliliters) of urine in your bladder, your brain tells you it's time to find a bathroom. ...

  19. Transformation of arsenic-rich copper smelter flue dust in contrasting soils: A 2-year field experiment

    Czech Academy of Sciences Publication Activity Database

    Jarošíková, A.; Ettler, V.; Mihaljevič, M.; Penížek, V.; Matoušek, Tomáš; Culka, A.; Drahota, P.

    2018-01-01

    Roč. 237, JUN (2018), s. 83-92 ISSN 0269-7491 Institutional support: RVO:68081715 Keywords : arsenic * smelter dust * soil Subject RIV: CB - Analytical Chemistry, Separation OBOR OECD: Analytical chemistry Impact factor: 5.099, year: 2016

  20. Preparation of graphite derivatives by selective reduction of graphite oxide and isocyanate functionalization

    Czech Academy of Sciences Publication Activity Database

    Kumar, A. R. S. S.; Piana, Francesco; Mičušík, M.; Pionteck, J.; Banerjee, S.; Voit, B.

    2016-01-01

    Roč. 182, 1 October (2016), s. 237-245 ISSN 0254-0584 Institutional support: RVO:61389013 Keywords : graphite oxide * surface modification * conductive nanoparticles Subject RIV: CD - Macromolecular Chemistry Impact factor: 2.084, year: 2016

  1. Urinary Tract Infections (For Kids)

    Medline Plus

    Full Text Available ... from the kidneys. When you have about a cup (237 milliliters) of urine in your bladder, your ... into a bathroom and pee into a plastic cup. Your doctor will give you special wipes to ...

  2. Latein als Sprache der mittelalterlichen Schriften über Wettervorhersage

    Czech Academy of Sciences Publication Activity Database

    Kocánová, Barbora

    -, č. 71 (2013), s. 237-248 ISSN 1376-7453 R&D Projects: GA MŠk(CZ) LD13043 Institutional support: RVO:67985955 Keywords : medieval weather forecasting * medieval Latin * medieval manuscripts Subject RIV: AI - Linguistics

  3. [The importance of the internal picture of the disease for the rehabilitative prognosis in paranoid schizophrenia].

    Science.gov (United States)

    Pkhidenko, S V

    1993-07-01

    Clinico-catamnestic analysis of internal picture of disease was carried out in 237 patients with paranoid schizophrenia. High ratio of anosognosia (52%) was found. As many as 11% of patients aimed at overcoming morbid symptoms.

  4. 78 FR 73565 - Agency Information Collection Activities: Proposed Collection, Comments Requested, New Collection...

    Science.gov (United States)

    2013-12-06

    ..., homicide offenses, human trafficking, kidnapping/abduction, larceny/theft offenses, motor vehicle theft...; Public Law110-457, Title II, Section 237(a), (b), December 23, 2008, the William Wilberforce Trafficking...

  5. Other Concerns & Conditions

    Science.gov (United States)

    ... anxiety, behavioral and mood disorders, substance abuse, or delinquency as teenagers. Parents of children with ADHD report ... United States, 2004–2006. National Center for Health Statistics . Vital Health Statistics, 10 (237), 1-15. Strine, ...

  6. 77 FR 72197 - Pears Grown in Oregon and Washington; Assessment Rate Decrease for Processed Pears

    Science.gov (United States)

    2012-12-05

    ... Agricultural Statistics Service, the total farm-gate value of summer/fall processed pears grown in Oregon and... introductory text and paragraph (a) are revised to read as follows: Sec. 927.237 Processed pear assessment rate...

  7. Fejtová, Olga/Ledvinka, Václav/Pešek, Jiří u.a.: Evropská velkoměsta mezi koncem války světové a války studené 1945–1989.

    Czech Academy of Sciences Publication Activity Database

    Nosková, Jana

    2014-01-01

    Roč. 54, - (2014), 233-237 ISSN 0523-8587 Institutional support: RVO:68378076 Keywords : European cities * Cold War * 1945–1989 * urban history * urban anthropology Subject RIV: AC - Archeology, Anthropology, Ethnology

  8. Sooaspekt ja selle keeleline ülekanne : Emil Tode Piiririik / Riita-Ilona Märka

    Index Scriptorium Estoniae

    Märka, Riita-Ilona

    2003-01-01

    "Piiririigi" tõlge inglise keelde: Õnnepalu, Tõnu. Border state : [novel] / translated from the Estonian by Madli Puhvel. Evanston [USA] : Northwestern University Press, 2000. Autorist lk. 234 (inglise k.) ja lk. 237 (vene k.)

  9. Pattern of Histopathological Diagnosis of Breast lesions in Gombe ...

    African Journals Online (AJOL)

    neoplastic proliferative and benign neoplastic disorders, while 118 (40.5%) were malignant neoplasms. Fibroadenoma was the commonest benign breast lesion with 69 (23.7%) cases. Of all the malignancies, invasive ductal carcinoma was the most ...

  10. evaluation of total annual costs of heat exchanger networks using

    African Journals Online (AJOL)

    user

    after solving the first problem using RPA based heat integration gave a minimum total annual cost (TAC) of $237, ... mathematical programming and non-RPA based Hint software. ... The concept of pinch analysis evolved over the years.

  11. Urinary Tract Infections (For Kids)

    Medline Plus

    Full Text Available ... Infections Diseases & Conditions Pregnancy & Baby Nutrition & Fitness Emotions & Behavior School & Family Life First Aid & Safety Doctors & Hospitals ... 237 milliliters) of urine in your bladder, your brain tells you it's time to find a bathroom. ...

  12. Fuelling Economic Growth The Role of Public–Private Sector ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Types of parts manufactured by domestic firms in the automotive sector. 237. 8.8. The first ... Tanzania Engineering and Manufacturing Design Organization. TIRDO. Tanzania ...... Table 2.3 Distribution of firms according to sector of production ...

  13. 77 FR 14558 - Announcement of Funding Awards for the Public and Indian Housing Resident Opportunity and Self...

    Science.gov (United States)

    2012-03-12

    ... Wide Resident Council of 555 Wabasha Street Saint Paul......... MN 55102 702,000 the City of St. Paul.... Cherry Court Resident c/o Kenneth Milwaukee WI 53212 237,619 Organization. Barbeau, Contract...

  14. About Military Sexual Trauma

    Medline Plus

    Full Text Available ... will automatically play next. Up next What is PTSD? (Whiteboard Video) - Duration: 3:38. Veterans Health Administration ... Health Administration 216 views 2:37 Veterans and PTSD: Challenging the Misconceptions - Duration: 2:14. Veterans Health ...

  15. germplasm collection of highland palms of afikpo in eastern nigeria

    African Journals Online (AJOL)

    DR. AMIN

    1Plant Breeding Division, Nigerian Institute For Oil Palm Research (NIFOR) P.M.B 1030 .... computed following standard statistical methods (Steel .... The production of NIFOR elite ... Malaysia Palm Oil Board, Kualar Lumpur, pp 171 – 237.

  16. 1417-IJBCS-Article-Tsopmbeng Gaston

    African Journals Online (AJOL)

    pc

    Evaluation of culture media for growth and sporulation of Phytophthora colocasiae Racib., causal ... Corresponding author, E-mail: grnoumbo@yahoo.fr, Tel: +237 99 66 50 42. ABSTRACT ..... Technology and Commerce (vol. 5),. Govil JN ...

  17. dispersion characteristics of settleable and dissolvable pollutants in ...

    African Journals Online (AJOL)

    The implication of this in waste stabilization pond design was also discussed. KEYWORDS: Dispersion, settleable pollutants, waste stabilization ponds. INTRODUCTION. A waste ...... and Soil Pollution 52, 237-245. Agunwamba, J. C., 1991.

  18. Trematodes of fishes of the Indo-west Pacific: told and untold richness

    Czech Academy of Sciences Publication Activity Database

    Cribb, T.H.; Bray, R. A.; Diaz, P.E.; Huston, D.C.; Kudlai, Olena; Martin, S.B.; Yong, R.Q.-Y.; Cutmore, S.C.

    2016-01-01

    Roč. 93, č. 3 (2016), s. 237-247 ISSN 0165-5752 Institutional support: RVO:60077344 Keywords : Great Barrier reef * French Polynesia * Cardicola forsteri Subject RIV: EH - Ecology, Behaviour Impact factor: 1.181, year: 2016

  19. Trad. Daniele Vitale, Arquitectos portugueses. Identidade, nacionalidade, modernidade

    OpenAIRE

    Marnoto, Rita

    2010-01-01

    (2010. Trad.). Daniele Vitale, Arquitectos portugueses. Identidade, nacionalidade, modernidade, JA Jornal Arquitectos. Publicação Trimestral da Ordem dos Arquitectos Portugal, 237, 93-101. ISSN 0870 1504 Trad. Daniele Vitale

  20. 48 CFR 1213.7101 - Solicitation provision and contract clause.

    Science.gov (United States)

    2010-10-01

    ... Data, in all solicitations and requests for quotations, and the clause at (TAR) 48 CFR 1252.237-72, Prohibition on Advertising, in solicitations, requests for quotations, and all contracts (e.g., purchase...

  1. Serosurveillance of Scrub Typhus in Small Mammals Collected from Military Training Sites near the DMZ, Northern Gyeonggi-do, Korea, and Analysis of the Relative Abundance of Chiggers from Mammals Examined

    Science.gov (United States)

    2010-09-01

    Korean J Paras/to/. Vol. 48, No. 3: 237-243, September 2010 DOl: JO.J3471kjp.2010.48.J.237 Serosurveillance of Scrub Typhus in Small Mammals...65th Medical BrigadeAJSAMEDDAC-Korea, Unit# 15281, APO AP 96205-5281, USA Abstract: Comprehensive quarterly serosurveillance on scrub typhus in small...rarely observed (prevalence < 1 0%). In contrast to previous surveys, higher chigger indices of the primary scrub typhus vectors, L. pallidum (165.4

  2. Profiling N-Type Dopants in Silicon

    Czech Academy of Sciences Publication Activity Database

    Hovorka, Miloš; Mika, Filip; Mikulík, P.; Frank, Luděk

    2010-01-01

    Roč. 51, č. 2 (2010), s. 237-242 ISSN 1345-9678 R&D Projects: GA ČR GP102/09/P543; GA AV ČR IAA100650803 Institutional research plan: CEZ:AV0Z20650511 Keywords : silicon * dopant contrast * photoemission electron microscopy * scanning electron microscopy Subject RIV: JA - Electronics ; Optoelectronics, Electrical Engineering Impact factor: 0.779, year: 2010 http://www.jim.or.jp/journal/e/51/02/237.html

  3. Situation Desperate: U.S. Army Engineer Disaster Relief Operations, Origins to 1950

    Science.gov (United States)

    2011-01-01

    the Sabine River sub- office, for example, relayed the following sad report to headquarters: “I regret to report the loss of all property in my...doctor with typhoid vaccine ; the cows and horses and dogs of every description wandering up and down the levees; the fur- niture, every kind of...215 Sabine River, 59 Sacramento Engineer District, 237, 238 Sacramento River, 186, 237 St. Francis River, 85, 87 St. Joe River, 217 St. Louis Engineer

  4. Analysis of trace neptunium in the vicinity of underground nuclear tests at the Nevada National Security Site.

    Science.gov (United States)

    Zhao, P; Tinnacher, R M; Zavarin, M; Kersting, A B

    2014-11-01

    A high sensitivity analytical method for (237)Np analysis was developed and applied to groundwater samples from the Nevada National Security Site (NNSS) using short-lived (239)Np as a yield tracer and HR magnetic sector ICP-MS. The (237)Np concentrations in the vicinity of the Almendro, Cambric, Dalhart, Cheshire, and Chancellor underground nuclear test locations range from nuclear tests at very low but measureable concentrations. Copyright © 2014 The Authors. Published by Elsevier Ltd.. All rights reserved.

  5. Dicty_cDB: Contig-U01557-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ling_GS-29-01-01-1... 30 5.1 3 ( BV439796 ) S237P619FE6.T0 PortugueseWaterDog Canis familiari... 36 5.1 2 ( ...enom... 42 8.1 1 ( BV424741 ) S237P6453FF6.T0 PortugueseWaterDog Canis familiar... 42 8.1 1 ( BV402984 ) S22

  6. Modeling of 830 nm FSO Link Attenuation in Fog or Wind Turbulence

    Czech Academy of Sciences Publication Activity Database

    Pešek, J.; Fišer, Ondřej; Svoboda, Jaroslav; Schejbal, V.

    2010-01-01

    Roč. 19, č. 2 (2010), s. 237-241 ISSN 1210-2512 R&D Projects: GA ČR GA102/08/0851; GA MŠk OC09027 Institutional research plan: CEZ:AV0Z30420517 Keywords : Free space optics propagation * fog attenuation, * wind turbulence attenuation * turbulent energy Subject RIV: JA - Electronics ; Optoelectronics, Electrical Engineering Impact factor: 0.503, year: 2010 http://www.radioeng.cz/fulltexts/2010/10_02_237_241.pdf

  7. Value of MR-angiography in brain infarction

    International Nuclear Information System (INIS)

    Pirronello, Veronica; Capizzano, Aristides A.; Chouela, Carolina L.; Ternak, Alejandro; Ramirez, Susana; Mazzuco, Juan C.

    2004-01-01

    A retrospective study has been performed in a series of 237 patients, with brain and neck MR and MR angiography techniques. 108/237 (45.5%) patients presented either hemorrhage or lacunar and non lacunar ischemic stroke, 67 of which showed restricted diffusion. Diffusion and perfusion techniques can significantly contribute to study acute stroke. In our series MR angiography showed a 4% sensitivity to detect small arteries pathology. (author)

  8. Dollar Summary of Prime Contract Awards by State, Place, and Contractor, FY84, Part 4, (Allenville, Missouri-Wyoming, Pennsylvania).

    Science.gov (United States)

    1984-01-01

    CLOSED CIRCUIT TV CORP 26 26INGERSOLL-RAND COMPANY INC 67 67INSTITUTE FOR ADVANCED STUDY 75 75 INTERNATIONAL BUSINESS MCHS 28 28M L ENERGIA INC 30...I 28 PRINCETON E 0 & 0 PARC 28 IBM CORP 25 25 M L ENERGIA INC 107 107 SAN LUIS CAMERA 41 41...SANDERS ASSOCIATES INC 848 848 SATELLITE SERVICES INC 237 237 SCHICKEL H GEN CONTR INC 132 132 SHERLOT HOME RENOVATION CORP 317 317 TRACY TROMBLEY CONT

  9. Modeling of lung cancer risk due to radon exhalation of granite stone in dwelling houses

    Directory of Open Access Journals (Sweden)

    Akbar Abbasi

    2017-01-01

    Conclusions: The estimated numbers of lung cancer deaths attributable to indoor radon due to granite stones in 2013 were 145 (3.33% and 103 (2.37% for poor and normal ventilation systems, respectively. According to our estimations, the values of 3.33% and 2.37% of lung cancer deaths in 2013 are attributed to radon exhalation of granite stones with poor and normal ventilation systems, respectively.

  10. New equations to calculate temperature correction factors for PO2 in human blood.

    Science.gov (United States)

    Inaba, H; Ohwada, T; Sato, J; Mizuguchi, T; Hirasawa, H

    1986-01-01

    Effects of hemoglobin concentration (Hb), pH, and body temperature (T) on the relationships between delta log PO2/delta T and PO2 were studied by means of a mathematical model using a Newton-Raphson iteration method. The functions between delta log PO2/delta T and PO2 were affected by the above three factors. New equations considering the effects of Hb, pH, and T were proposed by modifying the equation reported by Severinghaus: delta log PO2/delta T = (L +(U-L)/(A(vPO237)B + 1))(10(-2) where U = 3.15-0.45(7.4-pH37) L = 0.68-0.09(7.4-pH37) A = 5.86(exp10(0.074(T)-0.294(7.4-pH37)-11))((Hb)0.913) B = 6.33(exp10(-0.0051(T)))((Hb)-0.113) + 0.24(7.4-pH37) and vPO237 is virtual PO237 which may exist when PO237 is corrected to standard conditions (pH = 7.4, BE = 0) by the following equations: vPO237 = PO237(exp10(fB(7.4-pH37)-0.0013(BE))) fB = (PO237/26.6)0.08-1.52 where fB is the Bohr factor. The above equations provided values of delta log PO2/delta T which fit closely to those obtained by the complex iteration method with maximum differences of less than 1.3 X 10(-3) at T = 27, indicating that maximum % errors for PO2 at T (PO2T) are less than 3.0% at T = 27 and that our equations can be applied over a wide range of Hb, pH37 and T.

  11. Neptunium Transport Behavior in the Vicinity of Underground Nuclear Tests at the Nevada Test Site

    Energy Technology Data Exchange (ETDEWEB)

    Zhao, P; Tinnacher, R M; Zavarin, M; Williams, R W; Kersting, A B

    2010-12-03

    We used short lived {sup 239}Np as a yield tracer and state of the art magnetic sector ICP-MS to measure ultra low levels of {sup 237}Np in a number of 'hot wells' at the Nevada National Security Site (NNSS), formerly known as the Nevada Test Site (NTS). The results indicate that {sup 237}Np concentrations at the Almendro, Cambric, Dalhart, Cheshire and Chancellor sites, are in the range of 3 x 10{sup -5} to 7 x 10{sup -2} pCi/L and well below the MCL for alpha emitting radionuclides (15 pCi/L) (EPA, 2009). Thus, while Np transport is believed to occur at the NNSS, activities are expected to be well below the regulatory limits for alpha-emitting radionuclides. We also compared {sup 237}Np concentration data to other radionuclides, including tritium, {sup 14}C, {sup 36}Cl, {sup 99}Tc, {sup 129}I, and plutonium, to evaluate the relative {sup 237}Np transport behavior. Based on isotope ratios relative to published unclassified Radiologic Source Terms (Bowen et al., 1999) and taking into consideration radionuclide distribution between melt glass, rubble and groundwater (IAEA, 1998), {sup 237}Np appears to be substantially less mobile than tritium and other non-sorbing radionuclides, as expected. However, this analysis also suggests that {sup 237}Np mobility is surprisingly similar to that of plutonium. The similar transport behavior of Np and Pu can be explained by one of two possibilities: (1) Np(IV) and Pu(IV) oxidation states dominate under mildly reducing NNSS groundwater conditions resulting in similar transport behavior or (2) apparent Np transport is the result of transport of its parent {sup 241}Pu and {sup 241}Am isotopes and subsequent decay to {sup 237}Np. Finally, measured {sup 237}Np concentrations were compared to recent Hydrologic Source Term (HST) models. The 237Np data collected from three wells in Frenchman Flat (RNM-1, RNM-2S, and UE-5n) are in good agreement with recent HST transport model predictions (Carle et al., 2005). The agreement

  12. Update neutron nuclear data evaluation for 236,238Np

    International Nuclear Information System (INIS)

    Chen, Guochang; Wang, Jimin; Yu, Baosheng; Cao, Wentian; Tang, Guo-you

    2015-01-01

    The nuclear data with high accuracy for actinides play an important role in nuclear technology applications, including reactor design and operation, fuel cycle, estimation of the amount of minor actinides (MAs) in high burnup reactors and to research to transmute the MAs to short half-lived nuclides or stable ones. The nuclides of 236 Np are generated via the α-decay of 240 Am or 237 Np(n, 2n) and 237 Np(d, t) reactions. And the nuclides of 238 Np are generated via the α-decay of 242 Am or 237 Np(n, γ) and 237 Np(d, p) reactions. In the present work, according to the systematic trend of the total cross section and elastic cross section etc. of different Np isotopes, and based on the neutron optical model parameters (OMP) of 237 Np, a new set of neutron optical model parameters were obtained for 236,238 Np. Based on the new set OMP and the systematic trend of the cross sections of different Np isotopes, a full set of 236,238 Np neutron nuclear data has been updated and improved by theoretical calculation. The present result has significant improvements over the data in CENDL-3.1

  13. Excited levels of Pa-233; Niveles excitados del Pa-233

    Energy Technology Data Exchange (ETDEWEB)

    Vara Cuadrado, J M

    1969-07-01

    A study of Pa-233 excited levels from the alpha decay of Np-237 and from beta decay of Th-233 has been performed. The alpha decay spectrum was measured with a semiconductor spectrometer of 18 keV effective resolution (FWHM). Over 13 new lines were identified. The gamma ray spectra of Np-237 and Th-233 were obtained with a Ge-Li detector low and medium range energy lines, and with Si-Li detector for the low energy region. A continuous purification method of Np-237 from its comparatively short-lived daughter Pa-233 was applied. A high number of new lines were identified in both spectra. The gamma-gamma coincidence spectra were obtained with INa(T{sub 1}) detectors. (Author) 54 refs.

  14. Excited levels of Pa-233

    International Nuclear Information System (INIS)

    Vara Cuadrado, J. M.

    1969-01-01

    A study of Pa-233 excited levels from the alpha decay of Np-237 and from beta decay of Th-233 has been performed. The alpha decay spectrum was measured with a semiconductor spectrometer of 18 keV effective resolution (FWHM). Over 13 new lines were identified. The gamma ray spectra of Np-237 and Th-233 were obtained with a Ge-Li detector low and medium range energy lines, and with Si-Li detector for the low energy region. A continuous purification method of Np-237 from its comparatively short-lived daughter Pa-233 was applied. A high number of new lines were identified in both spectra. The gamma-gamma coincidence spectra were obtained with INa(T 1 ) detectors. (Author) 54 refs

  15. Aspects of 238Pu production in the experimental fast reactor JOYO

    International Nuclear Information System (INIS)

    Osaka, Masahiko; Koyama, Shin-ichi; Tanaka, Kenya; Itoh, Masahiko; Saito, Masaki

    2005-01-01

    Experimental determination of 238 Pu in 237 Np samples irradiated in the experimental fast reactor JOYO was done as part of the demonstration of 238 Pu production from 237 Np in fast reactors within the framework of the protected Pu production project, which aims at reinforcement of proliferation resistance of Pu by increasing the 238 Pu isotopic ratio. 238 Pu production amount in the irradiated 237 Np samples was determined by a radioanalytical technique. Aspects of 238 Pu production were examined on the basis of the present radioanalysis. The 238 Pu production amount depends on the neutron spectrum which can range from that of a typical fast reactor to a nearly epi-thermal spectrum. It is concluded that the fast reactor has not only high potential for use in protected Pu production, but also as an incinerator for excess Pu

  16. Exploring the Presence of microDNAs in Prostate Cancer Cell Lines, Tissue, and Sera of Prostate Cancer Patients and its Possible Application as Biomarker

    Science.gov (United States)

    2016-04-01

    ES2 OVCAR8 LnCap PC-3 C4-2 Cell Count 1.8X108 1x108 1.1X108 1.24X108 1.1X108 Episomal DNA (ug) 21.3 23.7 26 15.6 20.4 Starting DNA (ug) 21.3 23.7...kidney, liver, lung, skeletal muscle, spleen, sperm , testis and thymus) (5). EccDNA sequences were then enriched by multiple displacement amplification...including sperm . MicroDNAs arise preferentially from areas with high gene density, GC content, and exon density from promoters with activating chro

  17. Child Pornography. An Exploratory Study

    Science.gov (United States)

    1990-01-01

    The Sexual Exploitation of Children. New York: St Martins Press, 1986. Fields, Howa’-4 "Supreme Court, 6-3, Sans Possossiron of Child Porn ...Court, 6-3, Bans Possession of Child Porn ," Publishers Weekly 237, no.18 (May 4, 1990) 10. 27 See: O’Brien, 65-78; Seth L. Goldstein, "Investigating...15, (1973). 3 New York v. Ferber, 458 U.S. 757, (1982). 4 Howard Fields, "Supreme Court, 6-3, Bans Possession of Child Porn ,’" Publishers Weekly 237

  18. Non-conventional measurement techniques for the determination of some long-lived radionuclides produced in nuclear fuel

    International Nuclear Information System (INIS)

    Rosenberg, R.J.

    1992-04-01

    The results of a literature survey on non-radiometric analytical techniques for the determination of long-lived radionuclides are described. The methods which have been considered are accelerator mass spectrometry, inductively coupled plasma mass spectrometry, thermal ionization mass spectrometry, resonance ionization spectrometry, resonance ionization mass spectrometry and neutron activation analysis. Neutron activation analysis has been commonly used for the determination of 129 I and 237 Np in environmental samples. Inductively coupled mass spectrometry seems likely to become the method of choice for the determination of 99 Tc, 237 Np and Pu-isotopes. The methods are discussed and the chemical separation methods described. (orig.)

  19. Source-driven noise analysis measurements with neptunium metal reflected by high enriched uranium

    International Nuclear Information System (INIS)

    Valentine, Timothy E.; Mattingly, John K.

    2003-01-01

    Subcritical noise analysis measurements have been performed with neptunium ( 237 Np) sphere reflected by highly enriched uranium. These measurements were performed at the Los Alamos Critical Experiment Facility in December 2002 to provide an estimate of the subcriticality of 237 Np reflected by various amounts of high-enriched uranium. This paper provides a description of the measurements and presents some preliminary results of the analysis of the measurements. The measured and calculated spectral ratios differ by 15% whereas the 'interpreted' and calculated k eff values differ by approximately 1%. (author)

  20. Construction of a Recyclable Genetic Marker and Serial Gene Deletions in the Human Pathogenic Mucorales Mucor circinelloides.

    Science.gov (United States)

    Garcia, Alexis; Adedoyin, Gloria; Heitman, Joseph; Lee, Soo Chan

    2017-07-05

    Mucor circinelloides is a human pathogen, biofuel producer, and model system that belongs to a basal fungal lineage; however, the genetics of this fungus are limited. In contrast to ascomycetes and basidiomycetes, basal fungal lineages have been understudied. This may be caused by a lack of attention given to these fungi, as well as limited tools for genetic analysis. Nonetheless, the importance of these fungi as pathogens and model systems has increased. M. circinelloides is one of a few genetically tractable organisms in the basal fungi, but it is far from a robust genetic system when compared to model fungi in the subkingdom Dikarya. One problem is the organism is resistant to drugs utilized to select for dominant markers in other fungal transformation systems. Thus, we developed a blaster recyclable marker system by using the pyrG gene (encoding an orotidine-5'-phosphate decarboxylase, ortholog of URA3 in Saccharomyces cerevisiae ). A 237-bp fragment downstream of the pyrG gene was tandemly incorporated into the upstream region of the gene, resulting in construction of a pyrG-dpl237 marker. To test the functionality of the pyrG-dpl237 marker, we disrupted the carRP gene that is involved in carotenoid synthesis in pyrG - mutant background. The resulting carRP :: pyrG-dpl237 mutants exhibit a white colony phenotype due to lack of carotene, whereas wild type displays yellowish colonies. The pyrG marker was then successfully excised, generating carRP-dpl237 on 5-FOA medium. The mutants became auxotrophic and required uridine for growth. We then disrupted the calcineurin B regulatory subunit cnbR gene in the carRP :: dpl237 strain, generating mutants with the alleles carRP :: dpl237 and cnbR :: pyrG These results demonstrate that the recyclable marker system is fully functional, and therefore the pyrG-dpl237 marker can be used for sequential gene deletions in M. circinelloides . Copyright © 2017 Garcia et al.

  1. Contribution to the experimental study of transuranian element (Pu, Am, Cm) transfers between the various phases (particles, water, organisms) of the sedimentary system

    International Nuclear Information System (INIS)

    Grillo, M.C.

    1982-06-01

    The methodology of this work is first given. Transfer kinetics of 237 Pu, 241 Am and 242 Cm between seawater and macrofauna of loose substrates are studied. The effect of temperature and salinity over the transfers of 237 Pu, 241 Am and 242 Cm between water and bivalve mollusk Tapes decussatus is then studied. This work deals also with transfer kinetics of these elements between carnivorous organisms of the loose substrates and their preys. A preliminary study of 241 Am transfers between two phases, particles and interstitial water is finally presented: role of benthic burrowing organisms [fr

  2. Construction of a Recyclable Genetic Marker and Serial Gene Deletions in the Human Pathogenic Mucorales Mucor circinelloides

    Directory of Open Access Journals (Sweden)

    Alexis Garcia

    2017-07-01

    Full Text Available Mucor circinelloides is a human pathogen, biofuel producer, and model system that belongs to a basal fungal lineage; however, the genetics of this fungus are limited. In contrast to ascomycetes and basidiomycetes, basal fungal lineages have been understudied. This may be caused by a lack of attention given to these fungi, as well as limited tools for genetic analysis. Nonetheless, the importance of these fungi as pathogens and model systems has increased. M. circinelloides is one of a few genetically tractable organisms in the basal fungi, but it is far from a robust genetic system when compared to model fungi in the subkingdom Dikarya. One problem is the organism is resistant to drugs utilized to select for dominant markers in other fungal transformation systems. Thus, we developed a blaster recyclable marker system by using the pyrG gene (encoding an orotidine-5′-phosphate decarboxylase, ortholog of URA3 in Saccharomyces cerevisiae. A 237-bp fragment downstream of the pyrG gene was tandemly incorporated into the upstream region of the gene, resulting in construction of a pyrG-dpl237 marker. To test the functionality of the pyrG-dpl237 marker, we disrupted the carRP gene that is involved in carotenoid synthesis in pyrG− mutant background. The resulting carRP::pyrG-dpl237 mutants exhibit a white colony phenotype due to lack of carotene, whereas wild type displays yellowish colonies. The pyrG marker was then successfully excised, generating carRP-dpl237 on 5-FOA medium. The mutants became auxotrophic and required uridine for growth. We then disrupted the calcineurin B regulatory subunit cnbR gene in the carRP::dpl237 strain, generating mutants with the alleles carRP::dpl237 and cnbR::pyrG. These results demonstrate that the recyclable marker system is fully functional, and therefore the pyrG-dpl237 marker can be used for sequential gene deletions in M. circinelloides.

  3. Biology of neptunium

    International Nuclear Information System (INIS)

    Wirth, R.E.

    1985-11-01

    This work contains detailed information about fractional absorption of neptunium through gastrointestinal tract in vivo as well as about organ and subcellular distribution in rats. Biochemical investigations have shown, that neptunium is bound to the iron transport protein transferrin in the blood serum. A long-term experiment resulted in osteosarkomincidences of 11% (0.2 mp Np-237/kg) and 36% (1 mg Np-237/kg); simultaneous the whole-body retention was measured during the natural lifespan of the animals of 2.5 years. (orig.) [de

  4. {open_quotes}Transmutation efficiency calculation in the blanket on melted salts with central neptunium target{close_quotes}

    Energy Technology Data Exchange (ETDEWEB)

    Kolesov, V.F.; Shtarev, S.K.; Khoruzhiy, V.K. [Russia Federal Nuclear Center, Arzamas (Russian Federation)] [and others

    1995-10-01

    In the limits of ABC project version of two-sectional reactor system in the form of combination of subcritical blanket on melted salts and multiplying target from threshold fissile material {sup 237}Np is considered. This research is the development of the VNIIEF`s earlier work`s (Russia) investigating of usage possibilities in ABC project the conception of multisectional blankets with single-sided neutron coupling between sections. With the help of Monte-Carlo program the calculations results of system mentioned are given. The possibility of accelerator`s considerable power reduction at the account of thorium target substitution with neptunium-237 multiplying target is shown.

  5. Transport of neptunium through Yucca Mountain tuffs

    International Nuclear Information System (INIS)

    Triay, I.R.; Robinson, B.A.; Mitchell, A.J.; Overly, C.M.; Lopez, R.M.

    1993-01-01

    Neptunium has a high solubility in groundwaters from Yucca Mountain [1]. Uranium in nuclear reactors produces 237 Np which has a half-life of 2.1 4 x 10 6 years. Consequently, the transport of 237 Np through tuffs is of major importance in assessing the performance of a high-level nuclear waste repository at Yucca Mountain. The objective of this work is to determine the amount of Np retardation that is provided by the minerals in Yucca Mountain tuffs as a function of groundwater chemistry

  6. Minor Actinide Burning in Thermal Reactors. A Report by the Working Party on Scientific Issues of Reactor Systems

    International Nuclear Information System (INIS)

    Hesketh, K.; Porsch, D.; Rimpault, G.; Taiwo, T.; Worrall, A.

    2013-01-01

    The actinides (or actinoids) are those elements in the periodic table from actinium upwards. Uranium (U) and plutonium (Pu) are two of the principal elements in nuclear fuel that could be classed as major actinides. The minor actinides are normally taken to be the triad of neptunium (Np), americium (Am) and curium (Cm). The combined masses of the remaining actinides (i.e. actinium, thorium, protactinium, berkelium, californium, einsteinium and fermium) are small enough to be regarded as very minor trace contaminants in nuclear fuel. Those elements above uranium in the periodic table are known collectively as the transuranics (TRUs). The operation of a nuclear reactor produces large quantities of irradiated fuel (sometimes referred to as spent fuel), which is either stored prior to eventual deep geological disposal or reprocessed to enable actinide recycling. A modern light water reactor (LWR) of 1 GWe capacity will typically discharge about 20-25 tonnes of irradiated fuel per year of operation. About 93-94% of the mass of uranium oxide irradiated fuel is comprised of uranium (mostly 238 U), with about 4-5% fission products and ∼1% plutonium. About 0.1-0.2% of the mass is comprised of neptunium, americium and curium. These latter elements accumulate in nuclear fuel because of neutron captures, and they contribute significantly to decay heat loading and neutron output, as well as to the overall radio-toxic hazard of spent fuel. Although the total minor actinide mass is relatively small - approximately 20-25 kg per year from a 1 GWe LWR - it has a disproportionate impact on spent fuel disposal, and thus the longstanding interest in transmuting these actinides either by fission (to fission products) or neutron capture in order to reduce their impact on the back end of the fuel cycle. The combined masses of the trace actinides actinium, thorium, protactinium, berkelium and californium in irradiated LWR fuel are only about 2 parts per billion, which is far too low for

  7. Early career burnout among Dutch nurses : A process captured in a Rasch model

    NARCIS (Netherlands)

    de Vos, Jan Alexander; Brouwers, Andre; Schoot, Tineke; Pat-El, Ron; Verboon, Peter; Näring, Gerard

    2016-01-01

    This study investigates burnout among Dutch nursing graduates as a process by testing a sequential-developmental model. A sample of 237 respondents was recruited from a population of Dutch early career nurses. Burnout was measured with the Dutch version of the Maslach Burnout Inventory Human

  8. Early career burnout among Dutch nurses: A process captured in a Rasch model

    NARCIS (Netherlands)

    Vos, J.A. de; Brouwers, A.; Schoot, T.; Pat-El, R.; Verboon, P.; Näring, G.W.B.

    2016-01-01

    This study investigates burnout among Dutch nursing graduates as a process by testing a sequential-developmental model. A sample of 237 respondents was recruited from a population of Dutch early career nurses. Burnout was measured with the Dutch version of the Maslach Burnout Inventory Human

  9. El expresionismo de Gutiérrez Girardot

    Directory of Open Access Journals (Sweden)

    Guillermo Linero Montes

    2006-05-01

    Full Text Available Entre la ilustración y el expresionismo. Figuras de la literatura alemana. Rafael Gutiérrez Girardot. Fondo de Cultura Económica. Colombia, colección Tierra Firme, Bogotá, 2004, 237 págs.

  10. The occurrence of PPV in cherry trees in the Czech Republic

    Czech Academy of Sciences Publication Activity Database

    Navrátil, M.; Šafářová, D.; Fanigliulo, A.; Comes, S.; Petrzik, Karel; Karešová, R.

    2004-01-01

    Roč. 657, - (2004), 237-244 ISSN 0567-7572 R&D Projects: GA MZe(CZ) NAZV QD1407 Institutional research plan: CEZ:AV0Z5051902 Keywords : Plum pox virus * Prunus avium * sweet cherry cultivars * ELISA * RT-PCR Subject RIV: EE - Microbiology, Virology

  11. Socio-Demographic and Maternal Factors in Anaemia in Pregnancy ...

    African Journals Online (AJOL)

    Low educational attainment [Adjusted Odds Ratio (AOR)=2.13], being single or divorced [AOR=2.02], high parity [AOR=2.06], late booking [AOR=2.71] and short intervals between pregnancies [AOR=2.37] were significant predictors of anaemia in pregnancy. The high prevalence of anaemia in pregnancy related to low ...

  12. Conceptions of Pupils of the Primary on the Topic of an Electric Circuit in Three Countries (Canada, France and Morocco)

    Science.gov (United States)

    Métioui, Abdeljalil; MacWillie, Mireille Baulu; Trudel, Louis

    2016-01-01

    Qualitative research conducted with 237 pupils from Canada, France, and Morocco, between 10 and 12 years of age, on the setting and functioning of simple electric circuits, demonstrates that similar explanatory systems of the students. For this, we had given them a paper and pencil questionnaire of a sixty minutes duration. The first question was…

  13. Proton emission from laser-generated plasmas at different intensities

    Czech Academy of Sciences Publication Activity Database

    Torrisi, L.; Cutroneo, M.; Cavallaro, S.; Giuffrida, L.; Margarone, Daniele

    2012-01-01

    Roč. 57, č. 2 (2012), s. 237-240 ISSN 0029-5922. [International Conference on Research and Applications of Plasmas (PLASMA). Warsaw, 12.09.2011-16.09.2011] Institutional support: RVO:68378271 Keywords : laser-generated plasma * hydrogenated targets * proton acceleration Subject RIV: BL - Plasma and Gas Discharge Physics Impact factor: 0.507, year: 2012

  14. 75 FR 54524 - Defense Federal Acquisition Regulation Supplement; Guidance on Personal Services (DFARS Case 2009...

    Science.gov (United States)

    2010-09-08

    ... parts 211 and 237 are being amended to (1) require that statements of work or performance work statements clearly distinguish between Government employees and contractor employees and (2) ensure that... Department, including several checklists currently used. This interim rule adopts best practices and...

  15. A Descriptive Study of Individual and Cross-Cultural Differences in Statistics Anxiety

    Science.gov (United States)

    Baloglu, Mustafa; Deniz, M. Engin; Kesici, Sahin

    2011-01-01

    The present study investigated individual and cross-cultural differences in statistics anxiety among 223 Turkish and 237 American college students. A 2 x 2 between-subjects factorial multivariate analysis of covariance (MANCOVA) was performed on the six dependent variables which are the six subscales of the Statistical Anxiety Rating Scale.…

  16. Short Note Birds feeding in association with bat-eared foxes on ...

    African Journals Online (AJOL)

    Short Note Birds feeding in association with bat-eared foxes on Benfontein Game Farm, South Africa. Ute Stenkewitz, Jan F Kamler. Abstract. No Abstract. Ostrich 2008, 79(2): 235–237. Full Text: EMAIL FULL TEXT EMAIL FULL TEXT · DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT.

  17. Actinide neutron induced cross-sections; analysis of the OSMOSE LWR-UO{sub 2} experiment in MINERVE

    Energy Technology Data Exchange (ETDEWEB)

    Bernard, D.; Litaize, O.; Santamarina, A.; Antony, M.; Hudelot, J. P. [Commissariat a l' Energie Atomique, Cadarache, DEN/DER, 13108 Saint-Paul-Lez-Durance (France)

    2006-07-01

    This paper describes the interpretation of the first phase of the OSMOSE experimental program. The OSMOSE experiment began in 2005 in the MINERVE French facility and will continue until 2008. It consists in reactivity worth measurements of separated actinides by an oscillation technique. First results are obtained in a standard LWR neutron spectrum (UO{sub 2} lattice). The present study focuses on the following isotopes: {sup 234,236}U, {sup 237}Np, {sup 239,242}Pu. The comparison between APOLLO2 accurate deterministic calculations and experiments shows the reliability of the latest JEFF-3.1 European nuclear data library for all oscillated isotopes, except {sup 237}Np. The obtained (C/E-1){+-}({delta}E/E) values are the following: {sup 234}U: -5%{+-}2% {sup 237}Np: -11%{+-}2% {sup 239}Pu: +1%{+-}2% {sup 242}Pu: +2%{+-}2% An energetic decomposition of the reactivity worth is carried out using Standard Perturbation Theory that underlines the underestimation of the {sup 237}Np(n, {gamma}) thermal and resonant capture cross-section. (authors)

  18. Characterization of a Synechocystis double mutant lacking the photosystem II assembly factors YCF48 and Sll0933

    Czech Academy of Sciences Publication Activity Database

    Rengstl, B.; Knoppová, Jana; Komenda, Josef; Nickelsen, J.

    2013-01-01

    Roč. 237, č. 2 (2013), s. 471-480 ISSN 0032-0935 R&D Projects: GA ČR GBP501/12/G055; GA MŠk(CZ) ED2.1.00/03.0110 Institutional support: RVO:61388971 Keywords : Complex assembly * Cyanobacteria * Photosynthesis Subject RIV: EE - Microbiology, Virology Impact factor: 3.376, year: 2013

  19. Nové poznatky ke stavebnímu vývoji kostela sv. Jana Křtitele v Kurdějově

    Czech Academy of Sciences Publication Activity Database

    Bláha, Jiří; Dohnalová, P.

    2013-01-01

    Roč. 20, č. 1 (2013), s. 237-256 ISSN 1212-1487 R&D Projects: GA MK(CZ) DF11P01OVV002 Keywords : fortified church * timber roof * dendrochronology Subject RIV: AL - Art, Architecture, Cultural Heritage www.pruzkumypamatek.cz

  20. 48 CFR 1237.7003 - Solicitation provisions and contact clause.

    Science.gov (United States)

    2010-10-01

    ... and the clause at (TAR) 48 CFR 1252.237-72, Prohibition on Advertising, in solicitations and contracts for training services when the content and/or presentation of the course is controlled by DOT. (b... descriptive information (i.e., dated material such as resumes, company and/or personnel qualifications) to...

  1. Download this PDF file

    African Journals Online (AJOL)

    ÿþU s e r

    while nine patients (23.7%) had pin tract infection in the control group. There was a significantly lower ... duration of five days is expected to be incapable of preventing pin-tract .... Shapiro JM, Bond EL, Garman JK. 13. Hannan M; Juste RN; ...

  2. Electrotunable wetting and micro- and nanofluidics: general discussion

    Czech Academy of Sciences Publication Activity Database

    Bazant, M.; Bennewitz, R.; Bocquet, L.; Kratochvílová, Irena

    2017-01-01

    Roč. 199, Jul (2017), s. 195-237 ISSN 1359-6640 Institutional support: RVO:68378271 Keywords : ionic liquids * wall turbulence * double-layer * water * surfaces * interface * scale * electrolyt * capacitance * relaxation Subject RIV: CF - Physical ; Theoretical Chemistry OBOR OECD: Physical chemistry Impact factor: 3.588, year: 2016

  3. Assessing the Relationship between Family Mealtime Communication and Adolescent Emotional Well-Being Using the Experience Sampling Method

    Science.gov (United States)

    Offer, Shira

    2013-01-01

    While most prior research has focused on the frequency of family meals the issue of which elements of family mealtime are most salient for adolescents' well-being has remained overlooked. The current study used the experience sampling method, a unique form of time diary, and survey data drawn from the 500 Family Study (N = 237 adolescents with…

  4. Family history of systemic lupus erythematosus and risk of autoimmune disease

    DEFF Research Database (Denmark)

    Ulff-Møller, Constance Jensina; Simonsen, Jacob; Kyvik, Kirsten Ohm

    2017-01-01

    Objective.: To provide population-based estimates of relative risk of SLE and other autoimmune diseases (ADs) in relatives of SLE patients. Methods.: A cohort of 5 237 319 Danish residents identified through the Civil Registration System was coupled to their relatives through the parental link...

  5. 77 FR 112 - Effluent Limitations Guidelines and Standards for the Construction and Development Point Source...

    Science.gov (United States)

    2012-01-03

    ..., developing and general contracting. Heavy and civil 237 engineering construction, including land subdivision..., Engineering and Analysis Division, Office of Water (4303T), Environmental Protection Agency, 1200 Pennsylvania... Treatment Chemicals, Disposal and Toxicity Concerns F. Cold Weather Considerations G. Small Sites That Are...

  6. Application of SBRA Method in Mechanics of Continental Plates

    Czech Academy of Sciences Publication Activity Database

    Frydýšek, K.; Wandrol, I.; Kalenda, Pavel

    2012-01-01

    Roč. 6, č. 4 (2012), s. 230-237 ISSN 1998-4448 Institutional support: RVO:67985891 Keywords : mathematical modeling * probability * lithosphere plates Subject RIV: JL - Materials Fatigue, Friction Mechanics http://www.naun.org/main/NAUN/mechanics/16-581.pdf

  7. Smoothing identification of systems with small non-linearities

    Czech Academy of Sciences Publication Activity Database

    Kozánek, Jan; Piranda, J.

    2003-01-01

    Roč. 38, č. 1 (2003), s. 71-84 ISSN 0025-6455 R&D Projects: GA ČR GA101/00/1471 Institutional research plan: CEZ:AV0Z2076919 Keywords : identification * small non-linearities * smoothing methods Subject RIV: BI - Acoustics Impact factor: 0.237, year: 2003

  8. The Home Smoking Environment: Influence on Behaviors and Attitudes in a Racially Diverse Adolescent Population

    Science.gov (United States)

    Muilenburg, Jessica Legge; Latham, Teaniese; Annang, Lucy; Johnson, William D.; Burdell, Alexandra C.; West, Sabra J.; Clayton, Dixie L.

    2009-01-01

    Although studies indicate that public policy can influence the decrease in smoking behaviors, these policies have not necessarily transferred to home environments at the same rate. The authors surveyed 4,296 students in a southern urban area. African American students were 76.3% of the respondents and Caucasians accounted for 23.7%. African…

  9. Entheseal changes: Do they reflect socioeconomic status in the Early Medieval Central European population? (Mikulčice - Klášteřisko, Great Moravian Empire, 9th - 10th century)

    Czech Academy of Sciences Publication Activity Database

    Havelková, P.; Hladík, Marek; Velemínský, P.

    2013-01-01

    Roč. 23, č. 2 (2013), s. 237-251 ISSN 1047-482X Institutional research plan: CEZ:AV0Z80010507 Institutional support: RVO:68081758 Keywords : Early Middle Ages * enthesopathies * factor analysis * grave goods * musculoskeletal stress markers * social status Subject RIV: AC - Archeology, Anthropology, Ethnology Impact factor: 1.070, year: 2013

  10. Fatigue property and fatigue cracks of ultra-fine grained copper processed by equal-channel angular pressing

    Czech Academy of Sciences Publication Activity Database

    Wang, Q.; Du, Z.; Liu, X.; Kunz, Ludvík

    2011-01-01

    Roč. 2011, č. 682 (2011), s. 231-237 ISSN 1013-9826 Institutional research plan: CEZ:AV0Z20410507 Keywords : ultrafine-grained copper * equal channel angular pressing * fatigue * fatigue cracks Subject RIV: JL - Materials Fatigue, Friction Mechanics

  11. Waste Dump Closure and Cost Estimates at AngloGold Ashanti ...

    African Journals Online (AJOL)

    Michael

    2017-12-02

    Dec 2, 2017 ... 2University of Mines and Technology, P.O. Box 237, Tarkwa, Ghana ... The mine has closure plans for the waste dumps and the closure activity ... incur additional cost, it was advised that the mine should execute the closure and reclamation plan without delay. .... Progressively rehabilitate the project area.

  12. Fungal diversity notes 253-366: taxonomic and phylogenetic contributions to fungal taxa

    Czech Academy of Sciences Publication Activity Database

    Li, G.J.; Hyde, K.D.; Zhao, R. L.; Hongsanan, S.; Abdel-Aziz, F.A.; Abdel-Wahab, M. A.; Alvarado, P.; Alves-Silva, G.; Ammirati, J.F.; Ariyawansa, H.A.; Baghela, A.; Bahkali, A. H.; Beug, M.; Bhat, D.J.; Bojantchev, D.; Boonpratuang, T.; Bulgakov, T.S.; Camporesi, E.; Boro, M.C.; Ceska, O.; Chakraborty, D.; Chen, J.J.; Chethana, K.W.T.; Chomnunti, P.; Consiglio, G.; Cui, B.K.; Dai, D. Q.; Dai, Y.C.; Daranagama, D. A.; Das, K.; Vlasák, Josef

    2016-01-01

    Roč. 78, č. 1 (2016), s. 1-237 ISSN 1560-2745 Institutional support: RVO:60077344 Keywords : lichenized ascomycota ostropales * ribosomal dna-sequences * strictly anaerobic fungus * sp-nov russulaceae * molecular phylogeny * Basidiomycota Subject RIV: EF - Botanics Impact factor: 13.465, year: 2016

  13. Unemployment Impairs Mental Health: Meta-Analyses

    Science.gov (United States)

    Paul, Karsten I.; Moser, Klaus

    2009-01-01

    The effect of unemployment on mental health was examined with meta-analytic methods across 237 cross-sectional and 87 longitudinal studies. The average overall effect size was d = 0.51 with unemployed persons showing more distress than employed persons. A significant difference was found for several indicator variables of mental health (mixed…

  14. Cytotoxic Effect of Crude Aqueous Extract of Pistia Stratiotes Leaves ...

    African Journals Online (AJOL)

    1.19 mmol/L, 18.57 mmol/L and 27.27±2.37 mmol/L) between urea concentration of group 1, 2 and 3 before and after the administration of the extract. Serum creatinine concentration was found to be 108.51±3.21 mmol/L in controls, before the ...

  15. A clinical comparison of disposable airway devices | Strydom ...

    African Journals Online (AJOL)

    Cuff pressures were significantly higher in the Ambu™ and LMA Unique™ (p = 0.001). Maximum airway pressure attainable after 5 minutes was significantly higher in the Ambu™ (p = 0.036). Airway trauma as graded by visible blood on the device was low, and similar between groups (p = 0.237). Secretions were negligible ...

  16. Pattern of Maxillofacial Surgical Conditions in North Central Nigeria ...

    African Journals Online (AJOL)

    2018-02-07

    com on Wednesday, February 7, 2018, IP: 197.89.67.237] ... Table 2: Profile of orofacial surgical conditions seen and treated over 5 years during outreach programmes in ..... The North Central zone of the country, with a population of 20.2 ...

  17. Biological Art of Producing Useful Chemicals

    Indian Academy of Sciences (India)

    Home; Journals; Resonance – Journal of Science Education; Volume 21; Issue 3. Metabolic Engineering: Biological Art of Producing Useful Chemicals. Ram Kulkarni. General Article Volume 21 Issue 3 March 2016 pp 233-237. Fulltext. Click here to view fulltext PDF. Permanent link:

  18. Preservice Science Teachers' Science Teaching Orientations and Beliefs about Science

    Science.gov (United States)

    Kind, Vanessa

    2016-01-01

    This paper offers clarification of science teacher orientations as a potential component of pedagogical content knowledge. Science teaching orientations and beliefs about science held by 237 preservice science teachers were gathered via content-specific vignettes and questionnaire, respectively, prior to participation in a UK-based teacher…

  19. Příprava duto-vlákenných membrán pro separaci plynů inverzí fází: vliv smykové rychlosti na separační vlastnosti

    Czech Academy of Sciences Publication Activity Database

    Válek, R.; Malý, D.; Peter, Jakub; Ullsperger, J.

    2018-01-01

    Roč. 112, č. 4 (2018), s. 237-241 ISSN 0009-2770 Institutional support: RVO:61389013 Keywords : gas membrane separation * polymer membrane * hollow fibre Subject RIV: CD - Macromolecular Chemistry OBOR OECD: Polymer science Impact factor: 0.387, year: 2016 http://www.chemicke-listy.cz/ojs3/index.php/chemicke-listy/article/view/3067

  20. Trace element chemistry and textures of low-temperature pyrites associated with shallow fossil subsurface geothermal discharge in the Eger Graben, northwestern Bohemia

    Czech Academy of Sciences Publication Activity Database

    Zachariáš, J.; Adamovič, Jiří; Langrová, Anna

    2006-01-01

    Roč. 37, 29 (2006), s. 237-239 ISSN 0032-6267 R&D Projects: GA AV ČR IAA3013302 Institutional research plan: CEZ:AV0Z30130516 Keywords : pyrite * geothermal fluids * Eger Graben Subject RIV: DB - Geology ; Mineralogy

  1. Parenting Stress and Child Behavior Problems: A Transactional Relationship across Time

    Science.gov (United States)

    Neece, Cameron L.; Green, Shulamite A.; Baker, Bruce L.

    2012-01-01

    Parenting stress and child behavior problems have been posited to have a transactional effect on each other across development. However, few studies have tested this model empirically. The authors investigated the relationship between parenting stress and child behavior problems from ages 3 to 9 years old among 237 children, 144 of whom were…

  2. 77 FR 38769 - 97th Annual Meeting of the National Conference on Weights and Measures

    Science.gov (United States)

    2012-06-29

    ... Handbook 130, ``Uniform Laws and Regulations in the area of Legal Metrology and Engine Fuel Quality'' and.... Polyethylene Sheeting--Test Procedure--Footnote to Step 3.) Item 232-2, Method of Sale Regulation--Section 2.19... consumers as part of the oil change service. (See also Item 237-4, Handbook 130 Uniform Engine Fuels and...

  3. Streptokinase increases the sensitivity of colon cancer cells to chemotherapy by gemcitabine and cis-platine in vitro

    Czech Academy of Sciences Publication Activity Database

    Bobek, V.; Pintérová, D.; Kološtová, K.; Boubelík, Michael; Douglas, J.; Teyssler, P.; Pavlásek, J.; Kovařík, J.

    2006-01-01

    Roč. 237, č. 1 (2006), s. 95-101 ISSN 0304-3835 Institutional research plan: CEZ:AV0Z50520514 Keywords : chemotherapy * radiation * colon cancer Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 3.277, year: 2006

  4. Critical comparison of radiometric and mass spectrometric methods for the determination of radionuclides in environmental, biological and nuclear waste samples

    DEFF Research Database (Denmark)

    Hou, Xiaolin; Roos, Per

    2008-01-01

    application in the environmental and biological researches, these radionuclides include H-3, C-14, Cl-36, Ca-41 Ni-59,Ni-63, Sr-89,Sr-90, Tc-99, I-129, Cs-135,Cs-137, Pb-210, Ra-226,Ra-228, Np-237, Am-241, and isotopes of thorium, uranium and plutonium. The application of on-line methods (flow injection...

  5. The Conference on the Dynamics of Molecular Collisions Held at Snowbird, Utah on 14-19 July 1985.

    Science.gov (United States)

    1985-07-01

    Berkeley Lab. (701) 237-8906 Berkeley, CA 94720 S(415) 486-6 4 47 Dr. F. Borondo Dept. de Quimica Fisica y Quimica CuanticA Dr. Frank Budenholzer...F. Martin and M. Yaez. Departamento de Quimica Fisica y Quimica Cudntica Facultad de Ciencias. C-XIV. Universidad Aut6noma de Madrid. Cantoblanco

  6. Paradox Lost and Paradox Regained: Comments on Chouinard's "The Case for Participatory Evaluation..."

    Science.gov (United States)

    Datta, Lois-ellin

    2013-01-01

    Jill Chouinard, in her article "The Case for Participatory Evaluation in an Era of Accountability" (this issue, p. 237), may be re-iterating what has often been claimed and arguably is infused already in much of our theory and practice: the value of participatory approaches in some, perhaps many situations. She summarizes these claims eloquently…

  7. Enzootic plague foci, Algeria

    Directory of Open Access Journals (Sweden)

    M.A. Malek

    2015-03-01

    Full Text Available In Algeria, PCR sequencing of pla, glpD and rpoB genes found Yersinia pestis in 18/237 (8% rodents of five species, including Apodemus sylvaticus, previously undescribed as pestiferous; and disclosed three new plague foci. Multiple spacer typing confirmed a new Orientalis variant. Rodent survey should be reinforced in this country hosting reemerging plague.

  8. 78 FR 75201 - Suspension of Limitations Under the Jerusalem Embassy Act

    Science.gov (United States)

    2013-12-10

    ... Vol. 78 Tuesday, No. 237 December 10. 2013 Part IV The President Presidential Determination No. 2014-04 of December 3, 2013--Suspension of Limitations Under the Jerusalem Embassy Act Proclamation 9067--Death of Nelson Mandela Proclamation 9068--National Pearl Harbor Remembrance Day, 2013 Memorandum...

  9. Comment on "Mitigating grain growth in binary nanocrystalline alloys through solute selection based on thermodynamic stability maps"

    Czech Academy of Sciences Publication Activity Database

    Lejček, Pavel; Hofmann, S.

    2015-01-01

    Roč. 107, Sep (2015), s. 235-237 ISSN 0927-0256 R&D Projects: GA ČR GBP108/12/G043 Institutional support: RVO:68378271 Keywords : nanocrystalline materials * grain size * grain boundary energy * grain boundary segregation Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 2.086, year: 2015

  10. Distribution coefficient of plutonium between sediment and seawater

    International Nuclear Information System (INIS)

    Duursma, E.K.; Parsi, P.

    1974-01-01

    Using plutonium 237 as a tracer, a series of experiments were conducted to determine the distribution coefficient of plutonium onto sediments both under oxic and anoxic conditions, where the plutonium was added to seawater in three different valence states: III, IV and VI

  11. Word order and information structure in Czech 3-and 4-year-olds' comprehension.

    Czech Academy of Sciences Publication Activity Database

    Smolík, Filip

    2015-01-01

    Roč. 35, č. 3 (2015), s. 237-253 ISSN 0142-7237 R&D Projects: GA ČR GA13-26779S Institutional support: RVO:68081740 Keywords : Case marking * grammar comprehension * information structure Subject RIV: AN - Psychology Impact factor: 1.254, year: 2015

  12. 78 FR 68830 - Information Collection Requirement; Defense Federal Acquisition Regulation Supplement; Service...

    Science.gov (United States)

    2013-11-15

    ... or other forms of information technology. The Office of Management and Budget (OMB) has approved this... Services. The provision at DFARS 252.237- 7024 requires offerors to submit with its offer a written plan describing how it will continue to perform essential contractor services during periods of crisis. The...

  13. Teachers' Emotions and Emotion Management: Integrating Emotion Regulation Theory with Emotional Labor Research

    Science.gov (United States)

    Lee, Mikyoung; Pekrun, Reinhard; Taxer, Jamie L.; Schutz, Paul A.; Vogl, Elisabeth; Xie, Xiyao

    2016-01-01

    While the similarities between emotion regulation (Gross in "J Personal Soc Psychol" 74:224-237, 1998a) and emotional labor (Hochschild in The managed heart: commercialization of human feeling. University of California Press, Berkeley, 1983) have been theoretically discussed, empirical research on their relation is lacking. We examined…

  14. South African Journal of Animal Science - Vol 11, No 3 (1981)

    African Journals Online (AJOL)

    Ruproteïenbehoeftes van agtien-maand-oud osse gedurende die afrondingsperiode* · EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT · DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. H.J. Van der Merwe, A.P. van Schalkwyk, L.J.J. van Rensburg, 237-245 ...

  15. 40 CFR Table 1 to Subpart IIIi of... - Emission Standards for Stationary Pre-2007 Model Year Engines With a Displacement of

    Science.gov (United States)

    2010-07-01

    ...-2007 Model Year Engines With a Displacement of 1 Table 1 to Subpart IIII of Part 60 Protection of... NEW STATIONARY SOURCES Standards of Performance for Stationary Compression Ignition Internal... Stationary Pre-2007 Model Year Engines With a Displacement of 2,237 KW (3,000 HP) and With a Displacement of...

  16. The Enigmatic Nature of the Israeli Legal System

    African Journals Online (AJOL)

    NWUuser

    the nature of the services PMSCs provide, war is a business opportunity for all of them. Armed conflicts ... benefactor irrespective of the morality of the cause. This apart ... 15 See Abrahamsen and William 2007 Int'l Relations 237. .... issues. This has had a critical importance to security reform because it indicated, from the ...

  17. 76 FR 70751 - Trinity Adaptive Management Working Group

    Science.gov (United States)

    2011-11-15

    ... DEPARTMENT OF THE INTERIOR Fish and Wildlife Service [FWS-R8-FHC-2011-N237; FXFR1334088TWG0W4] Trinity Adaptive Management Working Group AGENCY: Fish and Wildlife Service, Interior. ACTION: Notice of meeting. SUMMARY: The Trinity Adaptive Management Working Group (TAMWG) affords stakeholders the...

  18. Q-Step methods for Newton-Jacobi operator equation | Uwasmusi ...

    African Journals Online (AJOL)

    The paper considers the Newton-Jacobi operator equation for the solution of nonlinear systems of equations. Special attention is paid to the computational part of this method with particular reference to the q-step methods. Journal of the Nigerian Association of Mathematical Physics Vol. 8 2004: pp. 237-241 ...

  19. Lidská monstra ve Vokabuláři zvaném Lactifer a v dalších středověkých pramenech

    Czech Academy of Sciences Publication Activity Database

    Šedinová, Hana

    2004-01-01

    Roč. 127, 3-4 (2004), s. 237-283 ISSN 0024-4457 Institutional research plan: CEZ:AV0Z9009908; CEZ:AV0Z9062906 Keywords : human monsters * Greek geography * Medieval literature Subject RIV: AJ - Letters, Mass-media, Audiovision

  20. Effet des opérations unitaires d'extraction sur le rendement et la ...

    African Journals Online (AJOL)

    The butter from traditional methods is better than chemically extracted whose physicochemical characteristics vary (CV=23.7 to 62.3%) by obtaining almonds parameters. Conclusion and applications: Cooking followed by sun drying, roasting, frying, and churning are the operations that most affected the quality and yield ...

  1. 48 CFR 837.403 - Contract clause.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 5 2010-10-01 2010-10-01 false Contract clause. 837.403... OF CONTRACTING SERVICE CONTRACTING Nonpersonal Health Care Services 837.403 Contract clause. The contracting officer shall insert the clause at 852.237-7, Indemnification and medical liability insurance, in...

  2. Experiment list: SRX524971 [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available SRX524971 hg19 Histone H3K27ac Uterus Endometrial stromal cells NA 33306045,98.9,47....1,237 GSM1372863: H3K27ac case2 w/ EP; Homo sapiens; ChIP-Seq source_name=Human endometrial stromal cells || tissue=Endometr

  3. Kamillo Horn und das Melodram

    Czech Academy of Sciences Publication Activity Database

    Bajgarová, Jitka

    2010-01-01

    Roč. 12, - (2010), s. 229-237 ISSN 1212-1193. [Zdeněk Fibich, středoevropský skladatel konce 19. století. Olomouc, 19.05.2010–21.05.2010] Institutional research plan: CEZ:AV0Z90580513 Keywords : Kamillo Horn * concert melodrama Subject RIV: AL - Art, Architecture, Cultural Heritage

  4. Znovuuvedení kritické analýzy diskurzu do českého prostředí

    Czech Academy of Sciences Publication Activity Database

    Homoláč, Jiří; Mrázková, Kamila

    2017-01-01

    Roč. 78, č. 3 (2017), s. 237-253 ISSN 0037-7031 Institutional support: RVO:68378092 Keywords : critical discourse analysis * discourse-historical approach * discursive strategies * topos Subject RIV: AI - Linguistics OBOR OECD: Linguistics Impact factor: 0.625, year: 2016

  5. Activation of cytotoxic lymphocytes through C-type lectin receptors and immunotherapy of cancer

    Czech Academy of Sciences Publication Activity Database

    Pospíšil, Miloslav; Vannucci, L.; Horváth, Ondřej; Krausová, Kateřina; Fišerová, Anna

    1998-01-01

    Roč. 2, Suppl 1 (1998), s. 237 ISSN 1107-3756. [World Congress on Advances in Oncology /3./ and International Symposium on Molecular Medicine /1./. 15.10.1998-17.10.1998, Island of Crete] R&D Projects: GA AV ČR IAA7020602; GA MŠk VS96141 Subject RIV: EC - Immunology

  6. Repressive coping and alexithymia in ideopathic environmental intolerance

    DEFF Research Database (Denmark)

    Skovbjerg, Sine; Zachariae, Robert; Rasmussen, Alice

    2010-01-01

    participated in a general population-based study and reported symptoms of environmental intolerance (n = 787) and patients with IEI (n = 237). The participants completed questionnaires assessing IEI, namely, a measure of repressive coping combining scores on the Marlowe–Crowne Social Desirability Scale (MCSDS...

  7. Seasonality of cardiovascular risk factors

    DEFF Research Database (Denmark)

    Marti-Soler, Helena; Gubelmann, Cédric; Aeschbacher, Stefanie

    2014-01-01

    OBJECTIVE: To assess the seasonality of cardiovascular risk factors (CVRF) in a large set of population-based studies. METHODS: Cross-sectional data from 24 population-based studies from 15 countries, with a total sample size of 237 979 subjects. CVRFs included Body Mass Index (BMI) and waist...

  8. Biologically induced formation of realgar deposits in soil

    Czech Academy of Sciences Publication Activity Database

    Drahota, P.; Mikutta, C.; Falteisek, L.; Duchoslav, V.; Klementová, Mariana

    2017-01-01

    Roč. 218, DEC (2017), s. 237-256 ISSN 0016-7037 Institutional support: RVO:61388980 Keywords : Arsenic speciation * Microbial communities * Realgar * Sulfur isotopes * Wetland soil * X-ray absorption spectroscopy Subject RIV: CA - Inorganic Chemistry OBOR OECD: Inorganic and nuclear chemistry Impact factor: 4.609, year: 2016

  9. Book review: H. Haeupler & T. Muer: Bildatlas der Farn- und Blütenpflanzen Deutschlands; Eugen Ulmer Verlag, Stuttgart, 2007, 789 pp

    Czech Academy of Sciences Publication Activity Database

    Petřík, Petr

    2007-01-01

    Roč. 42, č. 3 (2007), s. 237-239 ISSN 1211-9520 Institutional support: RVO:67985939 Keywords : distribution atlas * vascular plants * Germany Subject RIV: EF - Botanics OBOR OECD: Plant science s, botany Impact factor: 1.133, year: 2007

  10. Toxicity of two plant powders as biopesticides in the management of ...

    African Journals Online (AJOL)

    SARAH

    2015-02-28

    Feb 28, 2015 ... The lowest LC50 value after 6 days was obtained with A. cissampeloides applied at. 2.37g/20g of V. ... Ex Hook.) Harms (Passifloraceae). Cliche: Chougourou, 2015. ..... Innovative Pest Management, Pergamon Press,. Oxford ...

  11. Occurrence of red tide caused by Karenia mikimotoi (toxic dinoflagellate) in the Southwest coast of India

    Digital Repository Service at National Institute of Oceanography (India)

    Madhu, N.V.; Reny, P.D.; Paul, M.; Ullas, N.; Resmi, P.

    .5-39.9 mu M) and chlorophyll a (av. 56.8 + or -23.7 mg m sup(-3)) concentration were observed during the bloom period. Microscopic analysis revealed that the discoloration was caused by an unarmored toxic dinoflagellate, Karenia mikimotoi Miyake & Kominami...

  12. Multipoint linkage analysis in X-linked ocular albinism of the Nettleship-Falls type

    NARCIS (Netherlands)

    Bergen, A. A.; Samanns, C.; Schuurman, E. J.; van Osch, L.; van Dorp, D. B.; Pinckers, A. J.; Bakker, E.; Gal, A.; van Ommen, G. J.; Bleeker-Wagemakers, E. M.

    1991-01-01

    An extensive linkage analysis was performed by studying ten Xp22 loci in ten families segregating for X-linked ocular albinism of the Nettleship-Falls type (XOA). Linkage was confirmed between the XOA locus (OA1) and both DXS16 (theta max = 0.10, zeta max = 4.09) and DXS237 (theta max = 0.12, zeta

  13. Refinement of the localization of the X-linked ocular albinism gene

    NARCIS (Netherlands)

    Bergen, A. A.; Zijp, P.; Schuurman, E. J.; Bleeker-Wagemakers, E. M.; Apkarian, P.; van Ommen, G. J.

    1993-01-01

    Although physical and genetic mapping studies assigned the X-linked ocular albinism gene to Xp22.3, the exact gene order in this region is still unclear. We present additional genetic mapping data concerning X-linked ocular albinism that suggests the consensus order Xpter-STS-DXS237-KAL-(OA1,

  14. 76 FR 28625 - Sorghum Promotion, Research, and Information Program; State Referendum Results

    Science.gov (United States)

    2011-05-18

    ... the 1,204 valid ballots cast, 917 or 76.2 percent favored the program and 287 or 23.7 percent opposed... those eligible persons voting for approval who were engaged in the production and sale of sorghum during...

  15. Influence of form factors and multistep effects on the 232Th(d,t) 231Th and 230Th(d,p) 231Th reactions

    International Nuclear Information System (INIS)

    Wilcke, W.; Felix, W.; Elze, Th.W.; Huizenga, J.R.; Thompson, R.C.; Dreisler, R.M.

    1977-01-01

    Tables of spectroscopic information are given for the nuclei 233 , 235 , 237 Pa, and 229 , 231 Ac studied in the reactions 234 , 236 , 238 U, and 230 , 232 Th(t,α), including spin, parity, differential cross sections, and spectra. These quantities are discussed and plotted

  16. Resonance – Journal of Science Education | Indian Academy of ...

    Indian Academy of Sciences (India)

    Home; Journals; Resonance – Journal of Science Education. Prajval Shastri. Articles written in Resonance – Journal of Science Education. Volume 22 Issue 3 March 2017 pp 237-244 General Article. Black Holes in Our Universe: Do They Inch Up the Mass Ladder? Prajval Shastri · More Details Abstract Fulltext PDF.

  17. Stavitel železnic Eduard Bazika ve světle svých pamětí

    Czech Academy of Sciences Publication Activity Database

    Hlavačka, Milan

    2016-01-01

    Roč. 42, č. 1 (2016), s. 219-237 ISSN 0585-4172 Institutional support: RVO:67985963 Keywords : Bohemia * Eduard Bazika * Czech Tehnical High School Subject RIV: AB - History OBOR OECD: History (history of science and technology to be 6.3, history of specific sciences to be under the respective headings)

  18. Geochemical and Sm–Nd isotopic study of titanite from granitoid ...

    Indian Academy of Sciences (India)

    in granitic magmas that have equilibrated with titanite during fractional crystallization or partial melting ... Titanite; Kolar; Ramagiri; Dharwar craton; rare earth elements; Sm–Nd isotope dating. J. Earth Syst. Sci. 120, No. 2, April 2011, pp. 237–251 c Indian Academy of Sciences ... be altered by variations in temperature and/or.

  19. Identification of two novel mutations C79X and R235Q in the dihydropyrimidine dehydrogenase gene in a patient presenting with hematuria

    NARCIS (Netherlands)

    van Kuilenburg, A. B. P.; Meijer, J.; Dobritzsch, D.; Lohkamp, B.; Ruitenbeek, W.; Roelofsen, J.; Abeling, N. G. G. M.; Duran, M.; Buzing, C.

    2008-01-01

    A patient with hematuria was shown to have thymine-uraciluria. The dihydropyrimidine dehydrogenase (DPD) activity in peripheral blood mononuclear cells was 0.16 nmol/mg/h; controls: 9.9 +/- 2.8 nmol/mg/h. Analysis of DPYD showed that the patient was compound heterozygous for the novel mutations 237C

  20. Pramana – Journal of Physics | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Home; Journals; Pramana – Journal of Physics. Pooja Rani Sharma. Articles written in Pramana – Journal of Physics. Volume 84 Issue 2 February 2015 pp 237-247. Suppression of oscillations in mean-field diffusion · Neeraj Kumar Kamal Pooja Rani Sharma Manish Dev Shrimali · More Details Abstract Fulltext PDF.

  1. Changes in the Chlorophyll Content and Cytokinin Levels in the Top Three Leaves of New Plant Type Rice During Grain Filling

    Czech Academy of Sciences Publication Activity Database

    Rubia, L.; Rangan, L.; Kamínek, Miroslav; Dobrev, Petre; Malbeck, Jiří; Fowler, M.; Khush, G.; Elliott, M.

    2014-01-01

    Roč. 33, č. 1 (2014), s. 66-76 ISSN 0721-7595 R&D Projects: GA MŠk 1M06030 Institutional support: RVO:61389030 Keywords : Chlorophyll * Cytokinins * Grain filling Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 2.237, year: 2014

  2. Fuel selection for radioisotope thermoelectric generators

    International Nuclear Information System (INIS)

    Menezes, A.

    1988-06-01

    The availability of Radioisotope Thermoeletric Generator fuels is evaluated based on the amount of fuel discharged from selected power reactors. In general, the best alternatives are either to use Plutonium-238 produced by irradiation of Neptunium-237 generated in typical thermal reactors or to use Curium-244 directly separated from the discharged fuels of fast or thermal reactors. (author) [pt

  3. Past and prospective carbon stocks in forests of northern Wisconsin: a report from the Chequamegon-Nicolet National Forest Climate Change Response Framework

    Science.gov (United States)

    Richard Birdsey; Yude Pan; Maria Janowiak; Susan Stewart; Sarah Hines; Linda Parker; Stith Gower; Jeremy Lichstein; Kevin McCullough; Fangmin Zhang; Jing Chen; David Mladenoff; Craig Wayson; Chris. Swanston

    2014-01-01

    This report assesses past and prospective carbon stocks for 4.5 million ha of forest land in northern Wisconsin, including a baseline assessment and analysis of the impacts of disturbance and management on carbon stocks. Carbon density (amount of carbon stock per unit area) averages 237 megagrams (Mg) per ha, with the National Forest lands having slightly higher carbon...

  4. Depolarization affects lateral microdomain structure of yeast plasma membrane

    Czech Academy of Sciences Publication Activity Database

    Herman, P.; Večeř, J.; Opekarová, Miroslava; Veselá, Petra; Jančíková, I.; Zahumenský, J.; Malínský, Jan

    2015-01-01

    Roč. 282, č. 3 (2015), s. 419-434 ISSN 1742-464X R&D Projects: GA ČR GAP205/12/0720 Institutional support: RVO:68378041 Keywords : gel microdomains * lipid order * transmembrane potential Subject RIV: EA - Cell Biology Impact factor: 4.237, year: 2015

  5. CPAP Tips

    Medline Plus

    Full Text Available ... Mask Fitting Review Demonstration FreeCPAPAdvice com - Duration: 7:36. TheLankyLefty27 101,237 views 7:36 6 Best CPAP Masks 2017 - Duration: 2:58. ... 2:58 Donn's Sleep Apnea Story - Duration: 2:36. schneiderjobs 7,691 views 2:36 Loading more ...

  6. Water SA - Vol 32, No 2 (2006)

    African Journals Online (AJOL)

    The effect of sodium chloride and sodium bicarbonate derived anolytes, and anolyte-catholyte combination on biofilms · EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. MS Thantsha, TE Cloete, 237-242. http://dx.doi.org/10.4314/wsa.v32i2.5248 ...

  7. 78 FR 36232 - Announcement of Funding Awards; Service Coordinators in Multifamily Housing Program, Fiscal Year...

    Science.gov (United States)

    2013-06-17

    .......... Chase Manor Chase Manor.... 55-75 Norman Norwich 50 245,565 Associates. Road. CT....... Southern... St. The Green 2412 Franklin Washington 100 124,177 Paul Housing Valley Apts. St Ne. Inc. FL... Apts. MA....... Taunton Green Taunton Green.. 31 School St... Taunton 75 237,008 Associates. MA...

  8. The Study of Prompt and Delayed Muon Induced Fission. I.Total kinetic energies and mass distributions

    NARCIS (Netherlands)

    David, P; Hartfiel, J.; Janszen, H.; Petitjean, C.; Reist, H.W.; Polikanov, S.M.; Konijn, J.; Laat, de C.T.A.M.; Taal, A.; Krogulski, T.; Johansson, T.; Tibell, G.; Achard van Enschut, d' J.F.M.

    1987-01-01

    Mass yield and total kinetic energy release (TKE) distributions of fragments from prompt and delayed muon induced fission, separately, have been measured for the isotopes235U,238U,237Np and242Pu. The distributions from prompt muon induced fission are compared with the corresponding distributions

  9. How to exhaust your bone marrow

    DEFF Research Database (Denmark)

    Salomo, Louise; Salomo, Morten; Andersen, Steven A W

    2013-01-01

    at work and in his spare time, and kept a very thorough training and weight diary. Owing to a high intake of energy and protein drinks he tried to optimise his physical performance and kept a normal body mass index  at 23.7. A bone marrow biopsy showed gelatinous bone marrow transformation, normally seen...

  10. Influence of temperature on the starvation threshold of nauplii of barnacle Balanus amphitrite (Cirripedia: Thoracica)

    Digital Repository Service at National Institute of Oceanography (India)

    Desai, D.V.; Anil, A.C.

    & Rohlf F J , Biometry: The principles and practice of statistics in biological research , (W H Freeman & Comp, San Francisco), 1981. 12 Walley L J, Phil. Trans. R. Soc. (B).256 (1969) 237. 13 Storch V & Anger K, Helgolander Meeresunters, 36 (1983) 67. 14...

  11. Diode laser slit-jet spectra and analysis of the ν14 fundamental of 1-chloro-1,1-difluoroethane (HCFC-142b)

    Science.gov (United States)

    D'Amico, Giuseppe; Snels, Marcel

    2003-01-01

    High resolution infrared spectra (0.001 cm -1 FWHM) have been measured for mixtures of 1-chloro-1,1-difluoroethane in Ne, expanded in a supersonic planar jet. The ν14 fundamental has been analyzed for both isotopic species, CH3CF235Cl and CH3CF237Cl.

  12. original article the prevalence of intestinal coccidian parasites ...

    African Journals Online (AJOL)

    boaz

    Department of Medical Laboratory Sciences, Faculty of Health Sciences,. University of Bamenda. Email: henrikamga2002@yahoo.fr Tel: (+237)99721972. ABSTRACT. Background: Intestinal coccidia are group of protozoa which parasitize the epithelial cells of the intestinal tract of their hosts. Most infections usually produce ...

  13. Gaussian Filtering with Tapered Oil-Filled Photonic Bandgap Fibers

    DEFF Research Database (Denmark)

    Brunetti, Anna Chiara; Scolari, Lara; Weirich, Johannes

    2008-01-01

    A tunable Gaussian filter based on a tapered oil-filled photonic crystal fiber is demonstrated. The filter is centered at X=1364nm with a bandwidth (FWHM) of 237nm. Tunability is achieved by changing the temperature of the filter. A shift of 210nm of the central wavelength has been observed...

  14. Wide frequency independently controlled dual-band inkjet-printed antenna

    KAUST Repository

    AbuTarboush, Hattan F.; Shamim, Atif

    2014-01-01

    .2 and 23.7%, respectively. These dual-bands have the ability to be controlled independently between 1.1 and 7.5 GHz without affecting the other band. In addition, the proposed antenna can be assigned for different mobile and wireless applications

  15. Význam jako jeden-pro-druhého. Etická významovost a identita subjektu u pozdního Levinase

    Czech Academy of Sciences Publication Activity Database

    Bierhanzl, Jan

    2011-01-01

    Roč. 66, Suppl. (2011), s. 228-237 ISSN 0046-385X R&D Projects: GA ČR(CZ) GAP401/10/1164 Institutional research plan: CEZ:AV0Z90090514 Keywords : meaning * subject * non-sense Subject RIV: AA - Philosophy ; Religion

  16. Graphs of neutron cross section data for fusion reactor development

    International Nuclear Information System (INIS)

    Asami, Tetsuo; Tanaka, Shigeya

    1979-03-01

    Graphs of neutron cross section data relevant to fusion reactor development are presented. Nuclides and reaction types in the present compilation are based on a WRENDA request list from Japan for fusion reactor development. The compilation contains various partial cross sections for 55 nuclides from 6 Li to 237 Np in the energy range up to 20 MeV. (author)

  17. Water Jet Technology Used in Medicine

    Czech Academy of Sciences Publication Activity Database

    Hreha, P.; Hloch, S.; Magurová, D.; Valíček, Jan; Kozak, D.; Harničárová, M.; Rakin, M.

    2010-01-01

    Roč. 17, č. 7 (2010), s. 237-240 ISSN 1330-3651 Institutional research plan: CEZ:AV0Z3086906 Keywords : abrasive water jet * medicine * technology Subject RIV: JQ - Machines ; Tools Impact factor: 0.083, year: 2010

  18. Status of the breeding population of Great Cormorants in Denmark in 2012

    DEFF Research Database (Denmark)

    Bregnballe, Thomas; Hansen, Rikke; Therkildsen, Ole Roland

    2013-01-01

    There were 27,237 occupied nests of Great Cormorants (Phalacrocorax carbo sinensis) in the summer of 2012 in Denmark. This is an increase of ca. 1,700 nests compared to 2011. The cormorants had colonies or attempted to found colonies at 64 locations in 2012. This is close to the highest number...

  19. The Development and Establishment of Technology in South Africa. Part 1: The Role of Higher Education. Part 2: The Role of Industry.

    Science.gov (United States)

    du Preez, N. P.; van Eldik, P.; Mohr, M.; van der Watt, H. H.

    1998-01-01

    Responses from 118 of 237 executives in South Africa found the following highly rated: importance of universities in supplying high-level workers; need for high-skilled technicians and innovative entrepreneurs; and need for business to understand technology, fund research, and have a technology strategy. Respondents rated the current reality of…

  20. Genetic interaction between Lrp6 and Wnt5a during mouse development

    Czech Academy of Sciences Publication Activity Database

    Andersson, E.; Bryjová, Lenka; Biris, K.; Yamaguchi, T.P.; Arenas, E.; Bryja, Vítězslav

    2010-01-01

    Roč. 239, č. 1 (2010), s. 237-245 ISSN 1058-8388 Institutional research plan: CEZ:AV0Z50040507; CEZ:AV0Z50040702 Keywords : Wnt 5a * Lrp6 * somitogenesis Subject RIV: BO - Biophysics Impact factor: 2.864, year: 2010

  1. A dynamic gradient of Wnt signaling controls initiation of neurogenesis in the mammalian cortex and cellular specification in the hippocampus

    Czech Academy of Sciences Publication Activity Database

    Machoň, Ondřej; Backman, M.; Machonova, O.; Kozmik, Zbyněk; Vacík, Tomáš; Andersen, L.; Krauss, S.

    2007-01-01

    Roč. 311, č. 1 (2007), s. 223-237 ISSN 0012-1606 R&D Projects: GA MŠk(CZ) 1M0520 Institutional research plan: CEZ:AV0Z50520514 Keywords : Wnt * beta-catenin * gene * brain Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 4.714, year: 2007

  2. Může arbuskulární mykorhiza pomoci v zemědělské produkci?

    Czech Academy of Sciences Publication Activity Database

    Janoušková, Martina

    2017-01-01

    Roč. 65, č. 5 (2017), s. 237-240 ISSN 0044-4812 R&D Projects: GA MŠk(CZ) LH14285 Institutional support: RVO:67985939 Keywords : arbuscular mycorrhiza * agriculture * inoculation Subject RIV: EH - Ecology, Behaviour OBOR OECD: Ecology

  3. 76 FR 45594 - Mortgagee Review Board: Administrative Actions

    Science.gov (United States)

    2011-07-29

    ... or liability, agreed to pay a civil money penalty in the amount of $237,500. Cause: The Board took... over-insured mortgages; failed to ensure that there were no discrepancies between disbursements and/or..., without admitting fault or liability, to pay a civil money penalty in the amount of $46,000; to curtail...

  4. Interspecific hybridization in the genus Hieracium (s. str.) – evidence for bidirectional gene flow and spontaneous allopolyploidization

    Czech Academy of Sciences Publication Activity Database

    Mráz, P.; Chrtek, Jindřich; Fehrer, Judith

    2011-01-01

    Roč. 293, 1-4 (2011), s. 237-245 ISSN 0378-2697 R&D Projects: GA ČR GAP506/10/1363 Institutional research plan: CEZ:AV0Z60050516 Keywords : additive polymorphism * hybridization * polyploidization Subject RIV: EF - Botanics Impact factor: 1.335, year: 2011

  5. Character and dynamics of the floodplain of the Losenice River, Šumava Mts

    Czech Academy of Sciences Publication Activity Database

    Hartvich, Filip

    2008-01-01

    Roč. 13, č. 3 (2008), s. 237-249 ISSN 1211-7420 R&D Projects: GA AV ČR(CZ) KJB300460501 Grant - others:MŽP(CZ) SM/2/57/05 Institutional research plan: CEZ:AV0Z30460519 Keywords : floodplain * GIS delineation * flood consequences Subject RIV: DE - Earth Magnetism, Geodesy, Geography

  6. Differences between Mothers' and Fathers' Ratings of Family Functioning with the Family Assessment Device: The Validity of Combined Parent Scores

    Science.gov (United States)

    Cooke, Dawson; Marais, Ida; Cavanagh, Robert; Kendall, Garth; Priddis, Lynn

    2015-01-01

    The psychometric properties of the General Functioning subscale of the McMaster Family Assessment Device were examined using the Rasch Model (N = 237 couples). Mothers' and fathers' ratings of the General Functioning subscale of the McMaster Family Assessment Device are recommended, provided these are analyzed separately. More than a quarter of…

  7. Cytoplasmic nucleophosmin (cNPM) in acute myeloid leukaemia ...

    African Journals Online (AJOL)

    Amani H. Kazem

    2011-08-26

    Aug 26, 2011 ... b Hematology Department of the Medical Research Institute, Alexandria University, Alexandria, Egypt. Received 3 July ... appears to be more abundant in tumour cells than in normal cells. .... were then filed for bone marrow transplant if possible. 2.1. ..... Genes Chromosomes Cancer 2003;37:237–51. 18.

  8. Magnetically responsive yeast cells: methods of preparation and applications

    Czech Academy of Sciences Publication Activity Database

    Šafařík, Ivo; Maděrová, Zdeňka; Pospišková, K.; Horská, Kateřina; Šafaříková, Miroslava

    2015-01-01

    Roč. 32, č. 1 (2015), s. 227-237 ISSN 0749-503X R&D Projects: GA MŠk(CZ) LD13023; GA MŠk(CZ) LD13021 Institutional support: RVO:67179843 Keywords : yeast cells * Saccharomyces * Kluyveromyces * Rhodotorula * Yarrowia * magnetic modification Subject RIV: CE - Biochemistry Impact factor: 2.259, year: 2015

  9. Minimum Energy Dissipation under Cocurrent Flow in Packed Beds

    Czech Academy of Sciences Publication Activity Database

    Akramov, T.A.; Stavárek, Petr; Jiřičný, Vladimír; Staněk, Vladimír

    2011-01-01

    Roč. 50, č. 18 (2011), s. 10824-10832 ISSN 0888-5885 R&D Projects: GA ČR GA104/09/0880 Institutional research plan: CEZ:AV0Z40720504 Keywords : energy dissipation * current flow * packed bed Subject RIV: CI - Industrial Chemistry, Chemical Engineering Impact factor: 2.237, year: 2011

  10. 75 FR 67632 - Defense Federal Acquisition Regulation Supplement; Prohibition on Interrogation of Detainees by...

    Science.gov (United States)

    2010-11-03

    ...-AG88 Defense Federal Acquisition Regulation Supplement; Prohibition on Interrogation of Detainees by... National Defense Authorization Act for Fiscal Year 2010 (Pub. L. 111-84) prohibits the interrogation of..., to add DFARS 237.173, Prohibition on Interrogation of Detainees by Contractor Personnel, adding a...

  11. Nigerian Veterinary Journal - Vol 37, No 4 (2016)

    African Journals Online (AJOL)

    Immunomodulatory effect of Levamisole hydrochloride and Mentofin® in Newcastle disease vaccinated commercial broilers · EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. O.O. Esan, A Ehinmowo, J.O. Abiola, A.I. Adebiyi, O.A. Oladele, 237-242 ...

  12. Earth sciences

    International Nuclear Information System (INIS)

    Duguid, J.O.

    1977-01-01

    Studies on waste management research included reduction of radionuclide discharges and radionuclide cycling in terrestrial environments. Studies on assessment of K determinations included use of mathematical models to simulate the movement of radionuclides through soils and porous media and distribution coefficients of 237 Pu with Fuguay Sand in various suspending media and pH values

  13. Prevention of Alveolar Osteitis After Third Molar Surgery ...

    African Journals Online (AJOL)

    2017-05-16

    May 16, 2017 ... Nigerian Journal of Clinical Practice ¦ Volume 20 ¦ Issue 4 ¦ April 2017 observed similar percentages of alveolar osteitis using mouthwashes of warm saline and 0.2% chlorhexidine. (23.7% and 20.9%, respectively) in a randomized controlled study. The use of warm saline rinse is a common postextraction.

  14. Fruit sizes and the structure of frugivorous communities in a New Guinea lowland rainforest

    Czech Academy of Sciences Publication Activity Database

    Čtvrtečka, R.; Sam, Kateřina; Miller, S. E.; Weiblen, G. D.; Novotný, Vojtěch

    2016-01-01

    Roč. 41, č. 3 (2016), s. 228-237 ISSN 1442-9985 Grant - others:GA JU(CZ) GA13-09979S Institutional support: RVO:60077344 Keywords : Coleoptera * Diptera * Lepidoptera Subject RIV: EH - Ecology, Behaviour Impact factor: 1.708, year: 2016 http://onlinelibrary.wiley.com/doi/10.1111/aec.12326/abstract

  15. Identification of bacterial uropathogens by preparative isoelectricfocusing and matrix-assisted laser desorption/ionizationtime-of-flight mass spectrometry

    Czech Academy of Sciences Publication Activity Database

    Šalplachta, Jiří; Horká, Marie; Růžička, F.; Šlais, Karel

    2018-01-01

    Roč. 1532, JAN (2018), s. 232-237 ISSN 0021-9673 R&D Projects: GA MV VI20172020069; GA MZd(CZ) NV16-29916A Institutional support: RVO:68081715 Keywords : isoelectric focusing * mass spectrometry * urine * bacteria Subject RIV: CB - Analytical Chemistry, Separation OBOR OECD: Analytical chemistry Impact factor: 3.981, year: 2016

  16. What does že jo (and že ne) mean in spoken dialogue

    Czech Academy of Sciences Publication Activity Database

    Komrsková, Zuzana

    2017-01-01

    Roč. 68, č. 2 (2017), s. 229-237 ISSN 0021-5597 R&D Projects: GA ČR GA15-01116S Institutional support: RVO:68378092 Keywords : spoken languge * spoken corpus * tag question * responze word Subject RIV: AI - Linguistics OBOR OECD: Linguistics http://www.juls.savba.sk/ediela/jc/2017/2/jc17-02.pdf

  17. Characterization of nine microsatellite markers and development of multiplex PCRs for the Chinese huge musel Anodonta (Sinanodonta) woodiana Lea, 1834 (Mollusca, Bivalvia)

    Czech Academy of Sciences Publication Activity Database

    Popa, O. P.; Bartáková, Veronika; Bryja, Josef; Reichard, Martin; Popa, L. O.

    2015-01-01

    Roč. 60, June (2015), s. 234-237 ISSN 0305-1978 R&D Projects: GA ČR GA13-05872S Institutional support: RVO:68081766 Keywords : Invasive species * SSRs * Population genetics * Unionidae Subject RIV: EG - Zoology Impact factor: 0.988, year: 2015

  18. The reaction of NADPH with bovine mitochondrial NADH:ubiquinone oxidoreductase revisited: II. Comparison of the proposed working hypothesis with literature data.

    NARCIS (Netherlands)

    Albracht, S.P.J.

    2010-01-01

    The first purification of bovine NADH:ubiquinone oxidoreductase (Complex I) was reported nearly half a century ago (Hatefi et al. J Biol Chem 237:1676-1680, 1962). The pathway of electron-transfer through the enzyme is still under debate. A major obstacle is the assignment of EPR signals to the

  19. Analytical model of asymmetrical Mixed-Mode Bending test of adhesively bonded GFRP joint

    Czech Academy of Sciences Publication Activity Database

    Ševčík, Martin; Hutař, Pavel; Vassilopoulos, Anastasios P.; Shahverdi, M.

    2015-01-01

    Roč. 9, č. 34 (2015), s. 237-246 ISSN 1971-8993 R&D Projects: GA MŠk(CZ) EE2.3.30.0063; GA ČR GA15-09347S Institutional support: RVO:68081723 Keywords : GFRP materials * Mixed-Mode bending * Fiber bridging * Analytical model Subject RIV: JL - Materials Fatigue, Friction Mechanics

  20. Detection of field significant long-term monotonic trends in spring yields

    Czech Academy of Sciences Publication Activity Database

    Ledvinka, O.; Lamačová, Anna

    2015-01-01

    Roč. 29, č. 5 (2015), s. 1463-1484 ISSN 1436-3240 Institutional support: RVO:67179843 Keywords : Cross-correlation * Groundwater monitoring * Serial correlation * Spring yields * Trend analysis Subject RIV: DA - Hydrology ; Limnology OBOR OECD: Hydrology Impact factor: 2.237, year: 2015