WorldWideScience

Sample records for berkelium 237

  1. New berkelium isotope: 242Bk

    International Nuclear Information System (INIS)

    A new isotope of berkelium, 242Bk, was produced with a cross section of approx. 10 μb in reactions of boron on uranium and nitrogen on thorium. It decays by electron capture with a half-life of 7 +- 1.3 minutes. The branching ratio for this isotope for alpha decay is less than 1% and that for spontaneous fission is less than 0.03%. 2 figures, 2 tables

  2. Characterization of berkelium(III) dipicolinate and borate compounds in solution and the solid state.

    Science.gov (United States)

    Silver, Mark A; Cary, Samantha K; Johnson, Jason A; Baumbach, Ryan E; Arico, Alexandra A; Luckey, Morgan; Urban, Matthew; Wang, Jamie C; Polinski, Matthew J; Chemey, Alexander; Liu, Guokui; Chen, Kuan-Wen; Van Cleve, Shelley M; Marsh, Matthew L; Eaton, Teresa M; van de Burgt, Lambertus J; Gray, Ashley L; Hobart, David E; Hanson, Kenneth; Maron, Laurent; Gendron, Frédéric; Autschbach, Jochen; Speldrich, Manfred; Kögerler, Paul; Yang, Ping; Braley, Jenifer; Albrecht-Schmitt, Thomas E

    2016-08-26

    Berkelium is positioned at a crucial location in the actinide series between the inherently stable half-filled 5f(7) configuration of curium and the abrupt transition in chemical behavior created by the onset of a metastable divalent state that starts at californium. However, the mere 320-day half-life of berkelium's only available isotope, (249)Bk, has hindered in-depth studies of the element's coordination chemistry. Herein, we report the synthesis and detailed solid-state and solution-phase characterization of a berkelium coordination complex, Bk(III)tris(dipicolinate), as well as a chemically distinct Bk(III) borate material for comparison. We demonstrate that berkelium's complexation is analogous to that of californium. However, from a range of spectroscopic techniques and quantum mechanical calculations, it is clear that spin-orbit coupling contributes significantly to berkelium's multiconfigurational ground state. PMID:27563098

  3. Extraction of tetravalent berkelium and cerium by aliquate-336-S-NO3 quaternary ammonium salt

    International Nuclear Information System (INIS)

    Extraction of tetravalent berkelium and cerium by aliquate-336-S-NO3 quaternary ammonium salt from nitric acid solutions is investigated. The effect of concentrations of nitric acid and extracting agent, nature of an oxidant (potassium bromate, potassium bichromate, mixture of AgNO3 and (NH4)2S2O8) and solvent on the distribution coefficient of berkelium(4) and cerium(4) is studied. It is established that solutions of aliquate-336-S-NO3 in carbon tetrachloride and dichloroethane extract quantitatively tetravalent berkelium from 10-12 M nitric acid solutions and cerium - from 1-10 M nitric acid solutions containing potassium bichromate as an oxidant. It is shown that the value of distribution coefficient for berkelium and cerium depends on the nature of an oxidant and extracting agent concentration. It is established that in the case of extraction by quaternary ammonium salt with one berkelium(4) mole four aliquate-336-SNO3 moles are associated and 1.5-1.6 mole of extracting agent are associated with one cerium(4) mole. It permits to make a conclusion that stoichiometry of extraction reactions by quaternary ammonium salt is not the same for tetravalent berkelium and cerium. It is shown that trivalent transplutonium and rare earth elements are not practically extracted by aliquate-336-S-NO3 from nitric acid solutions

  4. WEB 237 Courses Tutorial / indigohelp

    OpenAIRE

    neha

    2015-01-01

    WEB 237 Week 1 Learning Team Assignment: Learning Team eCommerce Project WEB 237 Week 1 DQs WEB 237 Week 2 DQs WEB 237 Week 2 Learning Team Assignment: Planning, Brainstorming and Outlining WEB 237 Week 3 DQs WEB 237 Week 4 DQs WEB 237 Week 5 DQs WEB 237 Week 5 Learning Team Assignment: Finalized Paper Only WEB 237 Week 5 Learning Team Assignment: Finalized Powerpoint Only  

  5. Measurement of 237Th half-life

    International Nuclear Information System (INIS)

    237Th has been produced via a multinucleon transfer reaction by 60 MeV/u 18O ions bombardment of natural uranium. Thorium was radiochemically separated from the irradiated targets, 237Pa as a daughter nucleus of 237Th has been identified according to the growth and decay of 237Pa γ rays observed. The half-life of 237Th was determined to be 4.69 +- 0.60 min

  6. WEB 237 uop course tutorial/tutorial rank

    OpenAIRE

    nisert

    2015-01-01

    WEB 237 Week 1 Learning Team Assignment: Learning Team eCommerce Project WEB 237 Week 1 DQs WEB 237 Week 2 DQs WEB 237 Week 2 Learning Team Assignment: Planning, Brainstorming and Outlining WEB 237 Week 3 DQs WEB 237 Week 4 DQs WEB 237 Week 5 DQs WEB 237 Week 5 Learning Team Assignment: Finalized Paper Only WEB 237 Week 5 Learning Team Assignment: Finalized Powerpoint Only      

  7. 48 CFR 1552.237-74 - Publicity.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 6 2010-10-01 2010-10-01 true Publicity. 1552.237-74 Section 1552.237-74 Federal Acquisition Regulations System ENVIRONMENTAL PROTECTION AGENCY CLAUSES AND FORMS SOLICITATION PROVISIONS AND CONTRACT CLAUSES Texts of Provisions and Clauses 1552.237-74 Publicity. As prescribed in 1537.110, insert...

  8. 49 CFR 237.131 - Design.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 4 2010-10-01 2010-10-01 false Design. 237.131 Section 237.131 Transportation... TRANSPORTATION BRIDGE SAFETY STANDARDS Repair and Modification of Bridges § 237.131 Design. Each repair or... component of a bridge shall be designed by a railroad bridge engineer. The design shall specify the...

  9. 33 CFR 117.237 - Christina River.

    Science.gov (United States)

    2010-07-01

    ... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Christina River. 117.237 Section... DRAWBRIDGE OPERATION REGULATIONS Specific Requirements Delaware § 117.237 Christina River. (a) The owners of... Bridge over Christina River at milepost 1.4 will be closing to river traffic.” Five short blasts of...

  10. Chemical aspects of 237 Np Moessbauer spectroscopy

    International Nuclear Information System (INIS)

    The 237Np Moessbauer effect has been especially useful in studies of neptunium chemistry, by virtue of its excellent resolution and straightforward experimental techniques. Neptunium can have valences from +3 to +7, and a broad range of compounds can be prepared that are analogous to those of other actinide elements. Studies on neptunium compounds, for example, have a ready application to the analogous compounds of uranium and plutonium. The emphasis in this paper will be on the application of the 237Np Moessbauer effect to problems in neptunium chemistry

  11. 9 CFR 2.37 - Federal research facilities.

    Science.gov (United States)

    2010-01-01

    ... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Federal research facilities. 2.37 Section 2.37 Animals and Animal Products ANIMAL AND PLANT HEALTH INSPECTION SERVICE, DEPARTMENT OF AGRICULTURE ANIMAL WELFARE REGULATIONS Research Facilities § 2.37 Federal research facilities. Each Federal research facility shall establish...

  12. 48 CFR 2452.237-75 - Clearance of contractor personnel.

    Science.gov (United States)

    2010-10-01

    ... personnel. 2452.237-75 Section 2452.237-75 Federal Acquisition Regulations System DEPARTMENT OF HOUSING AND... Clauses 2452.237-75 Clearance of contractor personnel. As prescribed in 2437.110(e), insert the following clause in solicitations and contracts. Clearance of Contractor Personnel (OCT 1999) (a) General....

  13. 14 CFR 23.237 - Operation on water.

    Science.gov (United States)

    2010-01-01

    ... 14 Aeronautics and Space 1 2010-01-01 2010-01-01 false Operation on water. 23.237 Section 23.237... STANDARDS: NORMAL, UTILITY, ACROBATIC, AND COMMUTER CATEGORY AIRPLANES Flight Ground and Water Handling Characteristics § 23.237 Operation on water. A wave height, demonstrated to be safe for operation, and...

  14. Analysis list: nhr-237 [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available nhr-237 Embryo,Larvae + ce10 http://dbarchive.biosciencedbc.jp/kyushu-u/ce10/target/nhr-237.1.tsv http...://dbarchive.biosciencedbc.jp/kyushu-u/ce10/target/nhr-237.5.tsv http://dbarchive.bioscie...ncedbc.jp/kyushu-u/ce10/target/nhr-237.10.tsv http://dbarchive.biosciencedbc.jp/kyushu-u/ce10/colo/nhr-237.Embryo.tsv,http...://dbarchive.biosciencedbc.jp/kyushu-u/ce10/colo/nhr-237.Larvae.tsv http...://dbarchive.biosciencedbc.jp/kyushu-u/ce10/colo/Embryo.gml,http://dbarchive.biosciencedbc.jp/kyushu-u/ce10/colo/Larvae.gml ...

  15. Levels in 237Pu populated by 237Am (electron capture) and 241Cm(α) decays

    International Nuclear Information System (INIS)

    The electron capture decay scheme of 237Am (73 min) has been investigated by measuring the γ-ray and conversion-electron spectra of mass-separated 237Am samples. The γ-ray spectra were measured with a Ge(Li) spectrometer and the conversion-electron spectra were measured with a cooled Si(Li) detector and a magnetic β-ray spectrometer. Thirty-five γ rays were identified and the multipolarities of most of the transitions were deduced. The half-life of 237Am was determined by following the decay of the 280.2 keV photopeak and was found to be 73.0 plus-or-minus 1.0 min. The α-particle energy and α branching were measured to be 6.042 plus-or-minus 0.005 MeV and (2.5 plus-or-minus 0.3) times 10-2%, respectively. On the basis of the present investigation the following single-particle states have been identified in 237Pu: 7/2-743, 0; 1/2+631, 145.5; 5/2+622, 280.2; 3/2+631, 370.4; 5/2+633, 407.8; 7/2+624, 473.5; 5/2-752, 655.3; and 7/2+613, 908.8 keV. The ground state of 237Am has been deduced to be the 5/2-523 Nilsson orbital. The logft values for electron capture transitions to the observed states were derived. The α-particle spectrum of a mass-separated 241Cm sample was measured with the Argonne double focusing magnetic spectrometer. Eleven α groups identified in this spectrum populate the members of the ground state, 1/2+631, and 3/2+631 bands. The α-decay hindrance factors are consistent with the Nilsson-state assignments deduced from 237Am electron capture decay

  16. 49 CFR 237.31 - Adoption of bridge management programs.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 4 2010-10-01 2010-10-01 false Adoption of bridge management programs. 237.31 Section 237.31 Transportation Other Regulations Relating to Transportation (Continued) FEDERAL RAILROAD... Adoption of bridge management programs. Each track owner shall adopt a bridge safety management program...

  17. 48 CFR 1452.237-71 - Utilization of Woody Biomass.

    Science.gov (United States)

    2010-10-01

    ... Biomass. 1452.237-71 Section 1452.237-71 Federal Acquisition Regulations System DEPARTMENT OF THE INTERIOR... Utilization of Woody Biomass. As prescribed in § 1437.7202, insert the following clause: Utilization of Woody Biomass (MAY 2005) (a) The contractor may remove and utilize woody biomass, if: (1) Project work...

  18. 48 CFR 452.237-74 - Key Personnel.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 4 2010-10-01 2010-10-01 false Key Personnel. 452.237-74... SOLICITATION PROVISIONS AND CONTRACT CLAUSES Texts of Provisions and Clauses 452.237-74 Key Personnel. As prescribed in 437.110(d), insert a clause substantially as follows: Key Personnel (FEB 1988) (a)...

  19. 49 CFR 237.133 - Supervision of repairs and modifications.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 4 2010-10-01 2010-10-01 false Supervision of repairs and modifications. 237.133... Supervision of repairs and modifications. Each repair or modification pursuant to this part shall be performed under the immediate supervision of a railroad bridge supervisor as defined in § 237.55 of this part...

  20. 43 CFR 23.7 - Approval of exploration plan.

    Science.gov (United States)

    2010-10-01

    ... measures to be taken to prevent or control fire, soil erosion, pollution of surface and ground water... 43 Public Lands: Interior 1 2010-10-01 2010-10-01 false Approval of exploration plan. 23.7 Section 23.7 Public Lands: Interior Office of the Secretary of the Interior SURFACE EXPLORATION, MINING...

  1. 48 CFR 252.237-7001 - Compliance with audit standards.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Compliance with audit... of Provisions And Clauses 252.237-7001 Compliance with audit standards. As prescribed in 237.270(d)(2), use the following clause: Compliance With Audit Standards (MAY 2000) The Contractor, in performance...

  2. 49 CFR 237.101 - Scheduling of bridge inspections.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 4 2010-10-01 2010-10-01 false Scheduling of bridge inspections. 237.101 Section... ADMINISTRATION, DEPARTMENT OF TRANSPORTATION BRIDGE SAFETY STANDARDS Bridge Inspection § 237.101 Scheduling of bridge inspections. (a) Each bridge management program shall include a provision for scheduling...

  3. Np-237 in peat and lichen in Finland

    DEFF Research Database (Denmark)

    Salminen, S.; Paatero, J.; Roos, Per;

    2009-01-01

    Activity concentrations of 237Np in peat and lichen samples in Finland were determined and contributions from nuclear weapons testing in 1950–1960s and the Chernobyl accident were estimated. 237Np was determined with ICP-MS using 235Np as a tracer. Activity concentrations of 237Np in peat samples...... varied between 1.98 ± 0.05 and 14.1 ± 0.3 mBq/m2. The contribution from the Chernobyl accident to the total 237Np deposition in peat was 0.1–13%, the Chernobyl-derived fraction of total 237Np in peat being much lower than the previously determined corresponding Chernobyl-derived fractions of 239+240Pu...

  4. Dicty_cDB: SHF237 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SH (Link to library) SHF237 (Link to dictyBase) - - - Contig-U15547-1 SHF237P (Link to Original ... Value BC047807_1( BC047807 |pid:none) Danio rerio hypoxia ... up-regulated 1... 98 7e-19 BC071372_1( BC071372 |p ... id:none) Danio rerio hypoxia ... up-regulated 1... 98 7e-19 BC043837_1( BC043837 |p ...

  5. 48 CFR 1852.237-71 - Pension portability.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 6 2010-10-01 2010-10-01 true Pension portability. 1852... 1852.237-71 Pension portability. As prescribed at 1837.110-70(b), insert the following clause: Pension Portability (JAN 1997) (a) In order for pension costs attributable to employees assigned to this contract...

  6. 48 CFR 1352.237-75 - Key personnel.

    Science.gov (United States)

    2010-10-01

    ... SOLICITATION PROVISIONS AND CONTRACT CLAUSES Text of Provisions and Clauses 1352.237-75 Key personnel. As prescribed in 48 CFR 1337.110-71(b), insert the following clause: Key Personnel (APR 2010) (a) The contractor... 48 Federal Acquisition Regulations System 5 2010-10-01 2010-10-01 false Key personnel....

  7. 48 CFR 1252.237-73 - Key personnel.

    Science.gov (United States)

    2010-10-01

    ... SOLICITATION PROVISIONS AND CONTRACT CLAUSES Text of Provisions and Clauses 1252.237-73 Key personnel. As prescribed in (TAR) 48 CFR 1237.110(b), insert the following clause: Key Personnel (APR 2005) (a) The... 48 Federal Acquisition Regulations System 5 2010-10-01 2010-10-01 false Key personnel....

  8. 48 CFR 1552.237-72 - Key personnel.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 6 2010-10-01 2010-10-01 true Key personnel. 1552.237-72... personnel. As prescribed in 1537.110, insert the following contract clause when it is necessary for contract performance to identify Contractor key personnel. Key Personnel (APR 1984) (a) The Contractor shall assign...

  9. 48 CFR 2452.237-70 - Key personnel.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 6 2010-10-01 2010-10-01 true Key personnel. 2452.237-70... Key personnel. As prescribed in 2437.110(a), insert the following clause in solicitations and contracts when it is necessary for contract performance to identify the contractor's key personnel:...

  10. 46 CFR 108.237 - Fuel storage facilities.

    Science.gov (United States)

    2010-10-01

    ... Shipping COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) A-MOBILE OFFSHORE DRILLING UNITS DESIGN AND EQUIPMENT Construction and Arrangement Helicopter Facilities § 108.237 Fuel storage facilities. (a) Helicopter fuel storage tanks must be installed as far as practicable from— (1) The landing area; and...

  11. Dicty_cDB: VHA237 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHA237 (Link to dictyBase) - - - Contig-U16508-1 - (Link to Original site) ... 25. 40 0.11 2 EG619833 |EG619833.1 EMBRYOF088227O8 POSSUM _01-POSSUM -C-EMBRYO-2KB Trichosurus vulpecula cDNA ...

  12. 48 CFR 352.237-70 - Pro-Children Act.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 4 2010-10-01 2010-10-01 false Pro-Children Act. 352.237...-Children Act. As prescribed in 337.103-70(a), the Contracting Officer shall insert the following clause: Pro-Children Act (January 2006) (a) Public Law 103-227, Title X, Part C, also known as the...

  13. 48 CFR 1252.237-70 - Qualifications of contractor employees.

    Science.gov (United States)

    2010-10-01

    ....237-70 Qualifications of contractor employees. As prescribed in (TAR) 48 CFR 1237.110(a), insert the... secret in the interest of national defense or foreign policy. b. Work under this contract may involve... ensure that contractor employees are: (1) Citizens of the United States of America or an alien who...

  14. 48 CFR 237.270 - Acquisition of audit services.

    Science.gov (United States)

    2010-10-01

    ..., Compliance with Audit Standards, in solicitations and contracts for audit services. ... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Acquisition of audit... Assistance Services 237.270 Acquisition of audit services. (a) General policy. (1) Do not contract for...

  15. 48 CFR 352.237-71 - Crime Control Act-reporting of child abuse.

    Science.gov (United States)

    2010-10-01

    ...-reporting of child abuse. 352.237-71 Section 352.237-71 Federal Acquisition Regulations System HEALTH AND... Clauses 352.237-71 Crime Control Act—reporting of child abuse. As prescribed in 337.103-70(b), the Contracting Officer shall insert the following clause: Crime Control Act of 1990—Reporting of Child...

  16. 27 CFR 24.237 - Spirits added to juice or concentrated fruit juice.

    Science.gov (United States)

    2010-04-01

    ... 27 Alcohol, Tobacco Products and Firearms 1 2010-04-01 2010-04-01 false Spirits added to juice or concentrated fruit juice. 24.237 Section 24.237 Alcohol, Tobacco Products and Firearms ALCOHOL AND TOBACCO TAX AND TRADE BUREAU, DEPARTMENT OF THE TREASURY LIQUORS WINE Spirits § 24.237 Spirits added to juice or concentrated fruit juice. Juice...

  17. The radiological significance of 237Np in the environment

    International Nuclear Information System (INIS)

    Measurements have been made of the concentration of 237Np in tissues taken from sheep, which have grazed on sea-washed marshland on the west Cumbrian coast. The concentrations of 239Pu + 240Pu and 241Am were also determined in the same samples, to enable a comparison to be made of relative uptake of these radionuclides to livestock. Consequently, an assessment has been made of the relative radiological significance of these radionuclides, in terms of the dose received by the public from consuming sheep meat products. The concentrations of the same radionuclides were also measured in soil samples taken from the marsh on which the sheep grazed, to estimate the 237Np available to the sheep, via plant uptake and soil ingestion. (Author)

  18. Pilot measurements of 237Np in forest litter from Poland

    International Nuclear Information System (INIS)

    Described are results and the procedure for a pilot study on 237Np content in forest litter samples from Poland in relation to their plutonium activity. Neptunium was determined by inductively coupled plasma mass spectrometry (ICP-MS) and Pu by alpha spectrometry. Two samples originated from a location with pure global fallout and two others from a place with about 65% of the plutonium from Chernobyl. Plutonium activities were determined twice: at Krakow and in Monaco. The two results were consistent and 239+240Pu activities ranged from about 1 to about 7 Bq/kg dry weight (dw). The chemical recovery for Np was between 27 and 89%. Results for 237Np activity concentrations were between 0.099 ± 0.005 and 2.21 ± 0.076 mBq/kg dw. Observed activity ratios were lower than expected and could be explained by fractionation of Np against Pu in forest litter. (author)

  19. Levels in 237U studied by resonant neutron capture

    International Nuclear Information System (INIS)

    Primary and secondary γ rays in 237U from resonant neutron capture in 236U have been measured with the fast chopper facility, the neutron monochromator, and 2- and 24-keV neutron beam filters. A level scheme was constructed including 27 levels with spin and parity assignments. Rotational band members of the Nilsson configurations [631arrow-down], [622up-arrow], [624arrow-down], [631up-arrow], [633arrow-down], and [501arrow-down] and of the vibrational bands ][622up-arrow] - 2+] and ][631arrow-down] + 0+] were identified. There are more levels below 800 keV, in particular, K = 1/2- bands, than expected from comparison with 235U and 239U. The neutron binding energy in 237U was determined to be 5125.9 +- 0.5 keV

  20. Determination of 237Np in sediments and sea water

    International Nuclear Information System (INIS)

    Compared to other transuranic elements such as Pu and Am present environmental levels of Np are very low. Neptunium nuclides are therefore of little radiological significance in the concentrations found in the environment. In the longer term, however, 237Np will become one of the most important radionuclides remaining in high-level radioactive waste. We have further developed a new method for analysis of neptunium in large samples of soil, sediment and seawater. The samples are measured on alpha detectors and by ICPMS (Inductively coupled plasma mass spectrometry)

  1. Effect of naturally occurring organics on plutonium-237 uptake by algae and bacteria

    International Nuclear Information System (INIS)

    Naturally occurring organics were concentrated from Skinface Pond, near Aiken, South Carolina and separated into four nominal diameter size fractions (F I > 0.0183; 0.0183 > F II > 0.0032; 0.0032 > F III > 0.009; F IV 237Pu uptake. Plutonium-237 uptake was determined in log phase cultures after 6 hr incubations. The initial plutonium concentration in each flask was 1.1 x 10-4 μCi/ml 237Pu+4(NO3)4. Fractions I and II significantly reduced 237Pu uptake by S. obliquus, while F IV increased uptake and F III had no effect. Plutonium-237 uptake by A. hydrophila was not significantly different in the presence of F I, F II or F III than tryptic broth medium alone, while F IV significantly increased 237Pu uptake

  2. Study on adsorption of 237Np on bentonite

    International Nuclear Information System (INIS)

    The performance of adsorbing 237Np for bentonite as buffer/backfill material was investigated. The adsorption coefficients of 237Np were determined for three kinds of bentonite under atmosphere and anoxic atmosphere. Further, it was studied that Kd values were affected by pH and CO32-. The results are shown as follows: (1) Distribution coefficients Kd under atmosphere: for mixed-bentonite is 47.3 mL/g, for Mg-bentonite 52.0 mL/g and for Ca-bentonite 42.4 mL/g; and the corresponding Kd under anoxic atmosphere: 89.3 mL/g, 38.8 mL/g and 29.0 mL/g, respectively. (2) When pH was lower than 9.2, Kd of the mixed-bentonite increased with the increase of pH and the maxi-mumt Kd value appeared at pH 9.2. (3) Kd of the mixed-bentonite got lower in high carbonate concentration when the total neptunium concentration was smaller than the solubility of NaNpO2CO3. (author)

  3. 49 CFR 234.237 - Reverse switch cut-out circuit.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 4 2010-10-01 2010-10-01 false Reverse switch cut-out circuit. 234.237 Section... Maintenance, Inspection, and Testing Maintenance Standards § 234.237 Reverse switch cut-out circuit. A switch, when equipped with a switch circuit controller connected to the point and interconnected with...

  4. 19 CFR 10.237 - Verification and justification of claim for preferential tariff treatment.

    Science.gov (United States)

    2010-04-01

    ... preferential tariff treatment. 10.237 Section 10.237 Customs Duties U.S. CUSTOMS AND BORDER PROTECTION... preferential tariff treatment. (a) Verification by Customs. A claim for preferential tariff treatment made... port director may deny the claim for preferential tariff treatment. A verification of a claim...

  5. Plutonium-237: comparative uptake in chelated and non-chelated form by channel catfish (Ictalurus punctatus)

    International Nuclear Information System (INIS)

    Chelation can either enhance or reduce the uptake of ingested plutonium relative to PuOH (monomer) in channel catfish. Reduced uptake of 237Pu-fulvate is due either to the molecular weight of the complex or its stability in metabolic systems. Increased uptake of 237Pu-citrate is attributable to instability of the complex in metabolic systems. (author)

  6. Draft Genome Sequence of Lactobacillus collinoides CUPV237, an Exopolysaccharide and Riboflavin Producer Isolated from Cider.

    Science.gov (United States)

    Puertas, Ana Isabel; Capozzi, Vittorio; Llamas, María Goretti; López, Paloma; Lamontanara, Antonella; Orrù, Luigi; Russo, Pasquale; Spano, Giuseppe; Dueñas, María Teresa

    2016-01-01

    Lactobacillus collinoides CUPV237 is a strain isolated from a Basque cider. Lactobacillus collinoides is one of the most frequent species found in cider from Spain, France, or England. A notable feature of the L. collinoides CUPV237 strain is its ability to produce exopolysaccharides. PMID:27284133

  7. 237Np: Oxidation state in vivo and chelation by multidentate catecholat and hydroxypyridinonate ligands

    International Nuclear Information System (INIS)

    Chemically, 237Np(V) is as toxic as U(VI), and radiologically, about as toxic as 239Pu. Depending on redox conditions in vivo, 237Np exists as weakly complexing Np(V) (NpO2+) or as Np(IV), which forms complexes as stable as those of Pu(IV). Ten multidentate catecholate (CAM) and hydroxypyridinonate (HOPO) ligands with great affinity for Pu(IV) were compared with CaNa3-DTPA for in vivo chelation of 237Np. Mice were injected intravenously with 237NpO2Cl: those in a kinetic study were killed 1 to 2,880 min; in ligand studies, fed mice were injected intraperitoneally with a ligand 5, 60, or 1,440 min after 237Np(V), mice fasted for 16 h were gastrically intubated with a ligand 3 min after 237Np(V), and all were killed 24 h after ligand administration; tissues and excreta were radioanalyzed. Rapid plasma clearance and urinary excretion of 237Np(V) resemble U(VI); deposition and early retention in skeleton and liver resemble Pu(IV). The x-ray absorption near edge structure spectroscopy (XANES) spectra of femora of 237Np(V)-injected mice, compared with spectra of Np(V) and Np(IV) from reference solids, showed predominantly Np(IV). Significant in vivo 237Np chelation was obtained with all of the HOPO and CAM ligands injected at molar ratio 22; the HOPO ligands reduced 237Np in skeleton, liver, and other soft tissue, on average, to 72, 25, and 25% of control, respectively, while CaNa3-DTPA was ineffective

  8. 49 CFR 237.73 - Protection of bridges from over-weight and over-dimension loads.

    Science.gov (United States)

    2010-10-01

    ...-dimension loads. 237.73 Section 237.73 Transportation Other Regulations Relating to Transportation... Bridges § 237.73 Protection of bridges from over-weight and over-dimension loads. (a) Each track owner... exceed the capacity or dimensions of its bridges. (b) The instructions regarding weight shall...

  9. Pre-concentration studies of 237Np using sulphonic acid based actinide™ resin

    International Nuclear Information System (INIS)

    The absorption studies of the standard 237Np have been performed using actinide™ resin to standardise the selective separation. The supernatant solution was checked for alpha activity of 237Np using scintillation counting technique. It was found that more than 95 % of 237Np was absorbed in the actinide™ resin. The absorbed 237Np from the actinide™ resin was leached out using isopropyl alcohol. The leached out activity of 237Np in the isopropyl alcohol was estimated using same alpha scintillation counting technique and was found to be greater than 95 %. The selective absorption of 237Np resin from the other impurities in actinide™ is helpful in the analytical solution during recycle of fuels as well as in the waste management process. This is very much important because 237Np is one of the long-lived minor actinides produced from the 238U(n, 2n) reaction followed by beta decay. Thus it is useful for the conventional reactor based on natU and fast reactor based on U-Pu fuel. (author)

  10. Measurements of {sup 237}Np secondary neutron spectra

    Energy Technology Data Exchange (ETDEWEB)

    Kornilov, N.V.

    1997-03-01

    The activities carried out during the first year of the project are summarized. The main problems for Np spectra measurements arise from high intrinsic gamma-ray activity of the sample and admixture of the oxygen and iron nuclei. The inelastically scattered neutrons and the fission neutrons spectra for {sup 237}Np were measured by time-of-flight spectrometer of the IPPE at incident neutron energies {approx_equal}1.5 MeV, and {approx_equal}0.5 MeV. A solid tritium target and a Li-metallic target were used as neutron sources. The neutron scattering on C sample (C(n,n) standard reaction) was measured to normalize the Np data. The experimental data should be simulated by Monte Carlo method to correct the experimental data for oxygen and iron admixture as well as for multiple scattering of the neutrons in the sample. Therefore the response function of the spectrometer, and the neutron energy distribution from the source were investigated in detail. (author)

  11. Uptake from water and tissue distribution of neptunium-237 in crabs, shrimp and mussels

    International Nuclear Information System (INIS)

    The uptake of 237Np has been followed in the tissues of mussels, shrimp and crabs exposed to the actinide in sea-water under controlled conditions. Bioaccumulation was observed in all tissues examined with the highest concentration factors noted in the external shells of the three species. Despite some incorporation of 237Np into internal tissues, it is noteworthy that after prolonged exposure 92-98% of the organisms' total 237Np content was associated with the non-edible shells. The general behaviour of this toxic transuranic element in invertebrate tissues appears to be very similar to that of plutonium. (author)

  12. Preparation of 237U in photonuclear reaction 238U(γ,n) in electron accelerator - microtron MT-25

    International Nuclear Information System (INIS)

    237U are obtained in 238U(γ,n) reaction in electron accelerator - microtron MT-25 FLYaR. Radiation yield of 237U is 1 kBq/(mcA h mg 238U). Purification of 237U from fission products is carried out using extraction and ion exchange. Preparation of 237U with specific radioactivity 49500 kBq/mg 238U is prepared. Content of radioactive impurities in preparation does not exceed 10-5. Chemical yield of 237U is 70 %

  13. Pigmented villonodular synovitis: a retrospective multicenter study of 237 cases.

    Directory of Open Access Journals (Sweden)

    Guo-ping Xie

    Full Text Available To review clinical characteristics of pigmented villonodular synovitis (PVNS in China.Electronic medical records (EMR of four Chinese institutes were queried for patients with histologically proven PVNS between January 2005 and February 2014. Their data were collected including gender, age at diagnosis, clinical presentation, affected site, symptom duration, comorbidities, treatment strategy, recurrence and routine laboratories.A total of 237 patients with biopsy-proven PVNS were investigated. The gender ratio was 1.35 for a female predominance (101 males and 136 females. The average age was 36 years (range, 2 to 83 years. The median delay from initial clinical symptom to diagnosis was 18 months. Main affected areas were the knee (73.84% and the hip (18.14%. Forty patients had a clear history of joint trauma. Six patients were concurrently diagnosed with PVNS and avascular necrosis (AVN. Five patients suffered from PVNS following implantation of orthopaedic devices including artificial prosthesis, plate and wire. One hundred and twenty-nine patients underwent arthroscopic synovectomy and 108 open synovectomy. Altogether 48 patients (26 males and 22 females had recurrence of disease. The relapse rate was 24% (knee and 6.98% (hip, 20.93% (open surgery and 19.44% (arthroscopy, respectively. Erythrocyte sedimentation rate (ESR and C-reactive protein (CRP rate were elevated in 45.83% and 38.41% of the patients respectively.To our knowledge, this study is the largest sample size of PVNS patients reported as well as the largest sample of PVNS with concurrent AVN reported to date. Our outcomes suggest that PVNS shows a female predominance, occurs mostly between 20-40 years and favors the knee and hip. Recurrence is frequent, particularly in the knee. Serum ESR and CRP may be elevated in some patients. Additionally, the present study supports the theory of an association between PVNS and orthopedic surgery, which is not limited to joint replacement.

  14. 48 CFR 237.102-70 - Prohibition on contracting for firefighting or security-guard functions.

    Science.gov (United States)

    2010-10-01

    ... CONTRACTING SERVICE CONTRACTING Service Contracts-General 237.102-70 Prohibition on contracting for... by reason of a deployment. (b) Under Section 2907 of Public Law 103-160, this prohibition does...

  15. Status of the Neutron Capture Measurement on 237Np with the DANCE Array at LANSCE

    International Nuclear Information System (INIS)

    Neptunium-237 is a major constituent of spent nuclear fuel. Estimates place the amount of 237Np bound for the Yucca Mountain high-level waste repository at 40 metric tons. The Department of Energy's Advanced Fuel Cycle Initiative program is evaluating methods for transmuting the actinide waste that will be generated by future operation of commercial nuclear power plants. The critical parameter that defines the transmutation efficiency of actinide isotopes is the neutron fission-to-capture ratio for the particular isotope in a given neutron spectrum. The calculation of transmutation efficiency therefore requires accurate fission and capture cross sections. Current 237Np evaluations available for transmuter system studies show significant discrepancies in both the fission and capture cross sections in the energy regions of interest. Herein we report on 237Np (n,γ) measurements using the recently commissioned DANCE array

  16. Half-life measurement of heavy neutron-rich isotope 237Th

    International Nuclear Information System (INIS)

    The natural uranium targets are bombarded by 18O(60 MeV/u) ions, and the heavy neutron-rich isotope 237Th is produced through the multi-nucleon transfer reaction. A relatively fast radiochemical procedure is used to separate thorium from the uranium and complex reaction products mixture. The thorium fractions chemically separated are studied by off-line γ-ray spectroscopy using a HPGe detector coupled to a 4096 channel pulse-height analyzer. The growth-decay curve of 853.7 keV γ-ray from 237Pa (237Th daughter) are analyzed and the half-life of 237Th is determined to be 4.69 +- 0.60 min

  17. Production of $^{237}$U in the $^{238}$U ($\\gamma, n$) photonuclear reaction at the electron accelerator MT-25 microtron

    CERN Document Server

    Sabelnikov, A V; Gustova, M V; Belov, A G; Dmitriev, S N

    2004-01-01

    $^{237}$U was obtained in the $^{238}$U($\\gamma, n$) reaction at the electron accelerator MT-25 microtron of the FLNR of the JINR. The $^{237}$U radiation yield under experimental conditions amounted to 1 kBq/$\\mu $A$\\cdot $h$\\cdot$mg $^{238}$U. Capture of recoil atoms in a solid-solid system was used for isolation of $^{237}$U from the target material. Fluorides of chemical elements from I-III series of the Periodic Table of the Elements were used as $^{237}$U acceptors. The $^{237}$U isolation from radioactive impurities was realized by means of extraction and ion exchange. Specific activity of the $^{237}$U preparation was equal to 49500 kBq/mg $^{238}$U. The radioactive impurity content did not exceed 10$^{-6}$ Bq/Bq. The $^{237}$U chemical yield amounted to 70{\\%}.

  18. The discoveries of uranium 237 and symmetric fission — From the archival papers of Nishina and Kimura

    OpenAIRE

    IKEDA, Nagao

    2011-01-01

    Shortly before the Second World War time, Nishina reported on a series of prominent nuclear physical and radiochemical studies in collaboration with Kimura. They artificially produced 231Th, a member of the natural actinium series of nuclides, by bombarding thorium with fast neutrons. This resulted in the discovery of 237U, a new isotope of uranium, by bombarding uranium with fast neutrons, and confirmed that 237U disintegrates into element 93 with a mass number of 237. They also identified t...

  19. Analysis of Np-237 ENDF for the theortical interpretation of critical assembly experiments

    International Nuclear Information System (INIS)

    We report on the present status of our effort toward an improved Np-237 evaluated nuclear data file (ENDF). The aim here is to bridge the gap between calculated and observed k-eff values, as measured at the Np-U critical assembly at LANL, TA-18. As such, we perform a critical analysis of the existing body of experimental data and recommended evaluations. We are targeting in principal the fission nu-bar and cross section in Np-237, as well as the inelastic scattering which is particularly important since Np-237 is a threshold fissioner. This analysis will be employed in a future sensitivity study of the calculated k-eff with respect to variations of the afore mentioned nuclear data.

  20. Residue Val237 is critical for the enantioselectivity of Penicillium expansum lipase.

    Science.gov (United States)

    Tang, Lianghua; Su, Min; Chi, Liying; Zhang, Junling; Zhang, Huihui; Zhu, Ling

    2014-03-01

    The shape of the hydrophobic tunnel leading to the active site of Penicillium expansum lipase (PEL) was redesigned by single-point mutations, in order to better understand enzyme enantioselectivity towards naproxen. A variant with a valine-to-glycine substitution at residue 237 exhibited almost no enantioselectivity (E = 1.1) compared with that (E = 104) of wild-type PEL. The function of the residue, Val237, in the hydrophobic tunnel was further analyzed by site-directed mutagenesis. For each of these variants a significant decrease of enantioselectivity (E lipase. PMID:24338160

  1. 29 CFR 779.237 - Enterprise engaged in commerce or in the production of goods for commerce.

    Science.gov (United States)

    2010-07-01

    ... 29 Labor 3 2010-07-01 2010-07-01 false Enterprise engaged in commerce or in the production of goods for commerce. 779.237 Section 779.237 Labor Regulations Relating to Labor (Continued) WAGE AND... commerce or in the production of goods for commerce. Under section 3(s) the “enterprise” to be covered...

  2. 40 CFR 408.237 - Effluent limitations guidelines representing the degree of effluent reduction attainable by the...

    Science.gov (United States)

    2010-07-01

    ... control technology (BCT). 408.237 Section 408.237 Protection of Environment ENVIRONMENTAL PROTECTION... 40 Protection of Environment 28 2010-07-01 2010-07-01 true Effluent limitations guidelines... control technology (BCT). Except as provided in §§ 125.30 through 125.32, any existing point...

  3. 48 CFR 952.237-70 - Collective bargaining agreements-protective services.

    Science.gov (United States)

    2010-10-01

    ... collective bargaining agreements applicable to the work force under this contract, the Contractor shall use... 48 Federal Acquisition Regulations System 5 2010-10-01 2010-10-01 false Collective bargaining... Clauses 952.237-70 Collective bargaining agreements—protective services. As prescribed in 937.7040,...

  4. Photo fission cross-section of 232Th, 238U and 237Np

    International Nuclear Information System (INIS)

    In the present work, photo fission cross-section of 232Th, 238U and 237Np evaluated with the help of fission fragment angular distribution measurements by using Bremsstrahlung radiation from 7.4 MeV to 9.0 MeV have been carried out by employing high efficiency SSNTD technique

  5. A study of the multipolar composition of the electrofission cross section of 237Np

    International Nuclear Information System (INIS)

    The electrofission cross section for 237Np was measured over the energy range from 0,6 to 60,0 MeV. The multipolar composition of this cross section was investigated using the virtual photons formalism with three different techniques of analysis: unfolding and two versions of multiple parameter regression. (A.C.A.S.)

  6. Yeast Interacting Proteins Database: YGL237C, YOR047C [Yeast Interacting Proteins Database

    Lifescience Database Archive (English)

    Full Text Available YGL237C HAP2 Subunit of the heme-activated, glucose-repressed Hap2p/3p/4p /5p CCAAT-binding compl ... of the heme-activated, glucose-repressed Hap2p/3p/4p /5p CCAAT-binding complex, a transcriptional activa ...

  7. Yeast Interacting Proteins Database: YGL237C, YGR146C [Yeast Interacting Proteins Database

    Lifescience Database Archive (English)

    Full Text Available YGL237C HAP2 Subunit of the heme-activated, glucose-repressed Hap2p/3p/4p /5p CCAAT-binding compl ... of the heme-activated, glucose-repressed Hap2p/3p/4p /5p CCAAT-binding complex, a transcriptional activa ...

  8. Yeast Interacting Proteins Database: YGL237C, YLR423C [Yeast Interacting Proteins Database

    Lifescience Database Archive (English)

    Full Text Available YGL237C HAP2 Subunit of the heme-activated, glucose-repressed Hap2p/3p/4p /5p CCAAT-binding compl ... of the heme-activated, glucose-repressed Hap2p/3p/4p /5p CCAAT-binding complex, a transcriptional activa ...

  9. Yeast Interacting Proteins Database: YGL237C, YOR358W [Yeast Interacting Proteins Database

    Lifescience Database Archive (English)

    Full Text Available YGL237C HAP2 Subunit of the heme-activated, glucose-repressed Hap2p/3p/4p /5p CCAAT-binding compl ... of the heme-activated, glucose-repressed Hap2p/3p/4p /5p CCAAT-binding complex, a transcriptional activa ...

  10. Multimode approach to Am-241 and Np-237 fission induced by 660-MeV protons

    Czech Academy of Sciences Publication Activity Database

    Karapetyan, G. S.; Balabekyan, A. R.; Demekhina, N. A.; Adam, Jindřich

    2009-01-01

    Roč. 72, č. 6 (2009), s. 911-916. ISSN 1063-7788 R&D Projects: GA MŠk(CZ) LA08002 Institutional research plan: CEZ:AV0Z10480505 Keywords : FISSION * Am-241 * Np-237 Subject RIV: BG - Nuclear, Atomic and Molecular Physics, Colliders Impact factor: 0.539, year: 2009

  11. Reliable determination of 237Np in environmental solid samples using 242Pu as a potential tracer

    DEFF Research Database (Denmark)

    Qiao, Jixin; Hou, Xiaolin; Roos, Per;

    2011-01-01

    , thereby demonstrating the usefulness of 242Pu as a non-isotopic tracer for 237Np chemical yield monitoring. The on-column separation procedure fosters rapid analysis as required in emergency situations since each individual sample can be handled within 2.5h, and leads to a significant decrease in labor...

  12. 48 CFR 352.237-72 - Crime Control Act-requirement for background checks.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 4 2010-10-01 2010-10-01 false Crime Control Act... and Clauses 352.237-72 Crime Control Act—requirement for background checks. As prescribed in 337.103-70(c), the Contracting Officer shall insert the following clause: Crime Control Act of...

  13. Radiochemical determination of 237NP in soil samples contaminated with weapon grade plutonium

    Science.gov (United States)

    Antón, M. P.; Espinosa, A.; Aragón, A.

    2006-01-01

    The Palomares terrestrial ecosystem (Spain) constitutes a natural laboratory to study transuranics. This scenario is partially contaminated with weapon-grade plutonium since the burnout and fragmentation of two thermonuclear bombs accidentally dropped in 1966. While performing radiometric measurements in the field, the possible presence of 237Np was observed through its 29 keV gamma emission. To accomplish a detailed characterization of the source term in the contaminated area using the isotopic ratios Pu-Am-Np, the radiochemical isolation and quantification by alpha spectrometry of 237Np was initiated. The selected radiochemical procedure involves separation of Np from Am, U and Pu with ionic resins, given that in soil samples from Palomares 239+240Pu levels are several orders of magnitude higher than 237Np. Then neptunium is isolated using TEVA organic resins. After electrodeposition, quantification is performed by alpha spectrometry. Different tests were done with blank solutions spiked with 236Pu and 237Np, solutions resulting from the total dissolution of radioactive particles and soil samples. Results indicate that the optimal sequential radionuclide separation order is Pu-Np, with decontamination percentages obtained with the ionic resins ranging from 98% to 100%. Also, the addition of NaNO2 has proved to be necessary, acting as a stabilizer of Pu-Np valences.

  14. 50 CFR 23.7 - What office do I contact for CITES information?

    Science.gov (United States)

    2010-10-01

    ... plants (ii) Import of living plants from Canada at designated border ports (7 CFR 319.37-14(b) and 50 CFR... 50 Wildlife and Fisheries 6 2010-10-01 2010-10-01 false What office do I contact for CITES... FAUNA AND FLORA (CITES) Introduction § 23.7 What office do I contact for CITES information? Contact...

  15. Effect of DTPA on concentration ratios of 237Np and 244Cm in vegetative parts of bush bean and barley

    International Nuclear Information System (INIS)

    Bush beans (Phaseolus vulgaris L.) and barley (Hordeum vulgare L.) were grown in two different soils (noncalcareous and calcareous) in containers in a glasshouse with 530 pCi/g 237Np or 15040 pCi/g 244Cm mixed into separate containers of the soil. The chelating agent DTPA at 100 μg/g soil was added to one half of the containers. The concentration ratio (C.R.) without DTPA was two orders of magnitude higher for 237Np than for 244Cm by two and three orders of magnitude but had little influence on 237Np. For the calcareous soil with DTPA, 244Cm C.R.'s were greater than those for 237Np. In bush beans both 237Np and 244Cm C.R.'s were higher in primary leaves than in trifoliate leaves which were higher than for stems

  16. Role of once-daily glycopyrronium bromide (NVA237 in the management of COPD

    Directory of Open Access Journals (Sweden)

    D’Urzo A

    2013-08-01

    Full Text Available Anthony D'UrzoDepartment of Family and Community Medicine, University of Toronto, Toronto, ON, CanadaAbstract: Progressive airflow limitation is a hallmark feature of chronic obstructive pulmonary disease (COPD that ultimately leads to breathlessness, impaired quality of life, and reduced exercise capacity. Pharmacotherapy is used in patients with COPD to prevent and control symptoms, reduce both the frequency and severity of exacerbations, improve health status, and increase exercise tolerance. These strategies are intended to address management issues which promote both current disease control and a reduction in the risk of disease deterioration in the future. At the present time, long-acting β2-agonists (LABAs and long-acting muscarinic antagonists (LAMAs are available for maintenance therapy in patients with persistent symptoms. Tiotropium was the first LAMA to be approved for management of COPD, and many studies have described its beneficial effects on multiple clinically relevant outcomes. Glycopyrronium bromide (NVA237, a new LAMA, has been developed and received regulatory approval for management of COPD in a number of countries around the world. Results from pivotal Phase III trials suggest that NVA237 is safe and well tolerated in patients with moderate to severe COPD, and provides rapid and sustained improvements in lung function. Further, these changes are associated with statistically and clinically meaningful improvements in dyspnea, health-related quality of life, and exercise tolerance. Treatment with NVA237 also results in a significant reduction in risk of exacerbations and the need for rescue medication, and has been comparable with tiotropium with respect to safety and efficacy outcomes. Finally, emerging data indicate that NVA237 is efficacious both as monotherapy and in combination with indacaterol.Keywords: glycopyrronium bromide, NVA237, chronic obstructive pulmonary disease, inhaled long-acting bronchodilators

  17. Evaluation of 237Np reaction amount by chemical analysis of neptunium sample irradiated at experiment fast reactor 'JOYO'

    International Nuclear Information System (INIS)

    The chemical analysis technique was established to determine the nuclide generated in Neptunium (Np) sample with a high accuracy, to contribute to evaluation of transmutation characteristics of 237Np in the fast reactor. (1) Establishment of Chemical Analysis Technique. The chemical analysis technique containing determination technique of fission amount of 237Np, which was consist of Vanadium (V) of capsule material removal and Neodymium (Nd) recovery at high efficiency, was established with optimization of experimental conditions. Four Np samples irradiated in 'JOYO' were analyzed using this technique. Results were as follows. 237Np were determined with high accuracy (relative error was 2.2% at maximum). Errors of fission amount monitoring nuclides 148Nd were half less than that of 137Cs. Small amount of 236Pu was able to determined. (2) Evaluation of 237Np Reaction Amount. The reaction amount of capture, fission and (n, 2n) reactions were evaluated using analyzed values. Transmutation characteristics of 237Np were evaluated using reaction amount. Evaluated results were as follows. The ratio of capture or fission amount to unirradiated 237Np amount were 6.1 - 25.5 at%, 0.7 - 3.6 at%, respectively. The 237Np (n, 2n) 236mNp reaction amount was 7.0 x 10-6 times of 237Np amount at maximum. The dependences of 237Np reaction amount to neutron energy spectrum were revealed from the fact such as linearity of fission to capture reaction amount ratio against fast neutron ratio in same fuel assembly. (author)

  18. Measurement of the Thermal Neutron Capture Cross section of 237Np for the Study of Nuclear Transmutation

    International Nuclear Information System (INIS)

    Full text of publication follows: Accurate nuclear data of minor actinides are required for the study of nuclear transmutation of radioactive wastes. The 237Np is one of the most important minor actinides for this study because of its relatively large abundance in irradiated fuels. However, there are apparent discrepancies between the reported neutron capture cross sections of the 237Np for thermal neutrons. History on the measurements of the neutron capture cross section of 237Np for thermal neutrons is briefly presented first. Recent three data measured by a γ ray spectroscopic method are much smaller than those measured by other methods. To deduce the neutron capture cross section by an activation method with γ ray spectroscopy, the relevant γ-ray emission probabilities are used. These decay data could be an origin of the discrepancies on the neutron capture cross section of 237Np. To examine the hypothesis, we measured the relevant γ-ray emission probabilities of 233Pa and 238Np from the ratio of the emission rate to the activity. The obtained emission probabilities are used to correct the thermal neutron capture cross section of 237Np reported previously. The cross section is also independently determined by irradiating 237Np sample in the research reactor of Kyoto University and counting α rays emitted from 237Np and 238Pu with a Si detector. The measured emission probabilities of 233Pa and 238Np, and the neutron capture cross section of 237Np are compared with others from references. The results of the precise decay data explain the discrepancy on the neutron capture cross section of 237Np. Details of the experiments and results will be presented. (authors)

  19. Measurement of Delayed Neutron Yields from Thermal Neutron Induced Fission of $^{237}$Np

    CERN Document Server

    Gundorin, N A; Pikelner, L B; Revrova, N V; Salamatin, I M; Smirnov, V I; Zhdanova, K V; Zhuchko, V E

    2005-01-01

    This paper reports about the measurement of delayed neutron yields from a thermal neutron induced fission of $^{237}$Np. The method based on periodic irradiation of the sample in pulsed neutron beam with the subsequent registration of neutrons in intervals between pulses is used in the experiment. The method is realized on the "Isomer-M" installation, located on the channel of the IBR-2 pulsed reactor. A description of the installation and a technique of the experiment are presented, a thorough analysis of background processes is performed, results of measurements are shown in this paper. The value of delayed neutron yields from thermal neutron induced fission of $^{237}$Np obtained in the present investigation is $\

  20. Covalency of Neptunium(IV) organometallics from 237Np Moessbauer spectra

    International Nuclear Information System (INIS)

    The isomer shifts in 237Np Moessbauer spectra arise from the shielding of neptunium's 6s orbitals by the inner 5f orbitals. In covalent bonding, ligand contributions to the 5f electron density increase the shielding, and the 237Np isomer shift reflects differences in bond character among covalently bonded ligands. The large difference in isomer shift (3.8 cm/sec) between ionic Np(IV) and Np(III) compounds permits a good determination of ligand bonding differences in Np(IV) organometallic compounds. The Moessbauer spectra for about 20 Np(IV) organometallic compounds, principally cyclopentadienyl (Cp) compounds of the general composition Cp/sub x/Np chi/sub 4-x/ (x = 1,2,3; chi = Cl, BH4, /sup n/Bu, Ph, OR, acac), show both the differences in sigma bonding among the chi ligands, as well as the covalent effect of the Cp ligands

  1. Plutonium-237: an important research tool for studies of environmental plutonium kinetics

    International Nuclear Information System (INIS)

    The production and use of the photon-emitting isotope plutonium-237 in investigations of the uptake, retention, and distribution of monomeric plutonium (IV) both in an aquatic vertebrate, the channel catfish Ictalurus punctatus, and in a littoral aquatic micro-ecosystem, are presented. The rationale for use of plutonium-237 in environmental studies is discussed. Chelation can either enhance or reduce the uptake of ingested plutonium relative to plutonium hydroxide (monomer) in channel catfish. The highest observed retention (whole body) at 63 days was 3.8% of ingested dose for plutonium-237 citrate, while retention of the fulvate was 0.6%. Reduced uptake of the fulvate complex is due either to its high molecular weight (>10,000) or to its stability in metabolic systems. Increased uptake of plutonium-237 citrate is attributable to instability of the complex in metabolic systems. Tissue distribution studies revealed that relatively little (less than or equal to 10%) of intracardially injected plutonium citrate was excreted. Blood clearance rates were similar to those found in small mammals, with the plutonium being primarily associated with the plasma protein transferrin. The fractional body burdens in bone, liver, and kidney 17 days after injection were 31%, 24%, and 9% of the injection dose, respectively. High kidney burdens relativity to mammals are expected, since the kidney functions as the major site of homopoiesis in teleosts. Absence of significant excretion indicates that a short half-life component of elimination following gut clearance in gavage studies is due to plutonium labeling of the gut

  2. Electronic and structural properties of some ternary neptunium(VII) oxides from 237Np Moessbauer spectroscopy

    International Nuclear Information System (INIS)

    The 60 kev Moessbauer resonance of 237Np has been measured in some complex oxides of heptavalent neptunium. The nature of bonding and the molecular symmetry are discussed on the basis of the isomer shift and quadrupole coupling constant data. The molecular character of the compounds is evidenced by the low Debye temperatures and the strong bond covalency. The quadrupole coupling constant is temperature independent; this reveals the absence of any non-bonding states of f electrons. (authors)

  3. (237)Np(n,f) Cross Section: New Data and Present Status

    CERN Document Server

    Paradela, C; Carrapico, C; Eleftheriadis, C; Leeb, H; Calvino, F; Herrera-Martinez, A; Savvidis, I; Vlachoudis, V; Haas, B; Vannini, G; Le Naour, C; Gramegna, F; Wiescher, M; Pigni, M T; Audouin, L; Mengoni, A; Quesada, J; Becvar, F; Plag, R; Cennini, P; Mosconi, M; Duran, I; Rauscher, T; Couture, A; Capote, R; Sarchiapone, L; Vlastou, R; Domingo-Pardo, C; Dillmann, I; Pavlopoulos, P; Karamanis, D; Krticka, M; Jericha, E; Ferrari, A; Martinez, T; Trubert, D; Oberhummer, H; Karadimos, D; Plompen, A; Isaev, S; Terlizzi, R; Kaeppeler, F; Cortes, G; Cox, J; Voss, F; Pretel, C; Colonna, N; Berthoumieux, E; Vaz, P; Heil, M; Lopes, I; Lampoudis, C; Walter, S; Calviani, M; Gonzalez-Romero, E; Embid-Segura, M; Stephan, C; Igashira, M; Papachristodoulou, C; Aerts, G; Tavora, L; Berthier, B; Rudolf, G; Andrzejewski, J; Villamarin, D; Ferreira-Marques, R; Tain, J L; O'Brien, S; Gunsing, F; Reifarth, R; Perrot, L; Lindote, A; Neves, F; Poch, A; Kerveno, M; Rubbia, C; Koehler, P; Dahlfors, M; Wisshak, K; Salgado, J; Dridi, W; Ventura, A; Andriamonje, S; Assimakopoulos, P; Santos, C; Ferrant, L; Lozano, M; Patronis, N; Chiaveri, E; Guerrero, C; Kadi, Y; Vicente, M C; Praena, J; Baumann, P; Oshima, M; Rullhusen, P; Furman, W; David, S; Marrone, S; Tassan-Got, L; Cano-Ott, D; Pavlix, A; Alvarez-Velarde, F; Massimi, C; Mastinu, P; Pancin, J; Papadopoulos, C; Tagliente, G; Haight, R; Chepel, V; Kossionides, E; Badurek, G; Marganiec, J; Lukic, S; Tarrio, D; Alvarez, H

    2011-01-01

    In this document, we present the final result obtained at the n_TOF experiment; for the neutron-induced fission cross section of the (237)Np, from the fission threshold up to 1 GeV. The method applied to get tins result is briefly discussed. n_TOF data are compared to the last experimental measurements using other TOF facilities or the surrogate method, reported experiments performed with monoenergetic sources and the FISCAL systematic, including a discussion about the existing discrepancies.

  4. Proton-induced fission on 241Am, 238U and 237Np at intermediate energies

    OpenAIRE

    Deppman, A.; Andrade-II, E.; Guimaraes, V; Karapetyan, G. S.; Balabekyan, A. R.; Demekhina, N. A.

    2013-01-01

    Intermediate energy data of proton-induced fission on 241Am, 238U and 237Np targets were analysed and investigated using the computational simulation code CRISP. Inelastic interactions of protons on heavy nuclei and both symmetric and asymmetric fission are regarded. The fission probabilities are obtained from the CRISP code calculations by means of the Bohr-Wheeler model. The fission cross sections, the fissility and the number of nucleons evaporated by the nuclei, before and after fission, ...

  5. A simple and economic method for accurate determination of the energy peak efficiency of 208 keV γ-ray of 237U based on 241Pu/237U secular equilibrium

    International Nuclear Information System (INIS)

    A new method is developed for the determination of energy peak efficiency of 208 keV γ-ray of 237U based on 241Pu/237U secular equilibrium. Plutonium solution was purified to remove Am with Dowex 1 × 2 anion exchange chromatography and the concentration of 241Pu in the purified solution was determined using 242Pu isotope-dilution mass spectrometry on an inductively-coupled plasma mass spectrometry. The solution can be used as calibration source for the determination of energy peak efficiency of 208 keV γ-ray of 237U after 48 days. The method was validated for a planar HPGe detector at the 12 mm above the detector surface. The results showed that this is a simple and economic method for determining the energy peak efficiency of gamma detectors for 208 keV γ-ray of 237U. (author)

  6. 'n Nota oor die vertaling van Jeremia 2:37 ("Met jou hande op jou hoof"

    Directory of Open Access Journals (Sweden)

    H.F. Stander

    1998-08-01

    Full Text Available A note on the translation of Jeremiah 2:37 ("With your hands on your head" In Jeremiah 2:37 God says to Israel: "You will leave that place (= Egypt with your hands upon your head". In this article various Bible translations and commentaries are scrutinized to determine how modem exegetes interpret this phrase. Thereafter the author discusses Egyptian depictions of mourners in funeral processions with their hands on their heads. He shows how an exploration of Egyptian Art can contribute to a better understanding of Jeremiah 2:37. This study also shows that the two dynamic Afrikaans translations of the Bible ("Die Lewende Bybel" and "Die Nuwe Afrikaanse Vertaling" are wide off the mark in their interpretation of the phrase "with your hands on your head". The author also argues that exegetes should not only rely on written texts when they study the ancient world in which the Scriptures originated, but that they should also explore works of art.

  7. Measurements of neutron capture cross section of 237Np for fast neutrons

    International Nuclear Information System (INIS)

    The neutron capture cross section of 237Np has been measured for fast neutrons supplied at the center of the core in the Yayoi reactor. The activation method was used for the measurement, in which the amount of the product 238Np was determined by γ-ray spectroscopy using a Ge detector. The neutron flux at the center of the core calculated by the Monte Carlo simulation code MCNP was renormalized by using the activity of a gold activation foil irradiated simultaneously. The new convention is proposed in this paper to make possible a definite comparison of the integral measurement by the activation method using fast reactor neutrons with differential measurements using accelerator-based neutrons. 'Representative neutron energy' is defined in the convention at which the cross section deduced by the activation measurement has a high sensitivity. The capture cross section of 237Np corresponding to the representative neutron energy was deduced as 0.80±0.04 b at 214±9 keV from the measured reaction rate and the energy dependence of the cross section in the nuclear data library ENDF/B-VII.0. The deduced cross section of 237Np at the representative neutron energy agrees with the evaluated data of ENDF/B-VII.0, but is 15% higher than that of JENDL-3.3 and 13% higher than that of JENDL/AC-2008. (author)

  8. New experimental determination of the neutronic resonance parameters of 237Np below 500 eV

    International Nuclear Information System (INIS)

    For studies of future nuclear reactors dedicated to nuclear waste transmutation, an improvement of the accuracy of the neutron radiative capture cross section of 237Np appears necessary. In the framework of a collaboration between the Commissariat a l'Energie atomique (CEA) and Institute for Reference Materials and Measurement (IRMM, Geel, Bergium), a new determination of the resonance parameters of 237Np has been performed. Two types of experiments are carried out at GELINA, the IRMM pulsed neutron source, using the time of flight method: a transmission experiment which is related to the neutron total cross section and a capture experiment which gives the neutron radiative capture cross section. The resonance parameters presented in this work are extracted from the transmission data between 0 and 500 eV with the least square code REFIT, using the Reich-Moore formalism. In parallel, the Doppler effect is investigated. The commonly used free gas model appears inadequate below 20 eV for neptunium dioxide at room temperature. By the use of the program DOPUSH, which calculates the Doppler broadening with a harmonic crystal model according to Lamb's theory, we are able to produce abetter fit of the experimental data for the resonances of 237Np in NpO2 at low energy or temperatures. In addition to the resonance parameters, a study of their mean value and distribution is included in this work. (authors)

  9. Transmutation study of 237Np in energy + transmutation setup using 1.6 GeV deuteron-beam

    International Nuclear Information System (INIS)

    In this paper, the results of the measurement of cross sections of (n, γ) and (n, f) reactions of long lived fission fragment, Np237 have been presented in the mixed neutron environment of the E + T set up

  10. Radiochemical determination of Np-237 in soil samples contaminated with weapon grade plutonium

    International Nuclear Information System (INIS)

    The Palomares terrestrial ecosystem (Andalusia, southwestern Spain) is known to constitute a natural laboratory to study the distribution, behaviour and migration of certain actinides, such as plutonium, americium and neptunium. This scenario is partially contaminated with weapon grade plutonium since the burn-out and fragmentation of two of the four thermonuclear bombs accidentally dropped by a B-52 from the USA Air Force back in 1966. While performing radiometric measurements on the field, with the goal of gathering information about the surface contamination levels, the possible presence of 237Np was observed through its 29 keV gamma emission. To accomplish a more detailed characterization of the source term in the contaminated area using the isotopic ratios Pu-Am-Np, the radiochemical isolation and later quantification by alpha spectrometry of 237Np was initiated. As a first approach, a bibliographic study was undertaken, considering different radiochemical methods applied to a variety of samples such as soils, sediments, sea water, lichens, etc. The radiochemical procedure selected in our laboratory involves separation of neptunium from americium, uranium and plutonium with ionic resin (AG 1x2), given that in soil samples from Palomares 239+240Pu levels are several orders of magnitude higher than 237Np. Then neptunium is isolated using TEVA organic resin. After electro-deposition, quantification is performed by high resolution alpha spectrometry. Different analyses have been performed with blank solutions spiked with 236Pu, 237Np and 244Cm, solutions resulting from the total dissolution of isolated radioactive particles and soil samples. The lack of an appropriate tracer in our lab led to the determination of an average percentage of Np recovery using a certified solution of 237Np. Decontamination percentages obtained during the Pu-Np separation ranged from 98 % to 100 %. Some tests to investigate the effect of the addition or absence of NaNO2 (responsible for

  11. Structure of the Q237W mutant of HhaI DNA methyltransferase: an insight into protein-protein interactions

    OpenAIRE

    Dong, Aiping; Zhou, Lan; Zhang, Xing; Stickel, Shawn; Roberts, Richard J.; Cheng, Xiaodong

    2004-01-01

    We have determined the structure of a mutant (Q237W) of HhaI DNA methyltransferase, complexed with the methyl-donor product AdoHcy. The Q237W mutant proteins were crystallized in the monoclinic space group C2 with two molecules in the crystallographic asymmetric unit. Protein-protein interface calculations in the crystal lattices suggest that the dimer interface has the specific characteristics for homodimer protein-protein interactions, while the two active sites are spatially...

  12. New radiochemical methods for determination of 237Np a 241Pu using extraction chromatography (Presentation)

    International Nuclear Information System (INIS)

    Thesis was focused on the development of a new methodology for the separation of anthropogenic transuranium radionuclides 237Np a 241Pu from different kinds of matrices. The analytical methods used in this study were based on extraction chromatography and were optimized according to the sample type. The proposed radiochemical procedure is a combination of two algorithms, which represent the separation of radionuclides by using extraction chromatographic sorbents TEVA resin and TRU resin supplied by Eichrom Technologies LLC. 239Np a 237Np were selectively captured on sorbent TEVA resin in oxidation state 4+. TRU resin was used for purification of plutonium fraction from interfering americium radionuclide. 242Pu and 239Np radionuclides as tracers have been used to monitor the radiochemical yields of separation. Before every radiochemical separation tracer radionuclide 239Np was obtained by separation from the parent radionuclide 243Am, which is in radioactive equilibrium to 239Np. The average yield of chemical separation was 69,3% for 239Np at 277 keV energy line and 65,9% at 228 keV energy line. The NPL AH-B08069 (2008) samples which consist of the mixture of alpha-radionuclides were used for the modification and optimization of separation method used for separation of Np and Pu in model samples. This method provided high radiochemical yields of 239,240Pu (95,0 ± 3,5)% and 237Np (87,9 ± 3,0)%.. Reliability of the method was verified by applying our modified separation procedures on reference materials IAEA-375 and IAEA-414 supplied by International Atomic Energy Agency. A good agreement between the results is obtained by this procedure and the certified values were found. Samples of contaminated soils from the area of Nuclear power plant A-1 Jaslovske Bohunice which is stored temporarily before disposal were analyzed using developed separation procedure. Specific activity of investigated radionuclides was determined in these samples. (author)

  13. New radiochemical methods for determination of 237Np a 241Pu using extraction chromatography

    International Nuclear Information System (INIS)

    Thesis was focused on the development of a new methodology for the separation of anthropogenic transuranium radionuclides 237Np a 241Pu from different kinds of matrices. The analytical methods used in this study were based on extraction chromatography and were optimized according to the sample type. The proposed radiochemical procedure is a combination of two algorithms, which represent the separation of radionuclides by using extraction chromatographic sorbents TEVA resin and TRU resin supplied by Eichrom Technologies LLC. 239Np a 237Np were selectively captured on sorbent TEVA resin in oxidation state 4+. TRU resin was used for purification of plutonium fraction from interfering americium radionuclide. 242Pu and 239Np radionuclides as tracers have been used to monitor the radiochemical yields of separation. Before every radiochemical separation tracer radionuclide 239Np was obtained by separation from the parent radionuclide 243Am, which is in radioactive equilibrium to 239Np. The average yield of chemical separation was 69,3% for 239Np at 277 keV energy line and 65,9% at 228 keV energy line. The NPL AH-B08069 (2008) samples which consist of the mixture of alpha-radionuclides were used for the modification and optimization of separation method used for separation of Np and Pu in model samples. This method provided high radiochemical yields of 239,240Pu (95,0 ± 3,5)% and 237Np (87,9 ± 3,0)%.. Reliability of the method was verified by applying our modified separation procedures on reference materials IAEA-375 and IAEA-414 supplied by International Atomic Energy Agency. A good agreement between the results is obtained by this procedure and the certified values were found. Samples of contaminated soils from the area of Nuclear power plant A-1 Jaslovske Bohunice which is stored temporarily before disposal were analyzed using developed separation procedure. Specific activity of investigated radionuclides was determined in these samples. (author)

  14. RAPID SEPARATION METHOD FOR 237NP AND PU ISOTOPES IN LARGE SOIL SAMPLES

    Energy Technology Data Exchange (ETDEWEB)

    Maxwell, S.; Culligan, B.; Noyes, G.

    2010-07-26

    A new rapid method for the determination of {sup 237}Np and Pu isotopes in soil and sediment samples has been developed at the Savannah River Site Environmental Lab (Aiken, SC, USA) that can be used for large soil samples. The new soil method utilizes an acid leaching method, iron/titanium hydroxide precipitation, a lanthanum fluoride soil matrix removal step, and a rapid column separation process with TEVA Resin. The large soil matrix is removed easily and rapidly using this two simple precipitations with high chemical recoveries and effective removal of interferences. Vacuum box technology and rapid flow rates are used to reduce analytical time.

  15. Yeast Interacting Proteins Database: YGL237C, YBL021C [Yeast Interacting Proteins Database

    Lifescience Database Archive (English)

    Full Text Available YGL237C HAP2 Subunit of the heme-activated, glucose-repressed Hap2p/3p/4p /5p CCAAT-binding compl ... of the heme-activated, glucose-repressed Hap2p/3p/4p /5p CCAAT-binding complex, a transcriptional activa ... of the heme-activated, glucose-repressed Hap2p/3p/4p /5p CCAAT-binding complex, a transcriptional activa ... of the heme-activated, glucose-repressed Hap2p/3p/4p /5p CCAAT-binding complex, a transcriptional activa ...

  16. Study of 237Np photonuclear reactions near threshold, induced by gamma rays from thermal neutron capture

    International Nuclear Information System (INIS)

    The photodisintegration of 237Np has been studied using monochromatic photons produced by thermal neutron capture in several materials. The partial cross sections σ gamma, sub(f) and σ gamma, sub(n) were measured in the energy interval from 5.43 MeV to 10.83 MeV. Analysing the photofission data according to the liquid drop model, the height (E sub(f)) and the curvature ((h/2π)ω) of the simple fission barrier were determined: E sub(f) = (5.9 +- 0.2) MeV and (h/2π)ω = (0.8 +- 0.4) MeV. For the competition between photoneutron emission and fission (GAMMA sub(n) / GAMMA sub(f) a constant value was found (1.28+- 0.15) in the energy range 6.73 - 10.83 MeV. From this result the following nuclear temperatures for 237Np were extracted on bases of some models of levels density: T = 0.84 +- 0.06 MeV (Fujimoto-Yamaguchi model) and T = 0.60 +- 0.04 MeV (Constant Nuclear temperature model). (Author)

  17. Deducing the 237U(n,f) cross-section using the Surrogate Ratio Method

    Energy Technology Data Exchange (ETDEWEB)

    Burke, J T; Bernstein, L A; Escher, J; Ahle, L; Church, J A; Dietrich, F; Moody, K J; Norman, E B; Phair, L W; Fallon, P; Clark, R; Delaplanque, M; Descovich, M; Cromaz, M; Lee, I Y; Macchiavelli, A O; McMahan, M A; Moretto, L G; Rodriguez-Vieitez, E; Stephens, F S

    2005-08-16

    The authors have deduced the {sup 237}U(n,f) cross-section over an equivalent neutron energy range of 0 to 20 MeV using the Surrogate Ratio method. A 55 MeV {sup 4}He{sup 2+} beam from the 88 Inch Cyclotron at Lawrence Berkeley National Laboratory was used to induce fission in the following reactions {sup 238}U({alpha},{alpha}'f) and {sup 236}U({alpha},{alpha}'f). The {sup 238}U reaction was a surrogate for {sup 237}U(n,f) and the {sup 236}U reaction was used as a surrogate for {sup 235}U(n,f). The energies of the scattered alpha particles were detected in a fully depleted segmented silicon telescope array (STARS) over an angle range of 35{sup o} to 60{sup o} with respect to the beam axis. The fission fragments were detected in a third independent silicon detector located at backward angles between 106{sup o} to 131{sup o}.

  18. Isomeric ratio and cross section of the 237Np(n, 2n) reaction

    International Nuclear Information System (INIS)

    It has been shown that on the basis of the Hauser-Feshbach theory, and taking into account the law of the conservation of moment, the isomer ratio for the reaction 237Np (n, 2n) can be calculated. The indeterminateness of the modeling of the 236Np level scheme, to all appearances, has little effect on the energy dependence of the isomeric ratio. The error in the calculated cross section for the (n, 2n) reaction is determined chiefly by the error in the experimental data on the isomeric ratio and on the cross section for the formation of the short-lived state. Obtaining a correct estimate of the error is made difficult by the scarcity of experimental data on the isomeric ratio. The results of this work can be useful in practical activity when combined with an estimate of the cross sections and the creation of a complete system of neutron cross sections for 237Np. Theoretical estimates of the cross sections can to a significant extent compensate for the scarcity and indeterminateness of the experimental data

  19. Subcellular localization of neptunium-237 in lung and kidney after intratracheal administration in the rat: An ultrastructural and microanalytical study

    International Nuclear Information System (INIS)

    Chronic intratacheal administration of 237Np to rats was performed during 6 weeks. The total dose administered was 45.8 kBq. Two methods, electron microscopy and electron probe X-ray microanalysis, were used to determined the intracellular sites of localization of 237Np. Clusters of dense granules were observed in nuclei of pneumocytes and proximal tubular cells of the kidneys. These clusters have been shown to contain neptunium associated with phosphorus, sulfur and calcium. Alternations of nuclei and ultrastructural cytoplasmic lesions were observed. The absorbed doses in lungs and kidneys were very low. These results suggest that the chemical toxicity of 237Np is more important than its radiological toxicity. 30 refs., 2 figs

  20. The inhalation of insoluble iron oxide particles in the sub-micron ranges. Part II - Plutonium-237 labelled aerosols

    International Nuclear Information System (INIS)

    The results of a series of inhalation studies using iron oxide particles in the size range 0.1 to 0.3 um (count median diameter) are described. In this series the aerosols were labelled with plutonium 237. In vivo detection, excretion analysis and crude location studies were obtainable and the results compared to the earlier studies using chromium 51 labelled aerosols. Plutonium 237 can be considered as a simulator for plutonium 239 and attempts are made to extrapolate the results to the problem of the estimation of plutonium 239 in the human lung. (author)

  1. Transfer of 241Am and 237Pu from euphausiid moults to a carbonate-rich marine sediment

    International Nuclear Information System (INIS)

    Concentrations of 241Am and 237Pu adsorbed onto moulted exoskeletons from the euphausiid Meganyctiphanes norvegica decreased exponentially with 50% retention times of 3-7 d when moults were incubated in filtered seawater with small amounts of carbonate-rich sediment. Over 95% of sediment weight was present as -2) was greatest in the medium-fine sand fraction which had the highest carbonate content. These particles constituted -2 surface: atoms μm-3 in solution) was 103-104 times higher than similar quotients for 241Am and 237Pu sorbed to surfaces of organic particles are transferred to sediments. (author)

  2. Identification of Nilsson orbitals in the superdeformed minimum of 237Pu

    International Nuclear Information System (INIS)

    In this thesis, a spectroscopy experiment in the second minimum of the double humped fission barrier of 237Pu is presented, in which, for the first time, single - particle states for a neutron - rich shape isomer with odd neutron number were identified and characterised by their Nilsson quantum numbers. While rotational (236fU and 240fPu) and vibrational excitations (240fPu) had already been identified earlier in the even-even neighbouring nuclei, now the fission isomers in 237Pu (t1/2=115 ns/1.12 μs) were investigated in a γ-spectroscopy experiment at the Cologne Tandem accelerator. Using the 235U(α,2n) reaction with a pulsed R beam, states in the second minimum were populated. Following the prompt decay of excited states into the ground states of the two shape isomers, the nucleus decays with its halflife, the resulting fission fragments were detected in a specially built 4π parallel plate detector. The extremely rare isomeric γ decays were measured in coincidence with the fission fragments using the highly efficient MINIBALL spectrometer. The background-subtracted γ-ray spectrum was disentangled into contributions from the two shape isomers and 9 excited rotational bands were identified built on the ground states of the two isomers. The ground state spins of the two shape isomers were determined to be I=5/2 (115 ns isomer) and I=9/2 (1120 ns isomer). From the 149 identified γ transitions, independent level schemes were constructed for the two fission isomers in 237Pu. The consistency of these level schemes was supported by the connecting γ transitions between rotational bands. Furthermore, both level schemes could be combined to a common level scheme, in which the ground state of the long-lived 9/2 isomer was placed 54.0(3) keV above the ground state of the short-lived 5/2 isomer. The resulting level scheme was compared to Hartree-Fock-Bogolyubov single-particle calculations, Nilsson model and Woods-Saxon potential calculations. This comparison allowed

  3. Kinetics of intracardially injected plutonium-237 citrate in channel catfish (Ictalurus punctatus)

    International Nuclear Information System (INIS)

    Plutonium-237 distribution and translocation in channel catfish following intracardial injection are basically similar to patterns in mammals after intravenous administration. Bone and liver are the dominant contributors to the body burden. The fractional body burdens in bone, liver and kidney 17 days after injection were 31, 24 and 9% of the injected dose, respectively. High kidney burdens relative to mammals are expected since the kidney functions as the major site of hemopoeisis in teleosts. The observation of high concentrations in some ovaries, coupled with apparent polymorphism in plutonium-binding plasma proteins, suggests that some aspects of plutonium transport in blood plasma, of lower vertebrates may differ significantly from the mammals. Excretion over the 17-day period was <= 10%. The absence of significant excretion indicates that a short half-life component of elimination following gut clearance in earlier gavage studies is due to plutonium labelling of the gut. (author)

  4. The Separation and Measurement of Np( Ⅴ, Ⅵ) and Its Daughter 237Pa

    Institute of Scientific and Technical Information of China (English)

    2001-01-01

    By means of liquid scintillation measurement of the Np sample solution which reaches 237Np-233Pa equilibrium with its daughter Pa, the detection efficiency of low energy y spectrum at 28.54, 86.59 and 311.98 keV are obtained. Using these data, the separation of different valence of Np from its daughter Pa is studied. The initial valence of Np is Np(Ⅴ) in solution. In order to compare the separation results, H2O2 is used to prepare Np( Ⅴ). Np(Ⅵ) is prepared by K2Cr2O7 and concentrated HNO3, respectively. TTA and/or TOPO and the back-extraction of them are used to separate Np and Pa. It indicates that initial Np( Ⅴ ) can be separated by TTA or TOPO, and the Np

  5. Study of the excited levels of 233Pa by the 237Np alpha decay

    International Nuclear Information System (INIS)

    The excited levels in 233Pa following the 237Np alpha decay have been studied, by performing different experiences to complete available data and supply new information. Thus, two direct alpha spectrum measurement, one alpha-gamma bidimensional coincidence experiment, three gamma-gamma and gamma-X ray coincidences and some other measurements of the gamma spectrum, direct and coincident with alpha-particles have been made. These last experiences have allowed to obviate usual radiochemical separation methods, the 233Pa radioactive descendent interferences being eliminated by means of the coincidence technic. As a result, a primary decay scheme has been elaborated, including 15 new gamma transitions and two new levels, not observed in the most recent works. (Author) 60 refs

  6. Identification of Nilsson orbitals in the superdeformed minimum of {sup 237}Pu

    Energy Technology Data Exchange (ETDEWEB)

    Morgan, Thomas James

    2008-03-31

    In this thesis, a spectroscopy experiment in the second minimum of the double humped fission barrier of {sup 237}Pu is presented, in which, for the first time, single - particle states for a neutron - rich shape isomer with odd neutron number were identified and characterised by their Nilsson quantum numbers. While rotational ({sup 236f}U and {sup 240f}Pu) and vibrational excitations ({sup 240f}Pu) had already been identified earlier in the even-even neighbouring nuclei, now the fission isomers in {sup 237}Pu (t{sub 1/2}=115 ns/1.12 {mu}s) were investigated in a {gamma}-spectroscopy experiment at the Cologne Tandem accelerator. Using the {sup 235}U({alpha},2n) reaction with a pulsed R beam, states in the second minimum were populated. Following the prompt decay of excited states into the ground states of the two shape isomers, the nucleus decays with its halflife, the resulting fission fragments were detected in a specially built 4{pi} parallel plate detector. The extremely rare isomeric {gamma} decays were measured in coincidence with the fission fragments using the highly efficient MINIBALL spectrometer. The background-subtracted {gamma}-ray spectrum was disentangled into contributions from the two shape isomers and 9 excited rotational bands were identified built on the ground states of the two isomers. The ground state spins of the two shape isomers were determined to be I=5/2 (115 ns isomer) and I=9/2 (1120 ns isomer). From the 149 identified {gamma} transitions, independent level schemes were constructed for the two fission isomers in {sup 237}Pu. The consistency of these level schemes was supported by the connecting {gamma} transitions between rotational bands. Furthermore, both level schemes could be combined to a common level scheme, in which the ground state of the long-lived 9/2 isomer was placed 54.0(3) keV above the ground state of the short-lived 5/2 isomer. The resulting level scheme was compared to Hartree-Fock-Bogolyubov single

  7. Improvement of evaluated neutron nuclear data for 237Np and 241Am

    International Nuclear Information System (INIS)

    The nuclear data of 237Np and 241Am that are particularly important among the minor actinides were investigated by comparing JENDL-3.2 with the recent evaluated data and available experimental data. As a result of the study, several defects of JENDL-3.2 data were revealed. They were improved on the basis of experimental data or recent evaluated data. For the both nuclides, main quantities revised in the present work were the resonance parameters, cross sections, angular and energy distributions of secondary neutrons, number of neutrons per fission. The data were given in the neutron energy range from 10-5 eV to 20 MeV, and compiled in the ENDF-6 format. (author)

  8. Neutron-Induced Fission of Actinium-227, Protactinium-231 and Neptunium-237: Mass Distribution

    International Nuclear Information System (INIS)

    Results of radiochemical studies on the mass distribution in the neutron-induced fission of actinium-227, protactinium-231 and neptunium-237 have been presented. This work has been carried out as part of a programme to determine the mass distribution in the fission of heavy elements as a function of Z and A. All irradiations have been carried out in the core of the swimming-pool type reactor APSARA with cadmium shielding wherever necessary. Relative yields of several fission product nuclides have been obtained by a method involving a comparison of the fission product activities from the respective targets with those formed from uranium-235 simultaneously irradiated. Thermal-neutron fission yields of uranium-235 have been assumed. These results indicate a predominantly asymmetric mass distribution in all the three cases, and also a distinct though small symmetric peak in the case of actinium-227. (author)

  9. Radiation halos and hydrocarbon reservoirs: a review. [Review of 237 references

    Energy Technology Data Exchange (ETDEWEB)

    Armstrong, F.E.; Heemstra, R.J.

    1973-01-01

    237 papers on radiometric prospecting, which is the measurement of naturally occurring radioactivity in the earth's surface and its application to petroleum and natural gas exploration are reviewed. Many theories and documented surveys are listed in both support and refutation of this reported phenomenon, and the Bureau of Mines is conducting research to obtain direct field information in order to determine the credibility of a radiometric method of predicting petroleum accumulation. Proof of the existence of a ''radiation halo'' surrounding oilfields and gasfields would obviously be a valuable step forward in petroleum exploration. Intimate knowledge of such a phenomenon would be a prerequisite to its general application as a prospecting tool for petroleum.

  10. Measurements of fast neutron-induced fission data of Np-237

    Energy Technology Data Exchange (ETDEWEB)

    Win, Than; Saito, Keiichiro; Baba, Mamoru; Iwasaki, Tomohiko; Ibaraki, Masanobu; Miura, Takako; Sanami, Toshiya; Nauchi, Yasushi; Hirakawa, Naohiro [Tohoku Univ., Sendai (Japan). Faculty of Engineering

    1998-03-01

    We have performed the following measurements for {sup 237}Np using the 4.5 MV Dynamitron accelerator of Tohoku University as the pulsed neutron source: (1) Prompt fission neutron spectrum for 0.62 MeV incident neutrons, and (2) Neutron-Induced fission cross-section between 10 and 100 keV. The prompt fission neutron spectrum was measured using TOF method with a heavily shielded NE213 scintillation detector. The Maxwellian temperature T{sub m} derived is 1.28 MeV, which is lower than that of 1.38 MeV in JENDL-3.2. The fission cross sections were measured between 10 - 100 keV. The results are between JENDL-3.2 and ENDF/B-VI. (author)

  11. A comparative study of the carcinogenetic effects of 241Am, 239Pu and 237Np

    International Nuclear Information System (INIS)

    In this experiment, 420 wistar rats were used to study the comparative carcinogenetic effects of 241Am, 239Pu and 237Np. These nuclides were injected to animals intravenously, subcutaneously or directly into the lung (Stansen's lung puncture method) in doses of 1.0, 5.0 and 8.5 μCi/kg, respectively. As soluble nitrate, the nuclides were rapidly transfered from the site of injection into the bone and the liver. Osteosarcomas were found in some animals 8 months to one year after intoxication. Diagnosis of osteosarcoma is based on the histopatological examination and X-ray photography. In the Am-poisoned rats the incidence of osteosarcoma is about 31-74%, varied with different doses and different routes of intoxication; in Pu-poisoned rats, the incidence of osteosarcoma is about 55-66%. while in Np-poisoned rats, it is about 36-53%. Primary lung cancers were also found in those animals poisoned by means of Stansen's lung puncture method with the above three nuclides. The incidence of primary lung cancers is about 6% in Am-and Pu-poisoned rats and 13% in Np-poisoned rats. The incidence of metastasis of osteosarcoma in lung is about 25-65% for Am-poisoned rats, 45-55% for Pu-poisoned rats and 41-80% for Np-poisoned rats. The life-span of above poisoned rats was significantly shorter than that of the normal control animals. The chemical weight for 241Am, 239Pu and 237Np in same unit of radioactivity (1.0 μCi) equals to 0.308 μg, 15.9 μg and 1418.7 μg, respectively. For this reason, we have to pay more attention to the chemical mass effect in carcinogenesis of the above three nuclides

  12. Measurements of delayed neutron parameters for U-235 and Np-237

    Energy Technology Data Exchange (ETDEWEB)

    Loaiza, D.

    1997-07-01

    Delayed neutrons are emitted by excited nuclei formed in beta decay of fission products called delayed neutron precursors. About 1% of the total neutrons released in fission are delayed neutrons; however, this small fraction plays an important role in nuclear reactor control. The delayed neutrons determine the time-dependent behavior of reactors, and knowledge of parameters used to predict neutron emission rate is essential for establishing reactivity worths. The delayed neutron yields, decay constants, and the absolute yield for the six-group delayed neutrons have been measured for U-235 and Np-237. This experiment has been called for in the forecast of experiments needed to support operations in the US. The bare U-235 metal assembly Godiva IV at the Los Alamos Critical Experiment Facility (LACEF) provided the source of neutrons. Godiva IV generated about 10{sup 7} total fissions in the samples for the infinite and instantaneous irradiation needed to accentuate the shorter and longer-lived groups of delayed neutrons. The detection system used in the experiment consisted of 20 He-3 tubes embedded in a polyethylene cylinder. The delayed neutron activity resulting from the fast neutron-induced fission has been measured. The measured absolute yield for U-235 was determined to be 0.0163 {+-} 0.009 neutrons/fission. This value compares very well with the well-established Keepin absolute yield of 0.0165 {+-} 0.0005. The newly measured absolute yield value for Np-237 was 0.0126 {+-} 0.0007, which compares well to the recently reported value of 0.0129 {+-} 0.0004 by Saleh and Parish. The measured values for U-235 are corroborated with period (e-folding time) versus reactivity calculations.

  13. Production of plutonium tracers in Np-237 nuclear reactions with He-3-ions in the energy range from 26 to 60 MeV

    NARCIS (Netherlands)

    Aaltonen, J; Dendooven, P; Gromova, EA; Jakovlev, VA; Trzaska, WH

    1998-01-01

    Cross-sections for the reaction Np-237 + He-3 --> Pu-236,Pu-237,Pu-238 at He-3 bombarding energies from 26 to 60 MeV were measured. Thick-target yields, based on the measured and previously known cross-sections were constructed. The results are discussed and compared with Ether reactions leading to

  14. Measurement of the fission cross-section ratio for 237Np/235U around 14 MeV neutron energies

    International Nuclear Information System (INIS)

    Fission cross-section ratio was determined for 237Np/235U around 14 MeV neutron energies with a back-to-back ionization chamber. Neutrons were produced by a 180 KV accelerator using T(d,n)4He reaction. No significant energy dependence was found in the cross section ratio

  15. DETERMINATION OF 237NP AND PU ISOTOPES IN LARGE SOIL SAMPLES BY INDUCTIVELY COUPLED PLASMA MASS SPECTROMETRY

    Energy Technology Data Exchange (ETDEWEB)

    Maxwell, S.

    2010-07-26

    A new method for the determination of {sup 237}Np and Pu isotopes in large soil samples has been developed that provides enhanced uranium removal to facilitate assay by inductively coupled plasma mass spectrometry (ICP-MS). This method allows rapid preconcentration and separation of plutonium and neptunium in large soil samples for the measurement of {sup 237}Np and Pu isotopes by ICP-MS. {sup 238}U can interfere with {sup 239}Pu measurement by ICP-MS as {sup 238}UH{sup +} mass overlap and {sup 237}Np via {sup 238}U peak tailing. The method provides enhanced removal of uranium by separating Pu and Np initially on TEVA Resin, then transferring Pu to DGA resin for additional purification. The decontamination factor for removal of uranium from plutonium for this method is greater than 1 x 10{sup 6}. Alpha spectrometry can also be applied so that the shorter-lived {sup 238}Pu isotope can be measured successfully. {sup 239}Pu, {sup 242}Pu and {sup 237}Np were measured by ICP-MS, while {sup 236}Pu and {sup 238}Pu were measured by alpha spectrometry.

  16. Neutron capture cross section measurement of Np-237 below 10 keV by linac time-of-flight method

    Energy Technology Data Exchange (ETDEWEB)

    Lee, Samyol; Yamamoto, Shuji; Cho, Hyun-Je; Yoshimoto, Takaaki; Kobayashi, Katsuhei; Fujita, Yoshiaki [Kyoto Univ., Kumatori, Osaka (Japan). Research Reactor Inst; Ohkawachi, Yasushi [Japan Nuclear Cycle Development Inst., Oarai, Ibaraki (Japan). Oarai Engineering Center

    2001-03-01

    The neutron capture cross section of {sup 237}Np has been measured in the energy region from 0.01 eV to 10 keV by using the neutron time-of-flight (TOF) method with a 46 MeV electron linear accelerator (linac) at the Research Reactor Institute, Kyoto University (KURRI). A pair of C{sub 6}D{sub 6} scintillation detectors, which was placed at a distance of 12.0 {+-} 0.02 m from the pulsed neutron source, was employed for the prompt capture gamma-ray measurement from the {sup 237}Np sample. The measured result has been normalized to the reference value of the {sup 237}Np(n,{gamma}){sup 238}Np reaction in ENDF/B-VI at 0.0253 eV. The existing experimental and the evaluated capture cross sections in ENDF/B-VI and JENDL-3.2 have been compared with the present measurement. For the neutron capture cross section of {sup 237}Np, the data by Weston et al. and the evaluated data are in good agreement with the present measurement. However, the data by Hoffman et al. are obviously lower in the relevant energy region. The data, which were measured before using a lead slowing-down spectrometer at KURRI, have been in good agreement with the data obtained by energy-broadening the present TOF measurement. (author)

  17. Development of ionization technique for measurement of fast neutron induced fission products yields of {sup 237}Np

    Energy Technology Data Exchange (ETDEWEB)

    Goverdovski, A.A.; Khryachkov, V.A.; Ketlerov, V.V.; Mitrofanov, V.F.; Ostapenko, Yu.B.; Semenova, N.N.; Fomichev, A.N.; Rodina, L.F. [Institute of Physics and Power Engineering, Obninsk (Russian Federation)

    1997-03-01

    Twin gridded ionization chamber and corresponding software was designed for measurements of masses, kinetic energies and nuclear charges of fission fragments from fast neutron induced fission of {sup 237}Np. The ionization detector design, electronics, data acquisition and processing system and the test results are presented in this paper. (J.P.N.)

  18. Once-daily NVA237 improves exercise tolerance from the first dose in patients with COPD: the GLOW3 trial

    Directory of Open Access Journals (Sweden)

    Beeh KM

    2012-07-01

    Full Text Available Kai M Beeh,1 Dave Singh,2 Lilla Di Scala,3 Anton Drollmann31insaf Respiratory Research Institute, Wiesbaden, Germany; 2University Of Manchester, Medicines Evaluation Unit, University Hospital of South Manchester, Manchester, UK; 3Novartis Pharma AG, Basel, SwitzerlandIntroduction: Exercise limitation, dynamic hyperinflation, and exertional dyspnea are key features of symptomatic chronic obstructive pulmonary disease (COPD. We assessed the effects of glycopyrronium bromide (NVA237, a once-daily, long-acting muscarinic antagonist, on exercise tolerance in patients with moderate to severe COPD.Methods: Patients were randomized to a cross-over design of once-daily NVA237 50 µg or placebo for 3 weeks, with a 14-day washout. Exercise endurance, inspiratory capacity (IC during exercise, IC and expiratory volumes from spirometry, plethysmographic lung volumes, leg discomfort and dyspnea under exercise (Borg scales, and transition dyspnea index were measured on Days 1 and 21 of treatment. The primary endpoint was endurance time during a submaximal constant-load cycle ergometry test on Day 21.Results: A total of 108 patients were randomized to different treatment groups (mean age, 60.5 years; mean post-bronchodilator, forced expiratory volume in 1 second [FEV1] 57.1% predicted. Ninety-five patients completed the study. On Day 21, a 21% difference in endurance time was observed between patients treated with NVA237 and those treated with placebo (P < 0.001; the effect was also significant from Day 1, with an increase of 10%. Dynamic IC at exercise isotime and trough FEV1 showed significant and clinically relevant improvements from Day 1 of treatment that were maintained throughout the study. This was accompanied by inverse decreases in residual volume and functional residual capacity. NVA237 was superior to placebo (P < 0.05 in decreasing leg discomfort (Borg CR10 scale on Day 21 and exertional dyspnea on Days 1 and 21 (transition dyspnea index and Borg CR

  19. Impact of fission product partitioning and transmutation of Np-237, I-127 and Tc-99 on waste disposal strategies

    International Nuclear Information System (INIS)

    From the point of view of waste management, three isotopes 237Np, 129I and 99Tc deserve particular attention since they cannot be confined within any presently known geological barrier. The safety assessment studies showed that 129I diffuses through 50 m of clay after 5000 years and creates a radiological burden which is superior to the other nuclides. 99Tc and 237Np emerge much later (million years) but cannot be confined in the repository. Separation of 237Np is already envisaged by the reprocessing plants and small modifications to the PUREX process permit to separate this nuclide quantitatively. However, the overall Np reduction factor cannot be higher than 3 to 4 because 237Np is formed by alpha-decay of 241Am which is immobilized in the glass. The irradiation technology to transmute 237Np into 238Pu is available. Iodine is separated from the dissolver off-gases in the reference fuel cycle and could be transformed into a stable Ba(IO3)2 matrix which can serve as irradiation 1291 matrix to destroy. Technetium is produced as insoluble residue and occurs in the waste streams together with Ru, Rh and Pd. Its recovery is still questionable and needs further developments. Irradiation of small targets in HFRs can lead to a 90% transmutation of these long-lived isotopes but the irradiation periods (particularly for 129I) are very long. The present HFR generation is not designed to handle large amounts of long-lived radionuclides and new more powerful units ought to be designed for that purpose. (author)

  20. Impact of fission product partitioning and transmutation of Np-237, I-127 and Tc-99 on waste disposal strategies

    Energy Technology Data Exchange (ETDEWEB)

    Beatsle, L.H. [Studiecentrum voor Kernenergie - Centre d' Etude de l' Energie Nucleaire (SCK-CEN), Mol (Belgium)

    1991-07-01

    From the point of view of waste management, three isotopes {sup 237}Np, {sup 129}I and {sup 99}Tc deserve particular attention since they cannot be confined within any presently known geological barrier. The safety assessment studies showed that {sup 129}I diffuses through 50 m of clay after 5000 years and creates a radiological burden which is superior to the other nuclides. {sup 99}Tc and {sup 237}Np emerge much later (million years) but cannot be confined in the repository. Separation of {sup 237}Np is already envisaged by the reprocessing plants and small modifications to the PUREX process permit to separate this nuclide quantitatively. However, the overall Np reduction factor cannot be higher than 3 to 4 because {sup 237}Np is formed by alpha-decay of {sup 241}Am which is immobilized in the glass. The irradiation technology to transmute {sup 237}Np into {sup 238}Pu is available. Iodine is separated from the dissolver off-gases in the reference fuel cycle and could be transformed into a stable Ba(IO{sub 3}){sub 2} matrix which can serve as irradiation 1291 matrix to destroy. Technetium is produced as insoluble residue and occurs in the waste streams together with Ru, Rh and Pd. Its recovery is still questionable and needs further developments. Irradiation of small targets in HFRs can lead to a 90% transmutation of these long-lived isotopes but the irradiation periods (particularly for {sup 129}I) are very long. The present HFR generation is not designed to handle large amounts of long-lived radionuclides and new more powerful units ought to be designed for that purpose. (author)

  1. 237Np在破碎凝灰岩和凝灰质砂上的吸附研究%STUDY OF 237Np ADSORPTION ON CRUSHED TUFF AND TUFFACEOUS SAND

    Institute of Scientific and Technical Information of China (English)

    王旭东; 田中忠夫; 武部慎一

    2001-01-01

    The adsorption characteristics of 237Np on crushed tuff andtuffaceous sand from northeast Japan have been studied using sequential extraction analysis technique. With a large difference in cation exchange capacity (CEC), both materials show nearly same sorptivity for 237Np. Together with dominance of ion exchange processes in sorption indicated by sequential extraction analysis, it suggests an absence of specific sorption at sites of this kind. It's interesting to find that sorption on Fe-Mn oxyhydroxide-oxides, defined by our sequential extraction procedure, almost keep constant for both cases, without time dependency. A potential mechanism of surface chemical reaction is deduced. Kinetics with respect to exchangeable and residual portions in tuff and fuffaceous sand confirms that some slow processes are controlling radionuclide sorption.%用连续提取法研究了237Np在破碎凝灰岩和凝灰质砂上的吸附。研究结果表明,48h以后,2种介质对237Np的吸附百分数相近,而且吸附的237Np在各相间的分布均以离子交换态为主。凝灰岩和凝灰质砂的阳离子交换容量差异显著,说明离子交换作用仅发生在粘土矿物的表面,凝灰岩中蒙脱石的层间没有发生阳离子交换。在28d的实验时间内,237Np在介质中的Fe-Mn氧化物-氢氧化物上的吸附百分数几乎不随时间变化。这可能是因为该吸附过程为瞬时即可完成的表面化学反应。介质内离子交换相和残余相上的吸附则显示为缓慢的吸附过程。

  2. Post-Irradiation Examination of 237Np Targets for 238Pu Production

    Energy Technology Data Exchange (ETDEWEB)

    Morris, Robert Noel [ORNL; Baldwin, Charles A [ORNL; Hobbs, Randy W [ORNL; Schmidlin, Joshua E [ORNL

    2015-01-01

    Oak Ridge National Laboratory is recovering the US 238Pu production capability and the first step in the process has been to evaluate the performance of a 237Np target cermet pellet encased in an aluminum clad. The process proceeded in 3 steps; the first step was to irradiate capsules of single pellets composed of NpO2 and aluminum power to examine their shrinkage and gas release. These pellets were formed by compressing sintered NpO2 and aluminum powder in a die at high pressure followed by sintering in a vacuum furnace. Three temperatures were chosen for sintering the solution precipitated NpO2 power used for pellet fabrication. The second step was to irradiate partial targets composed of 8 pellets in a semi-prototypical arrangement at the two best performing sintering temperatures to determine which temperature gave a pellet that performed the best under the actual planned irradiation conditions. The third step was to irradiate ~50 pellets in an actual target configuration at design irradiation conditions to assess pellet shrinkage and gas release, target heat transfer, and dimensional stability. The higher sintering temperature appeared to offer the best performance after one cycle of irradiation by having the least shrinkage, thus keeping the heat transfer gap between the pellets and clad small minimizing the pellet operating temperature. The final result of the testing was a target that can meet the initial production goals, satisfy the reactor safety requirements, and can be fabricated in production quantities. The current focus of the program is to verify that the target can be remotely dissembled, the pellets dissolved, and the 238Pu recovered. Tests are being conducted to examine these concerns and to compare results to code predictions. Once the performance of the full length targets has been quantified, the pellet 237Np loading will be revisited to determine if it can be

  3. Standard Test Method for Measuring Reaction Rates by Radioactivation of Neptunium-237

    CERN Document Server

    American Society for Testing and Materials. Philadelphia

    2008-01-01

    1.1 This test method covers procedures for measuring reaction rates by assaying a fission product (F.P.) from the fission reaction 237Np(n,f)F.P. 1.2 The reaction is useful for measuring neutrons with energies from approximately 0.7 to 6 MeV and for irradiation times up to 30 to 40 years. 1.3 Equivalent fission neutron fluence rates as defined in Practice E 261 can be determined. 1.4 Detailed procedures for other fast-neutron detectors are referenced in Practice E 261. 1.5 The values stated in SI units are to be regarded as standard. No other units of measurement are included in this standard. 1.6 This standard does not purport to address all of the safety concerns, if any, associated with its use. It is the responsibility of the user of this standard to establish appropriate safety and health practices and determine the applicability of regulatory limitations prior to use.

  4. Fission mode analysis of the reaction {sup 237}Np(n,f) - possibilities and perspectives

    Energy Technology Data Exchange (ETDEWEB)

    Siegler, P. [Joint Research Centre, Geel (Belgium). Geel Establishment

    1996-03-01

    Fission fragment properties for the reaction {sup 237}Np(n,f) have been measured at the Van de Graaff Laboratory of the IRMM. Using a double gridded ionization chamber the mass, kinetic energy and the angular distribution for both fission fragments could be determined simultaneously for an incident neutron energy range from E{sub n}=0.3 MeV upto E{sub n}=5.5 MeV. Complete datasets have been acquired for 13 different neutron energies covering sub barrier fission as well as fission in the plateau region. A detailed analysis of the fragment distributions and the respective momenta has been carried out, checking the coherence against the excitation energy of the compound nucleus. The consideration of multi-modal fission offers an improved possibility for the description of the fragment distributions backed up by theoretical calculations on the basis of the multi-model random-neck rupture model of Brosa, Grossmann and Mueller. The changes of the fission fragment properties under investigation are completely described and an interpretation of the findings is presented. (author)

  5. Fast neutron induced fission of Np-237: mass spectra at high kinetic energies

    International Nuclear Information System (INIS)

    The results of measurements of the cold fragmentation mass spectra in neutron induced fission of Np-237 are discussed. The investigation of the cold fragmentation region of neptunium is needed in detail in order to understand the relationship between mass and charge subsystems inside the nucleus during all stage of a descent of the two-center figure from the fission barrier to the scission point. The twin gridded ionization chamber and data acquisition system used for the measurements are described. The fine structure of mass distributions which can be attributed to the role and behaviour of unpairing proton in neptunium is revealed. The conclusion is made that in comparison with any even-even compound system one proton in neptunium is free and can in principle join heavy fragment coming from light fragment. This effect is not specific property of the standard-I mass channel centered around magic fragment with mass m = 134 amu. Practically the same is observed for completely another channel: m = 152. It is very probable that the standard-II channel has the same properties

  6. New experimental determination of the neutronic resonance parameters of {sup 237}Np below 500 eV; Nouvelle determination experimentale des parametres de resonances neutroniques de {sup 237}Np en dessous de 500 eV

    Energy Technology Data Exchange (ETDEWEB)

    Gressier, V

    1999-10-01

    For studies of future nuclear reactors dedicated to nuclear waste transmutation, an improvement of the accuracy of the neutron radiative capture cross section of {sup 237}Np appears necessary. In the framework of a collaboration between the Commissariat a l'Energie atomique (CEA) and Institute for Reference Materials and Measurement (IRMM, Geel, Bergium), a new determination of the resonance parameters of {sup 237}Np has been performed. Two types of experiments are carried out at GELINA, the IRMM pulsed neutron source, using the time of flight method: a transmission experiment which is related to the neutron total cross section and a capture experiment which gives the neutron radiative capture cross section. The resonance parameters presented in this work are extracted from the transmission data between 0 and 500 eV with the least square code REFIT, using the Reich-Moore formalism. In parallel, the Doppler effect is investigated. The commonly used free gas model appears inadequate below 20 eV for neptunium dioxide at room temperature. By the use of the program DOPUSH, which calculates the Doppler broadening with a harmonic crystal model according to Lamb's theory, we are able to produce abetter fit of the experimental data for the resonances of {sup 237}Np in NpO{sub 2} at low energy or temperatures. In addition to the resonance parameters, a study of their mean value and distribution is included in this work. (authors)

  7. Assessment of uranium, plutonium, and Np-237 content of high level liquid waste on E-Area vault package limits

    International Nuclear Information System (INIS)

    The purpose of this report is to assess the waste tank inventory of uranium, plutonium and Np-237 to determine potential impacts on waste certification for the E-Area vaults (EAV). Procedure WAC 3.10, Rev. 1, of the 1S Manual imposes administrative control limits for radioactive material in waste packages sent to the EAV. Waste tank supernate contains trace amounts of U, Pu, and Np. Thus any material contaminated with supernate and placed in a B-25 waste package may contain one or more of these elements' radioactive isotopes. This report uses material inventory data, solubility data and tank volumes to determine the potential-, for waste packages, contaminated with waste tank supernate, to exceed the administrative control limits of procedure WAC 3. 10, Rev. 1, for U-233, U-234, U-235, U-236, U-238, Np-237, Pu-238, Pu-239, Pu-240, Pu-241, and Pu-242

  8. Assessment of uranium, plutonium, and Np-237 content of high level liquid waste on E-Area vault package limits

    Energy Technology Data Exchange (ETDEWEB)

    Clemmons, J.S.

    1994-06-08

    The purpose of this report is to assess the waste tank inventory of uranium, plutonium and Np-237 to determine potential impacts on waste certification for the E-Area vaults (EAV). Procedure WAC 3.10, Rev. 1, of the 1S Manual imposes administrative control limits for radioactive material in waste packages sent to the EAV. Waste tank supernate contains trace amounts of U, Pu, and Np. Thus any material contaminated with supernate and placed in a B-25 waste package may contain one or more of these elements` radioactive isotopes. This report uses material inventory data, solubility data and tank volumes to determine the potential-, for waste packages, contaminated with waste tank supernate, to exceed the administrative control limits of procedure WAC 3. 10, Rev. 1, for U-233, U-234, U-235, U-236, U-238, Np-237, Pu-238, Pu-239, Pu-240, Pu-241, and Pu-242.

  9. The c.-237_236GA>TT THAP1 Sequence Variant Does Not Increase Risk for Primary Dystonia

    Science.gov (United States)

    Xiao, Jianfeng; Zhao, Yu; Bastian, Robert W.; Perlmutter, Joel S.; Racette, Brad A.; Tabbal, Samer D.; Karimi, Morvarid; Paniello, Randal C.; Wszolek, Zbigniew K.; Uitti, Ryan J.; Van Gerpen, Jay A.; Simon, David K.; Tarsy, Daniel; Hedera, Peter; Truong, Daniel D.; Frei, Karen P.; Blitzer, Andrew; Rudzińska, Monika; Pfeiffer, Ronald F.; Le, Carrie; LeDoux, Mark S.

    2010-01-01

    Sequence variants in coding and non-coding regions of THAP1 have been associated with primary dystonia. In this study, 1446 Caucasian subjects with mainly adult-onset primary dystonia and 1520 controls were genotyped for a variant located in the 5’-untranslated region of THAP1 (c.-237_236GA>TT). Minor allele frequencies were 62/2892 (2.14%) and 55/3040 (1.81%) in subjects with dystonia and controls, respectively (P = 0.202). Subgroup analyses by gender and anatomical distribution also failed to attain statistical significance. In addition, there was no effect of the TT variant on expression levels of THAP1 transcript or protein. Our findings indicate that the c.-237_236GA>TT THAP1 sequence variant does not increase risk for adult-onset primary dystonia in Caucasians. PMID:21370264

  10. Electron paramagnetic resonance and electron nuclear double resonance of 237-neptunium hexafluoride in uranium hexafluoride single crystals

    Science.gov (United States)

    Butler, James E.; Hutchison, Clyde A., Jr.

    1981-03-01

    The EPR and ENDOR spectra of 237NpF6 molecules dilutely substituted for host molecules in single crystals of UF6 at temperatures between 1.2 and 2.1 °K have been obtained at microwave frequencies, ˜9.4 and ˜9.7 GHz. Approximate values are given for the parameters in a spin Hamiltonian formalism that describes the measurements. The results are discussed.

  11. RAPID DETERMINATION OF 237 NP AND PU ISOTOPES IN WATER BY INDUCTIVELY COUPLED PLASMA MASS SPECTROMETRY AND ALPHA SPECTROMETRY

    Energy Technology Data Exchange (ETDEWEB)

    Maxwell, S.; Jones, V.; Culligan, B.; Nichols, S.; Noyes, G.

    2010-06-23

    A new method that allows rapid preconcentration and separation of plutonium and neptunium in water samples was developed for the measurement of {sup 237}Np and Pu isotopes by inductively-coupled plasma mass spectrometry (ICP-MS) and alpha spectrometry; a hybrid approach. {sup 238}U can interfere with {sup 239}Pu measurement by ICP-MS as {sup 238}UH{sup +} mass overlap and {sup 237}Np via peak tailing. The method provide enhanced removal of uranium by separating Pu and Np initially on TEVA Resin, then moving Pu to DGA resin for additional removal of uranium. The decontamination factor for uranium from Pu is almost 100,000 and the decontamination factor for U from Np is greater than 10,000. This method uses stacked extraction chromatography cartridges and vacuum box technology to facilitate rapid separations. Preconcentration is performed using a streamlined calcium phosphate precipitation method. Purified solutions are split between ICP-MS and alpha spectrometry so that long and short-lived Pu isotopes can be measured successfully. The method allows for simultaneous extraction of 20 samples (including QC samples) in 4 to 6 hours, and can also be used for emergency response. {sup 239}Pu, {sup 242}Pu and {sup 237}Np were measured by ICP-MS, while {sup 236}Pu, {sup 238}Pu, and {sup 239}Pu were measured by alpha spectrometry.

  12. Osteosarcoma induction by plutonium-239, americium-241 and neptunium-237 : the problem of deriving risk estimates for man

    International Nuclear Information System (INIS)

    Spontaneous bone cancer (osteosarcoma) represents only about 0.3% of all human cancers, but is well known to be inducible in humans by internal contamination with radium-226 and radium-224. plutonium-239, americium-241 and neptunium-237 form, or will form, the principal long-lived alpha particle emitting components of high activity waste and burnt-up nuclear fuel elements. These three nuclides deposit extensively in human bone and although, fortunately, no case of a human osteosarcoma induced by any of these nuclides is known, evidence from animal studies suggests that all three are more effective than radium-226 in inducing osteosarcoma. The assumption that the ratio of the risk factors, the number of osteosarcoma expected per 10000 person/animal Gy, for radium-226 and any other bone-seeking alpha-emitter will be independent of animal species has formed the basis of all the important studies of the radiotoxicity of actinide nuclides in experimental animals. The aim of this communication is to review the risk factors which may be calculated from the various animal studies carried out over the last thirty years with plutonium-237, americium-241 and neptunium-237 and to consider the problems which may arise in extrapolating these risk factors to homo sapiens

  13. Nuclear Criticality Safety of the DOT 9975 Container for237NpO2Storage, Handling, and Transport

    Energy Technology Data Exchange (ETDEWEB)

    Reed, D.A.

    2003-08-29

    Nuclear criticality safety considerations are presented to address use of the DOT 9975 shipping container for {sup 237}NpO{sub 2}. The DOT 9975 container will be used by multiple DOE sites and contractors. Various of site- and activity-specific NCS and facility safety documents are yet to be developed. For these reasons, an overall assessment of criticality safety of {sup 237}NpO{sub 2}-loaded DOT 9975 containers is considered useful to personnel involved in generating, reviewing, or approving these various documents. It is concluded that inherent container features, the loading per container (maximum of 6 kg {sup 237}Np), and the nuclear physics properties of {sup 237}NpO{sub 2} combine to preclude the potential for a nuclear criticality accident. This conclusion applies to storage, handling, and transport operations involving closed DOT 9975 packages, including credible off-normal conditions that may result in damage to packages during those operations.

  14. The c.-237_236GA>TT THAP1 Sequence Variant Does Not Increase Risk for Primary Dystonia

    OpenAIRE

    Xiao, Jianfeng; Zhao, Yu; Robert W. Bastian; Perlmutter, Joel S.; Racette, Brad A.; Tabbal, Samer D.; Karimi, Morvarid; Paniello, Randal C.; Wszolek, Zbigniew K.; Uitti, Ryan J; Van Gerpen, Jay A; Simon, David K; Tarsy, Daniel; Hedera, Peter; Truong, Daniel D.

    2011-01-01

    Sequence variants in coding and non-coding regions of THAP1 have been associated with primary dystonia. In this study, 1446 Caucasian subjects with mainly adult-onset primary dystonia and 1520 controls were genotyped for a variant located in the 5’-untranslated region of THAP1 (c.-237_236GA>TT). Minor allele frequencies were 62/2892 (2.14%) and 55/3040 (1.81%) in subjects with dystonia and controls, respectively (P = 0.202). Subgroup analyses by gender and anatomical distribution also failed ...

  15. Prospects for a measurement of the 237U(n,f) cross section at the LANSCE Lujan Center

    Energy Technology Data Exchange (ETDEWEB)

    Devlin, Matthew James [Los Alamos National Lab. (LANL), Los Alamos, NM (United States); Mocko, Michal [Los Alamos National Lab. (LANL), Los Alamos, NM (United States); Gavron, Victor [Los Alamos National Lab. (LANL), Los Alamos, NM (United States); Jandel, Marian [Los Alamos National Lab. (LANL), Los Alamos, NM (United States); Rusev, Gencho Yordanov [Los Alamos National Lab. (LANL), Los Alamos, NM (United States); Bredeweg, Todd Allen [Los Alamos National Lab. (LANL), Los Alamos, NM (United States)

    2015-06-24

    A new measurement of the 237U(n, f) cross section from thermal to ≈ 100 keV is discussed, using one of the flightpaths at the LANSCE Lujan Center. Previous energy-resolved resonance-region measurements have been conducted using weapon test time-of-flight[1] and the LANSCE Lead Slowing Down Spectrometer[2], the former of which is limited in its energy range, and the latter in its energy resolution and range. We present here a proposal, based on simulations of the Lujan Center neutron flux and a hypothetical experiment, that is expected to adequately address both of these issues.

  16. Three-body calculation of the Delta-Delta dibaryon candidate D(03) at 2.37 GeV

    CERN Document Server

    Gal, Avraham

    2013-01-01

    The I(JP)=0(3+) D(03) dibaryon candidate observed as resonance at 2.37 GeV in pion-production pn collisions by WASA@COSY is relegated within a dynamical pion-nucleon-Delta three-body model to a Delta-Delta (upper) pion-D(12) (lower) coupled-channel quasi-bound dibaryon state, where D(12) is the dibaryon observed in the 1D2 partial wave of pp scattering at 2.15 GeV

  17. Efficacy and safety of once-daily NVA237 in patients with moderate-to-severe COPD: the GLOW1 trial

    Directory of Open Access Journals (Sweden)

    D'Urzo Anthony

    2011-12-01

    Full Text Available Abstract Background NVA237 is a once-daily dry-powder formulation of the long-acting muscarinic antagonist glycopyrronium bromide in development for the treatment of chronic obstructive pulmonary disease (COPD. The glycopyrronium bromide in COPD airways clinical study 1 (GLOW1 evaluated the efficacy, safety and tolerability of NVA237 in patients with moderate-to-severe COPD. Methods Patients with COPD with a smoking history of ≥ 10 pack-years, post-bronchodilator forced expiratory volume in 1 second (FEV1 1/forced vital capacity 1 antagonists permitted in patients stabilized on them prior to study entry. The primary outcome measure was trough FEV1 at Week 12. Results A total of 822 patients were randomized to NVA237 (n = 552 or placebo (n = 270. Least squares mean (± standard error trough FEV1 at Week 12 was significantly higher in patients receiving NVA237 (1.408 ± 0.0105 L, versus placebo (1.301 ± 0.0137 L; treatment difference 108 ± 14.8 mL, p 1 were apparent at the end of Day 1 and sustained through Week 26. FEV1 was significantly improved in the NVA237 group versus placebo throughout the 24-hour periods on Day 1 and at Weeks 12 and 26, and at all other visits and timepoints. Transition dyspnoea index focal scores and St. George's Respiratory Questionnaire scores were significantly improved with NVA237 versus placebo at Week 26, with treatment differences of 1.04 (p Conclusions Once-daily NVA237 was safe and well tolerated and provided rapid, sustained improvements in lung function, improvements in dyspnoea, and health-related quality of life, and reduced the risk of exacerbations and the use of rescue medication. Trial registration ClinicalTrials.gov: NCT01005901

  18. Inductively Coupled Plasma Mass Spectrometry For The Determination Of 237Np In Spent Nuclear Fuel Samples By Isotope Dilution Method Using 239Np As A Spike

    International Nuclear Information System (INIS)

    A determination method for 237Np in spent nuclear fuel samples was developed using an isotope dilution method with 239Np as a spike. In this method, inductively coupled plasma mass spectrometry (ICP-MS) was taken for the 237Np instead of the previously used alpha spectrometry. 237Np and 239Np were measured by ICP-MS and gamma spectrometry, respectively. The recovery yield of 237Np in synthetic samples was 95.9±9.7% (1S, n=4). The 237Np contents in the spent fuel samples were 0.15, 0.25, and 1.06 μg/mgU and these values were compared with those from ORIGEN-2 code. A fairly good agreement between the measurements (m) and calculations (c) was obtained, giving ratios (m/c) of 0.93, 1.12 and 1.25 for the three PWR spent fuel samples with burnups of 16.7, 19.0, and 55.9 GWd/MtU, respectively

  19. NKS-Norcmass reference material for analysis of Pu-isotopes and 237Np by mass spectrometry

    International Nuclear Information System (INIS)

    The aim of the reference material in the Norcmass-project was to produce a low-level (239Pu) sample of sufficient amount to allow individual laboratories to perform several tests without risk of using up the material. Although there are several reference materials available (eg IAEA) few have 239Pu/240Pu data and almost none have 237Np/239Pu-data. Those who have (eg IAEA-384) have very high concentrations and are not useful for testing analytical methods designed for low-level measurements where a large sample mass may be required. The reference material consist of the top 10cm of 2mm sieved soil pooled together from 12 different Danish locations collected during 2003. The Soil was blended and sieved through 0.6 and finally through a 0.4 mm sieve. A total amount of 17 kg soil was produced. Several aliquots of the material was subject to analysis by alpha spectrometry and ICP-MS. The material contain 239+240Pu at a concentration of 0.24 ± 0.01 mBq/g and a 240Pu/239Pu atom ratio of 0.19 ± 0.006. The ratio 237Np/239Pu was determined to 0.32 ± 0.01. (au)

  20. Capture cross section measurement of Np-237 below 1 keV with Lead Slowing-down Spectrometer

    Energy Technology Data Exchange (ETDEWEB)

    Kobayashi, Katsuhei; Cho, Hyun-Je; Yamamoto, Shuji; Yoshimoto, Takaaki; Fujita, Yoshiaki [Kyoto Univ., Kumatori, Osaka (Japan). Research Reactor Inst; Ohkawachi, Yasushi [Japan Nuclear Cycle Development Inst., Oarai, Ibaraki (Japan). Oarai Engineering Center

    2000-03-01

    Making use of the Kyoto University Lead slowing-down Spectrometer (KULS) driven by a 46 MeV electron linear accelerator (linac) at the Research Reactor Institute, Kyoto University (KURRI), the relative cross section for the {sup 237}Np(n,{gamma}) reaction has been measured from 0.01 eV to 1 keV with energy resolution of about 40% (FWHM). The neutron flux/spectrum has been measured by a BF{sub 3} counter. The cross section of the {sup 10}B(n,{alpha}) reaction in ENDF/B-VI was used as a reference one for the cross section measurement. The measured result has been normalized to the reference value of the {sup 237}Np(n,{gamma}){sup 238}Np reaction in ENDF/B-VI at 0.0253 eV, and the measurement has been compared with the experimental and the evaluated data in ENDF/B-VI and JENDL-3.2, whose data were broadened by the energy resolution of the KULS. (author)

  1. Emission probabilities of the KX-rays following the decay of 237 Np in equilibrium with 233 Pa

    International Nuclear Information System (INIS)

    Following participation in the international EUROMET project No. 416 and after our recent paper, concerning the measurement of the emission probability values of the main gamma-rays of 237 Np in equilibrium with 233 Pa, a complementary work has been done in the frame of the collaboration LNHB-VNIIM-KRI-IFIN (with the support of 'Ministere des Affaires Etrangeres' of France). The purpose was to determine the photon emission probabilities for the KX-rays following the decay of these two nuclides. Two different analysis methods have been used. At first, the KX-rays region was analyzed by fitting Voigt functions according to a least squares procedure, included in 'COLEGRAM' deconvolution code. In the second case, the analysis was performed by using full response functions. Thus, the work allowed the determination of the photon emission probabilities with a relative uncertainty of about 2%. This accurate set of data is useful in calculations related to the atomic level scheme of 237 Np/233 Pa and in X-ray spectrometry based applications. (authors)

  2. Longevity-associated NADH Dehydrogenase Subunit-2 237 Leu/Met Polymorphism Modulates the Effects of Daily Alcohol Drinking on Yearly Changes in Serum Total and LDL Cholesterol in Japanese Men

    Directory of Open Access Journals (Sweden)

    Takashima,Yutaka

    2009-12-01

    Full Text Available Reduced nicotinamide adenine dinucleotide (NADH dehydrogenase subunit 2 237 leucine/methionine (ND2-237 Leu/Met polymorphism, is reportedly associated with longevity in the Japanese population. The ND2-237Met genotype may exert resistance to atherogenic diseases, such as myocardial infarction or cerebrovascular disorders. To investigate whether ND2-237 Leu/Met polymorphism is associated with yearly changes in serum lipid levels, we conducted a longitudinal study of 107 healthy Japanese male subjects. Analysis of covariance revealed that the interaction between the ND2-237 Leu/Met genotypes and habitual drinking was significantly associated with yearly changes in serum total cholesterol (TC and low-density lipoprotein cholesterol (LDLC levels (p0.036 and p0.006, respectively. In multiple regression analysis, daily drinking was significantly and positively associated with yearly changes in serum LDLC levels in men with ND2-237Met (p0.026. After adjusting for covariates, yearly changes in serum LDLC levels were significantly lower in non-daily drinkers with ND2-237Met than in those with ND2-237Leu (p0.047. These results suggest that ND2-237Met has a beneficial impact on yearly changes in serum LDLC in non-daily drinkers but not in daily drinkers.

  3. Rapid determination of 237Np in soil samples by multi-collector inductively-coupled plasma mass spectrometry and gamma spectrometry

    International Nuclear Information System (INIS)

    A radiochemical procedure is developed for the determination of 237Np in soil with multi-collector inductively-coupled plasma mass spectrometry (MC-ICP-MS) and gamma-spectrometry. 239Np (milked from 243Am) was used as an isotopic tracer for chemical yield determination. The neptunium in the soil is separated by thenoyl-trifluoracetone extraction from 1 M HNO3 solution after reducing Np to Np(IV) with ferrous sulfamate, and then purified with Dowex 1 x 2 anion exchange resin. 239Np in the resulting solution is measured with gamma-spectrometry for chemical yield determination while the 237Np is measured with MC-ICP-MS. Measurement results for soil samples are presented together with those for two reference samples. By comparing the determined value with the reference value of the 237Np activity concentration, the feasibility of the procedure was validated. (author)

  4. Targeting Mutant p53 by a SIRT1 Activator YK-3-237 Inhibits the Proliferation of Triple-Negative Breast Cancer Cells

    OpenAIRE

    Yi, Yong Weon; Kang, Hyo Jin; Kim, Hee Jeong; Kong, Yali; Brown, Milton L.; Bae, Insoo

    2013-01-01

    Many types of mutations in tumor suppressor p53 are oncogenic through gain-of-function. Therefore, targeting mutant p53 (mtp53) is a promising therapeutic approach to fight against many types of cancers. We report here a small molecule compound YK-3-237 that reduces acetylation of mtp53 and exhibits anti-proliferative effects toward triple-negative breast cancer (TNBC) cells carrying mtp53. YK-3-237 activates SIRT1 enzyme activities in vitro and deacetylation of both mtp53 and wild type p53 (...

  5. The relative uptake of 237Pu(IV) and Pu(VI) oxidation states from water by bush beans

    International Nuclear Information System (INIS)

    Recent data is presented on the status of Pu oxidation states (IV) and (VI) during plant uptake from an aqueous culture. An experiment was performed with bush beans, using 237Pu, to monitor the stability of Pu(IV) and Pu(VI) in the solution phase, to evaluate the relative uptake of each oxidation state by bush beans from water, and to determine the valence of the Pu inside the vascular system by analyzing the xylem exudate. Pu(VI) in solution was assimilated by plants more rapidly than Pu(IV) but was reduced to the less biologically mobile Pu(IV) in the plant biochemical environment. Dominance of Pu(IV) in the xylem exudate indicates that Pu(VI) would not be expected to persist in vegetable matter. Therefore of the biochemically associated Pu in plant matter ingested by humans a considerably larger amount would occur as Pu(IV) than as Pu(VI). (author)

  6. Review of fission product yields and delayed neutron data for the actinides NP-237, PU-242, AM-242M, AM-243, CM-243 and CM-245

    International Nuclear Information System (INIS)

    A review of fission product yields and delayed neutron data for Np-237, Pu-242, Am-242m, Am-243, Cm-243 and Cm-245 has been undertaken. Gaps in understanding and inconsistencies in existing data were identified and priority areas for further experimental, theoretical and evaluation investigation detailed

  7. 240Pu(n,f), 242Pu(n,f), 237Np(n,f), neutron fission cross sections, Esub(n) = 2.5 MeV

    International Nuclear Information System (INIS)

    Measurements of the absolute neutron fission cross section of 240Pu, 242Pu and 237Np have been made at 2.5 MeV using a hybrid detector. The fission events were detected in an ionization chamber (2π) and the neutron flux was determined by a proton recoil telescope and a directional long counter. Our values are compared to previous data

  8. Fission Cross Sections of {209}Bi, {232}Th, {235}U, {238}U and {237}Np for Intermediate Energy Protons and Deuterons

    CERN Document Server

    Yurevich, V I; Yakovlev, R M; Sosnin, A N

    2001-01-01

    Fission cross sections of {209}Bi, {232}Th, {235}U, {238}U and {237}Np have been measured with 1.0-3.7 GeV protons and 1.0 GeV deuterons. The results are compared with other experimental data, available evaluations and predictions of the theoretical model.

  9. The Synergistic Effect of Valsartan and LAF237 [(S-1-[(3-Hydroxy-1-AdamantylAmmo]acetyl-2-Cyanopyrrolidine] on Vascular Oxidative Stress and Inflammation in Type 2 Diabetic Mice

    Directory of Open Access Journals (Sweden)

    Min Shen

    2012-01-01

    Full Text Available Aim. To investigate the combination effects and mechanisms of valsartan (angiotensin II type 1 receptor blocker and LAF237 (DPP-IV inhibitor on prevention against oxidative stress and inflammation injury in db/db mice aorta. Methods. Db/db mice (n=40 were randomized to receive valsartan, LAF237, valsartan plus LAF237, or saline. Oxidative stress and inflammatory reaction in diabetic mice aorta were examined. Results. Valsartan or LAF237 pretreatment significantly increased plasma GLP-1 expression, reduced apoptosis of endothelial cells isolated from diabetic mice aorta. The expression of NAD(PH oxidase subunits also significantly decreased resulting in decreased superoxide production and ICAM-1 (fold change: valsartan : 7.5 ± 0.7, P<0.05; LAF237: 10.2 ± 1.7, P<0.05, VCAM-1 (fold change: valsartan : 5.2 ± 1.2, P<0.05; LAF237: 4.8 ± 0.6, P<0.05, and MCP-1 (fold change: valsartan: 3.2 ± 0.6, LAF237: 4.7 ± 0.8; P<0.05 expression. Moreover, the combination treatment with valsartan and LAF237 resulted in a more significant increase of GLP-1 expression. The decrease of the vascular oxidative stress and inflammation reaction was also higher than monotherapy with valsartan or LAF237. Conclusion. These data indicated that combination treatment with LAF237 and valsartan acts in a synergistic manner on vascular oxidative stress and inflammation in type 2 diabetic mice.

  10. Mass and nuclear charge yields for sup 237 Np(2n sub th ,f) at different fission fragment kinetic energies

    Energy Technology Data Exchange (ETDEWEB)

    Martinez, G.; Barreau, G.; Sicre, A.; Doan, T.P.; Audouard, P.; Leroux, B. (CEA Centre d' Etudes Nucleaires de Bordeaux-Gradignan, 33 - Gradignan (France)); Arafa, W.; Brissot, R.; Bocquet, J.P. (Grenoble-1 Univ., 38 (France). Inst. des Sciences Nucleaires); Faust, H. (Institut Max von Laue - Paul Langevin, 38 - Grenoble (France)); Koczon, P.; Mutterer, M. (Technische Hochschule Darmstadt (Germany, F.R.). Inst. fuer Kernphysik); Goennenwein, F. (Tuebingen Univ. (Germany, F.R.). Physikalisches Inst.); Asghar, M. (Universite des Sciences et de la Technologie Houari Boumediene, Algiers (Algeria). Inst. de Physique); Quade, U.; Rudolph, K. (Muenchen Univ. (Germany, F.R.)); Engelhardt, D. (Karlsruhe Univ. (T.H.) (Germany, F.R.)); Piasecki, E. (Warsaw Univ. (Poland))

    1990-09-03

    The recoil mass separator LOHENGRIN of the Laue-Langevin Institute Grenoble has been used to measure for the first time, the yields of light fission fragments from the fissioning system: {sub 93}{sup 239}Np; this odd-Z nucleus is formed after double thermal neutron capture in a {sub 93}{sup 237}Np target. The mass distributions were measured for different kinetic energies between 92 and 115.5 MeV, but the nuclear charge distributions were determined only up to 112 MeV. These distributions are compared to the distributions obtained for the even-even system {sub 94}{sup 240}Pu. At high kinetic energy, the mass distribution shows a prominent peak around mass number A{sub L}=106. These cold fragmentations are discussed in terms of a calculation based on a scission point model extrapolated to the cold fission case. As expected for an odd-Z fissioning nucleus, the nuclear charge distributions do not reveal any odd-even effect. The global neutron odd-even effect is found to be (8.1{plus minus}1.5)%. A simple model has been used to show that most of the neutron odd-even effect results from prompt neutron evaporation from the fragments. (orig.).

  11. Neutron-induced transmutation reactions in 237Np, 238Pu, and 239Pu at the massive natural uranium spallation target

    International Nuclear Information System (INIS)

    Transmutation reactions in the 237Np, 238Pu, and 239Pu samples were investigated in the neutron field generated inside a massive (m = 512 kg) natural uranium spallation target. The uranium target assembly QUINTA was irradiated with the deuteron beams of kinetic energy 2, 4, and 8 GeV provided by the Nuclotron accelerator at the Joint Institute for Nuclear Research (JINR) in Dubna. The neutron-induced transmutation of the actinide samples was measured off-line by implementing methods of gamma-ray spectrometry with HPGe detectors. Results of measurement are expressed in the form of both the individual reaction rates and average fission transmutation rates. For the purpose of validation of radiation transport programs, the experimental results were compared with simulations of neutron production and distribution performed by the MCNPX 2.7 and MARS15 codes employing the INCL4-ABLA physics models and LAQGSM event generator, respectively. In general, a good agreement between the experimental and calculated reaction rates was found in the whole interval of provided beam energies

  12. Numerical methods to analyze alpha spectra and application to the study of neptunium 237 and neptunium 236

    International Nuclear Information System (INIS)

    A set of numerical methods to analize alpha spectra measured with semiconductor detectors are presented. The methods can be divided in two groups, the first being based in the X2 minimization ands the second in the use of the Fourier Transform. The methods based in the minimization of X2 can, in turn, be divided according to the model used to fit the spectra. Some of them use a monoenergetic line for the intercomparison with the other peaks in the same spectrum. The others take into account the analytical function developed to represent an alpha line. Both allow the determination of positions and areas of the components, as well as the uncertainties of the results. The Fast Fourier Transform is applied to the second group of methods, which include the smoothing of experimental data, and the deconvolution of spectra. Examples are given of the application of these methods to real spectra. The alpha spectra of 237Np and 236Np are studied by using some of the methods described in this work. (Author)

  13. Measurement of transuranic elements, chiefly 237Np (by neutron activation analysis), in the physical and biological compartments of the French shore of the English Channel

    International Nuclear Information System (INIS)

    The behaviour of transuranic elements in the marine environment has been studied via both in situ sampling and laboratory tracer experiments. In particular, the radionuclide 237Np was investigated and techniques for its quantitative determination are described. In the field investigations, a preliminary separation of Np from samples was performed prior to neutron activation analysis, with subsequent γ-ray spectrometry of 238Np. In the laboratory studies, 237Np was determined by a radiochemical method followed by α-spectrometry. The results obtained from the in situ study in the English Channel (sea water, seaweed, molluscs) and from laboratory-uptake experiments (water and mussels) are described. Levels of Pu, Am and Np are compared and the characteristics of neptunium transfer to molluscs are discussed. (author)

  14. Screening of the FcεRI-β-Gene in a Swiss Population of Asthmatic Children: No Association with E237G and Identification of New Sequence Variations

    Directory of Open Access Journals (Sweden)

    M. Rohrbach

    1998-01-01

    Full Text Available Background: The gene of the beta subunit of the high affinity receptor for IgE (FcεRI-β encoded on chromosome 11q13 has recently been identified as a candidate gene for asthma and atopy. Two coding variations, E237G and I181L have been described as being associated with asthma and atopy. Our aim was to investigate a Swiss population of atopic and asthmatic children for variations in this gene.

  15. Emission probabilities of gamma rays from the decay of 233Pa and 238Np, and the thermal neutron capture cross section of 237Np

    International Nuclear Information System (INIS)

    In order to determine the thermal neutron capture cross section of 237Np, the relevant γ emission probabilities of the 312-keV γ-ray from the decay of 233Pa and the 984-keV γ-ray from the decay of 238Np are deduced from the ratio of the emission rate to the activity. The emission rate and activity are measured with a Ge detector and a Si detector, respectively. The measured emission probability for 312-keV γ-ray is 41.6±0.9% and that for 984-keV γ-ray is 25.2±0.5%. The emission probabilities are used to correct the thermal neutron capture cross section of 237Np reported previously, and gives 168±6b. The neutron capture cross section is also determined as 169±6b by α-ray spectroscopic method. The measured emission probabilities and capture cross section are compared with others from references. By averaging these values deduced by different methods, the value of 169±4b is recommended as the thermal neutron capture cross section of 237Np for 2,200 m/s neutrons. (author)

  16. Analytical Method for Pu-239, Pu-240, Np-237 and Tc-99 using Inductively Coupled Plasma Mass Spectrometry

    International Nuclear Information System (INIS)

    An efficient analytical method for Pu isotopes (Pu-239 and Pu-240), Np-237 and Tc-99 in environmental samples has been developed using sector field inductively coupled plasma mass spectrometry (SF-ICPMS) detection. The chemical separation of Pu in terrestrial samples, soil, and sediment was carried out on two extraction resins, Sr-Spec and TEVA, which were sequentially combined in PrepLab, an integrated liquid handing device. By reducing the final eluent volume to 2.4 mL, directly injecting it to SF-ICPMS, and employing MCN-6000, a membrane desolvating sample introduction system, the analysis of Pu isotopes was found to be feasible in 1 g of soil. The detection limits of Pu-239, Pu-240, and Pu-242 were approximately 4 fg mL-1 (9.2 Bq mL-1), 3 fg mL-1 (25 Bq mL-1), and 6 fg mL-1 (0.87 Bq mL-1), which represent total amounts of 9.6, 7.2, and 14 fg, respectively, in the final eluent. Chemical separation and measurement were fully automated by a sequential injection (SI) program in an on-line system, and the analysis could thereby be completed within roughly 5 hours. The reliability of this method was confirmed by a validity test with several certified standard reference materials (NIST-4350b, IAEA-6, IAEA-300, IAEA-367, IAEA-368, IAEA-375). The analytical method for Pu in environmental seawater is different from that of terrestrial samples owing to the strong interference effect of U as well as ultra-low level Pu. Although the principle of chemical separation is nearly the same as in soil, seawater was co-precipitated with Fe(OH)2 in the pre-treatment step and a micro TEVA column (50 L) was used in the on-line system to improve precision and the lower detection limit. With this method, it was possible to analyze ultra-trace level Pu isotopes in only 5 L of surface seawater within 1 day, and the precision for Pu-239 and Pu-240 was less than 3.4% (n=7) and 5% (n=7), respectively. The accuracy of this method was verified by analysis of reference seawater (IAEA-381) as

  17. Analytical Method for Pu-239, Pu-240, Np-237 and Tc-99 using Inductively Coupled Plasma Mass Spectrometry

    Energy Technology Data Exchange (ETDEWEB)

    Kim, Cheol Su

    2007-02-15

    An efficient analytical method for Pu isotopes (Pu-239 and Pu-240), Np-237 and Tc-99 in environmental samples has been developed using sector field inductively coupled plasma mass spectrometry (SF-ICPMS) detection. The chemical separation of Pu in terrestrial samples, soil, and sediment was carried out on two extraction resins, Sr-Spec and TEVA, which were sequentially combined in PrepLab, an integrated liquid handing device. By reducing the final eluent volume to 2.4 mL, directly injecting it to SF-ICPMS, and employing MCN-6000, a membrane desolvating sample introduction system, the analysis of Pu isotopes was found to be feasible in 1 g of soil. The detection limits of Pu-239, Pu-240, and Pu-242 were approximately 4 fg mL-1 (9.2 Bq mL-1), 3 fg mL-1 (25 Bq mL-1), and 6 fg mL-1 (0.87 Bq mL-1), which represent total amounts of 9.6, 7.2, and 14 fg, respectively, in the final eluent. Chemical separation and measurement were fully automated by a sequential injection (SI) program in an on-line system, and the analysis could thereby be completed within roughly 5 hours. The reliability of this method was confirmed by a validity test with several certified standard reference materials (NIST-4350b, IAEA-6, IAEA-300, IAEA-367, IAEA-368, IAEA-375). The analytical method for Pu in environmental seawater is different from that of terrestrial samples owing to the strong interference effect of U as well as ultra-low level Pu. Although the principle of chemical separation is nearly the same as in soil, seawater was co-precipitated with Fe(OH)2 in the pre-treatment step and a micro TEVA column (50 L) was used in the on-line system to improve precision and the lower detection limit. With this method, it was possible to analyze ultra-trace level Pu isotopes in only 5 L of surface seawater within 1 day, and the precision for Pu-239 and Pu-240 was less than 3.4% (n=7) and 5% (n=7), respectively. The accuracy of this method was verified by analysis of reference seawater (IAEA-381) as

  18. Comment: 237 [Taxonomy Icon

    Lifescience Database Archive (English)

    Full Text Available for Life Science licensed under CC Attribution2.1 Japan 絵や写真の投稿もできます。右は、没になったティラノザウルス(目がかわいい)です。 ttamura 2008/11/11 12:11:40 2011/09/14 21:10:36 ...

  19. Coulex fission of 234U, 235U, 237Np, and 238Np studied within the SOFIA experimental program

    International Nuclear Information System (INIS)

    SOFIA (Studies On FIssion with Aladin) is an experimental project which aims at systematically measuring the fission fragments' isotopic yields as well as their total kinetic energy, for a wide variety of fissioning nuclei. The PhD work presented in this dissertation takes part in the SOFIA project, and covers the fission of nuclei in the region of the actinides: 234U, 235U, 237Np and 238Np. The experiment is led at the heavy-ion accelerator GSI in Darmstadt, Germany. This facility provides intense relativistic primary beam of 238U. A fragmentation reaction of the primary beam permits to create a secondary beam of radioactive ions, some of which the fission is studied. The ions of the secondary beam are sorted and identified through the FR-S (Fragment Separator), a high resolution recoil spectrometer which is tuned to select the ions of interest.The selected - fissile - ions then fly further to Cave-C, an experimental area where the fission experiment itself takes place. At the entrance of the cave, the secondary beam is excited by Coulomb interaction when flying through an target; the de-excitation process involves low-energy fission. Both fission fragments fly forward in the laboratory frame, due to the relativistic boost inferred from the fissioning nucleus.A complete recoil spectrometer has been designed and built by the SOFIA collaboration in the path of the fission fragments, around the existing ALADIN magnet. The identification of the fragments is performed by means of energy loss, time of flight and deviation in the magnet measurements. Both fission fragments are fully (in mass and charge) and simultaneously identified.This document reports on the analysis performed for (1) the identification of the fissioning system, (2) the identification of both fission fragments, on an event-by-event basis, and (3) the extraction of fission observables: yields, TKE, total prompt neutron multiplicity. These results, concerning the actinides, are discussed, and the

  20. Functional differences exist between TNFα promoters encoding the common -237G SNP and the rarer HLA-B*5701-linked A variant.

    Directory of Open Access Journals (Sweden)

    Peter D Simpson

    Full Text Available A large body of functional and epidemiological evidence have previously illustrated the impact of specific MHC class I subtypes on clinical outcome during HIV-1 infection, and these observations have recently been re-iterated in genome wide association studies (GWAS. Yet because of the complexities surrounding GWAS-based approaches and the lack of knowledge relating to the identity of rarer single nucleotide polymorphism (SNP variants, it has proved difficult to discover independent causal variants associated with favourable immune control. This is especially true of the candidate variants within the HLA region where many of the recently proposed disease influencing SNPs appear to reflect linkage with 'protective' MHC class I alleles. Yet causal MHC-linked SNPs may exist but remain overlooked owing to the complexities associated with their identification. Here we focus on the ancestral TNFα promoter -237A variant (rs361525, shown historically to be in complete linkage disequilibrium with the 'protective' HLA-B*5701 allele. Many of the ancestral SNPs within the extended TNFα promoter have been associated with both autoimmune conditions and disease outcomes, however, the direct role of these variants on TNFα expression remains controversial. Yet, because of the important role played by TNFα in HIV-1 infection, and given the proximity of the -237 SNP to the core promoter, its location within a putative repressor region previously characterized in mice, and its disruption of a methylation-susceptible CpG dinucleotide motif, we chose to carefully evaluate its impact on TNFα production. Using a variety of approaches we now demonstrate that carriage of the A SNP is associated with lower TNFα production, via a mechanism not readily explained by promoter methylation nor the binding of transcription factors or repressors. We propose that the -237A variant could represent a minor causal SNP that additionally contributes to the HLA-B*5701-mediated

  1. Functional differences exist between TNFα promoters encoding the common -237G SNP and the rarer HLA-B*5701-linked A variant.

    Science.gov (United States)

    Simpson, Peter D; Moysi, Eirini; Wicks, Kate; Sudan, Kritika; Rowland-Jones, Sarah L; McMichael, Andrew J; Knight, Julian; Gillespie, Geraldine M

    2012-01-01

    A large body of functional and epidemiological evidence have previously illustrated the impact of specific MHC class I subtypes on clinical outcome during HIV-1 infection, and these observations have recently been re-iterated in genome wide association studies (GWAS). Yet because of the complexities surrounding GWAS-based approaches and the lack of knowledge relating to the identity of rarer single nucleotide polymorphism (SNP) variants, it has proved difficult to discover independent causal variants associated with favourable immune control. This is especially true of the candidate variants within the HLA region where many of the recently proposed disease influencing SNPs appear to reflect linkage with 'protective' MHC class I alleles. Yet causal MHC-linked SNPs may exist but remain overlooked owing to the complexities associated with their identification. Here we focus on the ancestral TNFα promoter -237A variant (rs361525), shown historically to be in complete linkage disequilibrium with the 'protective' HLA-B*5701 allele. Many of the ancestral SNPs within the extended TNFα promoter have been associated with both autoimmune conditions and disease outcomes, however, the direct role of these variants on TNFα expression remains controversial. Yet, because of the important role played by TNFα in HIV-1 infection, and given the proximity of the -237 SNP to the core promoter, its location within a putative repressor region previously characterized in mice, and its disruption of a methylation-susceptible CpG dinucleotide motif, we chose to carefully evaluate its impact on TNFα production. Using a variety of approaches we now demonstrate that carriage of the A SNP is associated with lower TNFα production, via a mechanism not readily explained by promoter methylation nor the binding of transcription factors or repressors. We propose that the -237A variant could represent a minor causal SNP that additionally contributes to the HLA-B*5701-mediated 'protective' effect

  2. Measurement at n-TOF of the 237Np(n, γ) and 240Pu(n, γ) cross sections for the transmutation of nuclear waste

    International Nuclear Information System (INIS)

    The final design, safety assessment and precise performance analysis of transmutation devices such as Accelerator Driven Systems (ADS) or Fast Critical Reactors, need accurate and reliable nuclear data. The cross sections of 237Np and 240Pu have been measured in 2004 at n-TOF with good accuracy due to a combination of features unique in the world: high instantaneous neutron fluence and excellent energy resolution of the n-TOF facility [1], innovative Data Acquisition System based on flash ADCs and the use of a high performance BaF2 Total Absorption Calorimeter as a detection device. (authors)

  3. Preliminary calculations of release rates of Tc-99, I-129, and Np-237 from spent fuel in a potential repository in tuff

    International Nuclear Information System (INIS)

    This report presents preliminary calculations of time-dependent release rates of selected radionuclides from the engineered barrier system in a potential high-level waste repository in unsaturated tuff, representative of a potential repository at Yucca Mountain in southern Nevada. These results are intended for use as preliminary source terms for calculating total system performance. The radionuclides specified for preliminary release-rate calculations are Tc-99, I-129, Cs-135, and Np-237 for ground-water pathways and C-14 for gaseous release

  4. Rapid determination of 237Np in soil samples by multi-collector inductively-coupled plasma mass spectrometry and gamma spectrometry

    OpenAIRE

    Yi, Xiaowei; Shi, Yanmei; Xu, Jiang; He, Xiaobing; ZHANG, HAITAO; Lin, Jianfeng

    2013-01-01

    A radiochemical procedure is developed for the determination of 237Np in soil with multi-collector inductively-coupled plasma mass spectrometry (MC-ICP-MS) and gamma-spectrometry. 239Np (milked from 243Am) was used as an isotopic tracer for chemical yield determination. The neptunium in the soil is separated by thenoyl-trifluoracetone extraction from 1 M HNO3 solution after reducing Np to Np(IV) with ferrous sulfamate, and then purified with Dowex 1 × 2 anion exchange resin. 239Np in the resu...

  5. The bioavailability of the transuranic elements 237Pu and 241Am for the pond snail, Lymnaea stagnalis L., and their behaviour in selected natural surface waters

    International Nuclear Information System (INIS)

    An attempt was made to characterise the bioavailability of 237Pu and 241Am for the pond snail Lymnaea stagnalis L. in selected surface waters. The uptake, distribution and retention patterns were studied through the contamination route water-snail. The effects of a number of parameters, such as seasonal variation, water type (pH, conductivity, ionic composition) and presence of food, on the bioavailability of the transuranics were evaluated. Finally, an assessment was made concerning the chemical speciation of plutonium and americium in the selected freshwaters

  6. Analysis of the elastic scattering measured with a 23.7 MeV 7Be beam on a 9Be target

    International Nuclear Information System (INIS)

    We present new data for the reaction 7Be+9Be measured at Elab = 23.7 MeV. The elastic scattering angular distribution has been analyzed using the phenomenological optical model and the coupled-channels method. In the latter approach, we assumed a two-cluster model of the 7Be nucleus, and we included explicitly the ground state and first excited state of this nucleus. The contribution of the inelastic excitation of the 7Be nucleus to the quasielastic cross sections has been investigated.

  7. The neutron capture cross sections of 237Np(n,γ) and 240Pu(n,γ) and its relevance in the transmutation of nuclear waste

    International Nuclear Information System (INIS)

    Neutron capture cross sections of actinides are of great relevance for the Transmutation of Nuclear Waste in Accelerator Driven Systems (ADS) and Generation-IV reactors. The neutron capture cross sections of 237Np and 240Pu in the range of 1 eV to 2 keV were measured at the n-TOF facility with a Total Absorption Calorimeter. The data have been analyzed with the SAMMY code. The corresponding covariance matrices have been generated. The final cross sections are presented and compared to the previously existing ones.The n-TOF 237Np σ(n,γ) is in agreement with the evaluated data files below 300 eV and its is lower by 10 to 15% up to 2 keV. This discrepancy with the evaluated data files is also observed in the capture cross section derived from the transmission measurements of Gressier et al. In the case of the 240Pu σ(n,γ), the n-TOF σ(n,γ) agrees within uncertainties with JENDL-3.3 and JEFF-3.1, except for a group of resonances around 800 eV. Endf/B-VII data are lower than n-TOF and the mentioned evaluations, with differences that increase with neutron energy up to 15-20 per cent

  8. The neutron capture cross sections of {sup 237}Np(n,{gamma}) and {sup 240}Pu(n,{gamma}) and its relevance in the transmutation of nuclear waste

    Energy Technology Data Exchange (ETDEWEB)

    Guerrero, C.; Abbondanno, U.; Aerts, G.; Alvarez, H.; Alvarez-Velarde, F.; Andriamonje, S.; Andrzejewski, J.; Assimakopoulos, P.; Audouin, L.; Badurek, G.; Baumann, P.; Becvar, F.; Berthoumieux, E.; Calvino, F.; Calviani, M.; Cano-Ott, D.; Capote, R.; Carrapico, C.; Cennini, P.; Chepel, V.; Chiaveri, E.; Colonna, N.; Cortes, G.; Couture, A.; Cox, J.; Dahlfors, M.; David, S.; Dillmann, I.; Domingo-Pardo, C.; Dridi, W.; Duran, I.; Eleftheriadis, C.; Embid-Segura, M.; Ferrant, L.; Ferrari, A.; Ferreira-Marques, R.; Fujii, K.; Furman, W.; Goncalves, I.; Gonzalez-Romero, E.; Gramegna, F.; Gunsing, F.; Haas, B.; Haight, R.; Heil, M.; Herrera-Martinez, A.; Igashira, M.; Jericha, E.; Kappeler, F.; Kadi, Y.; Karadimos, D.; Karamanis, D.; Kerveno, M.; Koehler, P.; Kossionides, E.; Krticka, M.; Lampoudis, C.; Leeb, H.; Lindote, A.; Lopes, I.; Lozano, M.; Lukic, S.; Marganiec, J.; Marrone, S.; Martinez, T.; Massimi, C.; Mastinu, P.; Mengoni, A.; Milazzo, P.M.; Moreau, C.; Mosconi, M.; Neves, F.; Oberhummer, H.; O' Brien, S.; Pancin, J.; Papachristodoulou, C.; Papadopoulos, C.; Paradela, C.; Patronis, N.; Pavlik, A.; Pavlopoulos, P.; Perrot, L.; Pigni, M.T.; Plag, R.; Plompen, A.; Plukis, A.; Poch, A.; Praena, J.; Pretel, C.; Quesada, J.; Rauscher, T.; Reifarth, R.; Rubbia, C.; Rudolf, G.; Rullhusen, P.; Salgado, J.; Santos, C.; Sarchiapone, L.; Savvidis, I.; Stephan, C.; Tagliente, G.; Tain, J.L.; Tassan-Got, L.; Tavora, L.; Terlizzi, R.; Vannini, G.; Vaz, P.; Ventura, A.; Villamarin, D.; Vincente, M.C.; Vlachoudis, V.; Vlastou, R.; Voss, F.; Walter, S.; Wiescher, M.; Wisshak, K

    2008-07-01

    Neutron capture cross sections of actinides are of great relevance for the Transmutation of Nuclear Waste in Accelerator Driven Systems (ADS) and Generation-IV reactors. The neutron capture cross sections of {sup 237}Np and {sup 240}Pu in the range of 1 eV to 2 keV were measured at the n-TOF facility with a Total Absorption Calorimeter. The data have been analyzed with the SAMMY code. The corresponding covariance matrices have been generated. The final cross sections are presented and compared to the previously existing ones.The n-TOF {sup 237}Np {sigma}(n,{gamma}) is in agreement with the evaluated data files below 300 eV and its is lower by 10 to 15% up to 2 keV. This discrepancy with the evaluated data files is also observed in the capture cross section derived from the transmission measurements of Gressier et al. In the case of the {sup 240}Pu {sigma}(n,{gamma}), the n-TOF {sigma}(n,{gamma}) agrees within uncertainties with JENDL-3.3 and JEFF-3.1, except for a group of resonances around 800 eV. Endf/B-VII data are lower than n-TOF and the mentioned evaluations, with differences that increase with neutron energy up to 15-20 per cent.

  9. Adsorption-desorption characteristics of plutonium and americium with sediment particles in the estuarine environment: studies using plutonium-237 and americium-241

    International Nuclear Information System (INIS)

    The particle formation of plutonium and americium, their adsorption onto fresh water sediments and the desorption from the sediments in sea water were studied in the Laboratory under simulated river-estuary conditions, using γ-emitting plutonium-237 and americium-241. The results of the experiments show that the particle formation of plutonium depends on its valence states, on pH and on the salinity of the medium. For river water at pH4, some 25%, 20% and 30% of the added 237Pu was in particulate form, larger than 0.45 μm, for Pu (III), Pu (IV) and Pu (VI), respectively, while 65%, 90% and 50% of the respective valence states was associated with particles at pH 8. In sea water the general pattern remains similar, although Pu (VI) is more soluble in sea water owing to higher ligand concentrations for carbonate and bicarbonate complexes. The pH-dependency of particle formation of Am (III) is more steep than that of plutonium and seems to be influenced by colloidal substances occurring in the experimental media. The adsorption-desorption characteristics of plutonium and americium with the sediment in river water as well as sea water reflect the characteristics of their particle formation, being dependent upon such properties as valence states, the pH and salinity of the medium. A sewage effluent added to the media has small but measurable effects on the adsorption-desorption processes of plutonium. (author)

  10. Early retention and distribution of monomeric 237Pu(IV) and 239Pu(IV) in C57BL/Do mice

    International Nuclear Information System (INIS)

    The early metabolism of monomeric Pu may depend upon its in vivo concentration, since in higher concentrations it may polymerize forming radiocolloids and be subject to phagocytosis. In this study the early biological behavior of 237Pu(IV) and 239Pu(IV), administered by intraperitoneal injection in citrate solution into C57BL/Do mice, is compared with the in vivo concentrations of these two nuclides differing by a factor of 105. 237Pu is also used as a γ-ray tracer of the α-emitting 239Pu in order to determine the latter's biological retention and tissue distribution. The results show no significant difference in the metabolism of the two nuclides throughout a 91 day serial sacrifice schedule. However, there is a significant sex dependence in the total body retention of Pu primarily due to a factor of 2.7 greater quantity of Pu excreted by the female during the first 24 hours post-injection. Furthermore, the half-time for removal of Pu from the livers of males is 42.7 +- 5.5 days and from livers of females 29.0 +- 2.7 days

  11. Standard practice for the determination of 237Np, 232Th, 235U and 238U in urine by inductively coupled plasma-Mass spectrometry (ICP-MS) and gamma ray spectrometry.

    CERN Document Server

    American Society for Testing and Materials. Philadelphia

    2005-01-01

    1.1 This practice covers the separation and preconcentration of neptunium-237 (237Np), thorium-232 (232Th), uranium-235 (235U) and uranium-238 (238U) from urine followed by quantitation using ICP-MS. 1.2 This practice can be used to support routine bioassay programs. The minimum detectable concentrations (MDC) for this method, taking the preconcentration factor into account, are approximately 1E-2Bq for 237Np (0.38ng), 2E-6Bq for 232Th (0.50ng), 4E-5Bq for 235U (0.50ng) and 6E-6Bq for 238U (0.48ng). 1.3 This standard does not purport to address all of the safety problems, if any, associated with its use. It is the responsibility of the user of this standard to establish appropriate safety and health practices and determine the applicability of regulatory limitations prior to use.

  12. Delayed neutron and delayed photon characteristics from photofission of 232Th, 235,238U, and 237Np with endpoint Bremsstrahlung photons in the giant dipole resonance region

    International Nuclear Information System (INIS)

    A renewed interest in photonuclear reactions was stimulated by applications as radioactive ion beam production, irradiation stations by high energy photons, shielding of electron accelerators, etc. Today, a particular attention is paid to the non-destructive characterization of waste barrels and the detection of nuclear materials, both based on photofission process and the associated delayed neutron (DN) and delayed photon (DP) emissions. The need of accurate and complete data for DN and DP yields and time characteristics of actinides was the motivation for an experimental campaign, started in 2004. In this paper, the experimental setup and the data analysis method will be presented and the modeling work will be described. Experimental results for DN and DP characteristics will be compared to calculations in the case of photofission of 232Th, 235,238U, and 237Np. (authors)

  13. Mass asymmetry dependence of fusion time-scales in 11B+237Np and 12C, 16O, 19F+232Th reactions in a dynamical trajectory model

    International Nuclear Information System (INIS)

    Dynamical trajectory calculations were carried out for the reactions of 11B+237Np and 12C, 16O and 19F+232Th, having mass asymmetries on either side of the Businaro-Gallone critical mass asymmetry αBG, in order to examine the mass asymmetry dependence of fusion reactions in these systems. The compound nucleus formation times were calculated as a function of the partial wave of the reaction for all the systems. This study brings out that for systems with αBG, the formation times are significantly larger than for α>αBG, which is caused by the dynamical effects involved in the large scale shape changes taking place in the fusion process as well as due to the interplay between the thermal and the collective motion during the collision process. The calculated time scales are comparable to the experimental values derived from the pre-fission neutron multiplicity measurements. (author). 16 refs., 4 figs., 1 tab

  14. Calculation of fusion time scales in 11B + 237Np, 12C + 232Th and 16O + 232Th reactions in a dynamical trajectory model

    International Nuclear Information System (INIS)

    There are several theoretical models which treat the fusion process and energy dissipation in heavy ion collision in terms of a fluctuating force represented by the coupling between macroscopic and intrinsic degrees of freedom. One such dynamical model has been developed by Feldmeier (1987), where the properties of the dissipative force are determined from a microscopic picture of particle exchange between two nuclei. The macroscopic shapes of the nuclear system are represented by axially symmetric configuration with sharp surfaces. We have used the above model to calculate the fusion time scales for the systems 11B + 237Np, 12C +232Th and 16O + 232Th at 77, 86 and 104 MeV bombarding energies to examine the effect of mass asymmetry in fusion dynamics. (author). 2 figs

  15. Transmutation of 129I and 237Np using spallation neutrons produced by 1.5, 3.7 and 7.4 GeV protons

    International Nuclear Information System (INIS)

    Small samples of approximately 1 g of 129I and 237Np, two long-lived radioactive waste nuclides, were exposed to spallation neutron fluences from relatively small metal targets of lead or uranium, surrounded with a paraffin moderator 6 cm thick irradiated with 1.5, 3.7 and 7.4 GeV protons. The (n, γ) transmutation rates have been determined for the two radioactive waste nuclides. Conventional radiochemical La and U sensors and a variety of solid-state nuclear track detectors were irradiated simultaneously with secondary neutrons. The observed secondary neutron fluences appear to be systematically larger, as compared to the calculations with the well-known cascade codes (LAHET from Los Alamos and DCM-CEM from Dubna)

  16. Sequential Injection Method for Rapid and Simultaneous Determination of 236U, 237Np, and Pu Isotopes in Seawater

    DEFF Research Database (Denmark)

    Qiao, Jixin; Hou, Xiaolin; Steier, Peter;

    2013-01-01

    target analytes, whereupon plutonium and neptunium were simultaneously isolated and purified on TEVA, while uranium was collected on UTEVA. The separation behavior of U, Np, and Pu on TEVA–UTEVA columns was investigated in detail in order to achieve high chemical yields and complete purification...... for the radionuclides of interest. 242Pu was used as a chemical yield tracer for both plutonium and neptunium. 238U was quantified in the sample before the separation for deducing the 236U concentration from the measured 236U/238U atomic ratio in the separated uranium target using accelerator mass spectrometry....... Plutonium isotopes and 237Np were measured using inductively coupled plasma mass spectrometry after separation. The analytical results indicate that the developed method is robust and efficient, providing satisfactory chemical yields (70–100%) of target analytes and relatively short analytical time (8 h/sample)....

  17. Study of the mass, nuclear charge and kinetic energy distribution of the fission fragments produced in the reaction 237 Np (2n th, f)

    International Nuclear Information System (INIS)

    In this work, we report fission fragment mass, energy and charge distributions measured for the fissioning nucleus: 239 Np 146, This odd Z nucleus is formed after double thermal neutron capture on to the 237 Np 144 target nucleus. These measurements were performed at the I.L.L. recoil mass spectrometer ''Lohengrin'' in Grenoble. The fission fragments were registered by an ionisation chamber placed at the focal plane of the spectrometer. The obtained distributions are compared to the 240 Pu 146 fragment mass, energy and charge distributions. They are discussed within the Wilkins' scission-point model. Cold fission has been studied while selecting fragmentations with final kinetic energies close to the maximum energy released in the reaction. These cold fission events are discussed according to a calculation based on the Wilkins' scission-point model extrapolated to the cold fragmentation case. 51 refs

  18. Neutron induced fission cross section ratios for 232Th, /sup 235,238/U, 237Np, and 239Pu from 1 to 400 MeV

    International Nuclear Information System (INIS)

    Time-of-flight measurements of neutron induced fission cross section ratios for 232Th, /sup 235,238/U, 237Np, and 239Pu, were performed using the WNR high intensity spallation neutron source located at Los Alamos National Laboratory. A multiple-plate gas ionization chamber located at a 20-m flight path was used to simultaneously measure the fission rate for all samples over the energy range from 1 to 400 MeV. Because the measurements were made with nearly identical neutron fluxes, we were able to cancel many systematic uncertainties present in previous measurements. This allows us to resolve discrepancies among different data sets. In addition, these are the first neutron-induced fission cross section values for most of the nuclei at energies above 30 MeV. 8 refs., 3 figs

  19. Neutron-induced fission cross section of 237Np in the keV to MeV range at the CERN n_TOF facility

    Science.gov (United States)

    Diakaki, M.; Karadimos, D.; Vlastou, R.; Kokkoris, M.; Demetriou, P.; Skordis, E.; Tsinganis, A.; Abbondanno, U.; Aerts, G.; Álvarez, H.; Alvarez-Velarde, F.; Andriamonje, S.; Andrzejewski, J.; Assimakopoulos, P.; Audouin, L.; Badurek, G.; Baumann, P.; Bečvář, F.; Berthoumieux, E.; Calviani, M.; Calviño, F.; Cano-Ott, D.; Capote, R.; Carrillo de Albornoz, A.; Cennini, P.; Chepel, V.; Chiaveri, E.; Colonna, N.; Cortes, G.; Couture, A.; Cox, J.; David, S.; Dolfini, R.; Domingo-Pardo, C.; Dorochenko, A.; Dridi, W.; Duran, I.; Eleftheriadis, Ch.; Embid-Segura, M.; Ferrant, L.; Ferrari, A.; Ferreira-Marques, R.; Fitzpatrick, L.; Frais-Koelbl, H.; Fuji, K.; Furman, W.; Goncalves, I.; Gallino, R.; Gonzalez-Romero, E.; Goverdovski, A.; Gramegna, F.; Griesmayer, E.; Guerrero, C.; Gunsing, F.; Haas, B.; Haight, R.; Heil, M.; Herrera-Martinez, A.; Igashira, M.; Ioannidis, K.; Isaev, S.; Jericha, E.; Kadi, Y.; Käppeler, F.; Karamanis, D.; Kerveno, M.; Ketlerov, V.; Koehler, P.; Kolokolov, D.; Konovalov, V.; Krtička, M.; Lamboudis, C.; Leeb, H.; Lindote, A.; Lopes, I.; Lozano, M.; Lukic, S.; Marganiec, J.; Marques, L.; Marrone, S.; Massimi, C.; Mastinu, P.; Mengoni, A.; Milazzo, P. M.; Moreau, C.; Mosconi, M.; Neves, F.; Oberhummer, H.; O'Brien, S.; Oshima, M.; Pancin, J.; Papadopoulos, C.; Paradela, C.; Patronis, N.; Pavlik, A.; Pavlopoulos, P.; Perrot, L.; Plag, R.; Plompen, A.; Plukis, A.; Poch, A.; Pretel, C.; Quesada, J.; Rauscher, T.; Reifarth, R.; Rosetti, M.; Rubbia, C.; Rudolf, G.; Rullhusen, P.; Salgado, J.; Sarchiapone, L.; Savvidis, I.; Sedysheva, M.; Stamoulis, K.; Stephan, C.; Tagliente, G.; Tain, J. L.; Tassan-Got, L.; Tavora, L.; Terlizzi, R.; Vannini, G.; Vaz, P.; Ventura, A.; Villamarin, D.; Vincente, M. C.; Vlachoudis, V.; Voss, F.; Wendler, H.; Wiescher, M.; Wisshak, K.; n TOF Collaboration

    2016-03-01

    The neutron-induced fission cross section of 237Np was experimentally determined at the high-resolution and high-intensity facility n_TOF, at CERN, in the energy range 100 keV to 9 MeV, using the 235U(n ,f ) and 238U(n ,f ) cross section standards below and above 2 MeV, respectively. A fast ionization chamber was used in order to detect the fission fragments from the reactions and the targets were characterized as far as their mass and homogeneity are concerned by means of α spectroscopy and Rutherford backscattering spectroscopy respectively. Theoretical calculations within the Hauser-Feshbach formalism have been performed, employing the empire code, and the model parameters were tuned in order to successfully reproduce the experimental fission cross-sectional data and simultaneously all the competing reaction channels.

  20. Delayed neutron and delayed photon characteristics from photofission of 232Th, 235,238U, and 237Np with endpoint Bremsstrahlung photons in the giant dipole resonance region

    Science.gov (United States)

    Doré, D.; Dighe, P. M.; Berthoumieux, E.; Laborie, J.-M.; Ledoux, X.; Macary, V.; Panebianco, S.; Ridikas, D.

    2009-10-01

    A renewed interest in photonuclear reactions was stimulated by applications as radioactive ion beam production, irradiation stations by high energy photons, shielding of electron accelerators, etc. Today, a particular attention is paid to the non-destructive characterization of waste barrels and the detection of nuclear materials, both based on photofission process and the associated delayed neutron (DN) and delayed photon (DP) emissions. The need of accurate and complete data for DN and DP yields and time characteristics of actinides was the motivation for an experimental campaign, started in 2004. In this paper, the experimental setup and the data analysis method will be presented and the modeling work will be described. Experimental results for DN and DP characteristics will be compared to calculations in the case of photofission of 232Th, 235,238U, and 237Np.

  1. Transmutation of 129I, 237Np, 238Pu, 239Pu, and 241Am using neutrons produced in target-blanket system `Energy plus Transmutation' by relativistic protons

    Indian Academy of Sciences (India)

    J Adam; K Katovsky; A Balabekyan; V G Kalinnikov; M I Krivopustov; H Kumawat; A A Solnyshkin; V I Stegailov; S G Stetsenko; V M Tsoupko-Sitnikov; W Westmeier

    2007-02-01

    Target-blanket facility `Energy + Transmutation' was irradiated by proton beam extracted from the Nuclotron Accelerator in Laboratory of High Energies of Joint Institute for Nuclear Research in Dubna, Russia. Neutrons generated by the spallation reactions of 0.7, 1.0, 1.5 and 2 GeV protons and lead target interact with subcritical uranium blanket. In the neutron field outside the blanket, radioactive iodine, neptunium, plutonium and americium samples were irradiated and transmutation reaction yields (residual nuclei production yields) have been determined using -spectroscopy. Neutron field's energy distribution has also been studied using a set of threshold detectors. Results of transmutation studies of 129I, 237Np, 238Pu, 239Pu and 241Am are presented.

  2. South Equatorial Current (SEC) driven changes at DSDP Site 237, Central Indian Ocean, during the Plio-Pleistocene: Evidence from Benthic Foraminifera and Stable Isotopes

    Science.gov (United States)

    Gupta, Anil K.; Das, Moumita; Bhaskar, K.

    2006-12-01

    This study attempts to analyse paleoceanographic changes in the Central Indian Ocean (Deep Sea Drilling Project Site 237), linked to monsoon variability as well as deep-sea circulation during the Plio-Pleistocene. We used factor and cluster analyses of census data of the 34 most dominant species of benthic foraminifera that enabled us to identify five biofacies: Astrononion umbilicatulum- Uvigerina proboscidea (Au-Up), Pullenia bulloides- Bulimina striata (Pb-Bs), Globocassidulina tumida- Nuttallides umbonifera (Gt-Nu), Gyroidinoides nitidula- Cibicides wuellerstorfi (Gn-Cw) and Cassidulina carinata- Cassidulina laevigata (Cc-Cl) biofacies. Knowledge of the environmental preferences of modern deep-sea benthic foraminifera helped to interpret the results of factor and cluster analyses in combination with oxygen and carbon isotope values. The biofacies indicative of high surface productivity, resulting from a stronger South Equatorial Current (Au-Up and Pb-Bs biofacies), dominate the early Pliocene interval (5.6-4.5 Ma) of global warmth. An intense Indo-Pacific 'biogenic bloom' and strong Oxygen Minimum Zone extended to intermediate depths (˜1000-2000 m) over large parts of the Indian Ocean in the early Pliocene. Since 4.5 Ma, the food supply in the Central Indian Ocean dropped and fluctuated while deep waters were corrosive (biofacies Gt-Nu, Gn-Cw). The Pleistocene interval is characterized by an intermediate flux of organic matter (Cc-Cl biofacies).

  3. Application of digital signal-processing technique to delayed-neutron yield measurements on thermal-neutron induced fission of 237Np

    International Nuclear Information System (INIS)

    The measurement procedure based on the continuous thermal-neutron beam modulation with a mechanical chopper was developed for delayed-neutron yield measurement of the thermal-neutron induced fission of 237Np. The idea of the procedure is similar to that which is widely used in modern communications for the nonauthorized data access prevention. The data is modulated with predefined pattern before transmission to the public network and only the recipient that has the modulation pattern is able to demodulate it upon reception. For the thermal-neutron induced reaction applications, the thermal-neutron beam modulation pattern was used to demodulate the measured delayed-neutron intensity signals on the detector output resulting in nonzero output only for the detector signals correlated with the beam modulation pattern. A comparison of the method with the conventional measurement procedure was provided, and it was demonstrated that the cross-correlation procedure has special features making it superior over the conventional one when the measured value difference from the background is extremely small. Due to strong sensitivity of measurement procedure on the modulation pattern of the neutron beam, one can implement the modulation pattern of specific shape to separate the effect of the thermal part of the beam from the higher energy one in the most confident way in a particular experiment

  4. Experimental study of the neutron induced fission cross-section of 234U, 237Np and 243Am with time-of-flight spectrometry technics

    International Nuclear Information System (INIS)

    The current work concentrates on the measurements of the nuclear data needed for solving the problem of transmutation of radiotoxic waste. It includes fission cross-section of 234U in the energy range from thermal to 1 MeV, 237Np and 243Am in the resonance region and average group capture cross-section of 234U and 236U. Almost all of these data are recommended by IAEA as a first priority needs for transmutation problem. Another objective is to obtain the high resolution data of the fission cross-section of the 234U on the fission barrier to confirm the existence of the fine structure, attributed to the vibrational resonances in the third well of the fission barrier. The Dissertation summarizes more, than 10 years of the experiments, performed on the pulsed neutron sources IBR-2 and IBR-30 of Frank Laboratory of Neutron Physics of the Joint Institute for Nuclear Research (FLNP JINR) in Dubna, Russia; 'Fakel' of Russian Scientific Center 'Kurchatov's Institute' and n-TOF of CERN. The TOF technique was used for neutron energy spectrometry and various kinds of detectors to mark the fission events. The independent measurements of the same isotopes done on different neutron sources and sometimes with different techniques gives strong, self-consistent set of data. (author)

  5. Sequential leaching extraction of 239,240Pu, 238Pu, 241Pu, 237Np and 241Am from a mud sample: An intercomparison study

    International Nuclear Information System (INIS)

    The transuranics content of a mud sample taken from a nuclear waste storage container was analysed employing two different sequential extraction methods. The following fractions were isolated: (1)Water soluble (2) Readily available (3) Carbonate bound and specifically adsorbed (4) Organically bound (5) Oxide and hydroxides bound and (6) residual. Both methods differ in the reagents employed, the extraction sequence applied as well as the temperature and means of extraction. The 239,240Pu, 238Pu, 237Np and 241Am extracted in each phase were determined using standard radiochemical procedures. 241Pu was analysed through the 241Am in-growth on just one old disk of the residual fraction containing plutonium. Plutonium was mainly associated to organic-oxides fractions (89-92 %). The percentage extracted in each fraction depended on the method and the extraction sequence used. The soluble fraction of plutonium was less than 13%. Neptunium seemed to be the more soluble than the other transuranics (27%) and the americium showed a tendency to be associated to carbonates (30%). (author)

  6. In silico metabolic engineering of Bacillus subtilis for improved production of riboflavin, Egl-237, (R,R)-2,3-butanediol and isobutanol.

    Science.gov (United States)

    Hao, Tong; Han, Binbin; Ma, Hongwu; Fu, Jing; Wang, Hui; Wang, Zhiwen; Tang, Bincai; Chen, Tao; Zhao, Xueming

    2013-08-01

    Bacillus subtilis is a Gram-positive sporiferous bacterium widely used in a variety of industrial fields as a producer of high-quality vitamins, enzymes and proteins. Many genetic modifications and evolutionary engineering optimisations aiming at obtaining a better performing strain for its products have been studied. As genome-scale metabolic network models have gained significant popularity as effective tools in metabolic phenotype studies, we reconstructed a genome-scale metabolic network of B. subtilis-iBsu1147. The accuracy of iBsu1147 is validated by growth on various carbon sources, single gene knockout and large fragment non-essential gene knockout simulations. The model is used for the in silico metabolic engineering design of reactions over/underexpressed or knockout for increasing the production of four important products of B. subtilis: riboflavin, cellulase Egl-237, (R,R)-2,3-butanediol and isobutanol. The simulation predicted candidate reactions related to the improvement of strain performance on related products. The prediction is partly supported by previously published results. Due to the complexity of the biological system, it is difficult to manually find the factors that are not directly related to the production of the target compounds. The in silico predictions provide more choices for further strain improvement for these products. PMID:23666098

  7. Excited levels of 238Np from spectroscopic measurements of the 237Np(n,γ)238Np reaction and /sup 242m/Am alpha decay

    International Nuclear Information System (INIS)

    The gamma rays and conversion electrons emitted following neutron capture in a 237Np target have been measured by use of the GAMS and BILL spectrometers at Grenoble. Gamma ray and alpha particle measurements of /sup 242m/Am alpha decay (Ge(Li)γ singles, γ-γ coincidences, α singles) have been made at Livermore. The data from these measurements have been combined with earlier measurements (Ionescu 1979, Asaro 1964) to produce a more detailed level scheme for 238Np. Approximately 36 levels have been identified from all of the experimental evidence. The experimentally-observed bandhead energies can be compared with predicted values derived from a simple linear addition of excitation energies observed in neighboring odd-mass nuclei. Values for the Gallagher-Moszkowski splitting of each configurational pair were obtained from theoretical calculations (Piepenbring 1978). We have assigned configurations to ten rotational bands whose bandhead energies range from 0 to 342 keV and which represent all but one of the configurations predicted to occur below 385 keV

  8. Capture and Fission rate of 232-Th, 238-U, 237-Np and 239-Pu from spallation neutrons in a huge block of lead.

    CERN Document Server

    Vlachoudis, Vasilis

    2000-01-01

    The study is centered on the research of the incineration possibility of nuclear waste, by the association of a particle accelerator with a multiplying medium of neutrons, in the project "Energy Amplifier" of C. Rubbia. It consists of the experimental determination of the rates of capture and fission of certain elements (232-Th, 238-U, 237-Np and 239-Pu) subjected to a fluence of fast spallation neutrons. These neutrons are produced by the interaction of high kinetic energy protons (several GeV) provided by the CERN-PS accelerator, on a large lead solid volume. The measurement techniques used in this work, are based on the activation of elements in the lead volume and the subsequent gamma spectroscopy of the activated elements, and also by the detection of fission fragment traces. The development, of a Monte Carlo code makes it possible, on one hand, to better understand the relevant processes, and on the other hand, to validate the code, by comparison with measurements, for the design and the construction of...

  9. Determination of neutron resonance parameters of Neptunium 237 between 0 and 500 eV. The covariance matrices of statistical and of systematic origin, relating the resonance parameters, are also given; Determination des parametres des resonances neutroniques du neptunium 237, en dessous de 500eV, et obtention des matrices de covariances statistiques et systematiques entre les parametres de ces resonances

    Energy Technology Data Exchange (ETDEWEB)

    Lepretre, A.; Herault, N. [CEA Saclay, Dept. d' Astrophysique de Physique des Particules, de Physique Nucleaire et de l' Instrumentation Associee, 91- Gif sur Yvette (France); Brusegan, A.; Noguere, G.; Siegler, P. [Institut des Materiaux et des Metrologies - IRMM, Joint Research Centre, Gell (Belgium)

    2002-12-01

    This report is a follow up of the report CEA DAPNIA/SPHN-99-04T of Vincent Gressier. In the frame of a collaboration between the 'Commissariat a l'Energie Atomique (CEA)' and the Institute for Reference Materials and Measurement (IRMM, Geel, Belgique), the resonance parameters of neptunium 237 have been determined in the energy interval between 0 and 500 eV. These parameters have been obtained by using the Refit code in analysing simultaneously three transmission experiments. The covariance matrix of statistical origin is provided. A new method, based on various sensitivity studies is proposed for determining also the covariance matrix of systematic origin, relating the resonance parameters. From an experimental viewpoint, the study indicated that, with a large probability, the background spectrum has structure. A two dimensional profiler for the neutron density has been proved feasible. Such a profiler could, among others, demonstrate the existence of the structured background. (authors)

  10. Study of the excited levels of 233{sup P}a by the 237{sup N}p alpha decay; Estudio de los niveles excitados en el 233{sup P}a por la desintegracion alfa del 237{sup N}p

    Energy Technology Data Exchange (ETDEWEB)

    Gonzalez, J.; Gaeta, R.; Vano, E.; Los Arcos, J. M.

    1978-07-01

    The excited levels in 233{sup P}a following the 237{sup N}p alpha decay have been studied, by performing different experiences to complete available data and supply new information. Thus, two direct alpha spectrum measurement, one alpha-gamma bidimensional coincidence experiment, three gamma-gamma and gamma-X ray coincidences and some other measurements of the gamma spectrum, direct and coincident with alpha-particles have been made. These last experiences have allowed to obviate usual radiochemical separation methods, the 233{sup P}a radioactive descendent interferences being eliminated by means of the coincidence technic. As a result, a primary decay scheme has been elaborated, including 15 new gamma transitions and two new levels, not observed in the most recent works. (Author) 60 refs.

  11. Nuclear data evaluation for 237Np, 241Am, 242gAm and 242mAm irradiated by neutrons and protons at energies up to 250 MeV

    International Nuclear Information System (INIS)

    Evaluation of nuclear data has been performed for 237Np, 241Am, 242gAm and 242mAm. Neutron data were obtained at energies from 20 to 250 MeV and combined with JENDL-3.3 data at 20 MeV. Evaluation of the proton data has been done from 1 to 250 MeV. The coupled channel optical model was used to obtain angular distributions for elastic and inelastic scattering and transmission coefficients. Pre-equilibrium exciton model and Hauser-Feshbach statistical model were used to describe neutron and charged particles emission from excited nuclei. These evaluation is the first work for producing full sets of evaluated file up to 250 MeV for 237Np and Americium isotopes. (author)

  12. Evaluation and improvement of cross section accuracy for most important dosimetry reactions 27Al(n,p), 56Fe(n,p) and 237Np(n,f) including covariance data

    International Nuclear Information System (INIS)

    New evaluations of cross sections and their uncertainties for dosimetry reactions 27Al(n,p) , 56Fe(n,p) and 237Np(n,f) have been carried out in the frame work of IAEA Research Contract No. 11372/RB. Data files prepared for this reactions in the ENDF-6 format may be consider as candidates for the new International Reactor Dosimetry File: IRDF-2002. (author)

  13. 16 CFR 23.7 - Misuse of the words “platinum,” “iridium,” “palladium,” “ruthenium,” “rhodium,” and “osmium.”

    Science.gov (United States)

    2010-01-01

    ... § 23.7 Misuse of the words “platinum,” “iridium,” “palladium,” “ruthenium,” “rhodium,” and “osmium.” (a) It is unfair or deceptive to use the words “platinum,” “iridium,” “palladium,” “ruthenium,” “rhodium... Platinum, Iridium, Palladium, Ruthenium, Rhodium, and Osmium. (b) The following are examples of markings...

  14. Oxidation-reduction properties of americium, curium, berkelium, californium, einsteinium and fermium, and thermodynamic consequences for the 5f series

    International Nuclear Information System (INIS)

    The amalgamation of 5f elements from Am to Fm has been studied by using 241Am, 244Cm, 249Bk, 249Cf, 252Cf, 253Es, 254Es, 252Fm and 255Fm with two electrochemical methods, radiocoulometry and radiopolarography, perfectly adapted to investigate extremely diluted solutions when the concentration of electroactive species is as low as 10-16M. The theory of radiocoulometry has been developed in the general cases of reversible and irreversible electrode process. It has been used to interpret the experimental data on the kinetic curves of amalgamation, and to estimate the standard rate constant of the electrode process in complexing medium (citric). On the other hand the radiopolarographic method has been applied to study the mechanism of reduction at the dropping mercury electrode of cations M3+ in aqueous medium to the metal M with formation of amalgam. The results are exploited into two directions: 1- Acquisition of some data concerning the oxidation-reduction properties of elements from Am to Fm. Therefore the standard electrode E0 [M(III-0)] potentials for Bk, Cf and Es, and the standard electrode E0 [M(II-0)] potential for Fm are estimated and the relative stability of each oxidation state (from II to VII) of 5f elements is discussed; 2- Acquisition of unknown thermodynamic data on transcalifornium elements. Correlations between 4f and 5f elements are precised and some divergences appear for the second half of 4f and 5f series (i.e. for 65<=Z<=71 and 97<=Z<=103)

  15. Evaluation of thermal neutron cross-sections and resonance integrals of protactinium, americium, curium, and berkelium isotopes

    International Nuclear Information System (INIS)

    Data on the thermal neutron fission and capture cross-sections as well as their corresponding resonance integrals are reviewed and analysed. The data are classified according to the form of neutron spectra under investigation. The weighted mean values of the cross-sections and resonance integrals for every type of neutron spectra were adopted as evaluated data. (author). 87 refs, 2 tabs

  16. The Effect of Radiation Dose and Chemotherapy on Overall Survival in 237 Patients With Stage III Non-Small-Cell Lung Cancer

    International Nuclear Information System (INIS)

    Purpose: To study the effects of radiation dose, chemotherapy, and their interaction in patients with unresectable or medically inoperable Stage III non-small-cell lung cancer (NSCLC). Methods and Materials: A total of 237 consecutive Stage III NSCLC patients were evaluated. Median follow-up was 69.0 months. Patients were treated with radiation therapy (RT) alone (n = 106), sequential chemoradiation (n = 69), or concurrent chemoradiation (n = 62). The primary endpoint was overall survival (OS). Radiation dose ranged from 30 to 102.9 Gy (median 60 Gy), corresponding to a bioequivalent dose (BED) of 39 to 124.5 Gy (median 72 Gy). Results: The median OS of the entire cohort was 12.6 months, and 2- and 5-year survival rates were 22.4% and 10.0%, respectively. Multivariable Cox regression model demonstrated that Karnofsky performance status (p = 0.020), weight loss < 5% (p = 0.017), chemotherapy (yes vs. no), sequence of chemoradiation (sequential vs. concurrent; p < 0.001), and BED (p < 0.001) were significant predictors of OS. For patients treated with RT alone, sequential chemoradiation, and concurrent chemoradiation, median survival was 7.4, 14.9, and 15.8 months, and 5-year OS was 3.3%, 7.5%, and 19.4%, respectively (p < 0.001). The effect of higher radiation doses on survival was independent of whether chemotherapy was given. Conclusion: Radiation dose and use of chemotherapy are independent predictors of OS in Stage III NSCLC, and concurrent chemoradiation is associated with the best survival. There is no interaction between RT dose and chemotherapy.

  17. VLT AND ACS OBSERVATIONS OF RDCS J1252.9-2927: DYNAMICAL STRUCTURE AND GALAXY POPULATIONS IN A MASSIVE CLUSTER AT Z=1.237*

    Energy Technology Data Exchange (ETDEWEB)

    Demarco, R; Rosati, P; Lidman, C; Girardi, M; Nonino, M; Rettura, A; Strazzullo, V; der Wel, A v; Ford, H C; Mainieri, V; Holden, B P; Stanford, S A; Blakeslee, J P; Gobat, R; Postman, M; Tozzi, P; Overzier, R A; Zirm, A W; Benitez, N; Homeier, N L; Illingworth, G D; Infante, L; Jee, M J; Mei, S; Menanteau, F; Motta, V; Zheng, W; Clampin, M; Hartig, G

    2007-03-23

    We present results from an extensive spectroscopic survey, carried out with FORS on the ESO Very Large Telescope, and from an extensive multi-wavelength imaging data set from the Advanced Camera for Surveys and ground based facilities of the cluster of galaxies RDCS J1252.9-2927. We have spectroscopically confirmed 38 cluster members in the redshift range 1.22 < z < 1.25. The distribution in velocity of these spectroscopic members yields a cluster median redshift of z = 1.237 and a rest-frame velocity dispersion of 747{sub -84}{sup +74} km s{sup -1}. Star-forming members are observed to mainly populate the outskirts of the cluster while passive galaxies dominate the central cluster region. Using the 38 confirmed redshifts, we were able to resolve, for the first time at z > 1, kinematic structure. The velocity distribution, which is not Gaussian at the 95% confidence level, is consistent with two groups that are also responsible for the projected elongation of the cluster in the East-West direction. The groups are composed of 26 and 12 galaxies and have velocity dispersions of 486{sub -85}{sup +47} km s{sup -1} and 426{sub -105}{sup +57} km s{sup -1}, respectively. The elongation is also seen in the intracluster gas (from X-ray observations) and the dark matter distribution (from a weak lensing analysis). This leads us to conclude that RDCS J1252.9-2927 has not yet reached a final virial state. We extend the analysis of the color-magnitude diagram of spectroscopic members to more than 1 Mpc from the cluster center. The scatter and slope of non-[OII]-emitting cluster members in the near-IR red sequence is similar to that seen in clusters at lower redshift. Furthermore, none of the galaxies with luminosities greater than {approx} K*{sub s} + 1.5 show any [OII] emission feature, indicating that these more luminous, redder galaxies have stopped forming stars earlier than the fainter, bluer galaxies. Our observations provide detailed dynamical and spectrophotometric

  18. Measurement of neutron-induced fission cross-sections of Th232, U238, U233 and Np237 relative to U235 from 1 MeV to 200 MeV

    Energy Technology Data Exchange (ETDEWEB)

    Shcherbakov, O.A.; Laptev, A.B.; Petrov, G.A. [Petersburg Nuclear Physics Inst., Gatchina, Leningrad district (Russian Federation); Fomichev, A.V.; Donets, A.Y.; Osetrov, O.I.

    1998-11-01

    The measurements of neutron-induced cross-section ratios for Th232, U238, U233 and Np237 relative to U235 have been carried out in the energy range from 1 MeV up to 200 MeV using the neutron time-of-flight spectrometer GNEIS based on 1 GeV proton synchrocyclotron. Below 20 MeV, the results of present measurements are roughly in agreement with evaluated data though there are some discrepances to be resolved. (author)

  19. Measurement of the Neutron Capture Cross Sections of $^{233}$U, $^{237}$Np, $^{240,242}$Pu, $^{241,243}$Am and $^{245}$Cm with a Total Absorption Calorimeter at n_TOF

    CERN Multimedia

    Beer, H; Wiescher, M; Cox, J; Rapp, W; Embid, M; Dababneh, S

    2002-01-01

    Accurate and reliable neutron capture cross section data for actinides are necessary for the poper design, safety regulation and precise performance assessment of transmutation devices such as Fast Critical Reactors or Accelerator Driven Systems (ADS). The goal of this proposal is the measurement of the neutron capture cross sections of $^{233}$U, $^{237}$Np, $^{240,242}$Pu, $^{241,243}$Am and $^{245}$Cm at n_TOF with an accuracy of 5~\\%. $^{233}$U plays an essential role in the Th fuel cycle, which has been proposed as a safer and cleaner alternative to the U fuel cycle. The capture cross sections of $^{237}$Np,$^{240,242}$Pu, $^{241,243}$Am and $^{245}$Cm play a key role in the design and optimization of a strategy for the Nuclear Waste Transmutation. A high accuracy can be achieved at n_TOF in such measurements due to a combination of features unique in the world: high instantaneous neutron fluence and excellent energy resolution of the facility, innovative Data Acquisition System based on flash ADCs and t...

  20. Gamma-Ray Holdup Measurements of U-235, Np-237, and Am-241 Content in the C and D Out-gassing Ovens in the Deactivation and Decommissioning Activities in 321-M

    International Nuclear Information System (INIS)

    The Analytical Development Section of Savannah River National Laboratory (SRNL) was requested by the Facilities Disposition Projects (FDP) to determine the holdup of enriched uranium in the 321-M facility as part of an overall deactivation project of the facility. The 321-M facility was used to fabricate enriched uranium fuel assemblies, lithium-aluminum target tubes, neptunium assemblies, and miscellaneous components for the production reactors. The results of the holdup assays are essential for determining compliance with the Waste Acceptance Criteria, Material Control and Accountability, and to meet criticality safety controls. This report covers holdup measurements in the C and D out-gassing ovens that were used to remove gas entrained in billet assembly material prior to the billets being extruded into rods by the extrusion press. A portable high purity germanium (HPGe) detection system and a portable sodium iodide (NaI) detection system were used to determine highly enriched uranium (HEU) holdup and to determine holdup of Np-237 and Am-241 that were observed in these components. The HPGe detector was run by an EG and G Dart (TM) system that contains the high voltage power supply and signal processing electronics. A personal computer with Gamma-Vision software was used to control the Dart (TM) MCA and provide space to store and manipulate multiple 4096-channel spectra. The NaI detector was run with a Canberra NaI plus MCA card that converts a personal computer to a full function multichannel analyzer and with Canberra Genie-2000 acquisition and analysis software. The measured Np-237 and Am-241 contents were especially important in these components because their presence is unusual and unexpected in 321-M. It was important to obtain a measured value of these two species to disposition the out-gassing ovens and to determine whether a separate waste stream was necessary for release of these contaminated components to the E-Area Solid Waste Vault. The reported

  1. Investigation of Neutron Spectra and Transmutation of ^{129}I, ^{237}Np and Other Nuclides with 1.5 GeV Protons from the Dubna Nuclotron Using the Electronuclear Setup "Energy plus Transmutation"

    CERN Document Server

    Krivopustov, M I; Balabekyan, A R; Batusov, Yu A; Bielewicz, M; Brandt, R; Chaloun, P; Chultem, D; Dwivedi, K K; Elishev, A F; Fragopoulou, M; Henzl, V; Henzlová, D; Kalinnikov, V G; Kievets, M K; Krása, A; Krizek, F; Kugler, A; Manolopoulou, Metaxia; Mariin, I I; Nourreddine, A; Odoj, R; Pavliouk, A V; Pronskikh, V S; Robotham, H; Siemon, K; Szuta, M; Stegailov, V I; Solnyshkin, A A; Sosnin, A N; Stoulos, S; Tsoupko-Sitnikov, V M; Tumendelger, T; Wojecehowski, A; Wagner, V; Wan, J S; Westmeier, W; Zamani-Valasiadou, M; Kumawat, H; Kumar, V; Zaverioukha, O S; Zhuk, I V

    2004-01-01

    Experiments which are part of the scientific program "Investigations of physical aspects of electronuclear method of energy production and transmutation for radioactive waste of atomic energetics using relativistic beams from the JINR Synchrophasotron/Nuclotron" (project "Energy plus Transmutation") are described. A large lead target surrounded by a four-section uranium blanket with total weight of 206.4 kg natural uranium was irradiated with 1.5 GeV protons from the new cryogenic accelerator Nuclotron. Radiochemical sensors were exposed to the secondary particle fluences inside and on top of the target assembly. Two long-lived radioactive waste of atomic energetics sensors ^{129}I and ^{237}Np (approximately 1 g weight each) and stable nuclides ^{27}Al, ^{59}Co, ^{127}I, ^{139}La, ^{197}Au and ^{209}Bi as well as natural and enriched uranium were used. In addition, various solid state nuclear track detectors and nuclear emulsions were exposed simultaneously. The experimental results confirm the theoretical e...

  2. The fission cross sections of 230Th, 232Th, 233U, 234U, 236U, 238U, 237Np, 239Pu and 242Pu relative 235U at 14.74 MeV neutron energy

    International Nuclear Information System (INIS)

    The measurement of the fission cross section ratios of nine isotopes relative to 235U at an average neutron energy of 14.74 MeV is described with particular attention to the determination of corrections and to sources of error. The results are compared to ENDF/B-V and to other measurements of the past decade. The ratio of the neutron induced fission cross section for these isotopes to the fission cross section for 235U are: 230Th - 0.290 +- 1.9%; 232Th - 0.191 +- 1.9%; 233U - 1.132 +- 0.7%; 234U - 0.998 +- 1.0%; 236U - 0.791 +- 1.1%; 238U - 0.587 +- 1.1%; 237Np - 1.060 +- 1.4%; 239Pu - 1.152 +- 1.1%; 242Pu - 0.967 +- 1.0%. 40 refs., 11 tabs., 9 figs

  3. [Hemoglobin Boumerdès alpha 2(37) (C2) Pro----Arg beta 2: a new variant of the alpha chain associated with hemoglobin S in an Algerian family].

    Science.gov (United States)

    Dahmane-Arbane, M; Blouquit, Y; Arous, N; Bardakdjian, J; Benamani, M; Riou, J; Benabadji, M; Rosa, J; Galacteros, F

    1987-01-01

    We report the first case of Hb Boumerdes, an alpha chain variant alpha 2(37) (C2) Pro----Arg beta 2, in an Algerian family. The propositus was also homozygous for the sickle cell gene. The abnormal hybrid Hb alpha 2Boum. beta 2S had an electrophoretic mobility on cellulose acetate pH 8.7 electrophoresis between those of Hb S and Hb A2. Its expression was about 16%. The alpha 2Boum. beta 2A fraction has a mobility between those of Hb F and Hb S. The effects of this mutation on Hb oxygen affinity and deoxy Hb S polymer formation were not studied. The propositus' sickle cell phenotype was benign. PMID:3438164

  4. Fission Fragment Folding Angle Distributions for the Systems 11B+237Np, 12C+236U, and 16O+232Th in the Energy Range 1.1B<2.1

    International Nuclear Information System (INIS)

    Fission fragment folding angle distributions have been measured for the systems 11B+237Np, 12C+236U, and 16O+232Th, populating the same compound nucleus (248Cf) and at similar excitation energies (Ex 45-100 MeV). The full momentum transfer and incomplete momentum transfer fusion-fission components have been separated over the bombarding energy range 1.1c.m/VB 2.1. It is observed that the largest value of the ratio of the transfer fission to the total fission is around 10 to 15% at the highest energy investigated. Over the energy range mentioned above, it is found that the transfer fission corrected fission fragment anisotropies are not significantly different from the values already obtained from the analysis of the total fission data reported earlier and hence the conclusions reached from the inclusive data remain unchanged. The anisotropy data were analyzed for the two cases corresponding to fission events with sizable fission barriers (Bf>T) and with smaller fission barriers (Bf>T). It was interesting to find that the effective moment of inertia (Jeff) values deduced from the latter component were consistent with the values from Sierk prescription used in the former case

  5. About the first experiment on investigation of 129I, 237Np, 238Pu and 239Pu transmutation at the nuclotron 2.52 GeV deuteron beam in neutron field generated in U/Pb-assembly 'Energy plus transmutation'

    International Nuclear Information System (INIS)

    Preliminary results of the first experiment with energy 2.52 GeV at the electronuclear setup which consists of Pb-target (diameter 8.4 cm, length 45.6 cm) and natU-blanket (206.4 kg), transmutation samples of 129I, 237Np, 238Pu and 239Pu (radioecological aspect) are described. Hermetically sealed samples in notable amounts are gathered in atomic reactors and setups of industries which use nuclear materials and nuclear technologies were irradiated in the field of neutrons produced in the Pb-target and propagated in the natU-blanket. Estimates of transmutations were obtained as a result of measurements of gamma activities of the samples. The information about the space and energy distribution of neutrons in the volume of the lead target and the uranium blanket was obtained with the help of sets of activation threshold detectors (Al, Co, Y, I, Au, Bi and others), solid-state nuclear track detectors, 3He neutron detectors and nuclear emulsion. Comparison of the experimental data with the results of simulation with the MCNPX program was performed

  6. Investigation of neutron spectra and transmutation of 129I, 237Np and other nuclides with 1.5 GeV protons from the Dubna Nuclotron using the electronuclear setup 'Energy plus Transmutation'

    International Nuclear Information System (INIS)

    Experiments which are part of the scientific program 'Investigations of physical aspects of electronuclear method of energy production and transmutation for radioactive waste of atomic energetics using relativistic beams from the JINR Synchrophasotron/Nuclotron' (project 'Energy plus Transmutation') are described. A large lead target surrounded by a four-section uranium blanket with a total weight of 206.4 kg natural uranium was irradiated with 1.5 GeV protons from the new cryogenic accelerator Nuclotron. Radiochemical sensors were exposed to the secondary particle fluences inside and on top of the target assembly. Two long-lived radioactive waste of atomic energetics sensors 129I and 237Np (approximately 1 g weight each) and stable nuclides 27Al, 59Co, 127I, 139La, 197Au and 209Bi as well as natural and enriched uranium were used. In addition, various solid state nuclear track detectors and nuclear emulsions were exposed simultaneously. The experimental results confirm the theoretical estimations that the neutron spectra around the U/Pb-assembly are dominated by medium- and high-energy neutrons as shown by the observation of (n, xn)-reaction products in Co, Au and Bi sensors. The yield of thermal neutrons on the surface of the U-blanket is strongly reduced as compared to the surface of a smaller Pb target surrounded with paraffin. The latter data were determined with (n, γ) reactions in stable La sensors. In this experiment the technique of nuclear emulsions has been applied for the first time to measurements of neutron spectra in an accelerator driven system

  7. 7 CFR 205.237 - Livestock feed.

    Science.gov (United States)

    2010-01-01

    ...) The producer of an organic livestock operation must provide livestock with a total feed ration... § 205.603 may be used as feed additives and supplements. (b) The producer of an organic operation must... specific stage of life; (3) Feed plastic pellets for roughage; (4) Feed formulas containing urea or...

  8. 32 CFR 237a.4 - Procedures.

    Science.gov (United States)

    2010-07-01

    ... material. Participation in the production of motion pictures and TV programs, including filmed commercials... Production of Non-Government Motion Pictures and Television Programs.” (d) Use of contractor...

  9. 49 CFR 238.237 - Automated monitoring.

    Science.gov (United States)

    2010-10-01

    ... train speed and capabilities of the signal system. The railroad shall document the basis for setting... crewmember until the train reaches the next terminal. (2)(i) A tag shall be prominently displayed in the...; and (ii) When the train reaches its next terminal or the locomotive undergoes its next calender...

  10. Effect of Fe content on glass-forming ability and crystallization behavior of a (Ti{sub 69.7}Nb{sub 23.7}Zr{sub 4.9}Ta{sub 1.7}){sub 100−x}Fe{sub x} alloy synthesized by mechanical alloying

    Energy Technology Data Exchange (ETDEWEB)

    Zou, L.M.; Li, Y.H. [National Engineering Research Center of Near-Net-Shape Forming for Metallic Materials, South China University of Technology, Guangzhou 510640 (China); Yang, C., E-mail: cyang@scut.edu.cn [National Engineering Research Center of Near-Net-Shape Forming for Metallic Materials, South China University of Technology, Guangzhou 510640 (China); Qu, S.G.; Li, Y.Y. [National Engineering Research Center of Near-Net-Shape Forming for Metallic Materials, South China University of Technology, Guangzhou 510640 (China)

    2013-03-15

    Graphical abstract: The different mechanical properties for the consolidated and crystallized (Ti{sub 69.7}Nb{sub 23.7}Zr{sub 4.9}Ta{sub 1.7}){sub 100−x}Fe{sub x} (x = 0, 2, 6, and 10) alloys are attributed to the different crystallized phases and microstructures induced by the different nuclei growth mechanisms of as-milled nanocrystalline/amorphous alloy powders. Highlights: ► With the increased Fe content, the GFA of as-milled TiNbZrTaFe alloy increases gradually. ► The crystallization mechanism of as-milled alloy powders is different. ► Fe alloying addition affect the mechanical property of the crystallized alloys. ► The results provide a way for fabricating biomedical material by powder metallurgy. -- Abstract: (Ti{sub 69.7}Nb{sub 23.7}Zr{sub 4.9}Ta{sub 1.7}){sub 100−x}Fe{sub x} (x = 0, 2, 6, and 10) nanocrystalline, nanocomposite and metallic glass powders were synthesized by mechanical alloying. The glass-forming ability (GFA) and crystallization behavior of the synthesized alloy powders are investigated by X-ray diffraction, transmission electron microscopy, and differential scanning calorimetry. With the increased Fe content, the synthesized alloy powders after the steady state milling transform from full nanocrystalline structure for x = 0 to nanocomposite structure containing amorphous matrix surrounding nanocrystals for x = 2 and 6 and to full amorphous structure for x = 10, and thus has the increased enthalpy of crystallization and the increased GFA. The non-isothermal crystallization kinetics is analyzed by the modified Johnson–Mehl–Avrami (JMA) equation. The values of the Avrami exponent imply that the crystallization of (Ti{sub 69.7}Nb{sub 23.7}Zr{sub 4.9}Ta{sub 1.7}){sub 100−x}Fe{sub x} nanocomposite/metallic glass powders with x = 6 and 10 is governed by diffusion-controlled three and two-dimensional growth, respectively. Moreover, the crystallized bulk alloys consolidated from the synthesized alloy powders have different

  11. Dicty_cDB: VFK237 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ktkaktkxrekk--- ---r*ifrtkskdlcsrdcisigsft*trycis*fetreyfir**rsylyh*fwvi*kd* nnrwyihflwytrvfstr...ltgrnwiekklk ftlnqklnxaqilvkliqfslkkdqwivwxnkcfr*c*gkdts Frame B: arrl*siiiv*yifi*kvikkdlvkkiitkiknlksksn*nflkk... E Sequences producing significant alignments: (bits) Value A38578( A38578 ) protein kinase 2 (E...*krs*s sl*tks*ixhry*sn*ssfhsrktng*fgxtsalgdarvkiqa Frame C: lvvcnq**lcniylfkklskki*lkk*sqksri*nqnqikif*kk...RKEVEV HFKPKVKSGTDISQIDPVFTQERPMDSLVKQVL*vmlg*rykl Homology vs CSM-cDNA Score E Sequences producing

  12. 45 CFR 237.50 - Recipient count, Federal financial participation.

    Science.gov (United States)

    2010-10-01

    ... participation. Pursuant to the formulas in sections 3, 403, 1003, 1118, 1121, 1403, and 1603 of the Social... 45 Public Welfare 2 2010-10-01 2010-10-01 false Recipient count, Federal financial participation... participation. The quarterly statement of expenditures and recoveries which is required for OAA, AFDC, AB,...

  13. Dicty_cDB: VSF237 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available mRNA sequence. 40 0.009 2 BU574126 |BU574126.1 PA__Ea0006F03f Almond developing seed Prunus dulcis cDNA clo...ne PA__Ea0006F03f, mRNA sequence. 52 0.010 1 BU044788 |BU044788.1 PP_LEa0020I02f Peach developing... |BU042820.1 PP_LEa0014B11f Peach developing fruit mesocarp Prunus persica cDNA clone PP_LEa0014B11f, mRNA s

  14. Dicty_cDB: VFM237 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available KLISHVENN*li Frame B: *kkyqhitasststttttkeiitk*QTDDSLVIFDIYRKKK--- ---qlnxxxqvhvii*xrfsrm*kingflinnwkiikigl... n*flmlkiin*y Frame C: kkninillhhqhpqqqqqkk*llnnkrtiv**fsifiekk--- ---n*txcxrfm**fdxdfqecrr*mds**tigrs*rlg*r

  15. Dicty_cDB: AFM237 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available pmfrc*iwqtys cvtn**yhrrsqwqsl*slpqtilfrslpssp*g*lifstwwyesrri*scrnrpr*ily rctrdiytl*r*gsqerg*rpsr*gwlr*--- ---mcfvl**vg*xctxxrf...itr*cwwcw**syqsnfn*ngwyerqexrfhhwcyq*try hrssyppsrsfrsthlhsitr...ftiscchxqglxq*ixsrqgcrfxifgskxsrfxwxrfn *nlstcl*isys*ih*kgy*ixqspsxiw*xqxgx*lcrsxtrnys*slpxsheicssfx ir**y*k

  16. 48 CFR 1252.237-71 - Certification of data.

    Science.gov (United States)

    2010-10-01

    ... Certification of data. As prescribed in (TAR) 48 CFR 1213.7101 and 1237.7003, insert the following provision... U.S.C. 3801-3812 and 49 CFR part 31 and/or; (3) termination for default under any contract resulting... certification from its subcontractors. Signature: Date: Typed Name and Title: Company Name: This...

  17. Dicty_cDB: CHM237 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available s--- ---ft*ftphctnanrfnksnpw*q*ml*tlhfqhlqsscfsr*ihncqqtitrrshgig hwspemknqivaargsiqsiggipddlkelyktvweirqrtl...ifm*ngtkikfr ys*sn*sstkss*wsisrckdyrig*fgsrdssiyvntssrlwyfgsty*ciess*tnfk efcrds*eti*ih*skeqfigtigqqgal*nrnetw*eige...A ch... 161 8e-59 AM270068_2( AM270068 |pid:none) Aspergillus niger contig An04c0070... 178 2e-58 AM920437_1...slhqcqplqqvkslvtmnalnltlptftvvvf*qvnsqlstnnyskiswnwa lvtrdeesnrcctwfhsihrwhp**fertl*nslgnpsknshrygc*swcfhrsk...J390500.1 Candida albicans partial mRNA for ribonucleotide reductase large subunit (rnr1 gene). 64 3e-18 4 A

  18. 7 CFR 2.37 - Chief Information Officer.

    Science.gov (United States)

    2010-01-01

    ... aspects of information technology, including feasibility studies; economic analyses; systems design... development efforts to assure effective and economic use of resources and compatibility among systems of... communications, excluding the actual procurement of data transmission equipment, software, maintenance,...

  19. 48 CFR 52.237-10 - Identification of Uncompensated Overtime.

    Science.gov (United States)

    2010-10-01

    ... that results from multiplying the hourly rate for a 40-hour work week by 40, and then dividing by the proposed hours per week. For example, 45 hours proposed on a 40-hour work week basis at $20 per hour would... average of 40 hours per week by direct charge employees who are exempt......

  20. 48 CFR 1252.237-72 - Prohibition on advertising.

    Science.gov (United States)

    2010-10-01

    ... Prohibition on advertising. As prescribed in (TAR) 48 CFR 1213.7101 and 1237.7003, insert the following clause... 48 Federal Acquisition Regulations System 5 2010-10-01 2010-10-01 false Prohibition on advertising...) shall not advertise or solicit business from attendees for private, non-Government training...

  1. Use of trioctylphosphine oxide for transplutonium element extraction and purification

    International Nuclear Information System (INIS)

    Investigated was extraction of tri-valent curium, berkelium, californium, einsteinium as well as cerium and europium with trioctylphosphin oxide from lactic acid solutions, containing DTPA and aluminium nitrate depending on the aluminium nitrate and TOPO concentrations and nitric acid solutions of variable concentration as well. Under optimum conditions of extraction chromatography of berkelium studied was the distribution of cobalt, nickel, chromium, iron, aluminium, titanium, zirconium and niobium ions, and the coefficients of berkelium purification from cations investigated were determined. The effect of weight quantities of cation impurities on extraction chromatographic yield of berkelium has been investigated. Examples of practice application of the extraction chromatography with the use of TOPO are given

  2. Pu236(n,f) , Pu237(n,f) , and Pu238(n,f) cross sections deduced from (p,t) , (p,d) , and (p,p') surrogate reactions

    Energy Technology Data Exchange (ETDEWEB)

    Hughes, R. O. [Univ. of Richmond, VA (United States); Beausang, C. W. [Univ. of Richmond, VA (United States); Ross, T. J. [Univ. of Richmond, VA (United States); Burke, J. T. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States); Casperson, R. J. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States); Cooper, N. [Yale Univ., New Haven, CT (United States); Escher, J. E. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States); Gell, K. [Univ. of Richmond, VA (United States); Good, E. [Univ. of Richmond, VA (United States); Humby, P. [Yale Univ., New Haven, CT (United States); McCleskey, M. [Texas A & M Univ., College Station, TX (United States); Saastimoinen, A. [Texas A & M Univ., College Station, TX (United States); Tarlow, T. D. [Univ. of Richmond, VA (United States); Thompson, I. J. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States)

    2014-07-01

    The Pu236(n,f), Pu237(n,f) and Pu238(n,f) cross sections have been inferred by utilizing the surrogate ratio method. Targets of Pu239 and U235 were bombarded with 28.5-MeV protons, and the light ion recoils, as well as fission fragments, were detected using the STARS detector array at the K150 Cyclotron at the Texas A&M cyclotron facility. The (p, tf) reaction on Pu239 and U235 targets was used to deduce the σ (Pu236(n,f))/σ(U232(n,f)) ratio, and the Pu236(n,f) cross section was subsequently determined for En=0.5–7.5 MeV. Similarly, the (p,df) reaction on the same two targets was used to deduce the σ(Pu237(n,f))/σ(U233(n,f)) ratio, and the Pu237(n,f) cross section was extracted in the energy range En=0.5–7 MeV. The Pu238(n,f) cross section was also deduced by utilizing the (p,p') reaction channel on the same targets. There is good agreement with the recent ENDF/B-VII.1 evaluated cross section data for Pu238(n,f) in the range En=0.5–10.5 MeV and for Pu237(n,f) in the range En=0.5–7 MeV; however, the Pu236(n,f) cross section deduced in the present work is higher than the evaluation between 2 and 7 MeV.

  3. Speciation of 241Am molecular compounds through 237Np Moessbauer and 241Am XPS spectroscopy

    International Nuclear Information System (INIS)

    Light actinides (U to Am) can be found in several oxidation states from (II) to (VII) in the molecular form or in the condensed matter state. The large variety of oxidation states is usually attributed to the contribution of the 5f states to the valence orbitals. For the heavier actinides, for which the 5f electrons are non bonding, the actinides become rare-earth like with a smaller number of oxidation states (II and III). However it is still not understood what really decides on the stability of a given oxidation state, and how it is depending on the chemical environment (coordination sphere, nature of the counter-anion, etc). This work shows how Moessbauer spectroscopy and 4f photoelectron spectroscopy (XPS) can contribute to progress in the understanding of the electronic structure of the actinide, especially for Am compounds Moessbauer reverse experiments were undertaken to show in what manner the electronic structure of the Am is preserved during the decay process (oxidation state stability). The result of XPS measurements shows that it is possible to correlate the 4f binding energy of the Am to the charge at the actinide core. The obtained results are somewhat surprising. The formal oxidation state (V) is 'less oxidised' than expected. Some Am(III) have less electron density (that means are more ionic) than americyl (V) hydroxide or carbonate. The reason for these surprisingly results comes from the 'Am=O' multiple bond system which reduces dramatically the charge at the actinide by a pi-donation mechanism. The evolution of the 4f binding energy of the Am species does not follow the oxidation state order. Theoretical DFT calculation were done on Am(V) compounds for qualitative electronic modeling. (authors)

  4. 48 CFR 2452.237-77 - Observance of legal holidays and administrative leave.

    Science.gov (United States)

    2010-10-01

    ... contractor's personnel work on a holiday, no form of holiday or other premium compensation will be reimbursed.... (B) The deduction rate in dollars per day will be multiplied by the number of days services are...

  5. 77 FR 237 - Protection of Stratospheric Ozone: Adjustments to the Allowance System for Controlling HCFC...

    Science.gov (United States)

    2012-01-04

    ... code 423730), including air-conditioning (condensing unit, compressors) merchant wholesalers..., and Air Conditioning Montreal Protocol--Montreal Protocol on Substances that Deplete the Ozone Layer...-Conditioning and Warm Air Heating Equipment and Commercial and Industrial Refrigeration Equipment...

  6. Farmland biodiversity and agricultural management on 237 farms in 13 European and two African regions

    NARCIS (Netherlands)

    Lüscher, G.; Ammari, Y.; Andriets, A.; Angelova, Siyka; Arndorfer, Michaela; Bailey, D.; Balázs, K.; Bogers, M.M.B.; Bunce, R.G.H.; Choisis, Jean Philippe; Dennis, P.; Díaz, M.; Dyman, T.; Eiter, Sebastian; Fjellstad, W.; Fraser, M.; Friedel, Jürgen K.; Garchi, S.; Geijzendorffer, I.R.; Gomiero, Tiziano; González-Bornay, G.; Guteva, Y.; Herzog, F.; Jeanneret, P.; Jongman, R.H.G.

    2016-01-01

    Farmland is a major land cover type in Europe and Africa and provides habitat for numerous species. The severe decline in farmland biodiversity of the last decades has been attributed to changes in farming practices, and organic and low-input farming are assumed to mitigate detrimental effects of ag

  7. 2.37 饮食对Bilitec检查影响作用的研究

    Institute of Scientific and Technical Information of China (English)

    戴菲; 龚均; 张茹; 朱有玲; 王学勤

    2001-01-01

    目的 Bilitec 2000是近年来发明的一种便携式光纤分光光度仪,被认为是目前检测胆汁反流理想可靠的方法.但食物因素对其检测结果影响较大,本研究旨在通过对多种饮食吸收值(Abs)的测定,制定出适合国人饮食习惯的检查餐.方法采用便携式分光光度仪Bilitec 2000(瑞典Metronic Synectics Medic al公司)进行检测.体外检测对象包括主食类:米饭、馒头、面条等.副食类:鸡蛋、豆腐及红萝卜、菠菜等十几种常见蔬菜.水果类:苹果、香蕉、梨等.饮品类:鲜牛奶、纯净水等.将固体食物1g溶于10mL蒸馏水中稀释,半固体食物和饮料不予稀释,水果和蔬菜榨成汁不予稀释.体内研究对象为38例功能性消化不良患者.其中20例(男10例,女10例,平均年龄48.9±3.4岁)服用检查餐;18例(男9例,女9例,49.3±4.6岁)除禁烟酒和咖啡外, 自由进食.Bilitec探头置于受检者食道下端括约肌(LES)下5cm处.以Abs>0.14作为阈值 .结果浅色饮食的Abs多小于0.14,包括主食、牛奶、豆浆、鸡汤、土豆、大白菜等;深色饮食的Abs则大于0.14,多数蔬菜和水果的Abs偏高.根据检测结果制定出检查餐.早餐可选用牛奶(250~500mL)和面包(100g),热量约460~610kcal;将牛奶改为豆资料热量约360~410kcal.午餐主食为面条或米饭(100~200g),副食大白菜、土豆、鸡汤 ,热量约690~930kcal;晚餐主食为大米粥(100g)和馒头(100g),副食豆腐、煮鸡蛋,热量约700~800kcal.其中午餐和晚餐中的主副食可随意搭配,将总热量控制在2000kcal左右即可.20例FD患者摄入检查餐后,Abs平均为0.114±0.03,无一例高于0.14.18例自由饮食者餐后Abs平均为0.21±0.03.结论体外和体内检测结果表明食物对Bilitec检查有一定的影响.

  8. Transmutation experiments ion I-129, La-139 and Np-237 using the Nuclotron accelerator

    Czech Academy of Sciences Publication Activity Database

    Westmeier, W.; Brandt, B. A.; Langrock, E. J.; Odoj, R.; Adam, Jindřich; Bradnova, V.; Golovatyuk, VM.; Krasnov, VA.; Krivopustov, M. I.; Pronskikh, V. S.; Sosnin, A. N.; Tsoupko-Sitnikov, V. M.; Vladimirova, NM.; Hashemi-Nezhad, R. S.; Zamani-Valasiadou, M.

    2005-01-01

    Roč. 93, č. 2 (2005), s. 65-73. ISSN 0033-8230 R&D Projects: GA MŠk(CZ) 1P04LA213 Keywords : transmutation * relativistic proton beam * moderator Subject RIV: BG - Nuclear, Atomic and Molecular Physics, Colliders Impact factor: 0.846, year: 2005

  9. SU-E-J-237: Real-Time 3D Anatomy Estimation From Undersampled MR Acquisitions

    International Nuclear Information System (INIS)

    Recent developments made MRI guided radiotherapy feasible. Performing simultaneous imaging during fractions can provide information about changing anatomy by means of deformable image registration for either immediate plan adaptations or accurate dose accumulation on the changing anatomy. In 3D MRI, however, acquisition time is considerable and scales with resolution. Furthermore, intra-scan motion degrades image quality.In this work, we investigate the sensitivity of registration quality on imageresolution: potentially, by employing spatial undersampling, the acquisition timeof MR images for the purpose of deformable image registration can be reducedsignificantly.On a volunteer, 3D-MR imaging data was sampled in a navigator-gated manner, acquiring one axial volume (360×260×100mm3) per 3s during exhale phase. A T1-weighted FFE sequence was used with an acquired voxel size of (2.5mm3) for a duration of 17min. Deformation vector fields were evaluated for 100 imaging cycles with respect to the initial anatomy using deformable image registration based on optical flow. Subsequently, the imaging data was downsampled by a factor of 2, simulating a fourfold acquisition speed. Displacements of the downsampled volumes were then calculated by the same process.In kidneyliver boundaries and the region around stomach/duodenum, prominent organ drifts could be observed in both the original and the downsampled imaging data. An increasing displacement of approximately 2mm was observed for the kidney, while an area around the stomach showed sudden displacements of 4mm. Comparison of the motile points over time showed high reproducibility between the displacements of high-resolution and downsampled volumes: over a 17min acquisition, the componentwise RMS error was not more than 0.38mm.Based on the synthetic experiments, 3D nonrigid image registration shows little sensitivity to image resolution and the displacement information is preserved even when halving the resolution. This can be employed to greatly reduce image acquisition times for interventional applications in real-time. This work was funded by the SoRTS consortium, which includes the industry partners Elekta, Philips and Technolution

  10. 34 CFR 237.4 - In what amounts are fellowships awarded?

    Science.gov (United States)

    2010-07-01

    ... the national average salary of public school teachers in the most recent year for which satisfactory... fellowships in the maximum amount. (b) Minimum award. Except as provided in paragraph (c) of this section, a fellowship awarded under this part may not be less than half the national average salary of public...

  11. Natural Disasters and Adaptive Capacity. OECD Development Centre Working Paper No. 237

    Science.gov (United States)

    Dayton-Johnson, Jeff

    2004-01-01

    Natural disasters (droughts, earthquakes, epidemics, floods, wind storms) damage wellbeing, both in their immediate and long-term aftermath, and because the insecurity of exposure to disasters is in itself harmful to risk-averse people. As such, mitigating and coping with the risk of natural disasters is a pressing issue for economic development.…

  12. Fission barriers of 237 to 240 plutonium isotopes with the 236U(α,xn) reactions

    International Nuclear Information System (INIS)

    Excitation functions for the reactions 236U(α,xn)sup(240-x)Pu have been measured for x=2, 3, 4. The production of 236U targets as well as the chemical separation of Pu from the irradied targets are given. Experimental results have been analysed using the preequilibrium mechanism (PREEQ code) and the statistical model description of fission through a double humped barrier (GIVAB code)

  13. SU-E-J-237: Real-Time 3D Anatomy Estimation From Undersampled MR Acquisitions

    Energy Technology Data Exchange (ETDEWEB)

    Glitzner, M; Lagendijk, J; Raaymakers, B; Crijns, S [University Medical Center Utrecht, Utrecht (Netherlands); Senneville, B Denis de [University Medical Center Utrecht, Utrecht (Netherlands); Mathematical Institute of Bordeaux, University of Bordeaux, Talence Cedex (France)

    2015-06-15

    Recent developments made MRI guided radiotherapy feasible. Performing simultaneous imaging during fractions can provide information about changing anatomy by means of deformable image registration for either immediate plan adaptations or accurate dose accumulation on the changing anatomy. In 3D MRI, however, acquisition time is considerable and scales with resolution. Furthermore, intra-scan motion degrades image quality.In this work, we investigate the sensitivity of registration quality on imageresolution: potentially, by employing spatial undersampling, the acquisition timeof MR images for the purpose of deformable image registration can be reducedsignificantly.On a volunteer, 3D-MR imaging data was sampled in a navigator-gated manner, acquiring one axial volume (360×260×100mm{sup 3}) per 3s during exhale phase. A T1-weighted FFE sequence was used with an acquired voxel size of (2.5mm{sup 3}) for a duration of 17min. Deformation vector fields were evaluated for 100 imaging cycles with respect to the initial anatomy using deformable image registration based on optical flow. Subsequently, the imaging data was downsampled by a factor of 2, simulating a fourfold acquisition speed. Displacements of the downsampled volumes were then calculated by the same process.In kidneyliver boundaries and the region around stomach/duodenum, prominent organ drifts could be observed in both the original and the downsampled imaging data. An increasing displacement of approximately 2mm was observed for the kidney, while an area around the stomach showed sudden displacements of 4mm. Comparison of the motile points over time showed high reproducibility between the displacements of high-resolution and downsampled volumes: over a 17min acquisition, the componentwise RMS error was not more than 0.38mm.Based on the synthetic experiments, 3D nonrigid image registration shows little sensitivity to image resolution and the displacement information is preserved even when halving the resolution. This can be employed to greatly reduce image acquisition times for interventional applications in real-time. This work was funded by the SoRTS consortium, which includes the industry partners Elekta, Philips and Technolution.

  14. Reverberation in the UV-Optical Continuum Brightness Fluctuations of MACHO Quasar 13.5962.237

    CERN Document Server

    Schild, Rudolph E; Protopapas, Pavlos

    2009-01-01

    We examine the nature of brightness fluctuations in the UV-Optical spectral region of an ordinary quasar with 881 optical brightness measurements made during the epoch 1993 - 1999. We find evidence for systematic trends having the character of a pattern of reverberations following an initial disturbance. The initial pulses have brightness increases of order 20% and pulse widths of 50 days, and the reverberations have typical amplitudes of 12% with longer mean pulse widths of order 80 days and pulse separations of order 90 days. The repeat pattern occurs over the same time scales whether the initial disturbance is a brightening or fading. The lags of the pulse trains are comparable to the lags seen previously in reverberation of the broad blue-shifted emission lines following brightness disturbances in Seyfert galaxies, when allowance is made for the mass of the central object. In addition to the burst pulse trains, we find evidence for a semi-periodicity with a time scale of 2 years. These strong patterns of ...

  15. SU-E-J-237: Image Feature Based DRR and Portal Image Registration

    Energy Technology Data Exchange (ETDEWEB)

    Wang, X; Chang, J [NY Weill Cornell Medical Ctr, NY (United States)

    2014-06-01

    Purpose: Two-dimensional (2D) matching of the kV X-ray and digitally reconstructed radiography (DRR) images is an important setup technique for image-guided radiotherapy (IGRT). In our clinics, mutual information based methods are used for this purpose on commercial linear accelerators, but with often needs for manual corrections. This work proved the feasibility that feature based image transform can be used to register kV and DRR images. Methods: The scale invariant feature transform (SIFT) method was implemented to detect the matching image details (or key points) between the kV and DRR images. These key points represent high image intensity gradients, and thus the scale invariant features. Due to the poor image contrast from our kV image, direct application of the SIFT method yielded many detection errors. To assist the finding of key points, the center coordinates of the kV and DRR images were read from the DICOM header, and the two groups of key points with similar relative positions to their corresponding centers were paired up. Using these points, a rigid transform (with scaling, horizontal and vertical shifts) was estimated. We also artificially introduced vertical and horizontal shifts to test the accuracy of our registration method on anterior-posterior (AP) and lateral pelvic images. Results: The results provided a satisfactory overlay of the transformed kV onto the DRR image. The introduced vs. detected shifts were fit into a linear regression. In the AP image experiments, linear regression analysis showed a slope of 1.15 and 0.98 with an R2 of 0.89 and 0.99 for the horizontal and vertical shifts, respectively. The results are 1.2 and 1.3 with R2 of 0.72 and 0.82 for the lateral image shifts. Conclusion: This work provided an alternative technique for kV to DRR alignment. Further improvements in the estimation accuracy and image contrast tolerance are underway.

  16. 40 CFR 86.237-08 - Dynamometer test run, gaseous emissions.

    Science.gov (United States)

    2010-07-01

    ... the cold start “transient” phase, terminates at the end of the deceleration which is scheduled to... two periods. The first period, representing the cold start “transient” phase, terminates at the end of... this section shall begin between 9 and 11 minutes after the end of the sample period for the cold...

  17. Robert et Maya Kandel, La Catastrophe climatique, Hachette, 2009, 237 p.

    Directory of Open Access Journals (Sweden)

    Luc Semal

    2012-05-01

    Full Text Available Robert Kandel, astrophysicien et directeur de recherche émérite au CNRS, n’en est pas à son premier ouvrage sur le réchauffement climatique. Dans ce nouvel essai (co-rédigé avec sa fille Maya Kandel, il est intéressant de constater un changement de ton assez représentatif de l’inquiétude croissante des scientifiques à l’égard du bouleversement climatique en cours. Tout en rappelant qu’il a longtemps fait preuve de méfiance à l’égard des discours catastrophistes, Robert Kandel annonce dès l’i...

  18. 48 CFR 1352.237-70 - Security processing requirements-high or moderate risk contracts.

    Science.gov (United States)

    2010-10-01

    ... prescribed in 48 CFR 1337.110-70 (b), insert the following clause: Security Processing Requirements—High or...—Moderate Background Investigation (MBI). (2) Investigative requirements for IT Service Contracts are:...

  19. 27 CFR 19.237 - Disapproval of bonds or consents of surety.

    Science.gov (United States)

    2010-04-01

    ... competent jurisdiction of— (1) Any fraudulent noncompliance with any provision of any law of the United States, if such provision related to internal revenue or customs taxation of spirits, wines, or beer, or..., or (2) Any felony under a law of any State or the District of Columbia, or the United...

  20. 48 CFR 1352.237-72 - Security processing requirements-national security contracts.

    Science.gov (United States)

    2010-10-01

    ... prescribed in 48 CFR 1337.110-70(d), use the following clause: Security Processing Requirements—National... the performance of their work. Regardless of the contractor employees' location, appropriate security... Office of Security before start of work. (2) The Contracting Officer's Representative must send...

  1. 48 CFR 252.237-7019 - Training for Contractor Personnel Interacting with Detainees.

    Science.gov (United States)

    2010-10-01

    ... on behalf of the United States Government as a result of armed conflict or other military operation...) The Combatant Commander responsible for the area where a detention or interrogation facility...

  2. Building Basic Skills: Results from Vocational Education. Research & Development Series No. 237.

    Science.gov (United States)

    Lotto, Linda S.

    A study examined current research on the proficiency of vocational students in basic skill areas and explored current practices for improving the basic skills of vocational students at the secondary and postsecondary levels. Based on current research, vocational students, on an average, seemed to be less proficient in basic skills than were their…

  3. Analysis of shape isomer yields of 237Pu in the framework of dynamical–statistical model

    Indian Academy of Sciences (India)

    Hadi Eslamizadeh

    2012-02-01

    Data on shape isomer yield for + 235U reaction at $E^{\\text{lab}}$ = 20–29 MeV are analysed in the framework of a combined dynamical–statistical model. From this analysis, information on the double humped fission barrier parameters for some Pu isotopes has been obtained and it is shown that the depth of the second potential well should be less than the results of statistical model calculations.

  4. Speciation of {sup 241}Am molecular compounds through {sup 237}Np Moessbauer and {sup 241}Am XPS spectroscopy

    Energy Technology Data Exchange (ETDEWEB)

    Fouchard, S.; Gouder, T.; Colineau, E.; Wastin, F.; Rebizant, J.; Simoni, E.; Guillaumont, D.; Meyer, D

    2004-07-01

    Light actinides (U to Am) can be found in several oxidation states from (II) to (VII) in the molecular form or in the condensed matter state. The large variety of oxidation states is usually attributed to the contribution of the 5f states to the valence orbitals. For the heavier actinides, for which the 5f electrons are non bonding, the actinides become rare-earth like with a smaller number of oxidation states (II and III). However it is still not understood what really decides on the stability of a given oxidation state, and how it is depending on the chemical environment (coordination sphere, nature of the counter-anion, etc). This work shows how Moessbauer spectroscopy and 4f photoelectron spectroscopy (XPS) can contribute to progress in the understanding of the electronic structure of the actinide, especially for Am compounds Moessbauer reverse experiments were undertaken to show in what manner the electronic structure of the Am is preserved during the decay process (oxidation state stability). The result of XPS measurements shows that it is possible to correlate the 4f binding energy of the Am to the charge at the actinide core. The obtained results are somewhat surprising. The formal oxidation state (V) is 'less oxidised' than expected. Some Am(III) have less electron density (that means are more ionic) than americyl (V) hydroxide or carbonate. The reason for these surprisingly results comes from the 'Am=O' multiple bond system which reduces dramatically the charge at the actinide by a pi-donation mechanism. The evolution of the 4f binding energy of the Am species does not follow the oxidation state order. Theoretical DFT calculation were done on Am(V) compounds for qualitative electronic modeling. (authors)

  5. Migration of the radionuclides 99Tc, 237Np, 238Pu and 241Am in the caprock of the Gorleben repository

    International Nuclear Information System (INIS)

    31 different combinations of sediments with groundwaters (sediment-groundwater-systems) formed the basis of the experiments to determine sorption data and sorption mechanisms of radionuclides in selected acquifer systems with loose rock samples taken from shafts 1 and 2. The waters were selected on the basis of pore water analyses. For cohesive materials from which no pore water could be extracted, groundwaters from the horizon below and above were chosen. (orig.)

  6. Integrated plant safety assessment, Systematic Evaluation Program: Dresden Nuclear Power Station, Unit 2 (Docket No. 50-237)

    International Nuclear Information System (INIS)

    The US Nuclear Regulatory Commission (NRC) has prepared Supplement 1 to the final Integrated Plant Safety Assessment Report (IPSAR) (NUREG-0823), under the scope of the Systematic Evaluation Program (SEP), for the Commonwealth Edison Company (CECo) Dresden Nuclear Power Station, Unit 2 located in Grundy County, Illinois. The NRC initiated the SEP to provide the framework for reviewing the design of older operating nuclear reactor plants to reconfirm and document their safety. This report documents the review completed by means of the SEP for those issues that required refined engineering evaluations or the continuation of ongoing evaluations subsequent to issuing the final IPSAR for Dresden Unit 2. The review was provided for (1) an assessment of the significance of differences between current technical positions on selected issues and those that existed when Dresden Unit 2 was licensed, (2) a basis for deciding on how these differences should be resolved in an integrated plant review, and (3) a documented evaluation of plant safety. The final IPSAR and this supplement forms part of the bases for considering the conversion of the existing provisional operating license to a full-term operating license. 83 refs., 9 tabs

  7. The microwave spectrum, structure and dipole moment of cyclobutene ozonide (2,3,7-trioxabicyclo[2.2.1]heptane)

    Science.gov (United States)

    Borseth, Donald G.; Lorenčak, Primož; Badawi, Hassan M.; Hillig, Kurt W.; Kuczkowski, R. L.; Mendenhall, G. David

    1988-11-01

    Cyclobutene ozonide containing deuterium, 13C and 18O enrichment was prepared by ozonolysis of cyclobutene and via singlet molecular oxygen addition to furan. It was established that the ozonide has Cs symmetry. The structure was determined from the assignment of the microwave spectra of eight isotopic species. The peroxy bond distance of 1.492(5) Å is increased by about 0.03 Å compared with less strained monocyclic ozonides. The ring strain is also evident in several other bond distances and angles when compared with cyclopentene ozonide. The dipole moment is 2.857(2) debye.

  8. Measurements of periods, relative abundances and absolute yields of delayed neutrons from fast neutron induced fission of {sup 237}Np

    Energy Technology Data Exchange (ETDEWEB)

    Piksaikine, V. [Institute of Physics and Power Engineering, Obninsk (Russian Federation)

    1997-03-01

    The experimental method for measurements of the delayed neutron yields and period is presented. The preliminary results of the total yield, relative abundances and periods are shown comparing with the previously reported values. (J.P.N.)

  9. Neutron-induced transmutation reactions in Np-237, Pu-238, and Pu-239 at the massive natural uranium spallation target

    Czech Academy of Sciences Publication Activity Database

    Závorka, L.; Adam, Jindřich; Baldin, A. A.; Čaloun, Pavel; Chilap, V. V.; Furman, W.; Kadykov, M. G.; Khushvaktov, J.; Pronskikh, V. S.; Solnyshkin, A. A.; Sotnikov, V.; Stegailov, V. I.; Suchopár, Martin; Tsoupko-Sitnikov, V. M.; Tyutyunnikov, S. I.; Voronko, V.; Vrzalová, Jitka

    2015-01-01

    Roč. 349, APR (2015), s. 31-38. ISSN 0168-583X R&D Projects: GA MŠk LG14004 Institutional support: RVO:61389005 Keywords : ADS * spent nuclear fuel * transmutation reaction * spallation neutrons Subject RIV: BG - Nuclear, Atomic and Molecular Physics, Colliders Impact factor: 1.124, year: 2014

  10. Investigation of the soil-to-plant transfer of Np-237, Pu-238, Am-241 and Cm-244

    International Nuclear Information System (INIS)

    Inside a greenhouse for radioecological studies the root uptake of Np, Pu, Am, and Cm from 5 different soils into 19 crop plants have been measured. The soils have been artificially contaminated with the 4 nuclides in range from 1-20 Bq/g dry soil. Within 7 vegetation periods about 380 transfer measurements have been performed. The obtained results show that the soil-to-plant transfer is mainly influenced by the following parameters: physical and chemical properties of the different radionuclides, plant species and variety, soil type, time of soil utilization and soil management. The transfer factors measured are compared with those data which are proposed for the calculation of the long term radiation burden of the population by ingestion of contaminated food inside the Federal Republic of Germany. The experiments have been performed from the beginning of 1983 to the end of 1986. The results summarized within this report have already been published in annual reports or as contributions to scientific meetings. (orig.)

  11. Three-body calculation of the Delta-Delta dibaryon candidate D(03) at 2.37 GeV

    OpenAIRE

    Gal, Avraham; Garcilazo, Humberto

    2013-01-01

    The D(03) dibaryon is generated dynamically as a resonance pole in a pion-nucleon-Delta' three-body model, where Delta' is a stable Delta baryon. Using separable interactions dominated by the Delta(1232) isobar for pion-nucleon and by the D(12) isobar for nucleon-Delta', where D(12) is the nucleon-Delta 2150 MeV dibaryon deduced in and constrained by 1D2 pp scattering, the model reduces to an effective two-body problem for Delta-Delta' which is solved. The mass and width of D(03) are found cl...

  12. 48 CFR 652.237-73 - Statement of Qualifications for Preference as a U.S. Person.

    Science.gov (United States)

    2010-10-01

    ... language is quoted immediately before the definitions that apply to it. Space for the required information... suit, to sign contracts, and to hold property under the law of the jurisdiction under which they are... the prospective offeror may bring suit and be sued and in which service of process shall be...

  13. Discovery of Isotopes of the Transuranium Elements with 93 <= Z <= 98

    OpenAIRE

    Fry, C; Thoennessen, M

    2012-01-01

    One hundred and five isotopes of the transuranium elements neptunium, plutonium, americium, curium, berkelium and californium have so far been observed; the discovery of these isotopes is discussed. For each isotope a brief summary of the first refereed publication, including the production and identification method, is presented.

  14. Deaf-Blind Interpreting: Building on What You Already KnowDOI: 10.5007/2175-7968.2010v2n26p237

    Directory of Open Access Journals (Sweden)

    Karen Petronio

    2010-10-01

    Full Text Available  This article focuses on visual considerations and describes the numerous similarities between video interpreting and deaf-blind interpreting. It also looks at linguistic considerations for deaf-blind interpreting and presents research findings showing similarities and differences between ASL and Tactile ASL. Because many interpreters are unfamiliar with tactile communication, there is a section that includes an overview of Tactile ASL. The issues, descriptions, and data presented in this article are based on situations in the United States and involve the use of ASL and Tactile ASL; however, it is highly likely that these discussions and findings also relate to deaf-blind interpreting done in other countries using other sign languages.

  15. Integrated-plant-safety assessment Systematic Evaluation Program. Dresden Nuclear Power Station, Unit 2, Commonwealth Edison Company, Docket No. 50-237

    International Nuclear Information System (INIS)

    The Systematic Evaluation Program was initiated in February 1977 by the US Nuclear Regulatory Commission to review the designs of older operating nuclear reactor plants to reconfirm and document their safety. The review provides: (1) an assessment of how these plants compare with current licensing safety requirements relating to selected issues; (2) a basis for deciding on how these differences should be resolved in an integrated plant review; and (3) a documented evaluation of plant safety. This report documents the review of Dresden Nuclear Generating Station, Unit 2 owned and operated by the Commonwealth Edison Company and located in Grundy County, Illinois. Dresden Unit 2 is one of ten plants reviewed under Phase II of this program, which indicates how 137 topics selected for review under Phase I of the program were addressed. Equipment and procedural changes have been identified as a result of the review. It is expected that this report will be one of the bases in considering the issuance of a full-term operating license in place of the existing provisional operating license

  16. Application of ion associates of 2,3,7-trihydroxyfluorones with cetyl pyridinium cations for flotation separation of rare element ions

    International Nuclear Information System (INIS)

    It was suggested to use ionic associates of salicylfluorone with cetyl pyridinium cations as high-effective collector for flotation separation of Nb(5), Ta(5), Zr(4), Hf(4), Mo(6), W(6) ions. The optimal condition for flotation of Nb, Zr, Hf, Mo, W complexes is the following: pH 1-8; Ta-pH 0-8; separation degree equals 80-94%

  17. Quality of life of women submitted to myocardial revascularization surgery in a public hospital - doi:10.5020/18061230.2010.p237

    Directory of Open Access Journals (Sweden)

    Rafaela Melo de Oliveira

    2012-01-01

    Full Text Available Objective: To analyze the sociodemografic profile, risck factors and the quality of life of women submitted to myocardial revascularization surgery. Methods: We conducted a qualitative study by applying a questionnaire on lifestyle and risk factors and an interview with four guiding questions to 15 revascularized inpatients of cardiology units of a referral public hospital and who had no manifestations of depression prior to surgery. Results: The patients profile showed that 9 (60% were Caucasian, 8 (54% had incomplete primary education, 4(27% were housewives, 9 (60% lived in urban area, 10 (67% were married, all had a family income lower than three minimum wages and 4(27% had only two kids. From the content analysis of the interviews, the following categories aroused: religiosity, disruption with everyday life, family and quality of life. Conclusion: We found out that the knowledge about the psychosocial structure of each patient helps in the treatment of the individual submitted to myocardial revascularization. By identifying the lifestyle and risk factors, women promote self-knowledge, which can avoid habits that lead to cardiovascular diseases. We suggest the development of strategies for prevention and health promotion involving the patients and their families so that there is an extension of hospital care at home and a better adaptation to the new condition.

  18. VLT and ACS observations of RDCS J1252.9-2927: dynamical structure and galaxy populations in a massive cluster at z=1.237

    CERN Document Server

    Demarco, R; Lidman, C; Girardi, M; Nonino, M; Rettura, A; Strazzullo, V; Van der Wel, A; Ford, H C; Mainieri, V; Holden, B P; Stanford, S A; Blakeslee, J P; Gobat, R; Postman, M; Tozzi, P; Overzier, R A; Zirm, A W; Benítez, N; Homeier, N L; Illingworth, G D; Infante, L; Jee, M J; Mei, S; Menanteau, F; Motta, V; Zheng, W; Clampin, M; Hartig, G

    2007-01-01

    (Abridged) We present results from an extensive spectroscopic survey, carried out with FORS on the ESO VLT, and from an extensive multi-wavelength imaging data set from the ACS and ground based facilities of the cluster of galaxies RDCS J1252.9-2927. We have spectroscopically confirmed 38 cluster members in the redshift range 1.22 1, kinematic structure. The velocity distribution, which is not Gaussian at the 95% confidence level, is consistent with two groups that are also responsible for the projected elongation of the cluster in the East-West direction. The groups are composed of 26 and 12 galaxies with velocity dispersions of 486^{+47}_{-85} km s^-1 and 426^{+57}_{-105} km s^-1, respectively. The elongation is also seen in the intracluster gas and the dark matter distribution. This leads us to conclude that RDCS J1252.9-2927 has not yet reached a final virial state. We extend the analysis of the color-magnitude diagram of spectroscopic members to more than 1 Mpc from the cluster center. The scatter and s...

  19. Radiochemical method for the simultaneous determination of 233U, 236U, 237Np, 236Pu, 238Pu, and 239Pu in biological materials

    International Nuclear Information System (INIS)

    A radiochemical method has been developed for the determination of multiple isotopes of uranium, neptunium, and plutonium in biological materials. The elements are separated from the other sample constituents and from each other by anion exchange in halide media. Their recoveries are monitored by isotopic diluents. The amounts of the analyte and diluent isotopes of each element are measured alpha spectrometrically. The interelemental separation factors are generally greater than 102, and the recovery of each element ranges from 60% to 90%. 4 references, 1 table

  20. Functional differences exist between TNF(alpha) promoters encoding the common -237G SNP and the rarer HLA-B*5701-linked A variant.

    OpenAIRE

    Simpson, Peter D.; Eirini Moysi; Kate Wicks; Kritika Sudan; Rowland-Jones, Sarah L.; McMichael, Andrew J.; Julian Knight; Gillespie, Geraldine M.

    2012-01-01

    A large body of functional and epidemiological evidence have previously illustrated the impact of specific MHC class I subtypes on clinical outcome during HIV-1 infection, and these observations have recently been re-iterated in genome wide association studies (GWAS). Yet because of the complexities surrounding GWAS-based approaches and the lack of knowledge relating to the identity of rarer single nucleotide polymorphism (SNP) variants, it has proved difficult to discover independent causal ...

  1. Transmutation of 129I,237 Np, 239Pu, and 241Am using neutrons produced in target-blanket system "Energy plus Transmutation" by relativistic protons

    Czech Academy of Sciences Publication Activity Database

    Adam, Jindřich

    2007-01-01

    Roč. 68, č. 2 (2007), s. 201-212. ISSN 0304-4289 R&D Projects: GA MŠk 1P04LA213 Institutional research plan: CEZ:AV0Z10480505 Keywords : neutro production Subject RIV: BG - Nuclear, Atomic and Molecular Physics, Colliders Impact factor: 0.383, year: 2007

  2. Neutron multiplicities for the transplutonium nuclides

    International Nuclear Information System (INIS)

    This paper continues, with respect to the transplutonium nuclides, earlier efforts to collate and evaluate data from the scientific literature on the prompt neutron multiplicity distribution from fission and its first moment = ΣnuPnu. The isotopes considered here for which P/sub nu/ and or data (or both) were found in the literature are of americium (Am), curium (Cm), berkelium (Bk), californium (Cf), einsteinium (Es), fermium (Fm), and nobelium (No)

  3. Protein (Cyanobacteria): 308586 [PGDBj - Ortholog DB

    Lifescience Database Archive (English)

    Full Text Available /menaquinone biosynthesis Chamaesiphon minutus PCC 6605 MSSSSTTKDLYSGVEFSTWLELENLDAQEEYLI...YP_007097312.1 1117:6279 1118:2789 217161:237 1173032:237 1173020:237 methylase involved in ubiquinone

  4. First results studying the transmutation of 129I, 237Np, 238Pu, and 239Pu in the irradiation of an extended natU/Pb-assembly with 2.52 GeV deuterons

    Czech Academy of Sciences Publication Activity Database

    Krivopustov, M. I.; Pavljuk, A. V.; Kovalenko, A.D.; Mariin, I.I.; Elishev, A.F.; Adam, Jindřich; Kovalík, Alojz; Batusov, Yu, A.; Kalinnikov, V. G.; Brudanin, V. B.; Čaloun, Pavel; Tsoupko-Sitnikov, V. M.; Solnyshkin, A. A.; Stegailov, V. I.; Gerbish, Sh.; Svoboda, Ondřej; Dubnická, Z.; Kala, M.; Kloc, M.; Krása, Antonín; Kugler, Andrej; Majerle, Mitja; Wagner, Vladimír; Brandt, R.; Westmeier, W.; Robotham, H.; Siemon, K.; Bielewicz, M.; Kilim, S.; Szuta, M.; Strugalska-Gola, E.; Wojeciechowski, A.; Hashemi-Nezhad, R. S.; Manolopoulou, M.; Fragopolou, M.; Stoulos, S.; Zamani-Valasiadou, M.; Jokic, S.; Katovsky, K.; Schastny, O.; Zhuk, I. V.; Potapenko, A.S.; Safronova, A.A.; Lukashevich, Zh.A.; Voronko, V.A.; Sotnikov, V.V.; Sidorenko, V.V.; Ensinger, W.; Severin, H.D.; Batsev, S.; Kostov, L.; Protokhristov, Kh.; Stoyanov, Ch,.; Yordanov, O.; Zhivkov, P.K.; Kumar, A.V.; Sharma, M.; Khilmanovich, A.M.; Marcinkevich, B.A.; Korneev, S.V.; Damdinsuren, Ts.; Togoo, Ts.; Kumawat, H.

    2009-01-01

    Roč. 279, č. 2 (2009), s. 567-584. ISSN 0236-5731 R&D Projects: GA AV ČR IAA100480803; GA MŠk LC07050 Institutional research plan: CEZ:AV0Z10480505 Keywords : MCNPX. * GeV Subject RIV: BG - Nuclear, Atomic and Molecular Physics, Colliders Impact factor: 0.631, year: 2009

  5. CTD data of the Hawaii Ocean Time-series (HOT) program in the North Pacific 100 miles north of Oahu, Hawaii for cruises HOT228-237 during 2011 (NODC Accession 0101727)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — The HOT program makes repeated observations of the physics, biology and chemistry at a site approximately 100 km north of Oahu, Hawaii. Two stations are visited...

  6. Procedures for determination of 239,240Pu, 241Am, 237Np, 234,238U, 228,230,232Th, 99Tc and 210Pb-210Po in environmental material

    International Nuclear Information System (INIS)

    Since 1987, the Department of Nuclear Safety Research, Risoe National Laboratory has developed procedures for analysis of low-level amounts of radioactivity in large samples of 200 liters seawater, 10 gram sediment, soil and other environmental materials. These analytical procedures provide high chemical yields, good resolution and excellent decontamination factors for large environmental samples analysed by alpha spectrometry and mass spectrometry (ICPMS). The procedures have been checked through practical analysis work and are used in Norway, the Netherlands, Germany, Spain, France and Denmark. (au)

  7. Color Reaction of Copper with 2,3,7-Trihydroxy-9-dibromo-hydroxyphenyl Fluorone and Its Application%二溴羟基苯基荧光酮与铜的显色反应及应用

    Institute of Scientific and Technical Information of China (English)

    胡浩

    1998-01-01

    研究了在混合表面活性剂溴化十六烷基吡啶(CPB)及乳化剂OP存在下,二溴羟基苯基荧光酮(DBH-PF)与铜显色反应的条件.结果表明:在pH 5.4的六次甲基四胺-HCl缓冲介质中,DBH-PF与铜生成紫色络合物,λmax=538 nm,ε538=1.65×105 L*mol-1*cm-1.铜量在0~360 μg/L符合比尔定律.方法经实际试样验证,结果与原结果相符.对w(Cu)为0.044%~0.3%的样品进行测定,RSD(n=6)为1.71%~5.53%.

  8. TOWARD AN IMPROVED UNDERSTANDING OF STRUCTURE AND MAGNETISM IN NEPTUNIUM AND PLUTONIUM PHOSPHONATES AND SULFONATES

    Energy Technology Data Exchange (ETDEWEB)

    Albrecht-Schmitt, Thomas

    2012-03-01

    This grant supported the exploratory synthesis of new actinide materials with all of the actinides from thorium to californium with the exceptions of protactinium and berkelium. We developed detailed structure-property relationships that allowed for the identification of novel materials with selective ion-exchange, selective oxidation, and long-range magnetic ordering. We found novel bonding motifs and identified periodic trends across the actinide series. We identified structural building units that would lead to desired structural features and novel topologies. We also characterized many different spectroscopic trends across the actinide series. The grant support the preparation of approximately 1200 new compounds all of which were structurally characterized.

  9. Composition containing transuranic elements for use in the homeopathic treatment of aids

    International Nuclear Information System (INIS)

    A homeopathic remedy consisting of a composition containing one or more transuranic elements, particularly plutonium, for preventing and treating acquired immunodeficiency syndrome (AIDS) in humans, as well as seropositivity for human immunodeficiency virus (HIV). Said composition is characterized in that it uses any chemical or isotopic form of one or more transuranic elements (neptunium, plutonium, americium, curium, berkelium, californium or einsteinium), particularly plutonium, said form being diluted and dynamized according to conventional homeopathic methods, particularly the so-called Hahnemann and Korsakov methods, and provided preferably but not exclusively in the form of lactose and/or saccharose globules or granules impregnated with the active principle of said composition. (author)

  10. Detection of rare earth elements in Powder River Basin sub-bituminous coal ash using laser-induced breakdown spectroscopy (LIBS)

    Energy Technology Data Exchange (ETDEWEB)

    Tran, Phuoc [National Energy Technology Lab. (NETL), Pittsburgh, PA, (United State; Mcintyre, Dustin [National Energy Technology Lab. (NETL), Pittsburgh, PA, (United State

    2015-10-01

    We reported our preliminary results on the use of laser-induced breakdown spectroscopy to analyze the rare earth elements contained in ash samples from Powder River Basin sub-bituminous coal (PRB-coal). We have identified many elements in the lanthanide series (cerium, europium, holmium, lanthanum, lutetium, praseodymium, promethium, samarium, terbium, ytterbium) and some elements in the actinide series (actinium, thorium, uranium, plutonium, berkelium, californium) in the ash samples. In addition, various metals were also seen to present in the ash samples

  11. PROCEEDINGS OF THE SYMPOSIUM COMMEMORATING THE 25th ANNIVERSARY OF ELEMENTS 97 and 98 HELD ON JAN. 20, 1975

    Energy Technology Data Exchange (ETDEWEB)

    Seaborg, Glenn T.; Street Jr., Kenneth; Thompson, Stanley G.; Ghiorso, Albert

    1976-07-01

    This volume includes the talks given on January 20, 1975, at a symposium in Berkeley on the occasion of the celebration of the 25th anniversary of the discovery of berkelium and californium. Talks were given at this symposium by the four people involved in the discovery of these elements and by a number of people who have made significant contributions in the intervening years to the investigation of their nuclear and chemical properties. The papers are being published here, without editing, in the form in which they were submitted by the authors in the months following the anniversary symposium, and they reflect rather faithfully the remarks made on that occasion.

  12. Dicty_cDB: Contig-U04448-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available lvlcf*lh*lhysnvfikkgrkgii cyvnlvmyfqctfnfiiikikqstl*rch*wsfitifngekys*fwyl**iqrk*fplfl gsihrlvlltcscncliyyyf...yclrscifciclyyafnyisciiqtcs*KKVEKALF VMSILLCIFNVLSTLLLLRLNKALCEDATDGLSLPFSMEKSILDSGICSKFKGSDSLFSW GP...llvsievai mgdggtky*sghtnsktdntlytcyclrscifciclyyafnyisciiqtcs*KKVEKALF VMSILLCIFNVLSTLLLLRLNKALCEDATDGLSLPFS...cgcaggtgagataaataaaaatgtcaaaacataatataattgttggagtcgttacaat 236 Query: 237 tctctttttaggagcagtcattggaactaaatggtctattcattct...taccagataccaat 296 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Sbjct: 237 tc

  13. An atomic beam source for actinide elements: concept and realization

    International Nuclear Information System (INIS)

    For ultratrace analysis of actinide elements and studies of their atomic properties with resonance ionization mass spectroscopy (RIMS), efficient and stable sources of actinide atomic beams are required. The thermodynamics and kinetics of the evaporation of actinide elements and oxides from a variety of metals were considered, including diffusion, desorption, and associative desorption. On this basis various sandwich-type filaments were studied. The most promising system was found to consist of tantalum as the backing material, an electrolytically deposited actinide hydroxide as the source of the element, and a titanium covering layer for its reduction to the metal. Such sandwich sources were experimentally proven to be well suited for the production of atomic beams of plutonium, curium, berkelium and californium at relatively low operating temperatures and with high and reproducible yields. (orig.)

  14. EC decay of 244Bk

    Science.gov (United States)

    Sodaye, Suparna; Tripathi, R.; Sudarshan, K.; Sharma, S. K.; Pujari, P. K.; Palit, R.; Mukhopadhyay, S.

    2014-12-01

    Berkelium isotopes have been produced in 11B-induced reaction on 238U. The EC decay of 244Bk → 244Cm has been studied by carrying out the single and coincidence measurements of the γ-rays emitted during the de-excitation of the 244Cm levels. Radiochemical separations have been carried out to minimize the contribution from the fission products and target. The new half-life of 244Bk is obtained as 5.02 ± 0.03 h, which is close to the theoretically calculated value. The relative intensities of the decay γ-rays have been re-evaluated. Based on the coincidence measurements, a tentative partial level scheme for 244Bk → 244Cm decay has been proposed.

  15. Nuclear fission and the transuranium elements

    International Nuclear Information System (INIS)

    Many of the transuranium elements are produced and isolated in large quantities through the use of neutrons furnished by nuclear fission reactions: plutonium (atomic number 94) in ton quantities; neptunium (93), americium (95), and curium (96) in kilogram quantities; berkelium (97) in 100 milligram quantities; californium (98) in gram quantities; and einsteinium (99) in milligram quantities. Transuranium isotopes have found many practical applications---as nuclear fuel for the large-scale generation of electricity, as compact, long-lived power sources for use in space exploration, as means for diagnosis and treatment in the medical area, and as tools in numerous industrial processes. Of particular interest is the unusual chemistry and impact of these heaviest elements on the periodic table. This account will feature these aspects. 9 refs., 5 figs

  16. Nuclear fission and the transuranium elements

    Energy Technology Data Exchange (ETDEWEB)

    Seaborg, G.T.

    1989-02-01

    Many of the transuranium elements are produced and isolated in large quantities through the use of neutrons furnished by nuclear fission reactions: plutonium (atomic number 94) in ton quantities; neptunium (93), americium (95), and curium (96) in kilogram quantities; berkelium (97) in 100 milligram quantities; californium (98) in gram quantities; and einsteinium (99) in milligram quantities. Transuranium isotopes have found many practical applications---as nuclear fuel for the large-scale generation of electricity, as compact, long-lived power sources for use in space exploration, as means for diagnosis and treatment in the medical area, and as tools in numerous industrial processes. Of particular interest is the unusual chemistry and impact of these heaviest elements on the periodic table. This account will feature these aspects. 9 refs., 5 figs.

  17. EC decay of 244Bk

    International Nuclear Information System (INIS)

    Berkelium isotopes have been produced in 11B-induced reaction on 238U. The EC decay of 244Bk → 244Cm has been studied by carrying out the single and coincidence measurements of the γ-rays emitted during the de-excitation of the 244Cm levels. Radiochemical separations have been carried out to minimize the contribution from the fission products and target. The new half-life of 244Bk is obtained as 5.02 ± 0.03 h, which is close to the theoretically calculated value. The relative intensities of the decay γ-rays have been re-evaluated. Based on the coincidence measurements, a tentative partial level scheme for 244Bk → 244Cm decay has been proposed. (paper)

  18. Production of transuranium elements

    International Nuclear Information System (INIS)

    The Radiochemical Engineering Development Center (REDC) has the programmatic responsibility for the Department of Energy's Transuranium Element Program. Principle elements from the program are einsteinium, berkelium, and fermium. Targets containing curium oxide mixed with aluminum powder are fabricated by the REDC and irradiated in the Oak Ridge National Laboratory (ORNL) High Flux Isotope Reactor. Following an irradiation period of 6-12 months, targets are returned to the REDC for chemical processing. Processing operations consists of aluminum dejacketing in a caustic-nitrate solution, filtration, acid dissolution, solvent extraction, anion exchange, and finally a cation exchange to recover the actinides. The processing operations take place in heavily shielded hot cell facilities and all operations are carried out remotely. The chemistry for the separations has been well established over the 26-yr. operating life of the facility

  19. Carmody, Patricio Mateo. Buscando consensos al fin del mundo: hacia una política exterior Argentina con consensos (2015-2027) : Buenos Aires, Consejo Argentino para las Relaciones Internacionales (CARI), Buenos Aires, 2015, 237 páginas

    OpenAIRE

    Riva, Macarena

    2015-01-01

    Esta publicación es una continuación del trabajo “Política exterior al fin del mundo. Argentina, Brasil y Chile en el tiempo democrático (1983-2010)”, en el cual el autor analiza los niveles de consenso en materia de política exterior de estos tres países latinoamericanos, concluyendo que, mientras en Brasil y en Chile existe cierto grado de consenso, en Argentina hay “desacuerdos básicos” en su política internacional. Ante tal panorama, Carmody se plantea si es posible diseñar una política e...

  20. 2,3,7,8-TCDD的短期暴露对HepG2肝癌细胞内小分子代谢产物的影响%Effects of Short-Term Exposure to 2,3,7, 8-TCDD on Low-Molecular Metabolites in HepG2 Cells

    Institute of Scientific and Technical Information of China (English)

    张保琴; 张海军; 杨常青; 陈吉平

    2012-01-01

    To investigate the mechanisms underlying metabolic toxicity and hepatotoxicity of dioxins,HepG2 cells were selected to be exposed to the most toxic dioxin,23,7,8-tetrachlorodibenz0-p-dioxin (TCDD) for 24 h,and the proliferative activity of HepG2 cells was determined by MTT assay,while low-molecular metabolites (amino acids,glucose,itrea and glycerol) were qualitatively and quantitatively analyzed by HPLC-MS/MS.Results showed that short-term TCDD exposure had little effect on the proliferative activity of HepG2 cells.Glucose consumption did not change significantly after 24 h-exposure to TCDD,but only when the concentration of TCDD increased to 1 nmol·L-1,glucose consumption showed a slight decrease.0.01 nmol·L-1 TCDD inhibited the synthesis of praline and glutamate in HepG2 cells,and the synthesis of glutamate decreased in an obvious dose-response manner.The absorbability of several amino acids (valine,tryptophan,tyrosine,methi-onine,leucine and isoleucine) was stimulated by TCDD in a dose-response manner.The productions of urea and glycerol tended to decrease with increasing TCDD concentration.After 24 h-exposure to 1 nmol·L-1TCDD,the productions of urea and glycerol decreased to 1% and 18% of that of the control group.These results demonstrated that short-term exposure to TCDD could affect low-molecular metabolites in HepG2 cells to different degrees.TCDD exerted toxicity to HepG2 cells by disturbing its metabolism.%为了研究二恶英对细胞的代谢毒性,探究其肝毒性的作用机制,以二恶英中毒性最强的2,3,7,8-四氯代二苯并-对-二恶英(TCDD)为代表污染物,以HepG2肝癌细胞为受试对象,采用四甲基偶氮唑蓝(MTT)法和高技液相色谱/串联质谱法考察了TCDD的24 h暴露对HepG2细胞的增殖活性以及细胞的葡萄糖、氨基酸、尿素和甘油等小分子代谢物的影响.结果显示,短暂的TCDD暴露对HepG2细胞的增殖活性无显著影响.24 h的TCDD暴露对细胞的葡萄糖消耗量无显著影响,但当TCDD浓度增至1 nmo1·L-1时,葡萄糖的消耗量表现出一定的降低趋势.0.01 nmol·L-1TCDD就会使细胞脯氨酸和谷氨酸的合成能力下降,且谷氨酸的变化表现出明显的剂量-效应关系;TCDD可刺激细胞对缬氨酸、苏氨酸、酪氨酸、甲硫氨酸以及亮氨酸与异亮氮酸的吸收,并具有明显的浓度依赖性.随着TCDD浓度的增加,甘油和尿素产生量的降低趋势逐渐明显,1 nmol· L-1TCDD处理24 h后,甘油和尿素的产生量仅为对照组的1%和18%.研究表明,TCDD在短时间内使HepG2细胞内的一系列小分子代谢产物发生了不同程度的改变,且呈现出一定的剂量-效应关系.可见,TCDD可通过干扰HepG2肝癌细胞的代谢过程产生毒性.

  1. Comment on Spracklandus Hoser, 2009 (Reptilia, Serpentes, ELAPIDAE): request for confirmation of availability of the generic name and for the nomenclatural validation of the journal in which it was published (Case 3601; BZN 70:234–237; 71:30–38; 133-135,181-182 ,252-253)

    Science.gov (United States)

    Rhodin, Anders G.J.; Kaiser, Hinrich; van Dijk, Peter Paul; Wüster, Wolfgang; O’Shea, Mark; Archer, Michael; Auliya, Mark; Boitani, Luigi; Bour, Roger; Clausnitzer, Viola; Contreras-MacBeath, Topiltzin; Crother, Brian I.; Daza, Juan M.; Driscoll, Carlos A.; Flores-Villela, Oscar; Frazier, Jack; Fritz, Uwe; Gardner, Alfred L.; Gascon, Claude; Georges, Arthur; Glaw, Frank; Grazziotin, Felipe G.; Groves, Colin P.; Haszprunar, Gerhard; Havaš, Peter; Hero, Jean-Marc; Hoffmann, Michael; Hoogmoed, Marinus S.; Horne, Brian D.; Iverson, John B.; Jäch, Manfred; Jenkins, Christopher L.; Jenkins, Richard K.B.; Kiester, A. Ross; Keogh, J. Scott; Lacher, Thomas E., Jr.; Lovich, Jeffrey E.; Luiselli, Luca; Mahler, D. Luke; Mallon, David P.; Mast, Roderic; McDiarmid, Roy W.; Measey, John; Mittermeier, Russell A.; Molur, Sanjay; Mosbrugger, Volker; Murphy, Robert W.; Naish, Darren; Niekisch, Manfred; Ota, Hidetoshi; Parham, James F.; Parr, Michael J.; Pilcher, Nicolas J.; Pine, Ronald H.; Rylands, Anthony B.; Sanderson, James G.; Savage, Jay M.; Schleip, Wulf; Scrocchi, Gustavo J.; Shaffer, H. Bradley; Smith, Eric N.; Sprackland, Robert; Stuart, Simon N.; Vetter, Holger; Vitt, Laurie J.; Waller, Tomás; Webb, Grahame; Wilson, Edward O.; Zaher, Hussam; Thomson, Scott

    2015-01-01

    In Case 3601 Raymond Hoser has asked the Commission to validate for the purposes of nomenclature the name Spracklandus Hoser, 2009, and ‘the journal in which it was published,’ issue 7 of the Australasian Journal of Herpetology (AJH). We note that the entire run of AJH has been written, edited, and published solely by Hoser. Although his requests to the Commission were presented as narrow and, in his words, ‘routine matters,’ we are convinced that they represent an important tipping-point with broad implications of major concern for zoological taxonomy and nomenclature as a whole and, by extension, the greater scientific community. Since Hoser’s actions and works have failed to follow scientific best practices (e.g. Turtle Taxonomy Working Group, 2007, 2014; Kaiser et al., 2013; Kaiser, 2014) and both the Commission’s general Recommendations and Code of Ethics in Appendix A, the global herpetological community has widely rejected his taxonomic decisions and resultant nomenclature. This has unfortunately caused a confusing dual nomenclature to develop in the herpetological community, with most boycotting or ignoring Hoser’s 700+ new names coined in the AJH, while he and a few personal followers actively promote their usage. We believe that suppression of the name Spracklandus, and all issues of AJH, is the only effective way to bring this contentious and confusing issue to resolution. The plenary power available under Article 81.1 of the Code exist specifically to allow the Commission to make rulings in individual cases that disturb stability and cause confusion, whether the works are Code-compliant or not. We maintain that it is in the interest of nomenclatural stability, not only for herpetology, but for all of zoological taxonomy, that the plenary power be invoked to declare the works in AJH unavailable, regardless of any narrow interpretation of their technical Code-compliance. We present our arguments for rejection of the validity of AJH in the following commentary. In view of the wide-reaching implications of this case for all of zoology, and reflecting the deep and broad-based community concern over these issues, our contributing authors include 70 global scientific leaders and accomplished amateurs from a wide variety of zoological disciplines.

  2. Analysis of trace neptunium in the vicinity of underground nuclear tests at the Nevada National Security Site

    International Nuclear Information System (INIS)

    A high sensitivity analytical method for 237Np analysis was developed and applied to groundwater samples from the Nevada National Security Site (NNSS) using short-lived 239Np as a yield tracer and HR magnetic sector ICP-MS. The 237Np concentrations in the vicinity of the Almendro, Cambric, Dalhart, Cheshire, and Chancellor underground nuclear test locations range from <4 × 10−4 to 2.6 mBq/L (6 × 10−17–4.2 × 10−13 mol/L). All measured 237Np concentrations are well below the drinking water maximum contaminant level for alpha emitters identified by the U.S. EPA (560 mBq/L). Nevertheless, 237Np remains an important indicator for radionuclide transport rates at the NNSS. Retardation factor ratios were used to compare the mobility of 237Np to that of other radionuclides. The results suggest that 237Np is less mobile than tritium and other non-sorbing radionuclides (14C, 36Cl, 99Tc and 129I) as expected. Surprisingly, 237Np and plutonium (239,240Pu) retardation factors are very similar. It is possible that Np(IV) exists under mildly reducing groundwater conditions and exhibits a retardation behavior that is comparable to Pu(IV). Independent of the underlying process, 237Np is migrating downgradient from NNSS underground nuclear tests at very low but measureable concentrations. - Highlights: • A high sensitivity analytical method for 237Np analysis in groundwater was developed. • Groundwater samples from the Nevada National Security Site (NNSS) were analyzed. • 237Np concentrations were well below the EPA maximum contaminant level in drinking water. • 237Np is less mobile than 3H and other non-sorbing radionuclides. • 237Np and Pu apparent retardation factors are similar

  3. Dicty_cDB: SHL542 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 6e-61 AK145000_1( AK145000 |pid:none) Mus musculus mammary gland RCB-052... 237 6...i*sivkinslrnqkqsvlklyyslmmalql vwlis*ny*ikikisilfigsivfn*nvklikrecwlkqmqkvskrikii*qlkrfkisn knmnylnilsrvqef ...irlvrsgglhy csnaikfvpdlkkipkfqdltskdalspetiqastnldsiihnlsnnlsegteyfkmlvn vfatefrnianqhlknfyiivpal...F0681 protein KIAA1033; 237 6e-61 AK161247_1( AK161247 |pid:none) Mus musculus adult male testis cDN... 237 ...asnyidhminskdklfkkskaigaeallftddgfai glayilklldqnkdfdslhwfdriqlkcetdqkrmlaeanakgikedqnhlaikk

  4. An inhibitor of viral RNA replication is encoded by a plant resistance gene.

    Science.gov (United States)

    Ishibashi, Kazuhiro; Masuda, Kiyoshi; Naito, Satoshi; Meshi, Tetsuo; Ishikawa, Masayuki

    2007-08-21

    The tomato Tm-1 gene confers resistance to tomato mosaic virus (ToMV). Here, we report that the extracts of Tm-1 tomato cells (GCR237) have properties that inhibit the in vitro RNA replication of WT ToMV more strongly than that of the Tm-1-resistance-breaking mutant of ToMV, LT1. We purified this inhibitory activity and identified a polypeptide of approximately 80 kDa (p80(GCR237)) using LC-tandem MS. The amino acid sequence of p80(GCR237) had no similarity to any characterized proteins. The p80(GCR237) gene cosegregated with Tm-1; transgenic expression of p80(GCR237) conferred resistance to ToMV within tomato plants; and the knockdown of p80(GCR237) sensitized Tm-1 tomato plants to ToMV, indicating that Tm-1 encodes p80(GCR237) itself. We further show that in vitro-synthesized Tm-1 (p80(GCR237)) protein binds to the replication proteins of WT ToMV and inhibits their function at a step before, but not after, the viral replication complex is formed on the membrane surfaces. Such binding was not observed for the replication proteins of LT1. These results suggest that Tm-1 (p80(GCR237)) inhibits the replication of WT ToMV RNA through binding to the replication proteins. PMID:17699618

  5. 78 FR 72817 - Drawbridge Operation Regulation; Gulf Intracoastal Waterway, Near Moss Lake, LA

    Science.gov (United States)

    2013-12-04

    ... Lake, LA AGENCY: Coast Guard, DHS. ACTION: Notice of deviation from drawbridge regulation. SUMMARY: The... pontoon bridge across the Gulf Intracoastal Waterway, mile 237.5, near Moss Lake, Louisiana. The deviation... 237.5 near Moss Lake, Louisiana. In accordance with 33 CFR 117.5, except as otherwise authorized...

  6. New records of Ascaridia platyceri (Nematoda) in parrots (Psittaciformes)

    Czech Academy of Sciences Publication Activity Database

    Kajerová, V.; Baruš, Vlastimil; Literák, I.

    2004-01-01

    Roč. 49, č. 7 (2004), s. 237-241. ISSN 0375-8427 R&D Projects: GA ČR GA524/03/0061 Institutional research plan: CEZ:AV0Z6093917 Keywords : ascarids * morphology * Nematoda Subject RIV: EG - Zoology Impact factor: 0.790, year: 2004 http://www.vri.cz/docs/vetmed/49-7-237.pdf

  7. EFFECT OF HYDROPHOBIC ORGANIC POLLUTANTS BIOAVAILABILITY ON ECOTOXICITY OF HISTORICALLY CONTAMINATED SOILS

    Czech Academy of Sciences Publication Activity Database

    Čvančarová, Monika; Innemanová, P.; Cajthaml, Tomáš

    2012-01-01

    Roč. 11, č. 3 (2012), s. 237-237. ISSN 1843-3707. [ Environmental Microbiology and Biotechnology. 10.04.2012-12.04.2012, Bologna] R&D Projects: GA TA ČR TA01020804 Institutional research plan: CEZ:AV0Z50200510 Keywords : Supercritical fluid extraction Subject RIV: EE - Microbiology, Virology

  8. The role of ATM in maintenance of telomeres in Arabidopsis thaliana

    Czech Academy of Sciences Publication Activity Database

    Široký, Jiří; Mokroš, Petr; Vespa, L.; Shippen, D.

    Southampton, 2006. C2.37-C2.37. [Cell Cycle Symposium. 03.07.2006-06.07.2006, Southampton] R&D Projects: GA ČR(CZ) GA522/06/0380 Institutional research plan: CEZ:AV0Z50040507 Keywords : Arabidopsis thaliana * DNA repair * ataxia telangiectasia mutated Subject RIV: BO - Biophysics

  9. Gastrointestinal absorption and retention of plutonium-238 in neonatal rats and swine

    International Nuclear Information System (INIS)

    Neonatal rats gavaged with 237Pu or 238Pu retained a substantial quantity in gut mucosa for a week but absorbed only 2.9% of the 237Pu. After 140 days the amount retained fell to half that initially deposited. Newborn swine also retained large amounts in the gut and absorbed about 40% of the dose

  10. AcEST: DK946499 [AcEST

    Lifescience Database Archive (English)

    Full Text Available +ELESHA Q+L EVYP+GP+ Sbjct: 187 ILVNTFIELESHAIQSLSGSTVPEVYPVGPI 217 >tr|Q8W237|Q8W237_DORBE Betanidin 6-O-glucosyltransferase OS=Doro...theanthus bellidiformis PE=2 SV=1 Length = 481 Score = 33.1 bits (74), Expect = 7.1

  11. Dicty_cDB: Contig-U03903-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available A sequence from clone DKEYP-86F8 in l... 52 0.023 1 ( BV433213 ) S237P6285FG10.T0 Portugu...6 1 ( BV438906 ) S237P6374FA9.T0 PortugueseWaterDog Canis familiar... 44 5.6 1 ( AM456273 ) Vitis vinifera c

  12. Dicty_cDB: Contig-U12507-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 129S1/SvImJ Mus musculus STS genomi... 58 0.001 1 ( BV434071 ) S237P6227RB12.T0 PortugueseWaterDog Canis fam...ilia... 58 0.001 1 ( BV424860 ) S237P6196FC6.T0 PortugueseWaterDog Canis familiar

  13. EST Table: FY745710 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available ron-binding protein aquarius (Intron-binding protein of 160 kDa) (IBP160) [Tribolium castaneum] FY745710 famL ... ...|gene:AGAP004028 11/11/04 78 %/237 aa gnl|Amel|GB19403-PA 11/11/04 78 %/237 aa gi|91085659|ref|XP_971350.1| PREDICTED: similar to Int

  14. 27 CFR 19.231 - Filing of operations or unit bonds.

    Science.gov (United States)

    2010-04-01

    ... management of the business of the principal has been convicted of or has compromised any offense set forth in § 19.237(a)(1) or has been convicted of any offense set forth in § 19.237(a)(2). In the event the...

  15. Dicty_cDB: Contig-U04716-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ( BV429027 ) S237P6215FG6.T0 PortugueseWaterDog Canis familiar... 38 6e-04 2 ( CE020668 ) tigr-gss-dog-1700...AFT ... 48 0.034 2 ( CE733596 ) tigr-gss-dog-17000315432205 Dog Library Canis lup... 38 0.034 2 ( BV431612 ) S237P656RA1.T0 Portugu...library Mus ... 38 0.13 2 ( BV431707 ) S237P6458FA8.T0 PortugueseWaterDog Canis familiar... 38 0.13 2 ( BV25... ( BV437326 ) S237P6229FG2.T0 PortugueseWaterDog Canis familiar... 38 0.13 2 ( CE358139 ) tigr-gss-dog-17000... Canis lup... 38 0.14 2 ( BV432826 ) S237P6430RB9.T0 PortugueseWaterDog Canis familiar... 36 0.14 2 ( CE4742

  16. Nuclear Chemistry Institute, Mainz University. Annual Report 1995

    International Nuclear Information System (INIS)

    The annual report of the Institut fuer Kernchemie addresses inter alia three main research activities. The first belongs to the area of basic research, covering studies in the fields of nuclear fission, chemistry of the super-heavy elements and of heavy-ion reactions extending from the Coulomb barrier to relativistic energies, and nuclear astrophysics in connection with the ''r process''. By means of laser technology, high-precision data could be measured of the ionization energies of berkelium and californium. Studies of atomic clusters in the vacuum of an ionization trap revealed interesting aspects. The second major activity was devoted to the analysis of environmental media, applying inter alia neutron activation analysis and resonance ionization mass spectroscopy (RIMS). The third activity resulted in the development of novel processes, or the enhancement of existing processes or methods, for applications in basic research work and in environmental analytics. Another item of interest is the summarizing report on the operation of the TRIGA research reactor. (orig./SR)

  17. Paul Scherrer Institute Scientific Report 1999. Volume I: Particles and Matter

    International Nuclear Information System (INIS)

    Although originally planned for fundamental research in nuclear physics, the particle beams of pions, muons, protons and neutrons are now used in a large variety of disciplines in both natural science and medicine. The beams at PSI have the world's highest intensities and therefore allow certain experiments to be performed, which would not be possible elsewhere. The highlight of research this year was the first-ever determination of the chemical properties of the superheavy element 107 Bohrium. This was undertaken, by an international team led by H. Gaeggeler of PSI's Laboratory for Radiochemistry. Bohrium was produced by bombarding a Berkelium target with Neon ions from the Injector I cyclotron and six atoms were detected after having passed through an online gas chromatography device. At the Laboratory for Particle Physics the focus has shifted from nuclear physics to elementary particle physics with about a fifty-fifty split between investigations of rare processes or particle decays using the high intensity muon, pion and recently also polarized neutron beams of PSI, and research at the highest energy frontier at CERN (Geneva) and DESY (Hamburg). Important space instrumentation has been contributed by the Laboratory for Astrophysics to the European Space Agency and NASA satellite programmes. The Laboratory for Micro and Nanotechnology continued to focus on research into molecular nanotechnology and SiGeC nanostructures, the latter with the aim of producing silicon based optoelectronics. Progress in 1999 in these topical areas is described in this report. A list of scientific publications in 1999 is also provided

  18. Investigations for the influence of geochemical parameters on the sorption and desorption of lanthanides and uranium onto opalinus clay as potential host rock for a repository

    International Nuclear Information System (INIS)

    The development of a disposal in deep geological formations for radioactive waste is a very important task for the future. The safety assessment for more than a hundred thousand years needs a full understanding of all processes of interaction between the radioactive waste and the surrounded formations. This work contributes to this understanding. The interaction between lanthanides (homologues of the actinides americium, curium and berkelium) / uranium and the host rock opalinus clay under influence of organic substances (NOM) have been analyzed and discussed. The complex system was split into 3 binary basic systems with the following interactions - Interactions between lanthanides / uranium and NOM - Interactions between lanthanides / uranium and the opalinus clay - Interactions between NOM and opalinus clay All binary systems can be influenced by geological parameters like pH, ion strength and competing cations. The sorption / desorption of the lanthanides onto the opalinus clay is analyzed via inductively coupled plasma mass spectrometry. For the investigation of the complexation behavior of metals with NOM we used capillary electrophoresis coupled with inductively coupled plasma mass spectrometry. Under these conditions the chosen model organic humic acid affected the sorption of the lanthanides onto opalinus clay favorably. The smaller organic compounds, which dominate in the composition of the clay organics, remobilized the metals after sorption onto clay and the sorption can be inhibited by NOM. Due to the reduced metal sorption onto Opalinus clay by NOM, a migration through the clay may be possible.

  19. CAPABILITY TO RECOVER PLUTONIUM-238 IN H-CANYON/HB-LINE

    Energy Technology Data Exchange (ETDEWEB)

    Fuller, Kenneth S. Jr.; Smith, Robert H. Jr.; Goergen, Charles R.

    2013-01-09

    Plutonium-238 is used in Radioisotope Thermoelectric Generators (RTGs) to generate electrical power and in Radioisotope Heater Units (RHUs) to produce heat for electronics and environmental control for deep space missions. The domestic supply of Pu-238 consists of scrap material from previous mission production or material purchased from Russia. Currently, the United States has no significant production scale operational capability to produce and separate new Pu-238 from irradiated neptunium-237 targets. The Department of Energy - Nuclear Energy is currently evaluating and developing plans to reconstitute the United States capability to produce Pu-238 from irradiated Np-237 targets. The Savannah River Site had previously produced and/or processed all the Pu-238 utilized in Radioisotope Thermoelectric Generators (RTGs) for deep space missions up to and including the majority of the plutonium for the Cassini Mission. The previous full production cycle capabilities included: Np-237 target fabrication, target irradiation, target dissolution and Np-237 and Pu-238 separation and purification, conversion of Np-237 and Pu-238 to oxide, scrap recovery, and Pu-238 encapsulation. The capability and equipment still exist and could be revitalized or put back into service to recover and purify Pu-238/Np-237 or broken General Purpose Heat Source (GPHS) pellets utilizing existing process equipment in HB-Line Scrap Recovery, and H-anyon Frame Waste Recovery processes. The conversion of Np-237 and Pu-238 to oxide can be performed in the existing HB-Line Phase-2 and Phase-3 Processes. Dissolution of irradiated Np-237 target material, and separation and purification of Np-237 and Pu-238 product streams would be possible at production rates of ~ 2 kg/month of Pu-238 if the existing H-Canyon Frames Process spare equipment were re-installed. Previously, the primary H-Canyon Frames equipment was removed to be replaced: however, the replacement project was stopped. The spare equipment is

  20. Capability to Recover Plutonium-238 in H-Canyon/HB-Line - 13248

    Energy Technology Data Exchange (ETDEWEB)

    Fuller, Kenneth S. Jr.; Smith, Robert H. Jr.; Goergen, Charles R. [Savannah River Nuclear Solutions, LLC, Savannah River Site, Aiken, SC 29802 (United States)

    2013-07-01

    Plutonium-238 is used in Radioisotope Thermoelectric Generators (RTGs) to generate electrical power and in Radioisotope Heater Units (RHUs) to produce heat for electronics and environmental control for deep space missions. The domestic supply of Pu-238 consists of scrap material from previous mission production or material purchased from Russia. Currently, the United States has no significant production scale operational capability to produce and separate new Pu-238 from irradiated neptunium-237 targets. The Department of Energy - Nuclear Energy is currently evaluating and developing plans to reconstitute the United States capability to produce Pu-238 from irradiated Np-237 targets. The Savannah River Site had previously produced and/or processed all the Pu-238 utilized in Radioisotope Thermoelectric Generators (RTGs) for deep space missions up to and including the majority of the plutonium for the Cassini Mission. The previous full production cycle capabilities included: Np- 237 target fabrication, target irradiation, target dissolution and Np-237 and Pu-238 separation and purification, conversion of Np-237 and Pu-238 to oxide, scrap recovery, and Pu-238 encapsulation. The capability and equipment still exist and could be revitalized or put back into service to recover and purify Pu-238/Np-237 or broken General Purpose Heat Source (GPHS) pellets utilizing existing process equipment in HB-Line Scrap Recovery, and H-Canyon Frame Waste Recovery processes. The conversion of Np-237 and Pu-238 to oxide can be performed in the existing HB-Line Phase-2 and Phase- 3 Processes. Dissolution of irradiated Np-237 target material, and separation and purification of Np-237 and Pu-238 product streams would be possible at production rates of ∼2 kg/month of Pu-238 if the existing H-Canyon Frames Process spare equipment were re-installed. Previously, the primary H-Canyon Frames equipment was removed to be replaced: however, the replacement project was stopped. The spare equipment

  1. Holdup measurements on an SRNL Mossbauer spectroscopy instrument

    International Nuclear Information System (INIS)

    Gamma-ray holdup measurements of a Mossbauer spectroscopy instrument are described and modeled. In the qualitative acquisitions obtained in a low background area of Savannah River National Laboratory, only Am-241 and Np-237 activity were observed. The Am-241 was known to be the instrumental activation source, while the Np-237 is clearly observed as a source of contamination internal to the instrument. The two sources of activity are modeled separately in two acquisition configurations using two separate modeling tools. The results agree well, demonstrating a content of (1980 ± 150) μCi Am-241 and (110 ± 50) μCi of Np-237. (author)

  2. Comparison of fission and capture cross sections of minor actinides

    CERN Document Server

    Nakagawa, T

    2003-01-01

    The fission and capture cross sections of minor actinides given in JENDL-3.3 are compared with other evaluated data and experimental data. The comparison was made for 32 nuclides of Th-227, 228, 229, 230, 233, 234, Pa-231, 232, 233, U-232, 234, 236, 237, Np-236, 237, 238, Pu-236, 237, 238, 242, 244, Am-241, 242, 242m, 243, Cm-242, 243, 244, 245, 246, 247 and 248. Given in the present report are figures of these cross sections and tables of cross sections at 0.0253 eV and resonance integrals.

  3. Comparison of fission and capture cross sections of minor actinides

    International Nuclear Information System (INIS)

    The fission and capture cross sections of minor actinides given in JENDL-3.3 are compared with other evaluated data and experimental data. The comparison was made for 32 nuclides of Th-227, 228, 229, 230, 233, 234, Pa-231, 232, 233, U-232, 234, 236, 237, Np-236, 237, 238, Pu-236, 237, 238, 242, 244, Am-241, 242, 242m, 243, Cm-242, 243, 244, 245, 246, 247 and 248. Given in the present report are figures of these cross sections and tables of cross sections at 0.0253 eV and resonance integrals. (author)

  4. Holdup Measures on an SRNL Mossbauer Spectroscopy Instrument

    Energy Technology Data Exchange (ETDEWEB)

    Dewberry, R.; Brown, T.; Salaymeh, S.

    2010-05-05

    Gamma-ray holdup measurements of a Mossbauer spectroscopy instrument are described and modeled. In the qualitative acquisitions obtained in a low background area of Savannah River National Laboratory, only Am-241 and Np-237 activity were observed. The Am-241 was known to be the instrumental activation source, while the Np-237 is clearly observed as a source of contamination internal to the instrument. The two sources of activity are modeled separately in two acquisition configurations using two separate modeling tools. The results agree well, demonstrating a content of (1980 {+-} 150) {mu}Ci Am-241 and (110 {+-} 50) {mu}Ci of Np-237.

  5. Neptunium determination by inductively coupled plasma mass spectrometry (ICP-MS)

    International Nuclear Information System (INIS)

    The determination of neptunium-237 (237Np) traditionally has been performed by alpha spectrometry or neutron activation analysis. These methods are labor intensive and require several days for completion. Inductively Coupled Plasma Mass Spectrometry (ICP-MS) is a possible alternative for 237Np determinations. This paper describes the analytical method developed for samples that have significant levels of uranium present. The lower reporting limits achievable by ICP-MS are competitive with the counting methods, but the real advantage for this laboratory lies in the lower cost and faster turnaround time provided by ICP-MS. (author)

  6. Mutual emergency assistance for radiation accidents

    International Nuclear Information System (INIS)

    A revised document on ''Mutual Emergency Assistance for Radiation Accidents'' jointly prepared by the Agency with the participation of the World Health Organization (WHO), the Food and Agricultural Organization of the United Nations (FAO), the International Labour Organisation (ILO) and the Office of the United Nations Disaster Relief Co-ordinator (UNDRO) was issued in 1980 as TECDOC-237. The present document lists the additional information received after publication of the 1980 edition and is issued as a Supplement to TECDOC-237 (1980 Edition). Some useful information contained in TECDOC-237 such as the IAEA arrangement and the WHO Collaborating Centres for Radiation Emergency Assistance are reprinted for ready reference

  7. A Survey of Special Educators' Awareness of, Experiences with, and Attitudes toward Nonverbal Communication Aids in the Schools.

    Science.gov (United States)

    Shrewsbury, Rosemary G.; And Others

    1985-01-01

    Results of surveys completed by 237 special educators indicate respondents' limited awareness, understanding, and experiences with nonverbal communication aids. Results have implications for preservice and continuing education programs for special educators. (Author/CL)

  8. Urinary Tract Infections (For Kids)

    Medline Plus

    Full Text Available ... School Butterflies? Read This Chloe & Nurb Meet The Brain (Movie) Quiz: Do You Need a Flu Shot? ... 237 milliliters) of urine in your bladder, your brain tells you it's time to find a bathroom. ...

  9. Cryptosporidiosis in other vertebrates

    Czech Academy of Sciences Publication Activity Database

    Kváč, Martin; McEvoy, J.; Stenger, B.; Clark, M.

    Wien: Springer Vienna, 2014 - (Cacciò, S.; Widmer, G.), s. 237-326 ISBN 978-3-7091-1561-9 Institutional support: RVO:60077344 Keywords : Cryptosporidium * diversity Subject RIV: EE - Microbiology, Virology

  10. Zwischen Gewalt und Toleranz. Die unsichere Existenz der Brüderunität im spätmittelalterlichen Böhmen

    Czech Academy of Sciences Publication Activity Database

    Hlaváček, Petr

    Leipzig: Evangelische Verlagsanstalt, 2014 - (Plasger, G.; Stobbe, H.), s. 237-244 ISBN 978-3-374-03923-4 Institutional support: RVO:67985955 Keywords : Middle Ages * Bohemia * tolerance * violence Subject RIV: AB - History

  11. FastStats: Anemia or Iron Deficiency

    Science.gov (United States)

    ... this? Submit What's this? Submit Button NCHS Home Anemia or Iron Deficiency Recommend on Facebook Tweet Share ... visits Number of visits to emergency departments with anemia as the primary hospital discharge diagnosis: 237,000 ...

  12. Transpiration of Poplar Based Short Rotation Coppice under Drought Stress

    Czech Academy of Sciences Publication Activity Database

    Orság, Matěj; Fischer, Milan; Trnka, Miroslav; Tripathi, Abishek

    2013-01-01

    Roč. 991, JUN 04-07 (2013), s. 231-237. ISSN 0567-7572 Institutional support: RVO:67179843 Keywords : sap flow * transpiration * transpiration * poplar * modeling Subject RIV: EH - Ecology, Behaviour

  13. Tick-borne encephalitis

    Czech Academy of Sciences Publication Activity Database

    Růžek, Daniel; Bilski, B.; Günther, G.

    Florida : CRC Press, 2013, s. 211-237. ISBN 9781466567207 Institutional support: RVO:60077344 Keywords : tick-borne encephalitis * neuroviral Infections * viruses Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine

  14. Separation of Staphylococcus aureus causing serious infections by electrophoretic techniques

    Czech Academy of Sciences Publication Activity Database

    Tesařová, Marie; Horká, Marie; Moravcová, Dana; Šťavíková, Lenka; Růžička, F.

    2014. s. 237-238. [Chemtech /14./. 22.10.2014-25.10.2014, Istambul] R&D Projects: GA MV VG20112015021 Institutional support: RVO:68081715 Keywords : Staphylococcus aureus * electrophoretic techniques Subject RIV: CB - Analytical Chemistry, Separation

  15. The Czech Metalworkers´ Federation/ Odborový svaz KOVO (OS KOVO) in Domestic and European Arenas

    Czech Academy of Sciences Publication Activity Database

    Mansfeldová, Zdenka

    Stuttgart: ibidem-Verlag, 2015 - (Landgraf, C.; Pleines, H.), s. 237-253 ISBN 978-3-8382-0734-6 Institutional support: RVO:68378025 Keywords : Metalworkers´ trade union * European cooperation Subject RIV: AD - Politology ; Political Sciences

  16. Towards a methodology for educational modelling: a case in educational assessment

    OpenAIRE

    Giesbers, Bas; Van Bruggen, Jan; Hermans, Henry; Joosten-ten Brinke, Desirée; Burgers, Jan; Koper, Rob; Latour, Ignace

    2005-01-01

    Giesbers, B., van Bruggen, J., Hermans, H., Joosten-ten Brinke, D., Burgers, J., Koper, R., & Latour, I. (2007). Towards a methodology for educational modelling: a case in educational assessment. Educational Technology & Society, 10 (1), 237-247.

  17. Study on Removing Micro-neptunium From Milligramme Uranium

    Institute of Scientific and Technical Information of China (English)

    2008-01-01

    <正>In the production of radioisotopes and neutron activation analysis, it is very important to know the fast neutron densities, so that the yields of the radioistopes can be estimated. The 238U (n, 2n) 237U reactor

  18. Scenic Splendor in Calabash Island City

    Institute of Scientific and Technical Information of China (English)

    YIFAN&WANGNAN

    2003-01-01

    The Huludao landscape is one of green hills and a blue sea.Along its 237-km-long coastline are 20 finesanded beaches lapped by gentle waves ofclear water with gently undulating hills in the background.

  19. Zikr e samâ‘ tra i sufi qâdirî di Hyderabad

    Czech Academy of Sciences Publication Activity Database

    Valdinoci, Mauro

    Milano: Mimesis, 2013 - (De Zorzi, G.), s. 213-237. (Mimesis. Eterotopie. 214). ISBN 978-88-575-1938-8 Institutional support: RVO:68378009 Keywords : Sufism * meditation * practice Subject RIV: AA - Philosophy ; Religion

  20. Human Retrovirus K10 Retropepsin

    Czech Academy of Sciences Publication Activity Database

    Stříšovský, Kvido; Kräusslich, H. G.

    Amsterdam : Academic Press, 2013 - (Salvesen, G.), s. 234-237 ISBN 978-0-12-382219-2 Institutional support: RVO:61388963 Keywords : human endogenous retrovirus * retropepsin * aspartic protease * dimerisation Subject RIV: CE - Biochemistry

  1. Latein als Sprache der mittelalterlichen Schriften über Wettervorhersage

    Czech Academy of Sciences Publication Activity Database

    Kocánová, Barbora

    -, č. 71 (2013), s. 237-248. ISSN 1376-7453 R&D Projects: GA MŠk(CZ) LD13043 Institutional support: RVO:67985955 Keywords : medieval weather forecasting * medieval Latin * medieval manuscripts Subject RIV: AI - Linguistics

  2. Plant cytomics: A new window for plant biologists

    Czech Academy of Sciences Publication Activity Database

    Loureiro, J.; Rodriguez, E.; Pinto, G.; Doležel, Jaroslav; Santos, C.

    2005. P.237. [COST 843 Final Conference and “COST 843 and COST 851 Joint Meeting”. 28.06.2005-03.07.2005, Stará Lesná] Keywords : Genomics * proteomics * cytomics Subject RIV: EB - Genetics ; Molecular Biology

  3. 78 FR 59715 - Outer Continental Shelf (OCS), Alaska OCS Region, Chukchi Sea Planning Area, Proposed Oil and Gas...

    Science.gov (United States)

    2013-09-27

    ....gov/leasesale237 . Interested parties also may use the interactive map tool for the Arctic at http..., and the bowhead whale migration area. While BOEM will consider information submitted previously on...

  4. Czech Codifications in the High Middle Ages

    Czech Academy of Sciences Publication Activity Database

    Krafl, Pavel

    Firenze : Firenze University Press, 2014 - (Maffei, P.; Varanini, G.), s. 237-244 ISBN 978-88-6655-632-9 Institutional support: RVO:67985963 Keywords : Bohemia * legal history * codification * High Middle Ages Subject RIV: AB - History

  5. Strategic trade policy, intellectual property rights protection, and North-South trade

    Czech Academy of Sciences Publication Activity Database

    Žigić, Krešimir

    Cheltenham: Edward Elgar, 2004 - (Maskus, K.), s. 406-439 ISBN 1-84376-237-4 Institutional research plan: CEZ:AV0Z7085904 Keywords : trade policy * intellectual property rights * optimal tariffs Subject RIV: AH - Economics

  6. Attention and time constraints in performing and learning a table tennis forehand shot

    OpenAIRE

    Maxwell, JP; Beek, PJ; Koedijker, JM; Oudejans, RRD; Poolton, JM; Masters, RSW

    2010-01-01

    This is a section on p. S95 of article 'Verbal and Poster: Motor Development, Motor Learning and Control, and Sport and Exercise Psychology' in Journal of Sport and Exercise Psychology, 2010, v.32, p.S36-S237

  7. Sooaspekt ja selle keeleline ülekanne : Emil Tode Piiririik / Riita-Ilona Märka

    Index Scriptorium Estoniae

    Märka, Riita-Ilona

    2003-01-01

    "Piiririigi" tõlge inglise keelde: Õnnepalu, Tõnu. Border state : [novel] / translated from the Estonian by Madli Puhvel. Evanston [USA] : Northwestern University Press, 2000. Autorist lk. 234 (inglise k.) ja lk. 237 (vene k.)

  8. Podíl "paleolitických" versus "neolitických" haploskupin Y chromozomu u české populace

    Czech Academy of Sciences Publication Activity Database

    Kráčmarová, A.; Bruchová, H.; Černý, Viktor; Brdička, R.

    2006-01-01

    Roč. 58, č. 2 (2006), s. 237-249. ISSN 0323-1267 Institutional research plan: CEZ:AV0Z80020508 Keywords : archaeogenetics * Y chromosome * migrations Subject RIV: AC - Archeology, Anthropology, Ethnology

  9. Fejtová, Olga/Ledvinka, Václav/Pešek, Jiří u.a.: Evropská velkoměsta mezi koncem války světové a války studené 1945–1989.

    Czech Academy of Sciences Publication Activity Database

    Nosková, Jana

    2014-01-01

    Roč. 54, - (2014), 233-237. ISSN 0523-8587 Institutional support: RVO:68378076 Keywords : European cities * Cold War * 1945–1989 * urban history * urban anthropology Subject RIV: AC - Archeology, Anthropology , Ethnology

  10. Local viscoelastic properties of a thermoplastic/carbon laminate as an indicator of fatigue damage

    Czech Academy of Sciences Publication Activity Database

    Minster, Jiří; Šperl, Martin; Lukeš, J.

    Vol. 606. Durnten-Zurich: Trans Tech Publications, 2014 - (Haušild, P.), s. 237-240 ISBN 978-3-03835-062-0. ISSN 1013-9826. [Local Mechanical Properties /10./. Kutná Hora (CZ), 06.11.2013-08.11.2013] R&D Projects: GA TA ČR(CZ) TA03010209 Institutional support: RVO:68378297 Keywords : thermoplastic laminate * fatigue * damage accumulation * microindentation Subject RIV: JI - Composite Materials http://www.scientific.net/KEM.606.237

  11. Antibacterial Activity of the Flavonoids from Dalbergia odorifera on Ralstonia solanacearum

    OpenAIRE

    Wenjian Zuo; Hongjin Bai; Mingfu Gong; Xiabo Zhao; Wenli Mei; Haofu Dai

    2011-01-01

    Phytohemical investigation on the heartwood of Dalbergia odorifera resulted in the isolation of nine flavonoids. Their structures were elucidated as sativanone (1), (3R)-vestitone (2), (3R)-2',3',7-trihydroxy-4'-methoxyisoflavanone (3), (3R)-4'-methoxy-2',3,7-trihydroxyisoflavanone (4), carthamidin (5), liquiritigenin (6), isoliquiritigenin (7), (3R)-vestitol (8), and sulfuretin (9) based on their spectral data. All compounds were evaluated for their inhibitory activity against Ralstonia sola...

  12. Effects of metabotropic glutamate receptor 5 antagonist MPEP on anxiety-like behavior in immature rats

    Czech Academy of Sciences Publication Activity Database

    Mikulecká, Anna; Mareš, Pavel

    Wageningen: Noldus Information Technology bv, 2008 - (Spink, A.; Ballintijn, M.; Bogers, N.; Grieco, F.; Loijens, L.; Noldus, L.; Smit, G.; Zimmerman, P.). s. 237-237 ISBN 978-90-74821-81-0. [Measuring Behavior 2008. 26.03.2008-29.03.2008, Maastricht] R&D Projects: GA ČR(CZ) GA305/06/1188 Institutional research plan: CEZ:AV0Z50110509 Keywords : spo2 * immature rats * glutamate receptor * anxiety Subject RIV: FH - Neurology

  13. RESEARCH OF QUALITY, SAFETY AND CONTENT OF BIOLOGICALLY ACTIVE SUBSTANCES OF FOOD RED BEET

    OpenAIRE

    Gorash E. Y.; Victorova E. P.; Kupin G. A.; Aleshin V. N.; Lisovoy V. V.

    2015-01-01

    The article presents results of research of quality, safety and content of biologically active substances of food red beet roots of Bordo 237 variety, grown in the Krasnodar region in 2014. On the basis of the research carried out it was established, that there are carbohydrates, proteins, organic acids and mineral substances in the food red beet roots of Bordo 237 variety. Food red beet roots are a source of dietary fibers (pectin, protopectin, hemicelluloses and cellulose), possessing antit...

  14. Investigation on migration behavior of TRU-nuclides

    International Nuclear Information System (INIS)

    The migration behavior of TRU nuclides in geological formation has been studied by a batch and a column method, considering the influence of humic complexation and colloid formation. The migration test of 237Np and 238Pu is carrying out in natural field, to verify the data and the conventional migration model for the safety evaluation of TRU waste disposal. It was found that the migration of 237Np and 238Pu in the natural field is largely retarded sorption onto soil. (author)

  15. Elementspeziation von Neptunium im Ultraspurenbereich

    OpenAIRE

    Stöbener, Nils

    2013-01-01

    In der vorliegenden Arbeit wurde der Nachweis des Isotops Np-237 mit Resonanzionisations-Massenspektrometrie (RIMS) entwickelt und optimiert. Bei RIMS werden Probenatome mehrstufig-resonant mit Laserstrahlung angeregt, ionisiert und anschließend massenspektrometrisch nachgewiesen. Die Bestimmung geeigneter Energiezustände für die Anregung und Ionisation von Np-237 erfolgte durch Resonanzionisationsspektroskopie (RIS), wobei über 300 bisher unbekannte Energieniveaus und autoionisierende Zustän...

  16. Drug: D08673 [KEGG MEDICUS

    Lifescience Database Archive (English)

    Full Text Available D08673 Drug Viloxazine (INN) C13H19NO3 237.1365 237.2949 D08673.gif Antidepressant ...:6530] [KO:K05035]; serotonin transporter inhibitor [HSA:6532] [KO:K05037] hsa04726(6532) Serotonergic synapse map07027 Antidepress...[BR:br08303] N NERVOUS SYSTEM N06 PSYCHOANALEPTICS N06A ANTIDEPRESSANTS N06AX Other antidepressants N06AX09

  17. 242Pu as tracer for simultaneous determination of 237Np and 239,240Pu in environmental samples

    DEFF Research Database (Denmark)

    Chen, Q.J.; Dahlgaard, H.; Nielsen, S.P.;

    2002-01-01

    describes a suitable chemical procedure for Np and Pu including a quantitative pre-concentration of neptunium and plutonium, preparation of Np4+ and Pu4+, NP(NO3)(6)(2-) and Pu(NO3)(6)(2-), The ratio of Np-237/Pu-242 (or Np-237/Pu-239) before and after the procedure has been determined using 10 g soil (free...

  18. Dicty_cDB: Contig-U01557-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ling_GS-29-01-01-1... 30 5.1 3 ( BV439796 ) S237P619FE6.T0 PortugueseWaterDog Canis familiari... 36 5.1 2 ( ...enom... 42 8.1 1 ( BV424741 ) S237P6453FF6.T0 PortugueseWaterDog Canis familiar... 42 8.1 1 ( BV402984 ) S22

  19. A peptide fusion protein in hibits angiogenesis and tumorgrowth by blocking VEGF binding to KDR

    Institute of Scientific and Technical Information of China (English)

    2002-01-01

    Vascular endothelial growth factor (VEGF) binding to its tyrosine kinase receptors (KDR/FLK1, Flt-1) induces angiogenesis. In search of the peptides blocking VEGF binding to its receptor KDR/FLK1 to inhibit tumor- angiogenesis and growth, we screened a phage display peptide library with KDR as target protein, and some candidate peptides were isolated. In this study, we cloned the DNA fragment coding the peptide K237 from the library, into a vector pQE42 to express fusion protein DHFR-K237 in E. coli M15. The affection of fusion protein DHFR-K237 on endothelial cell proliferation and angiogenesis was investigated. In vitro, DHFR-K237 could completely block VEGF binding to KDR and significantly inhibit the VEGF-medi- ated proliferation of the human vascular endothelial cells. In vivo, DHFR-K237 inhibited angiogenesis in chick embryo chorioa- llantoric membrane and tumor growth in nude mice. These results suggest that K237 is an effective antagonist of VEGF binding to KDR, and could be a potential agent for cancer biotherapy.

  20. Minor Actinide Burning in Thermal Reactors. A Report by the Working Party on Scientific Issues of Reactor Systems

    International Nuclear Information System (INIS)

    The actinides (or actinoids) are those elements in the periodic table from actinium upwards. Uranium (U) and plutonium (Pu) are two of the principal elements in nuclear fuel that could be classed as major actinides. The minor actinides are normally taken to be the triad of neptunium (Np), americium (Am) and curium (Cm). The combined masses of the remaining actinides (i.e. actinium, thorium, protactinium, berkelium, californium, einsteinium and fermium) are small enough to be regarded as very minor trace contaminants in nuclear fuel. Those elements above uranium in the periodic table are known collectively as the transuranics (TRUs). The operation of a nuclear reactor produces large quantities of irradiated fuel (sometimes referred to as spent fuel), which is either stored prior to eventual deep geological disposal or reprocessed to enable actinide recycling. A modern light water reactor (LWR) of 1 GWe capacity will typically discharge about 20-25 tonnes of irradiated fuel per year of operation. About 93-94% of the mass of uranium oxide irradiated fuel is comprised of uranium (mostly 238U), with about 4-5% fission products and ∼1% plutonium. About 0.1-0.2% of the mass is comprised of neptunium, americium and curium. These latter elements accumulate in nuclear fuel because of neutron captures, and they contribute significantly to decay heat loading and neutron output, as well as to the overall radio-toxic hazard of spent fuel. Although the total minor actinide mass is relatively small - approximately 20-25 kg per year from a 1 GWe LWR - it has a disproportionate impact on spent fuel disposal, and thus the longstanding interest in transmuting these actinides either by fission (to fission products) or neutron capture in order to reduce their impact on the back end of the fuel cycle. The combined masses of the trace actinides actinium, thorium, protactinium, berkelium and californium in irradiated LWR fuel are only about 2 parts per billion, which is far too low for

  1. Radiological safety considerations in the design and operation of the Oak Ridge National Laboratory Transuranium Research Laboratory (TRL)

    International Nuclear Information System (INIS)

    The Transuranium Research Laboratory (TRL) is the central facility at Oak Ridge National Laboratory (ORNL) for chemical and physical research involving transuranium elements. Transuranium Research Laboratory investigations are about equally divided between studies of inorganic and structural chemistry of the heavy elements and nuclear structure and properties of their isotopes. Elements studied include neptunium, plutonium, americium, curium, berkelium, californium, and einsteinium, each in microgram-to-gram quantities depending upon availability and experimental requirements. This paper describes an eight-step safety procedure that is followed in planning and approving individual research projects. This procedure should provide an ''optimum margin of safety'' and should permit the accomplishment of successful research. Steps in the procedure are as follows: (1) Evaluate the external and internal exposure radioactivity hazards. (2) Establish any concurrent conventional industrial safety risks that may be encountered in the operation. (3) Consider, in the proper perspective, the potential consequences of possible interactions of radioactivity risks with associated industrial safety risks and problems, applying the concepts of credibility and probability. (4) Design equipment, develop operating procedures, and ensure the proficiency of operating personnel to provide necessary safeguards to accomplish programme objectives with minimum risks and minimum operational constraints. (5) Ensure that necessary safeguards are, in fact, incorporated in equipment and procedures before actual work is begun. (6) Ensure that appropriate monitoring instrumentation, surveillance, and other necessary protective technical and craft support are available and are used during operation. (7) Make certain that appropriate measures exist to manage credible radiation accidents and other emergencies properly. (8) Inform others, in sufficient detail, of the success or deficiency of design

  2. Radiochemical studies of neutron deficient actinide isotopes

    International Nuclear Information System (INIS)

    The production of neutron deficient actinide isotopes in heavy ion reactions was studied using alpha, gamma, x-ray, and spontaneous fission detection systems. A new isotope of berkelium, 242Bk, was produced with a cross-section of approximately 10 μb in reactions of boron on uranium and nitrogen on thorium. It decays by electron capture with a half-life of 7.0 +- 1.3 minutes. The alpha-branching ratio for this isotope is less than 1% and the spontaneous fission ratio is less than 0.03%. Studies of (Heavy Ion, pxn) and (Heavy Ion, αxn) transfer reactions in comparison with (Heavy ion, xn) compound nucleus reactions revealed transfer reaction cross-sections equal to or greater than the compound nucleus yields. The data show that in some cases the yield of an isotope produced via a (H.I.,pxn) or (H.I.,αxn) reaction may be higher than its production via an xn compound nucleus reaction. These results have dire consequences for proponents of the ''Z1 + Z2 = Z/sub 1+2/'' philosophy. It is no longer acceptable to assume that (H.I.,pxn) and (H.I.,αxn) product yields are of no consequence when studying compound nucleus reactions. No evidence for spontaneous fission decay of 228Pu, 230Pu, 232Cm, or 238Cf was observed indicating that strictly empirical extrapolations of spontaneous fission half-life data is inadequate for predictions of half-lives for unknown neutron deficient actinide isotopes

  3. Transuranium Processing Plant semiannual report of production, status, and plans for period ending December 31, 1975

    Energy Technology Data Exchange (ETDEWEB)

    King, L.J.; Bigelow, J.E.; Collins, E.D.

    1976-10-01

    Between July 1, 1975, and December 31, 1975, maintenance was conducted at TRU for a period of three months, 295 g of curium oxide (enough for approximately 26 HFIR targets) were prepared, 100 mg of high-purity /sup 248/Cm, were separated from /sup 252/Cf that had been purified during earlier periods, 11 HFIR targets were fabricated, and 28 product shipments were made. No changes were made in the chemical processing flowsheets normally used at TRU during this report period. However, three equipment racks were replaced (with two new racks) during this time. In Cubicle 6, the equipment replaced was that used to decontaminate the transplutonium elements from rare earth fission products and to separate curium from the heavier elements by means of the LiCl-based anion-exchange process. In Cubicle 5, the equipment used to separate the transcurium elements by high-pressure ion exchange and to purify berkelium by batch solvent extraction was replaced. Two neutron sources were fabricated, bringing the total fabricated to 79. One source that had been used in a completed project was returned to the TRU inventory and is available for reissue. Three sources, for which no further use was foreseen, were processed to isolate and recover the ingrown /sup 248/Cm and the residual /sup 252/Cf. Eight pellets, each containing 100 ..mu..g of high-purity /sup 248/Cm were prepared for irradiation in HFIR to study the production of /sup 250/Cm. The values currently being used for transuranium element decay data and for cross-section data in planning irradiation-processing cycles, calculating production forecasts, and assaying products are tabulated.

  4. Radiochemical studies of neutron deficient actinide isotopes

    Energy Technology Data Exchange (ETDEWEB)

    Williams, K.E.

    1978-04-01

    The production of neutron deficient actinide isotopes in heavy ion reactions was studied using alpha, gamma, x-ray, and spontaneous fission detection systems. A new isotope of berkelium, /sup 242/Bk, was produced with a cross-section of approximately 10 ..mu..b in reactions of boron on uranium and nitrogen on thorium. It decays by electron capture with a half-life of 7.0 +- 1.3 minutes. The alpha-branching ratio for this isotope is less than 1% and the spontaneous fission ratio is less than 0.03%. Studies of (Heavy Ion, pxn) and (Heavy Ion, ..cap alpha..xn) transfer reactions in comparison with (Heavy ion, xn) compound nucleus reactions revealed transfer reaction cross-sections equal to or greater than the compound nucleus yields. The data show that in some cases the yield of an isotope produced via a (H.I.,pxn) or (H.I.,..cap alpha..xn) reaction may be higher than its production via an xn compound nucleus reaction. These results have dire consequences for proponents of the ''Z/sub 1/ + Z/sub 2/ = Z/sub 1+2/'' philosophy. It is no longer acceptable to assume that (H.I.,pxn) and (H.I.,..cap alpha..xn) product yields are of no consequence when studying compound nucleus reactions. No evidence for spontaneous fission decay of /sup 228/Pu, /sup 230/Pu, /sup 232/Cm, or /sup 238/Cf was observed indicating that strictly empirical extrapolations of spontaneous fission half-life data is inadequate for predictions of half-lives for unknown neutron deficient actinide isotopes.

  5. Paul Scherrer Institute Scientific Report 1999. Volume I: Particles and Matter

    Energy Technology Data Exchange (ETDEWEB)

    Gobrecht, J.; Gaeggeler, H.; Herlach, D.; Junker, K.; Kettle, P.-R.; Kubik, P.; Zehnder, A. [eds.

    2000-07-01

    lthough originally planned for fundamental research in nuclear physics, the particle beams of pions, muons, protons and neutrons are now used in a large variety of disciplines in both natural science and medicine. The beams at PSI have the world's highest intensities and therefore allow certain experiments to be performed, which would not be possible elsewhere. The highlight of research this year was the first-ever determination of the chemical properties of the superheavy element {sup 107} Bohrium. This was undertaken, by an international team led by H. Gaeggeler of PSI's Laboratory for Radiochemistry. Bohrium was produced by bombarding a Berkelium target with Neon ions from the Injector I cyclotron and six atoms were detected after having passed through an online gas chromatography device. At the Laboratory for Particle Physics the focus has shifted from nuclear physics to elementary particle physics with about a fifty-fifty split between investigations of rare processes or particle decays using the high intensity muon, pion and recently also polarized neutron beams of PSI, and research at the highest energy frontier at CERN (Geneva) and DESY (Hamburg). Important space instrumentation has been contributed by the Laboratory for Astrophysics to the European Space Agency and NASA satellite programmes. The Laboratory for Micro and Nanotechnology continued to focus on research into molecular nanotechnology and SiGeC nanostructures, the latter with the aim of producing silicon based optoelectronics. Progress in 1999 in these topical areas is described in this report. A list of scientific publications in 1999 is also provided.

  6. Actinide production in the reaction of heavy ions with curium-248

    International Nuclear Information System (INIS)

    Chemical experiments were performed to examine the usefulness of heavy ion transfer reactions in producing new, neutron-rich actinide nuclides. A general quasi-elastic to deep-inelastic mechanism is proposed, and the utility of this method as opposed to other methods (e.g. complete fusion) is discussed. The relative merits of various techniques of actinide target synthesis are discussed. A description is given of a target system designed to remove the large amounts of heat generated by the passage of a heavy ion beam through matter, thereby maximizing the beam intensity which can be safely used in an experiment. Also described is a general separation scheme for the actinide elements from protactinium (Z=91) to mendelevium (Z=101), and fast specific procedures for plutonium, americium and berkelium. The cross sections for the production of several nuclides from the bombardment of 248Cm with 18O, 86Kr and 136Xe projectiles at several energies near and below the Coulomb barrier were determined. The results are compared with yields from 48Ca and 238U bombardments of 248Cm. Simple extrapolation of the product yields into unknown regions of charge and mass indicates that the use of heavy ion transfer reactions to produce new, neutron-rich above-target species is limited. The substantial production of neutron-rich below-target species, however, indicates that with very heavy ions like 136Xe and 238U the new species 248Am, 249Am and 247Pu should be produced with large cross sections from a 248Cm target. A preliminary, unsuccessful attempt to isolate 247Pu is outlined. The failure is probably due to the half life of the decay, which is calculated to be less than 3 minutes. The absolute gamma ray intensities from 251Bk decay, necessary for calculating the 251Bk cross section, are also determined

  7. Neptunium Transport Behavior in the Vicinity of Underground Nuclear Tests at the Nevada Test Site

    Energy Technology Data Exchange (ETDEWEB)

    Zhao, P; Tinnacher, R M; Zavarin, M; Williams, R W; Kersting, A B

    2010-12-03

    We used short lived {sup 239}Np as a yield tracer and state of the art magnetic sector ICP-MS to measure ultra low levels of {sup 237}Np in a number of 'hot wells' at the Nevada National Security Site (NNSS), formerly known as the Nevada Test Site (NTS). The results indicate that {sup 237}Np concentrations at the Almendro, Cambric, Dalhart, Cheshire and Chancellor sites, are in the range of 3 x 10{sup -5} to 7 x 10{sup -2} pCi/L and well below the MCL for alpha emitting radionuclides (15 pCi/L) (EPA, 2009). Thus, while Np transport is believed to occur at the NNSS, activities are expected to be well below the regulatory limits for alpha-emitting radionuclides. We also compared {sup 237}Np concentration data to other radionuclides, including tritium, {sup 14}C, {sup 36}Cl, {sup 99}Tc, {sup 129}I, and plutonium, to evaluate the relative {sup 237}Np transport behavior. Based on isotope ratios relative to published unclassified Radiologic Source Terms (Bowen et al., 1999) and taking into consideration radionuclide distribution between melt glass, rubble and groundwater (IAEA, 1998), {sup 237}Np appears to be substantially less mobile than tritium and other non-sorbing radionuclides, as expected. However, this analysis also suggests that {sup 237}Np mobility is surprisingly similar to that of plutonium. The similar transport behavior of Np and Pu can be explained by one of two possibilities: (1) Np(IV) and Pu(IV) oxidation states dominate under mildly reducing NNSS groundwater conditions resulting in similar transport behavior or (2) apparent Np transport is the result of transport of its parent {sup 241}Pu and {sup 241}Am isotopes and subsequent decay to {sup 237}Np. Finally, measured {sup 237}Np concentrations were compared to recent Hydrologic Source Term (HST) models. The 237Np data collected from three wells in Frenchman Flat (RNM-1, RNM-2S, and UE-5n) are in good agreement with recent HST transport model predictions (Carle et al., 2005). The agreement

  8. Investigation of parvovirus B19 infection in 266 pregnant women in Zhengzhou%郑州市流产或死胎孕妇人微小病毒B19感染情况测定

    Institute of Scientific and Technical Information of China (English)

    靳静; 冷弘; 徐慧丹; 刘全离; 赵国强

    2005-01-01

    目的:了解郑州市流产或死胎孕妇人微小病毒B19的感染情况.方法:采用ELISA和PCR方法分别检测郑州市237例正常孕妇及29例不明原因流产或死胎孕妇血清中B19-IgG、B19-IgM和B19 DNA表达情况.结果:29例流产或死胎孕妇B19-IgG、B19-IgM和B19 DNA阳性率分别为51.7%(15/29)、6.9%(2/29)和13.8%(4/29),237例正常孕妇B19-IgG、B19-IgM和B19 DNA阳性率分别30.4%(72/237)、1.3%(3/237)和2.5%(6/237),差异均有统计学意义(P<0.05).结论:郑州市孕妇中存在人微小病毒B19的感染,可能导致不明原因流产或死胎.

  9. Uptake of three isotopes of plutonium from soil by sweet corn grown in a growth chamber

    International Nuclear Information System (INIS)

    A gamma-emitting isotope of plutonium for simulating 238Pu and 239Pu behavior in the environment would eliminate the high cost of sample preparation necessary for detecting alpha particles. To date, selected tracers for this purpose have not been satisfactory; however, the availability of 237Pu has provided an additional candidate tracer. 237Pu has been used to trace 239Pu in metabolic studies of plutonium distribution in, and excretion by, dogs and rats and to determine the distribution coefficient of plutonium between sediment and sea water. The suitability of 237Pu as a tracer for 238Pu and 239Pu in environmental systems was determined using a plant-soil system. These three isotopes were compared by measuring their uptakes by sweet corn. A nitrate solution containing all three isotopes was added to the soil. The apparent availability of the three isotopes differed: 237Pu was more available than 238Pu, which was more available than 239Pu. The quantity of 237Pu in the standing crop, on a mass basis, closely approximated that of 238Pu

  10. Hanford intercontractor support

    International Nuclear Information System (INIS)

    Distribution coefficients (Kd values) were determined on subsoils from Washington and South Carolina for 241Am, 237Np, and 99Tc as a function of equilibrium solution concentration of calcium (Ca2+) and of sodium (Na+). Kd values decreased in all cases with increasing solution concentrations of Ca2+ and Na+. For the South Carolina subsoil Kd values ranged from 1.0 to 67 for 241Am as a function of Ca2+, from 0.2 to 0.002 M, respectively, 1.6 to 280 for 241Am as a function of Na+, 0.43 to 0.66 for 237Np as a function of Ca2+, and 0.16 to 0.25 for 237Np as a function of Na+ from 3.0 less than 0.015 M, respectively. For the Washington soil, Kd values were greater than 1200 for 241Am and ranged from 0.36 to 2.37 as a function of Ca2+ and from 3.19 to 3.90 for 237Np as a function of Na+ over the above concentration ranges, respectively. Kd values for 99Tc were essentially 0 at all NaHCO3 concentrations on the South Carolina subsoil

  11. Excited levels of Pa-233; Niveles excitados del Pa-233

    Energy Technology Data Exchange (ETDEWEB)

    Vara Cuadrado, J. M.

    1969-07-01

    A study of Pa-233 excited levels from the alpha decay of Np-237 and from beta decay of Th-233 has been performed. The alpha decay spectrum was measured with a semiconductor spectrometer of 18 keV effective resolution (FWHM). Over 13 new lines were identified. The gamma ray spectra of Np-237 and Th-233 were obtained with a Ge-Li detector low and medium range energy lines, and with Si-Li detector for the low energy region. A continuous purification method of Np-237 from its comparatively short-lived daughter Pa-233 was applied. A high number of new lines were identified in both spectra. The gamma-gamma coincidence spectra were obtained with INa(T{sub 1}) detectors. (Author) 54 refs.

  12. Method for Determination of Neptunium in Large-Sized Urine Samples Using Manganese Dioxide Coprecipitation and 242Pu as Yield Tracer

    DEFF Research Database (Denmark)

    Qiao, Jixin; Hou, Xiaolin; Roos, Per

    2013-01-01

    A novel method for bioassay of large volumes of human urine samples using manganese dioxide coprecipitation for preconcentration was developed for rapid determination of 237Np. 242Pu was utilized as a nonisotopic tracer to monitor the chemical yield of 237Np. A sequential injection extraction...... 100% and high separation capacity of processing up to 5 L of human urine samples. The MnO2 coprecipitation process is simple and straightforward in which a batch (8–12) of samples can be pretreated within 4 h (i.e., <0.5 h/sample). In connection with the automated column separation and ICPMS...... quantification, which takes less than 1.5 h in total, the overall analytical time was on average less than 2 h for each sample. The high effectiveness and sample throughput make the developed method well suited for urine bioassay of 237Np in routine monitoring of occupationally internal radiation exposure and...

  13. Excited levels of Pa-233

    International Nuclear Information System (INIS)

    A study of Pa-233 excited levels from the alpha decay of Np-237 and from beta decay of Th-233 has been performed. The alpha decay spectrum was measured with a semiconductor spectrometer of 18 keV effective resolution (FWHM). Over 13 new lines were identified. The gamma ray spectra of Np-237 and Th-233 were obtained with a Ge-Li detector low and medium range energy lines, and with Si-Li detector for the low energy region. A continuous purification method of Np-237 from its comparatively short-lived daughter Pa-233 was applied. A high number of new lines were identified in both spectra. The gamma-gamma coincidence spectra were obtained with INa(T1) detectors. (Author) 54 refs

  14. Study on the radionuclide elution from quartz sand source and their speciation

    International Nuclear Information System (INIS)

    The study of the elution of the radionuclide from quartz sand source and their speciation is carried out by column method. The colloid form of nuclides in the eluted solution is studied by ultra-filtration method. The existing form of the nuclides on the sand after elution is studied with sequential extraction method. When the volume of eluted solution is up to 110 times of the column volume, the nuclide 237Np of more than 90% is eluted, and in the exchangeable form. The nuclide 237Np remained in the sand is mainly in the form of being coincident with the matrix of carbonate (5.5%) and the transition metals, iron and manganese (1.3%). The elution of 238Pu from sand is more difficult than that of 237Np. 238Pu may exist in colloid form in eluted solution

  15. The association analysis of FcεRⅠβ with allergic asthma in a Chinese population

    Institute of Scientific and Technical Information of China (English)

    崔天盆; 王琳; 吴健民; 谢俊刚

    2003-01-01

    Objective To investigate the link between the polymorphism of -109 and Glu237 in the high-affinity IgE receptor β (FcεRⅠβ) gene and susceptibilty to allergic asthma in a Chinese population.Method Blood samples from 216 allergic asthma patients and 198 age- and sex-matched controls were studied. A-109C/T and a coding variant Glu237Gly in FcεRⅠβ were detected with polymerase chain reaction-restriction fragment length polymorphism(PCR-RFLP).Results The genotype frequencies were 0.403 for -109T/T, 0.491 for -109T/C and 0.106 for -109C/C in allergic asthma in a Chinese population. No significant difference in the distribution of -109C/T polymorphism was found between allergic asthma subjects and healthy controls, however, homozygosity for the -109T allele was associated with increased total plasma IgE levels in subjects with allergic asthma (F=4.020,P<0.05). The allele frequency of Gly237 in the patients and control was 0.236 and 0.136 respectively. There was a significant association between the Gly/Gly genotype and allergic asthma. Among allergic asthma patients Gly237 was significantly associated with high IgE levels.Conclusions These results suggest that the Gly237 variant of the FcεRⅠβ gene is involved in the development of allergic asthma. The-109C/T and Glu237Gly polymorphisms are two of the genetic factor identified thus far, which affect total plasma IgE levels of allergic asthma patients in a Chinese population.

  16. Non-conventional measurement techniques for the determination of some long-lived radionuclides produced in nuclear fuel

    International Nuclear Information System (INIS)

    The results of a literature survey on non-radiometric analytical techniques for the determination of long-lived radionuclides are described. The methods which have been considered are accelerator mass spectrometry, inductively coupled plasma mass spectrometry, thermal ionization mass spectrometry, resonance ionization spectrometry, resonance ionization mass spectrometry and neutron activation analysis. Neutron activation analysis has been commonly used for the determination of 129I and 237Np in environmental samples. Inductively coupled mass spectrometry seems likely to become the method of choice for the determination of 99Tc, 237Np and Pu-isotopes. The methods are discussed and the chemical separation methods described. (orig.)

  17. Drug: D07283 [KEGG MEDICUS

    Lifescience Database Archive (English)

    Full Text Available D07283 Drug Esketamine (INN) C13H16ClNO 237.092 237.7252 D07283.gif Anesthetic ATC ...amine D07283 Esketamine (INN) Target-based classificatio...-aspartate receptor [HSA:2902 2903 2904 2905 2906] [KO:K05208 K05209 K05210 K05211 K05212] Esketamine [ATC:N01AX14] D07283 Esketamine... classification [BR:br08303] N NERVOUS SYSTEM N01 ANESTHETICS N01A ANESTHETICS, GENERAL N01AX Other general anesthetics N01AX14 Esket

  18. Antibacterial Activity of the Flavonoids from Dalbergia odorifera on Ralstonia solanacearum

    Directory of Open Access Journals (Sweden)

    Wenjian Zuo

    2011-11-01

    Full Text Available Phytohemical investigation on the heartwood of Dalbergia odorifera resulted in the isolation of nine flavonoids. Their structures were elucidated as sativanone (1, (3R-vestitone (2, (3R-2',3',7-trihydroxy-4'-methoxyisoflavanone (3, (3R-4'-methoxy-2',3,7-trihydroxyisoflavanone (4, carthamidin (5, liquiritigenin (6, isoliquiritigenin (7, (3R-vestitol (8, and sulfuretin (9 based on their spectral data. All compounds were evaluated for their inhibitory activity against Ralstonia solanacearum. This is the first report about anti-R. solanacearum activity of the compounds from D. odorifera.

  19. Adenomyosis in Pakistani women: four year experience at the Aga Khan University Medical Centre, Karachi.

    OpenAIRE

    Shaikh, H; Khan, K. S.

    1990-01-01

    As part of a quality assurance programme at the Aga Khan University Medical Centre, Karachi, Pakistan, all hysterectomy specimens were reviewed from January 1986 to December 1989. Adenomyosis was found in 237 of the 419 (56.5%) specimens studied. Of these 237 patients, 232 (97.9%) were parous and 196 (82.8%) were in the fourth and fifth decades of life. This high prevalence in parous women aged 40-59 years was significant. Fibroids, cervicitis, and endometrial hyperplasia were the most common...

  20. Systematic study of anomalous fragment anisotropies in near- and sub-barrier fusion-fission reactions

    International Nuclear Information System (INIS)

    The fusion cross sections and fragment angular distributions for the complete fusion-fission reactions of 11B+238U, 237Np, 12C+237Np, 16O+232Th, 238U, and 19F+23Th at near- and sub-barrier energies have been measured by the fragment folding angle technique. It is revealed that the anomalous anisotropies of fission fragments in latter three systems are existence. Based on the experimental observations and Dressing and Randrup's theory, a new version model of preequilibrium fission is put forward to explain the anomaly. (author)

  1. Asociación entre el estado de infección por VIH y complicaciones infecciosas poscesárea electiva Association between HIV infection status and infectious complications after an elective c-section

    OpenAIRE

    Romina Tejada; Leandro Huayanay; César Gutiérrez; Carlos Velásquez; César Loarte

    2012-01-01

    Objetivos. Determinar la asociación entre VIH y complicaciones infecciosas (CI) después de una cesárea electiva. Materiales y métodos. Estudio de cohortes no concurrentes; se revisaron las historias clínicas de 237 cesáreas electivas en gestantes VIH reactivas atendidas en el Instituto Nacional Materno Perinatal de Perú, realizadas entre 2004 a 2012. Estas fueron pareadas por cirujano y fecha de cesárea con 237 gestantes VIH no reactivas. Se recogieron datos sociodemográficos, clínicos, carac...

  2. Distribution of neptunium and plutonium in New Mexico lichen samples (Usnea arizonica) contaminated by atmospheric fallout

    International Nuclear Information System (INIS)

    The concentrations of 237Np, 239Pu and 240Pu were determined in lichen samples (Usnea arizonica) that were collected from ten locations in New Mexico between 2011 and 2013 using isotope dilution inductively-coupled plasma mass spectrometry (ID-ICP-MS). The observed isotopic ratios for 237Np/239Pu and 240Pu/239Pu indicate trace contamination from global and regional fallout (e.g. Trinity test and atmospheric testing at the Nevada Test Site). The fact that actinide contamination is detected in recent lichen collections suggests continuous re-suspension of fallout radionuclides even 50 years after ratification of the Limited Test Ban Treaty. (author)

  3. Triggering and the gravitational instability in shells and supershells

    Czech Academy of Sciences Publication Activity Database

    Palouš, Jan

    Cambridge : Cambridge University Press, 2007 - (Elmegreen, B.; Palouš, J.), s. 114-118 ISBN 978-0-521-86346-9. - (Proceedings of the International Astronomical Union. IAU S237). [Symposium of the International Astronomical Union /237./. Praha (CZ), 14.08.2006-18.08.2006] R&D Projects: GA MŠk(CZ) LC06014 Institutional research plan: CEZ:AV0Z10030501 Keywords : shock waves * turbulence * ISM bubbles * ISM clouds * stars formation Subject RIV: BN - Astronomy, Celestial Mechanics, Astrophysics

  4. AcEST: DK960259 [AcEST

    Lifescience Database Archive (English)

    Full Text Available TST39A01NGRL0006_O21 657 Adiantum capillus-veneris mRNA. clone: TST39A01NGRL0006_O21. 5' end seq ... |RL5_LYSTE 60S ribosomal protein L5 OS=Lysiphlebus test ... 237 1e-63 sp|Q9W5R8|RL5_DROME 60S ribosomal pro ... |RL5_LYSTE 60S ribosomal protein L5 OS=Lysiphlebus test aceipes GN=RpL5 PE=2 SV=1 Length = 297 Score = 237 ...

  5. Non-conventional measurement techniques for the determination of some long-lived radionuclides produced in nuclear fuel

    International Nuclear Information System (INIS)

    The results of a literature survey on non-radiometric analytical techniques for the determination of long-lived radionuclides are described. The methods which have been considered are accelerator mass spectrometry, inductively coupled plasma mass spectrometry, thermal ionization mass spectrometry, resonance ionization spectrometry, resonance ionization mass spectrometry and neutron neutron activation analysis. Neutron activation analysis has been commonly used for the determination of 129I and 237Np in environmental samples. Inductively coupled mass spectrometry seems likely to become the method of choice for the determination of 99Tc, 237Np and Pu-isotopes. The methods are discussed and the chemical separation methods described. (author) 88 refs.; 8 tabs

  6. Genetic, molecular and functional analyses of complement factor I deficiency

    DEFF Research Database (Denmark)

    Nilsson, S.C.; Trouw, L.A.; Renault, N.;

    2009-01-01

    analyze expression and secretion. The G170V mutation resulted in a protein that was not expressed, whereas the mutations Q232K, C237Y, S250L, I339M and H400L affected secretion. Furthermore, the C237Y and the S250L mutants did not degrade C4b and C3b as efficiently as the WT. The truncated Q336x mutant......Complete deficiency of complement inhibitor factor I (FI) results in secondary complement deficiency due to uncontrolled spontaneous alternative pathway activation leading to susceptibility to infections. Current genetic examination of two patients with near complete FI deficiency and three...

  7. Contribution to the experimental study of transuranian element (Pu, Am, Cm) transfers between the various phases (particles, water, organisms) of the sedimentary system

    International Nuclear Information System (INIS)

    The methodology of this work is first given. Transfer kinetics of 237Pu, 241Am and 242Cm between seawater and macrofauna of loose substrates are studied. The effect of temperature and salinity over the transfers of 237Pu, 241Am and 242Cm between water and bivalve mollusk Tapes decussatus is then studied. This work deals also with transfer kinetics of these elements between carnivorous organisms of the loose substrates and their preys. A preliminary study of 241Am transfers between two phases, particles and interstitial water is finally presented: role of benthic burrowing organisms

  8. Statistical model evaluation of (n,xn) and (n,xnf) cross sections for heavy nuclei

    International Nuclear Information System (INIS)

    A method for a statistical model evaluation of fission, (n,2n) and (n,3n) cross sections from 2MeV to 20MeV neutrons on 237U, 238U, 239U and 239Pu is presented. It consists of the determination of fission width parameters by a fit to known fission cross-sections. This method makes use of neutron transmission coefficients from an adapted coupled channel model. The neutron, fission and radiative widths are calculated by the statistical model including Fermi gas model level densities. Results are given for 237U, 238U, 239U and 239Pu nuclei

  9. Violence and psychosis. I. Risk of violence among psychotic men.

    OpenAIRE

    Taylor, P J; Gunn, J.

    1984-01-01

    A survey of the records of 1241 men remanded in prison on criminal charges over four months yielded a high prevalence of psychiatric disorder. Of the total prison intake of 2743 men over the same period, 246 (9.0%) showed major symptoms of psychiatric illness and a further 237 (8.6%) symptoms of withdrawal from drugs or alcohol. Symptoms of neurotic disorders were underrecorded, so in terms of diagnosis 237 men (8.7%) were considered to be psychotic. Of these, 166 (70%) were schizophrenic. Th...

  10. Association of gastric lymphoid follicles and Helicobacter pylori infection

    OpenAIRE

    Afzal Mohammad; Baez-Giangreco Atilio; Joarder Mohamad Amin; Laajam Mohamed

    1999-01-01

    Lymphoid tissue is normally absent in the gastric mucosa; however, lymphoid follicles are very frequently noted in Helicobacter-associated gastritis. We reviewed 237 cases of chronic gastritis with lymphoid follicles. Out of this 227 cases (95.8%) were found to have H. pylori infection. The significance of this finding and its possible relationship to primary gastric lymphoma are discussed.

  11. Dicty_cDB: Contig-U10493-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available = 294/294 (100%) Strand = Plus / Plus Query: 50 cagcntacntccgntgggtcggncctgnatataatgnaaaaataattccna...ntacntccgntgggtcggncctgnatataatgnaaaaataattccnagncntttat 109 Query: 110 cnagnattcnaaatcccatttttagntcctttgnnc...10), Expect = 3e-57 Identities = 237/294 (80%) Strand = Plus / Plus Query: 50 cagcntacntccgntgggtcggncctgnatataatgnaaaaataattccna... Strand = Plus / Minus Query: 50 cagcntacntccgntgggtcggncctgnatataatgnaaaaataattccnagncntttat 109 ||||||||||...|||||||||||||||||||||||||||||||||||||||||||||||||| Sbjct: 295 cagcntacntccgntgggtcggncctgnatataatgnaaaaataattccna

  12. Occurrence of red tide caused by Karenia mikimotoi (toxic dinoflagellate) in the Southwest coast of India

    Digital Repository Service at National Institute of Oceanography (India)

    Madhu, N.V.; Reny, P.D.; Paul, M.; Ullas, N.; Resmi, P.

    .5-39.9 mu M) and chlorophyll a (av. 56.8 + or -23.7 mg m sup(-3)) concentration were observed during the bloom period. Microscopic analysis revealed that the discoloration was caused by an unarmored toxic dinoflagellate, Karenia mikimotoi Miyake & Kominami...

  13. A new species of Trichothelium and new records of Porinaceae from Ecuador

    Czech Academy of Sciences Publication Activity Database

    McCarthy, P. M.; Palice, Zdeněk

    2003-01-01

    Roč. 35, č. 3 (2003), s. 237-240. ISSN 0024-2829 R&D Projects: GA AV ČR KSK6005114; GA ČR GA206/98/1194 Institutional research plan: CEZ:AV0Z6005908 Keywords : Ecuador * Porina * Trichothelium Subject RIV: EF - Botanics Impact factor: 0.889, year: 2003

  14. Analysis of slag material in the production of zinc oxide

    Czech Academy of Sciences Publication Activity Database

    Luptáková, Natália; Pešlová, F.

    Brno : University of Defence, 2014 - (Stodola, J.; Šťastný, J.; Vališ, D.; Neumann, V.), s. 237-242 ISBN 978-80-7231-969-5. [Deterioration, Dependability, Diagnostics. Brno (CZ), 07.10.2014-08.10.2014] Institutional support: RVO:68081723 Keywords : zinc slag * production of zinc oxide * analysis of slag * phases Subject RIV: JG - Metallurgy

  15. Mesostructured amorphous manganese oxides: facile synthesis and highly durable elimination of low-concentration NO at room temperature in air.

    Science.gov (United States)

    Du, Yanyan; Hua, Zile; Huang, Weimin; Wu, Meiying; Wang, Min; Wang, Jin; Cui, Xiangzhi; Zhang, Lingxia; Chen, Hangrong; Shi, Jianlin

    2015-04-01

    At a high space velocity of 120 000 mL g(-1) h(-1) and a relative humidity of 50-90%, 98% removal of 10 ppm NO has been achieved for over 237 h and no sign of deactivation was observed with mesostructured amorphous manganese oxides (AMO), due to the prevention of the catalyst active sites from deactivation. PMID:25728967

  16. Viron kirjallisuuden kieli 1990-luvulla modernismin, postmodernismin ja postkolonialismin taustaa vasten / Tiit Hennoste ; tõlk. Niko Remes

    Index Scriptorium Estoniae

    Hennoste, Tiit, 1953-

    2003-01-01

    Andmed autori kohta lk. 237. Orig.: Eesti kirjanduse keelest modernismi, postmodernismi ja postkolonialismi taustal. Ilmunud ka kogumikus: Hennoste, Tiit. Eurooplaseks saamine : kõrvaltkäija altkulmupilk. Tartu : Tartu Ülikooli Kirjastus, 2003, lk. 202-231. Bibliograafia lk. 229-231

  17. Courses in Media Ethics. A Spring 1977 Survey.

    Science.gov (United States)

    Christians, Clifford G.

    A questionnaire regarding the teaching of media ethics courses was sent to communication program administrators in 1977. This paper reports the responses obtained from 237 programs (96% response rate). For the 27% of schools reporting specific courses in ethics, the paper notes the number and types of schools with ethics courses, the place of…

  18. Comparison of soil nematode communities in three forest types on sand and clay coal-mining dumps in Germany and Czech Republic

    Czech Academy of Sciences Publication Activity Database

    Háněl, Ladislav

    2003-01-01

    Roč. 40, č. 4 (2003), s. 237-243. ISSN 0440-6605 R&D Projects: GA ČR GA526/01/1055 Institutional research plan: CEZ:AV0Z6066911 Keywords : Nematoda * diversity * trophic groups Subject RIV: EH - Ecology, Behaviour Impact factor: 0.474, year: 2003

  19. Liposomal formulation of alpha-tocopheryl maleamide: In vitro and in vivo toxicological profile and anticancer effect against spontaneous breast carcinomas in mice

    Czech Academy of Sciences Publication Activity Database

    Turánek, J.; Wang, X. F.; Knötigová, P.; Koudelka, Š.; Dong, L. F.; Vrublová, E.; Mahdavian, E.; Procházka, L.; Sangsura, S.; Vacek, A.; Salvatore, B. A.; Neužil, Jiří

    2009-01-01

    Roč. 237, č. 3 (2009), s. 249-257. ISSN 0041-008X R&D Projects: GA AV ČR KAN200520703; GA AV ČR(CZ) IAA500520602 Institutional research plan: CEZ:AV0Z50520701 Keywords : Liposome * apoptosis * vitamin E analogues Subject RIV: FR - Pharmacology ; Medidal Chemistry Impact factor: 3.359, year: 2009

  20. Experiencing More Mathematics Anxiety than Expected? Contrasting Trait and State Anxiety in High Achieving Students

    Science.gov (United States)

    Roos, A.-L.; Bieg, M.; Goetz, T.; Frenzel, A. C.; Taxer, J.; Zeidner, M.

    2015-01-01

    This study examined mathematics anxiety among high and low achieving students (N = 237, grades 9 and 10) by contrasting trait (habitual) and state (momentary) assessments of anxiety. Previous studies have found that trait anxiety measures are typically rated higher than state measures. Furthermore, the academic self-concept has been identified to…

  1. From green to clean: a promising and sustainable approach towards environmental remediation and human health for the 21(st) century

    Czech Academy of Sciences Publication Activity Database

    Schwitzguebel, J. P.; Kumpiene, J.; Comino, E.; Vaněk, Tomáš

    2009-01-01

    Roč. 53, č. 4 (2009), s. 209-237. ISSN 0002-1857 R&D Projects: GA MŠk 2B08058 Institutional research plan: CEZ:AV0Z50380511 Keywords : abiotic stress * biofortification * contaminants Subject RIV: DK - Soil Contamination ; De-contamination incl. Pesticides Impact factor: 0.288, year: 2009

  2. Unemployment Impairs Mental Health: Meta-Analyses

    Science.gov (United States)

    Paul, Karsten I.; Moser, Klaus

    2009-01-01

    The effect of unemployment on mental health was examined with meta-analytic methods across 237 cross-sectional and 87 longitudinal studies. The average overall effect size was d = 0.51 with unemployed persons showing more distress than employed persons. A significant difference was found for several indicator variables of mental health (mixed…

  3. Enzootic plague foci, Algeria

    Directory of Open Access Journals (Sweden)

    M.A. Malek

    2015-03-01

    Full Text Available In Algeria, PCR sequencing of pla, glpD and rpoB genes found Yersinia pestis in 18/237 (8% rodents of five species, including Apodemus sylvaticus, previously undescribed as pestiferous; and disclosed three new plague foci. Multiple spacer typing confirmed a new Orientalis variant. Rodent survey should be reinforced in this country hosting reemerging plague.

  4. 48 CFR 837.403 - Contract clause.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 5 2010-10-01 2010-10-01 false Contract clause. 837.403... OF CONTRACTING SERVICE CONTRACTING Nonpersonal Health Care Services 837.403 Contract clause. The contracting officer shall insert the clause at 852.237-7, Indemnification and medical liability insurance,...

  5. Facing Guilt: Role of Negative Affectivity, Need for Reparation, and Fear of Punishment in Leading to Prosocial Behaviour and Aggression

    Czech Academy of Sciences Publication Activity Database

    Caprara, G. V.; Barbaranelli, C.; Pastorelli, C.; Čermák, Ivo; Rozsa, S.

    2001-01-01

    Roč. 15, č. 3 (2001), s. 219-237. ISSN 0890-2070 Institutional research plan: CEZ:AV0Z7025918 Keywords : emotional predictors of aggression * Guilt * Negative Affectivity Subject RIV: AN - Psychology Impact factor: 1.081, year: 2001

  6. 75 FR 51969 - Endangered and Threatened Wildlife and Plants; 90-Day Finding on a Petition to List the Oklahoma...

    Science.gov (United States)

    2010-08-24

    ... a petition dated May 22, 2008, from Dr. Douglas Goldman of the Harvard University Herbaria... indicates that, based on 237 herbarium specimen records, the species may be extirpated from nine States of... Tennessee) (Petition, p. 2). The petition also states that these same herbarium records indicate the...

  7. Current knowledge of the species complex Anastrepha fraterculus (Diptera, Tephritidae) in Brazil

    Czech Academy of Sciences Publication Activity Database

    Vaníčková, Lucie; Hernández-Ortiz, V.; Bravo, I. S. J.; Dias, V.; Roriz, A. K. P.; Laumann, R. A.; Mendonca, A. L.; Paranhos, B. A. J.; do Nascimento, R. R.

    -, č. 540 (2015), s. 211-237. ISSN 1313-2989 Institutional support: RVO:61388963 Keywords : South American fruit fly * cryptic species * taxonomy * sexual behavior * chemical communication Subject RIV: EG - Zoology Impact factor: 0.933, year: 2014 http://zookeys.pensoft.net/articles.php?id=6228

  8. Extra-intestinal localization of Goussia sp (Apicomplexa) oocysts in Rana dalmatina (Anura: Ranidae), and the fate of infection after metamorphosis

    Czech Academy of Sciences Publication Activity Database

    Jirků, M.; Modrý, David

    2006-01-01

    Roč. 70, č. 3 (2006), s. 237-241. ISSN 0177-5103 R&D Projects: GA ČR GA206/03/1544; GA ČR GD524/03/H133 Institutional research plan: CEZ:AV0Z60220518 Keywords : Goussia * Rana * Coccidia Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 1.509, year: 2006

  9. Liquid effluent discharges to Rivacre Brook, Capenhurst: an evaluation and radiological assessment of some monitoring data on environmental radioactivity

    International Nuclear Information System (INIS)

    An assessment of the radiological impact of past and current discharges of liquid radioactive effluents to the Rivacre Brook demonstrated that critical group doses are less than 0.001 mSv/a, with contributions from isotopes of uranium, Tc-99 and Np-237. (Author)

  10. 78 FR 75209 - Federal Leadership on Energy Management

    Science.gov (United States)

    2013-12-10

    ... From the Federal Register Online via the Government Publishing Office #0; #0; #0; Presidential Documents #0; #0; #0;#0;Federal Register / Vol. 78 , No. 237 / Tuesday, December 10. 2013 / Presidential Documents#0;#0; ] Memorandum of December 5, 2013 Federal Leadership on Energy Management Memorandum for the Heads of Executive Departments and Agencies In order...

  11. Comment on "Mitigating grain growth in binary nanocrystalline alloys through solute selection based on thermodynamic stability maps"

    Czech Academy of Sciences Publication Activity Database

    Lejček, Pavel; Hofmann, S.

    2015-01-01

    Roč. 107, Sep (2015), s. 235-237. ISSN 0927-0256 R&D Projects: GA ČR GBP108/12/G043 Institutional support: RVO:68378271 Keywords : nanocrystalline materials * grain size * grain boundary energy * grain boundary segregation Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 2.131, year: 2014

  12. Response of grapevine leaves to plasmopara viticola infection by means of measurement of reflectance and fluorescence signals

    Czech Academy of Sciences Publication Activity Database

    Šebela, David; Olejníčková, Julie; Župčanová, A.; Sotolář, R.

    2012-01-01

    Roč. 27, č. 8 (2012), s. 229-237. ISSN 1211-8516 R&D Projects: GA MŠk(CZ) ED1.1.00/02.0073 Institutional support: RVO:67179843 Keywords : Plasmopara viticola * downy mildew * grapevine * leaf tissue * susceptible varieties * chlorophyll fluorescence imaging * reflectance Subject RIV: GM - Food Processing

  13. Dichelyne (Dichelyne) spinigerus sp. nov. (Nematoda: Cucullanidae) from the marine fish Otolithes ruber (Sciaenidae) off Iran and first description of the male of Philometra otolithi Moravec et Manoharan, 2013 (Nematoda: Philometridae)

    Czech Academy of Sciences Publication Activity Database

    Moravec, František; Khosheghbal, M.; Pazooki, J.

    2014-01-01

    Roč. 59, č. 2 (2014), s. 229-237. ISSN 1230-2821 R&D Projects: GA ČR GBP505/12/G112 Institutional support: RVO:60077344 Keywords : parasitic nematode * Dichelyne * Philometra * marine fish * Otolithes * Iran Subject RIV: EG - Zoology Impact factor: 0.905, year: 2014

  14. Miscellaneous Viral Retropepsins

    Czech Academy of Sciences Publication Activity Database

    Konvalinka, Jan; Kräusslich, H. G.

    Amsterdam: Academic Press, 2013 - (Salvesen, G.), s. 237-240 ISBN 978-0-12-382219-2 Institutional support: RVO:61388963 Keywords : retropepsin * protease * bovine immunodeficiency virus * Visna lentivirus * jaagsiekte sheep retrovirus * intracisternal A-type particles Subject RIV: CE - Biochemistry

  15. Raltegravir with optimized background therapy for resistant HIV-1 infection

    DEFF Research Database (Denmark)

    Steigbigel, Roy T; Cooper, David A; Kumar, Princy N;

    2008-01-01

    recipients (1.5%) and 6 of the 237 placebo recipients (2.5%). The results of the two studies were consistent. At week 16, counting noncompletion as treatment failure, 355 of 458 raltegravir recipients (77.5%) had HIV-1 RNA levels below 400 copies per milliliter, as compared with 99 of 236 placebo recipients...

  16. 77 FR 73666 - Center for Scientific Review; Notice of Closed Meetings

    Science.gov (United States)

    2012-12-11

    ... Institutes of Health, 6701 Rockledge Drive, Room 3184, MSC 7848, Bethesda, MD 20892, (301) 237- 9918, niw@csr.nih.gov . Name of Committee: Center for Scientific Review Special Emphasis Panel; Integrative..., Room 5182, MSC 7844, Bethesda, MD 20892, (301) 408- 9664, bishopj@csr.nih.gov . (Catalogue of...

  17. On additive preservers of semi-Browder operators

    Czech Academy of Sciences Publication Activity Database

    Mbekhta, M.; Müller, Vladimír; Oudghiri, M.

    2014-01-01

    Roč. 59, č. 2 (2014), s. 237-244. ISSN 0035-3965 R&D Projects: GA ČR GA201/09/0473; GA AV ČR IAA100190903 Institutional support: RVO:67985840 Keywords : additive preservers * semi-Browder operators Subject RIV: BA - General Mathematics http://imar.ro/journals/Revue_Mathematique/pdfs/2014/2/6.pdf

  18. Fuel selection for radioisotope thermoelectric generators

    International Nuclear Information System (INIS)

    The availability of Radioisotope Thermoeletric Generator fuels is evaluated based on the amount of fuel discharged from selected power reactors. In general, the best alternatives are either to use Plutonium-238 produced by irradiation of Neptunium-237 generated in typical thermal reactors or to use Curium-244 directly separated from the discharged fuels of fast or thermal reactors. (author)

  19. Distribution coefficient of plutonium between sediment and seawater

    International Nuclear Information System (INIS)

    Using plutonium 237 as a tracer, a series of experiments were conducted to determine the distribution coefficient of plutonium onto sediments both under oxic and anoxic conditions, where the plutonium was added to seawater in three different valence states: III, IV and VI

  20. Acidification in European mountain lake districts: A regional assessment of critical load exceedance

    Czech Academy of Sciences Publication Activity Database

    Curtis, CH. J.; Botev, I.; Camarero, L.; Catalan, J.; Cogalniceanu, D.; Hughes, M.; Kernan, M.; Kopáček, Jiří; Korhola, A.; Psenner, R.; Rogora, M.; Stuchlík, E.; Veronesi, M.; Wright, R. F.

    2005-01-01

    Roč. 67, č. 3 (2005), s. 237-251. ISSN 1015-1621 Grant ostatní: EC(XE) EMERGE EVK1-CT-1999-00032 Institutional research plan: CEZ:AV0Z60170517 Keywords : FAB model * sulphur * nitrogen Subject RIV: DJ - Water Pollution ; Quality Impact factor: 1.662, year: 2005

  1. 76 FR 72958 - Center for Scientific Review; Notice of Closed Meetings

    Science.gov (United States)

    2011-11-28

    ...@csr.nih.gov . Name of Committee: Center for Scientific Review Special Emphasis Panel; PAR09-162: Basic... 20892, (301) 443-4512, cooperc@csr.nih.gov . Name of Committee: Center for Scientific Review Special... 7848, Bethesda, MD 20892, (301) 237- 9918, niw@csr.nih.gov . (Catalogue of Federal Domestic...

  2. 75 FR 1399 - Center for Scientific Review; Notice of Closed Meetings

    Science.gov (United States)

    2010-01-11

    ... 7808, Bethesda, MD 20892, 301-435- 1191, wedeenc@csr.nih.gov . Name of Committee: Vascular and... 4124, MSC 7802, Bethesda, MD 20892, (301) 435-1210, chaudhaa@csr.nih.gov . Name of Committee: Brain... Rockledge Drive, Room 5194, MSC 7846, Bethesda, MD 20892, (301) 237- 9838, bhagavas@csr.nih.gov . ] Name...

  3. Microhabitats of Collembola (Insecta: Entognatha) in beech and spruce forests and their influence on biodiversity

    Czech Academy of Sciences Publication Activity Database

    Rusek, Josef

    2001-01-01

    Roč. 37, - (2001), s. 237-244. ISSN 1164-5563 R&D Projects: GA AV ČR IAA6066702; GA ČR GA206/99/1416 Institutional research plan: CEZ:AV0Z6066911 Keywords : Collembola communities * biodiversity Subject RIV: EH - Ecology, Behaviour Impact factor: 0.317, year: 2001

  4. Parenting Stress and Child Behavior Problems: A Transactional Relationship across Time

    Science.gov (United States)

    Neece, Cameron L.; Green, Shulamite A.; Baker, Bruce L.

    2012-01-01

    Parenting stress and child behavior problems have been posited to have a transactional effect on each other across development. However, few studies have tested this model empirically. The authors investigated the relationship between parenting stress and child behavior problems from ages 3 to 9 years old among 237 children, 144 of whom were…

  5. Německé podnikání Baťova koncernu. Studie k hospodářským a sociálním dějinám hornoslezského továrního města Ottmuth (Otmęt)

    Czech Academy of Sciences Publication Activity Database

    Jemelka, M.; Ševeček, Ondřej

    2013-01-01

    Roč. 111, č. 2 (2013), s. 237-274. ISSN 0037-6833 R&D Projects: GA ČR(CZ) GAP410/10/1995 Institutional support: RVO:67985955 Keywords : Baťa concern * Upper Silesia * Ottmuth (Otmęt) * shoe Industry Subject RIV: AB - History

  6. Development of a Scale for Measuring Invasive Plant Environmentalism.

    Science.gov (United States)

    Wolfe, Edward W.; Dozier, Hallie

    2000-01-01

    Developed an instrument to measure invasive plant environmentalism (knowledge and attitudes concerning non-native plant invasions). Scaled responses of 237 plant nursery customers to a 17-item standardized interview using the partial credit model. Results indicate that the instrument measured the construct of invasive plant environmentalism…

  7. K sepulkrální plastice v Corpusu inscriptionum Bohemiae

    Czech Academy of Sciences Publication Activity Database

    Roháček, Jiří

    Praha : Arte factum, 2002 - (Prix, D.), s. 231-237 ISBN 80-903230-1-4 R&D Projects: GA AV ČR IBS8033202; GA ČR GA408/02/0442 Institutional research plan: CEZ:AV0Z8033913 Keywords : sepulchral sculpture * epigraphy * inscription Subject RIV: AL - Art, Architecture, Cultural Heritage

  8. Development of IFN-gamma resistance is associated with attenuation of SOCS genes induction and constitutive expression of SOCS 3 in melanoma cells

    Czech Academy of Sciences Publication Activity Database

    Fojtová, Miloslava; Boudný, V.; Kovařík, Aleš; Lauerová, L.; Adámková, L.; Součková, K.; Jarkovský, J.; Kovařík, J.

    2007-01-01

    Roč. 97, č. 2 (2007), s. 231-237. ISSN 0007-0920 Institutional research plan: CEZ:AV0Z50040507; CEZ:AV0Z50040702 Keywords : SOCS protein * malignant melanoma * interferon resistance Subject RIV: BO - Biophysics Impact factor: 4.635, year: 2007

  9. Control of Load and Profile in the Machine-Cutting of D-Shaped Tunnels: An Initial Investigation

    OpenAIRE

    Edwards, J B

    1983-01-01

    Previous reports in this service (Research Reports 220 and 237) have been concerned only with the load-control of tunnelling machines producing tunnels of near-circular cross sectional profile. The investigations there reported were aimed primarily at improving the load control on such a machine currently operating at the N.C.B's Cadley Hill Colliery.

  10. Family and Consumer Sciences Curricula: What Do Students, Parents, Faculty and Community Want?

    Science.gov (United States)

    Pauley, Elizabeth D.

    1996-01-01

    A survey of 317 Pennsylvania middle school students, 237 parents, 29 faculty, 39 family/consumer professionals, and 19 community members indicated that the program teaches only 4 of adults' top 10 subject preferences and none of the top 3 (family, parenting, communicating). All four top subjects preferred by students (banking, sewing, child care,…

  11. Prevalence of Health Behaviors among a University Staff: An Exploratory Study

    Science.gov (United States)

    Torabi, Mohammad; Thiagarajah, Krisha; Jeng, Ifeng

    2010-01-01

    This study assessed the prevalence of health behaviors among non-academic staff at a Midwestern U.S. university. A sample of 627 women and 237 men completed a web survey for the study. Most of the health behaviors showed no sex difference. Health behaviors of drinking, smoking, and irregular breakfast eating were significantly associated with…

  12. Preparation and surface characterization of novel epoxy-based organic-inorganic nanocomposite coatings

    Czech Academy of Sciences Publication Activity Database

    Špírková, Milena; Brus, Jiří; Baldrian, Josef; Šlouf, Miroslav; Kotek, Jiří

    2005-01-01

    Roč. 88, č. 4 (2005), s. 237-242. ISSN 1476-4865 R&D Projects: GA AV ČR IAA400500505 Grant ostatní: European Union(XE) HPRN-CT-2002-00306 Keywords : coatings * sol-gel process * montmorillonite Subject RIV: CD - Macromolecular Chemistry Impact factor: 0.393, year: 2005

  13. Internationalisation of Vocational Education and Training: An Adapting Curve for Teachers and Learners

    Science.gov (United States)

    Tran, Ly Thi

    2013-01-01

    Competency-based training and training packages are mandatory for Australian vocational education and training (VET). VET qualifications are designed to provide learners with skills, knowledge, and attributes required for Australian workplaces. Yet, toward the end of December 2011, there were 171,237 international student enrolments in the…

  14. Endogenous and exogenous components in the circadian variation of core body temperature in humans

    NARCIS (Netherlands)

    Hiddinga, AE; Beersma, DGM; VandenHoofdakker, RH

    1997-01-01

    Core body temperature is predominantly modulated by endogenous and exogenous components. In the present study we tested whether these two components can be reliably assessed in a protocol which lasts for only 120 h. In this so-called forced desynchrony protocol, 12 healthy male subjects (age 23.7 +/

  15. Intensive game keeping, coppicing and butterflies: The story of Milovicky Wood, Czech Republic

    Czech Academy of Sciences Publication Activity Database

    Beneš, Jiří; Čížek, Oldřich; Dovala, J.; Konvička, Martin

    2006-01-01

    Roč. 237, 1-3 (2006), s. 353-365. ISSN 0378-1127 R&D Projects: GA ČR GA526/04/0417 Institutional research plan: CEZ:AV0Z50070508 Keywords : butterfly conservation * Central Europe * coppice management Subject RIV: EH - Ecology, Behaviour Impact factor: 1.839, year: 2006

  16. شیوع مصرف تنباکوی غیرتدخینی در دانشجویان پسر دانشگاه‏های شهر زاهدان و آگاهی از مضرات آن در سال 1391

    Directory of Open Access Journals (Sweden)

    ماریه هنرمند

    2013-12-01

    Results: 102 male students (23.7% had used smokeless tobacco during their life time and 11.4% were current users. Smokeless tobacco consumption showed significant relationship with university type, living place, yearly average grade and education level of mother (P

  17. Critical comparison of radiometric and mass spectrometric methods for the determination of radionuclides in environmental, biological and nuclear waste samples

    DEFF Research Database (Denmark)

    Hou, Xiaolin; Roos, Per

    2008-01-01

    application in the environmental and biological researches, these radionuclides include H-3, C-14, Cl-36, Ca-41 Ni-59,Ni-63, Sr-89,Sr-90, Tc-99, I-129, Cs-135,Cs-137, Pb-210, Ra-226,Ra-228, Np-237, Am-241, and isotopes of thorium, uranium and plutonium. The application of on-line methods (flow injection...

  18. 2009 USGS Potato Creek Lidar Survey

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — LiDAR collected for the upper portion of the Flint River in central georgia. 237.6 sqmiles collected between May 1st and May 4th, 2009. The data contains 1 meter...

  19. Preservice Science Teachers' Science Teaching Orientations and Beliefs about Science

    Science.gov (United States)

    Kind, Vanessa

    2016-01-01

    This paper offers clarification of science teacher orientations as a potential component of pedagogical content knowledge. Science teaching orientations and beliefs about science held by 237 preservice science teachers were gathered via content-specific vignettes and questionnaire, respectively, prior to participation in a UK-based teacher…

  20. Minor Delinquency and Immigration: A Longitudinal Study among Male Adolescents

    Science.gov (United States)

    Titzmann, Peter F.; Silbereisen, Rainer K.; Mesch, Gustavo

    2014-01-01

    On the basis of general theories of delinquency and the specific situation of immigrants, this longitudinal study investigated predictors of initial levels and rates of change in delinquency among 188 male ethnic German Diaspora immigrants from the former Soviet Union (FSU) in Germany, 237 male native German adolescents, and 182 male Jewish…

  1. Space weathering simulations through controlled growth of iron nanoparticles on olivine

    Czech Academy of Sciences Publication Activity Database

    Kohout, Tomáš; Čuda, J.; Filip, J.; Britt, D.; Bradley, T.; Tuček, J.; Skála, Roman; Kletetschka, Günther; Kašlík, J.; Malina, O.; Šišková, K.; Zbořil, R.

    2014-01-01

    Roč. 237, 15 July (2014), s. 75-83. ISSN 0019-1035 R&D Projects: GA MŠk LH12079 Institutional support: RVO:67985831 Keywords : asteroids, surface * Moon, surface * regoliths * spectroscopy Subject RIV: BN - Astronomy, Celestial Mechanics, Astrophysics Impact factor: 3.038, year: 2014

  2. Native GABA(B) receptors are heteromultimers with a family of auxiliary subunits

    Czech Academy of Sciences Publication Activity Database

    Schwenk, J.; Metz, M.; Zolles, G.; Tureček, Rostislav; Fritzius, T.; Bildl, W.; Tarusawa, E.; Kulik, A.; Unger, A.; Ivankova, K.; Seddik, R.; Tiao, J. Y.; Rajalu, M.; Trojanová, Johana; Rohde, V.; Gassmann, M.; Schulte, U.; Fakler, B.; Bettler, B.

    2010-01-01

    Roč. 465, č. 7295 (2010), s. 231-237. ISSN 0028-0836 R&D Projects: GA ČR GA309/06/1304 Institutional research plan: CEZ:AV0Z50390512 Keywords : GABA (B) * nhibitor neurotransmitter * receptors Subject RIV: FH - Neurology Impact factor: 36.101, year: 2010

  3. Complete genome sequence of chinese strain of ‘Candidatus Liberibacter asiaticus’

    Science.gov (United States)

    The complete genome sequence of ‘Candidatus Liberibacter asiaticus’ strain (Las) Guangxi-1(GX-1) was obtained by an Illumina HiSeq 2000. The GX-1 genome comprises 1,268,237 nucleotides, 36.5 % GC content, 1,141 predicted coding sequences, 44 tRNAs, 3 complete copies of ribosomal RNA genes (16S, 23S ...

  4. Outcomes of communication competence: A study on a Portuguese restaurant chain

    OpenAIRE

    Castro, Paroma Nandi de

    2013-01-01

    This research studies the mediating role of satisfaction with both organizational integration and supervisor communication on the relationship between communication competence and both trust in the supervisor and job satisfaction, using a sample collected from 237 employees of 21 restaurants from a Portuguese restaurant chain. As expected, satisfaction with organizational integration partially mediated the relationship between communication competence and both trust and job satisfact...

  5. Characterization and perturbation of Gabor frame sequences with rational parameters

    DEFF Research Database (Denmark)

    Bownik, M.; Christensen, Ole

    2007-01-01

    work by [Ron and Shen, Weyl-Heisenherg systenis and Riesz bases in L-2(R-d). Duke Math. J. 89 (1997) 237-282]. who considered the case where A is finite. As a consequence of the results, we obtain results concerning stability of Gabor frames under perturbation of the generators. We also introduce the...

  6. Changes in the expression of NR1 subunit of NMDA receptor in schizophrenic hippocampus

    Czech Academy of Sciences Publication Activity Database

    Vrajová, M.; Peková, S.; Klaschka, Jan; Štastný, P.

    Elsevier. Roč. 17, Suppl. 1 (2007), s237-s238. ISSN 0924-977X. [ECNP Congress /20./. 13.10.2006-17.10.2006, Vienna] Institutional research plan: CEZ:AV0Z10300504 Keywords : schizophrenia * NMDA receptor * NR1 subunit * hippocampus * gender * antipsychotics

  7. The role of aryl hydrocarbon receptor in regulation of enzymes involved in metabolic activation of polycyclic aromatic hydrocarbons in a model of rat liver progenitor cells

    Czech Academy of Sciences Publication Activity Database

    Vondráček, Jan; Krčmář, P.; Procházková, Jiřina; Trilecová, L.; Gavelová, M.; Skálová, L.; Szotáková, B.; Bunček, M.; Radilová, H.; Kozubík, Alois; Machala, M.

    2009-01-01

    Roč. 180, č. 2 (2009), s. 226-237. ISSN 0009-2797 R&D Projects: GA ČR(CZ) GA524/06/0517 Institutional research plan: CEZ:AV0Z50040507; CEZ:AV0Z50040702 Keywords : cytochromes P450 * PAHs * aldo-keto reductases Subject RIV: BO - Biophysics Impact factor: 2.457, year: 2009

  8. Počátky vysokoúčinné kapalinové chromatografie v Brně

    Czech Academy of Sciences Publication Activity Database

    Šlais, Karel

    Praha : Česká společnost pro hmotnostní spektrometrii, 2015 - (Pól, J.; Volný, M.), s. 214-237 ISBN 978-80-905045-5-4 Institutional support: RVO:68081715 Keywords : high performance liquid chromatography * history and development of HPLC * laboratory work Subject RIV: CB - Analytical Chemistry, Separation

  9. Proton emission from laser-generated plasmas at different intensities

    Czech Academy of Sciences Publication Activity Database

    Torrisi, L.; Cutroneo, M.; Cavallaro, S.; Giuffrida, L.; Margarone, Daniele

    2012-01-01

    Roč. 57, č. 2 (2012), s. 237-240. ISSN 0029-5922. [International Conference on Research and Applications of Plasmas (PLASMA). Warsaw, 12.09.2011-16.09.2011] Institutional support: RVO:68378271 Keywords : laser-generated plasma * hydrogenated targets * proton acceleration Subject RIV: BL - Plasma and Gas Discharge Physics Impact factor: 0.507, year: 2012

  10. Arquitectura subcelular del sistema endocannabinoide en el núcleo ventromedial del hipotálamo de ratón

    OpenAIRE

    Reguero Acebal, Leire

    2014-01-01

    356 p. : il., graf. Nota: Contiene versión resumida en inglés p.237-256 con el título “Subcellular architecture of the endocannabinoid system in the mouse ventromedial nucleus of the hypothalamus”

  11. Magnetically responsive yeast cells: methods of preparation and applications

    Czech Academy of Sciences Publication Activity Database

    Šafařík, Ivo; Maděrová, Zdeňka; Pospišková, K.; Horská, Kateřina; Šafaříková, Miroslava

    2015-01-01

    Roč. 32, č. 1 (2015), s. 227-237. ISSN 0749-503X R&D Projects: GA MŠk(CZ) LD13023; GA MŠk(CZ) LD13021 Institutional support: RVO:67179843 Keywords : yeast cells * Saccharomyces * Kluyveromyces * Rhodotorula * Yarrowia * magnetic modification Subject RIV: EH - Ecology, Behaviour Impact factor: 1.634, year: 2014

  12. Over-expression of p53 mutants in LNCaP cells alters tumor growth and angiogenesis in vivo

    DEFF Research Database (Denmark)

    Perryman, L A; Blair, J M; Kingsley, E A;

    2006-01-01

    significant. Angiogenesis was decreased in tumors expressing F134L and R273H compared with M237L, or controls. Conditioned medium from F134L tumors inhibited growth of normal human umbilical-vein endothelial cells but not telomerase-immortalized bone marrow endothelial cells. F134L tumor supernatants showed...

  13. Morphology and properties of SEBS block copolymer compatibilized PS/HDPE blends

    Czech Academy of Sciences Publication Activity Database

    Rek, V.; Vranješ, N.; Šlouf, Miroslav; Fortelný, Ivan; Jelčic, Ž.

    2008-01-01

    Roč. 40, č. 3 (2008), s. 237-251. ISSN 0095-2443 Grant ostatní: Ministry of Science, Education and Sport(HR) 0125059 Institutional research plan: CEZ:AV0Z40500505 Keywords : aPS/HDPE/SEBS blends * morphology * processing * rheological Subject RIV: CD - Macromolecular Chemistry Impact factor: 0.658, year: 2008

  14. Siblings of Disabled Children: Birth Order and Age-Spacing Effects.

    Science.gov (United States)

    Breslau, Naomi

    1982-01-01

    Siblings (N=237) of disabled children were compared to 248 siblings from a random family sampling to examine the effects of relative birth order and age spacing on psychological functioning. Younger males scored higher than older males on psychological impairment, while younger females were psychologically better off than older females. (CL)

  15. Monitoring and physical model simulation of a complex slope deformation in neovolcanics

    Czech Academy of Sciences Publication Activity Database

    Rybář, Jan; Košťák, Blahoslav

    Lisse: Balkema, 2003 - (Natau, O.; Fecker, E.; Pimental, E.), s. 231-237 ISBN 90-5809-603-3. [International Symposium on Geotechnical Measurements and Modelling. Karlsruhe (DE), 23.09.2003-25.09.2003] Institutional research plan: CEZ:AV0Z3046908 Keywords : slope movements * field measurements * physical models Subject RIV: DB - Geology ; Mineralogy

  16. Effects of Role Division, Interaction, and Shared Mental Model on Team Performance in Project-Based Learning Environment

    Science.gov (United States)

    Jo, Il-Hyun

    2011-01-01

    The purpose of this study was to investigate the cognitive mechanism of project-based learning teams of college students on the basis of the Shared Mental Model (SMM) theory. The study participants were 237 female college students in Korea organized into 51 project teams. To test the study hypotheses, a structural equation modeling was employed.…

  17. Overtopping Measurements on the Wave Dragon Nissum Bredning Prototype

    DEFF Research Database (Denmark)

    Frigaard, Peter; Kofoed, Jens Peter; Rasmussen, Michael R.

    2004-01-01

    The paper describes the methods used to estimate (calculated from some indirect measurements) the overtopping of the wave energy converter Wave Dragon placed in a real sea environment. The wave energy converter in quistion is the 237-tonne heavy Wave Dragon Nissum Bredning Prototype. Comparisons...

  18. Follow-up of foreign safety studies of final storage of nuclear fuel waste

    International Nuclear Information System (INIS)

    Models and calculation programs have been developed in order to estimate the migration of radioactivity and the resulting doses. The efforts to producing reliable parameter values are increased. Safety analysis has rendered low doses. The dominant nuclides have been iodine 129, neptunium 237, technetium 99, carbon 14, and radium 226. 120 references. (G.B.)

  19. The trajectory, structure and origin of the Chelyabinsk asteroidal impactor

    Czech Academy of Sciences Publication Activity Database

    Borovička, Jiří; Spurný, Pavel; Brown, P.; Wiegert, P.; Kalenda, Pavel; Clark, D.; Shrbený, Lukáš

    2013-01-01

    Roč. 503, č. 7475 (2013), s. 235-237. ISSN 0028-0836 R&D Projects: GA ČR(CZ) GAP209/11/1382 Institutional support: RVO:67985815 ; RVO:67985891 Keywords : superbolide * meteorite fall * airburst Subject RIV: BN - Astronomy, Celestial Mechanics, Astrophysics; DB - Geology ; Mineralogy (USMH-B) Impact factor: 42.351, year: 2013

  20. Agrese a sebevědomí

    Czech Academy of Sciences Publication Activity Database

    Šolcová, Iva

    2006-01-01

    Roč. 50, č. 3 (2006), s. 231-237. ISSN 0009-062X Institutional research plan: CEZ:AV0Z70250504 Keywords : aggression * self - esteem * egotism Subject RIV: AN - Psychology Impact factor: 0.279, year: 2006

  1. Pathological psychology

    Institute of Scientific and Technical Information of China (English)

    2009-01-01

    2009258 Executive function and working memory of patients with mild cognitive impairment.GUO Cuiping(郭翠萍),et al.Neuropsychol Lab,Dept neurol,1st Hosp,Anhui Med Univ,Hefei 230022,Chin J Neurol,2009;42940:237-240.

  2. Trade policy in markets with collusion: the case of North–South R&D spillovers

    Czech Academy of Sciences Publication Activity Database

    Boone, J.; Žigić, Krešimir

    2015-01-01

    Roč. 69, č. 2 (2015), s. 224-237. ISSN 1090-9443 R&D Projects: GA ČR(CZ) GAP402/12/0961 Institutional support: PRVOUK-P23 Keywords : R&D spillovers * tariff protection * supergames Subject RIV: AH - Economics

  3. Entheseal changes: Do they reflect socioeconomic status in the Early Medieval Central European population? (Mikulčice - Klášteřisko, Great Moravian Empire, 9th - 10th century)

    Czech Academy of Sciences Publication Activity Database

    Havelková, P.; Hladík, Marek; Velemínský, P.

    2013-01-01

    Roč. 23, č. 2 (2013), s. 237-251. ISSN 1047-482X Institutional research plan: CEZ:AV0Z80010507 Institutional support: RVO:68081758 Keywords : Early Middle Ages * enthesopathies * factor analysis * grave goods * musculoskeletal stress markers * social status Subject RIV: AC - Archeology, Anthropology, Ethnology Impact factor: 1.070, year: 2013

  4. Target residues from the reaction of 3.65A GeV 12C with 232Th and 238U

    International Nuclear Information System (INIS)

    The cross sections for the production of about a hundred different radionuclides of 24Na - 237U range from the reaction of 3.65A GeV 12C with 232Th and 238U were measured by off-line gamma-ray spectroscopy. 5 refs.; 1 tab

  5. 77 FR 47065 - Final National Pollutant Discharge Elimination System (NPDES) General Permit for Stormwater...

    Science.gov (United States)

    2012-08-07

    ........... 236 Heavy and Civil Engineering 237 Construction. EPA does not intend the preceding table to be... 13175 in the February 29, 2012 Federal Register notice. See 77 FR 12292 for more information. Authority... Discharges From Construction Activities AGENCY: Environmental Protection Agency (EPA). ACTION: Notice...

  6. Particle Size Effects on the Quality of Flour Tortillas Enriched with Whole Grain Waxy Barley

    Science.gov (United States)

    Wheat tortillas were enriched with whole barley flour (WBF) of different particle sizes including 237 micros (regular-R), 131 micros (intermediate-IM), and 68 micros (microground-MG). Topographical and fluorescent microstructure images of flours, doughs and tortillas were examined. Flours and tort...

  7. Word order and information structure in Czech 3-and 4-year-olds' comprehension.

    Czech Academy of Sciences Publication Activity Database

    Smolík, Filip

    2015-01-01

    Roč. 35, č. 3 (2015), s. 237-253. ISSN 0142-7237 R&D Projects: GA ČR GA13-26779S Institutional support: RVO:68081740 Keywords : Case marking * grammar comprehension * information structure Subject RIV: AN - Psychology Impact factor: 1.400, year : 2014

  8. Low temperature magneto-structural transitions in Mn3Ni20P6

    Czech Academy of Sciences Publication Activity Database

    Cedervall, J.; Beran, Přemysl; Vennstrom, M.; Danielsson, T.; Ronneteg, S.; Hoglin, V.; Lindell, D.; Eriksson, O.; Andre, G.; Andersson, Y.; Nordblad, P.; Sahlberg, M.

    2016-01-01

    Roč. 237, MAY (2016), s. 343-348. ISSN 0022-4596 R&D Projects: GA MŠk(CZ) LM2011019 EU Projects: European Commission(XE) 283883 - NMI3-II Institutional support: RVO:61389005 Keywords : Mn-compounds * magnetic structure * antiferromagnetism * neutron diffraction Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 2.133, year: 2014

  9. Patterns of bryophyte and vascular plant richness in European subalpine springs

    Czech Academy of Sciences Publication Activity Database

    Sekulová, L.; Hájek, Michal; Hájková, Petra; Mikulášková, E.; Buttler, A.; Syrovátka, V.; Rozbrojová, Zuzana

    2012-01-01

    Roč. 213, č. 2 (2012), s. 237-249. ISSN 1385-0237 Institutional research plan: CEZ:AV0Z60050516 Keywords : springs * spesies richness * environmental factors Subject RIV: EF - Botanics Impact factor: 1.534, year: 2012 http://www.springerlink.com/content/m6gq67w137746672/

  10. Drug: D04844 [KEGG MEDICUS

    Lifescience Database Archive (English)

    Full Text Available D04844 Mixture, Drug Paraformaldehyde - dibucaine hydrochloride mixt; Periodon (TN)... Paraformaldehyde [DR:D01494], Dibucaine hydrochloride [DR:D02220] Therapeutic category: 2730 Therapeutic category of dr...sics and sedatives 2730 Analgesics and sedatives D04844 Paraformaldehyde - dibucaine hydrochloride mixt CAS: 617-48-1 PubChem: 17398192 NIKKAJI: J237.180D ...

  11. Uptake of three isotopes of plutonium from soil by sweet corn grown in a growth chamber

    International Nuclear Information System (INIS)

    The use of 237Pu as a tracer for 238Pu and 239Pu was studied in a plant--soil system. Sandy clay--loam soil was spiked with approx. 240 pCi/g of 237Pu, 14.3 pCi/g of 238Pu, and 33 pCi/g of 239Pu in the form of Pu(NO3)4. The uptake of these three isotopes of plutonium was measured in the standing vegetation of sweet corn (Zea mays L. var. Silver Queen) after 30 and 50 days of growth. The mean concentrations in the standing crop and the concentration ratios of each isotope decreased from 30 to 50 days. There was an apparent differential availability of the three isotopes: 237Pu was more available than 238Pu, which was more available than 239Pu. The quantity of 237Pu in the standing crop, on a mass basis, closely approximated that of 238Pu for both sampling times. Factors influencing these results are discussed

  12. Pharmacogenetic determinants of beta-fibrinogen gene polymorphism in response to aspirin in patients with severe ischemic stroke

    Directory of Open Access Journals (Sweden)

    Kiking Ritarwan

    2014-12-01

    Conclusion: Plasma fibrinogen levels decreased after administration of either aspirin or polymorphisms according to age. Identification of stroke risk factors based on the relative risk of plasma fibrinogen levels are at higher degree in younger age. [J Exp Integr Med 2014; 4(4.000: 237-240

  13. Production of medically valuable stilbenes and emodin in knotweed

    Czech Academy of Sciences Publication Activity Database

    Frantík, Tomáš; Kovářová, M.; Koblihová, Helena; Bartůňková, Kristýna; Nývltová, Z.; Vosátka, Miroslav

    2013-01-01

    Roč. 50, oct.2013 (2013), s. 237-243. ISSN 0926-6690 R&D Projects: GA MŠk 1M0571 Institutional support: RVO:67985939 Keywords : knokweed * resveratrol * emodin Subject RIV: EF - Botanics Impact factor: 3.208, year: 2013

  14. Fatigue property and fatigue cracks of ultra-fine grained copper processed by equal-channel angular pressing

    Czech Academy of Sciences Publication Activity Database

    Wang, Q.; Du, Z.; Liu, X.; Kunz, Ludvík

    2011-01-01

    Roč. 2011, č. 682 (2011), s. 231-237. ISSN 1013-9826 Institutional research plan: CEZ:AV0Z20410507 Keywords : ultrafine-grained copper * equal channel angular pressing * fatigue * fatigue cracks Subject RIV: JL - Materials Fatigue, Friction Mechanics

  15. 48 CFR 937.7040 - Contract clauses.

    Science.gov (United States)

    2010-10-01

    ... CONTRACTING SERVICE CONTRACTING Protective Services Contracting 937.7040 Contract clauses. The contracting officer shall insert the clause at 952.237-70 entitled “Collective bargaining agreements—protective services” in all protective services solicitations and contracts involving DOE-owned facilities...

  16. Effect of Support on the Synergy in HDS of Thiophene and HDN of Pyridine over Mo Sulfide Catalysts Promoted by Rh

    Czech Academy of Sciences Publication Activity Database

    Vít, Zdeněk; Gulková, Daniela; Kaluža, Luděk; Zdražil, Miroslav

    2004-01-01

    Roč. 83, č. 2 (2004), s. 237-244. ISSN 0133-1736 R&D Projects: GA AV ČR IAA4072103 Institutional research plan: CEZ:AV0Z4072921 Keywords : Rh-Mo catalyst * hydrodesulfurization * synergetic effect Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 0.618, year: 2004

  17. Coupled Cluster Theories for Strongly Correlated Molecular Systems

    Czech Academy of Sciences Publication Activity Database

    Kowalski, K.; Bhaskaran-Nair, K.; Brabec, Jiří; Pittner, Jiří

    Heidelberg: Springer-Verlag Berlin, 2013 - (Avella, A.; Mancini, F.), s. 237-271 ISBN 978-3-642-35106-8 R&D Projects: GA ČR GAP208/11/2222 Institutional support: RVO:61388955 Keywords : coupled cluster theories * strongly correlated molecular systems * computational chemistry Subject RIV: CF - Physical ; Theoretical Chemistry

  18. Correlates of functional disability in early rheumatoid arthritis : A cross-sectional study of 706 patients in four European countries

    NARCIS (Netherlands)

    Smedstad, LM; Moum, T; Guillemin, F; Kvien, TK; Finch, MB; Suurmeijer, TPBM; vandenHeuvel, WJA

    1996-01-01

    In this cross-sectional study of 706 European patients with rheumatoid arthritis (RA) of less than or equal to 4 yr duration, we examined possible correlates of functional disability assessed by the Health Assessment Questionnaire. First, we examined a subsample of 237 Norwegian patients. The Ritchi

  19. Nieuws uit de literatuur III

    NARCIS (Netherlands)

    NN,

    1986-01-01

    C.G. Hanson & J.L. Mason, 1985. Bird seed aliens in Britain, Watsonia 15:237-252. Een goed gedocumenteerde en geannoteerde lijst van in totaal 438 soorten die als vogelvoer of als verontreiniging daarvan in Engeland worden ingevoerd. Het is aannemelijk dat de resultaten van hun bevindingen ook van t

  20. Study on Correlation of English Pronunciation Self-Concept to English Learning

    Science.gov (United States)

    Tang, Xin; Zhang, Shengqi; Li, Yucong; Zhao, Miqiang

    2013-01-01

    English pronunciation self-concept is formed in the process of pronunciation learning, which refers to the learners' self-conception and assessment of one's English pronunciation proficiency and pronunciation (Gimson, A. C. 1980). This paper reports an investigation on 237 non-English major college students into the relationship between English…

  1. Ionic speciation of Np in frozen solutions

    International Nuclear Information System (INIS)

    Light actinides exhibit many oxidation states (II) that are stable in salts and are relatively stable in solution. Np IV to Np VII solutions were prepared and quickly frozen. We report the preliminary results of the 237Np Mossbauer study. These results are discussed and compared to those available for Np compounds in the crystalline state or Np ions in solution. 3 refs

  2. Archäologischer Frühling. Aufnahmen historischer Baudenkmäler in Böhmen

    Czech Academy of Sciences Publication Activity Database

    Trnková, Petra

    Wien : Photoinstitut Bonartes, 2015 - (Faber, M.), s. 237-245 ISBN 978-3-902993-20-5 Institutional support: RVO:68378033 Keywords : Andreas Groll (1812-1872) * Bernhard Grueber * Johann Erasmus Wocel * photography * architecture * history * 19th century * Prague * Kutná Hora Subject RIV: AL - Art, Architecture, Cultural Heritage

  3. Semiconductor lasers for medical applications

    Czech Academy of Sciences Publication Activity Database

    Hulicius, Eduard; Kubeček, V.

    Cambridge: Woodhead Publishing Limited, 2013 - (Jelínková, H.), s. 222-250. (Woodhead Publishing Series in Electronic and Optical Materials. 37). ISBN 978-0-85709-237-3 Institutional support: RVO:68378271 Keywords : semiconductor laser * LED * MBE * MOVPE * optical spectra * optical power Subject RIV: BH - Optics, Masers, Laser s

  4. Nuclear Data Sheets for A=213

    International Nuclear Information System (INIS)

    Evaluated spectroscopic data and level schemes from radioactive decay and nuclear reaction studies are presented for all nuclei with mass number A=213. This evaluation for A=213 supersedes the earlier one by Y. A. Akovali (1992Ak01), published in Nuclear Data Sheets 66, 237 (1992)

  5. 20 CFR 408.708 - What events must you report to us?

    Science.gov (United States)

    2010-04-01

    ... section 237(a) or 212(a)(6)(A) of the Immigration and Nationality Act. (f) Fleeing to avoid criminal... jurisdiction within the United States from which you flee, for a crime, or an attempt to commit a crime, which... from which you flee, for a crime, or an attempt to commit a crime, which is a felony under the laws...

  6. 20 CFR 408.204 - What conditions will prevent you from qualifying for SVB or being entitled to receive SVB payments?

    Science.gov (United States)

    2010-04-01

    ... to section 237(a) or 212(a)(6)(A) of the Immigration and Nationality Act and before the month in... from which you fled, for a crime or an attempt to commit a crime that is a felony under the laws of...

  7. Seaweed-Derived Biostimulant (Kelpak (R)) Influences Endogenous Cytokinins and Bioactive Compounds in Hydroponically Grown Eucomis autumnalis

    Czech Academy of Sciences Publication Activity Database

    Aremu, A.O.; Plačková, Lenka; Grúz, Jiří; Bíba, Ondřej; Novák, Ondřej; Stirk, W. A.; Doležal, Karel; van Staden, J.

    2016-01-01

    Roč. 35, č. 1 (2016), s. 151-162. ISSN 0721-7595 R&D Projects: GA MŠk(CZ) LO1204; GA MŠk LK21306 Institutional support: RVO:61389030 Keywords : Asparagaceae * Conservation * Medicinal plants Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 2.237, year: 2014

  8. Dicty_cDB: Contig-U09376-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 1540 ) S237P6228RD7.T0 PortugueseWaterDog Canis familiar... 44 8.9 1 ( BV422520 )...H211-264C24 in... 44 8.9 1 ( BX294128 ) Zebrafish DNA sequence from clone DKEYP-35F12 in ... 44 8.9 1 ( BV44

  9. Dicty_cDB: CHK317 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available nments: (bits) Value N AL844507 |AL844507.1 Plasmodium falciparum chromosome 8. 66 2e-13 2 BV429546 |BV429546.1 S237P6409FA7.T0 Portu...gueseWaterDog Canis familiaris STS genomic, sequence tag

  10. Dicty_cDB: Contig-U15405-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available s troglodyt... 44 0.80 1 ( BV495481 ) S217P61918FE2.T0 Noemie Pan troglodytes troglodyt... 44 0.80 1 ( BV436248 ) S237P6495RF5.T0 Por...tugueseWaterDog Canis familiar... 44 0.80 1 ( BV312740 )

  11. Trainee Reactions to Learner Control: An Important Link in the E-Learning Equation

    Science.gov (United States)

    Fisher, Sandra L.; Wasserman, Michael E.; Orvis, Karin A.

    2010-01-01

    This paper examines the benefits and limitations of learner control functionality in the e-learning environment. A quasi-experiment with 237 learners was conducted to examine the role of high-level learner control (i.e. enabling trainee "choice" to complete an e-learning program with or without interactive learner control features versus…

  12. Jazyk v sociální interakci: Nad českým překladem knihy Petera Auera Jazyková interakce

    Czech Academy of Sciences Publication Activity Database

    Kaderka, Petr; Nekvapil, J.

    Praha : Nakladatelství Lidové noviny, 2014, s. 237-248. ISBN 978-80-7422-268-9 R&D Projects: GA ČR GAP406/12/1829 Institutional support: RVO:68378092 Keywords : social interaction * multimodal interaction * linguistic interaction * Peter Auer * translation strategies * terminology management Subject RIV: AI - Linguistics

  13. The effect of growth regulator Rastim 30 DKV on the level of endogenous phytohormones in tomato (Solanum lycopersicum L.)

    Czech Academy of Sciences Publication Activity Database

    Henselová, M.; Vizárová, G.; Macháčková, Ivana

    2001-01-01

    Roč. 47, č. 9 (2001), s. 411-417. ISSN 0370-663X R&D Projects: GA ČR GV206/96/K188; GA MŠk LN00A081 Institutional research plan: CEZ:AV0Z5038910 Keywords : auxin * cytokinins * ethylene Subject RIV: EF - Botanics Impact factor: 0.237, year: 2001

  14. An annotated list of parasites (Isopoda, Copepoda, Monogenea, Digenea, Cestoda and Nematoda) collected in groupers (Serranidae, Epinephelinae) in New Caledonia emphasizes parasite biodiversity in coral reef fish

    Czech Academy of Sciences Publication Activity Database

    Justine, J.-L.; Beveridge, I.; Boxshall, G.A.; Bray, R. A.; Moravec, František; Trilles, J.-P.; Whittington, I.D.

    2010-01-01

    Roč. 57, č. 4 (2010), s. 237-262. ISSN 0015-5683 R&D Projects: GA MŠk LC522 Institutional research plan: CEZ:AV0Z60220518 Keywords : Isopoda * Copepoda * Monogenea * Digenea * Cestoda * Nematoda * Serranidae * Epinephelinae * parasite biodiversity * coral reef * New Caledonia Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 1.533, year: 2010

  15. Learning English Pragmatics in China: An Investigation into Chinese EFL Learners' Perceptions of Pragmatics

    Science.gov (United States)

    Yuan, Yifeng; Tangen, Donna; Mills, Kathy A.; Lidstone, John

    2015-01-01

    This paper reports the findings of a study investigating Chinese English language learners' perceptions of pragmatics in the EFL learning context in China. A total of 237 Chinese EFL first--year university students participated in the study. A questionnaire and focus group interviews were used to collect data about learners' pragmatics insights…

  16. Preparation of tracer 239Np from 243Am

    International Nuclear Information System (INIS)

    The aim of this work is the preparation of tracer 239Np from 243Am by extraction chromatography as a separation method that can be used as a tracer to determine the radiochemical yield of 237Np in the analysis of environmental samples. (authors)

  17. A Factor Analytic Study of the Coopersmith Self-Esteem Inventory Adult Short Form.

    Science.gov (United States)

    Haines, Janet; Wilson, George V.

    1988-01-01

    A factor analysis was conducted on the Coopersmith Self-Esteem Inventory-Adult Short Form using 237 college students and 43 female office workers in Australia. Factors were found corresponding with three of the four subscales: general self, social self-peers, and home-parents (family). No factor related to the school-academic (work) subscale. (SLD)

  18. Enzootic plague foci, Algeria

    OpenAIRE

    Malek, M.A.; Hammani, A.; Beneldjouzi, A.; Bitam, I.

    2014-01-01

    In Algeria, PCR sequencing of pla, glpD and rpoB genes found Yersinia pestis in 18/237 (8%) rodents of five species, including Apodemus sylvaticus, previously undescribed as pestiferous; and disclosed three new plague foci. Multiple spacer typing confirmed a new Orientalis variant. Rodent survey should be reinforced in this country hosting reemerging plague.

  19. 78 FR 31966 - Agency Information Collection Activities: Proposed Collection; Comment Request

    Science.gov (United States)

    2013-05-28

    ... Annual Burden Hours: 94,875 hours. Table A.12--Estimated Annualized Burden Hours and Costs Avg. Total Number of Number of Total burden per annual Avg. Total annual Type of respondent Form name/Form No...,133 94,875 3,546,237.70 * Note: The ``Avg. Hourly Wage Rate'' for each respondent includes a...

  20. Semi-automatic motion compensation of contrast-enhanced ultrasound images from abdominal organs for perfusion analysis

    Czech Academy of Sciences Publication Activity Database

    Schafer, S.; Nylund, K.; Saevik, F.; Engjom, T.; Mézl, M.; Jiřík, Radovan; Dimcevski, G.; Gilja, O.H.; Tönnies, K.

    2015-01-01

    Roč. 63, AUG 1 (2015), s. 229-237. ISSN 0010-4825 R&D Projects: GA ČR GAP102/12/2380 Institutional support: RVO:68081731 Keywords : ultrasonography * motion analysis * motion compensation * registration * CEUS * contrast-enhanced ultrasound * perfusion * perfusion modeling Subject RIV: FS - Medical Facilities ; Equipment Impact factor: 1.240, year: 2014

  1. Gender-Related Processes and Drug Use: Self-Expression with Parents, Peer Group Selection, and Achievement Motivation

    Science.gov (United States)

    Razzino, Brian E.; Ribordy, Sheila C.; Grant, Kathryn; Ferrari, Joseph R.; Bowden, Blake S.; Zeisz, Jennifer

    2004-01-01

    This investigation examined gender differences in communication with parents, peer group selection, and academic motivation as related to drug use among adolescents (290 girls, 237 boys; age range = 12-19 years). For girls, increased self-expression with parents was associated with greater academic motivation, more academically motivated friends,…

  2. Impact-pressure controlled orientation of shatter cone magnetizations in Sierra Madera, Texas, USA

    Czech Academy of Sciences Publication Activity Database

    Adachi, T.; Kletetschka, Günther

    2008-01-01

    Roč. 52, č. 2 (2008), s. 237-254. ISSN 0039-3169 Institutional research plan: CEZ:AV0Z30130516 Keywords : shatter cones * impact crater * shock fractures * magnetism * Mars Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 0.770, year: 2008

  3. EST Table: FS792589 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available FS792589 E_FL_ffbm_10B23_F_0 10/09/28 54 %/237 aa ref|NP_001119728.1| hemolymph ... protein [Bombyx ... mori] dbj|BAA02093.1| hemolymph ... protein [Bombyx mori] 10/09/09 n.h 10/08/29 n.h 10 ...

  4. EST Table: FS869514 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available FS869514 E_FL_fner_39P15_R_0 10/09/28 54 %/237 aa ref|NP_001119728.1| hemolymph ... protein [Bombyx ... mori] dbj|BAA02093.1| hemolymph ... protein [Bombyx mori] 10/09/11 n.h 10/08/29 n.h 10 ...

  5. The Home Smoking Environment: Influence on Behaviors and Attitudes in a Racially Diverse Adolescent Population

    Science.gov (United States)

    Muilenburg, Jessica Legge; Latham, Teaniese; Annang, Lucy; Johnson, William D.; Burdell, Alexandra C.; West, Sabra J.; Clayton, Dixie L.

    2009-01-01

    Although studies indicate that public policy can influence the decrease in smoking behaviors, these policies have not necessarily transferred to home environments at the same rate. The authors surveyed 4,296 students in a southern urban area. African American students were 76.3% of the respondents and Caucasians accounted for 23.7%. African…

  6. Changes in the Chlorophyll Content and Cytokinin Levels in the Top Three Leaves of New Plant Type Rice During Grain Filling

    Czech Academy of Sciences Publication Activity Database

    Rubia, L.; Rangan, L.; Kamínek, Miroslav; Dobrev, Petre; Malbeck, Jiří; Fowler, M.; Khush, G.; Elliott, M.

    2014-01-01

    Roč. 33, č. 1 (2014), s. 66-76. ISSN 0721-7595 R&D Projects: GA MŠk 1M06030 Institutional support: RVO:61389030 Keywords : Chlorophyll * Cytokinins * Grain filling Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 2.237, year: 2014

  7. Fiber consumption and metabolic syndrome in adults: Results from NHANES 1999-2004

    Science.gov (United States)

    The objective of this study was to examine the effect ofincreasing fiber and whole grain (WG) consumption on the odds of having metabolic syndrome (MetS) in a recent, nationally representative sample of US adults 19 to 51 years (n=7,039) and 51+ years (n=6,237) using a secondary analysis of NHANES 1...

  8. The asteroid genus Haccourtaster (Echinodermata, Goniasteridae) in the Bohemian Cretaceous Basin, Czech Republic

    Czech Academy of Sciences Publication Activity Database

    Žítt, Jiří

    2005-01-01

    Roč. 26, č. 2 (2005), s. 225-237. ISSN 0195-6671 R&D Projects: GA ČR(CZ) GA206/01/1580 Institutional research plan: CEZ:AV0Z30130516 Keywords : Cretaceous * Asteroidea * New species Subject RIV: EG - Zoology Impact factor: 0.981, year: 2005

  9. Polská exilová vláda a československo-sovětská smlouva

    Czech Academy of Sciences Publication Activity Database

    Friedl, Jiří

    Praha : Historický ústav, 2014 - (Němeček, J.), s. 67-77 ISBN 978-80-7286-237-5. - (Práce Historického ústavu AV ČR, v.v 55) Institutional support: RVO:67985963 Keywords : Czechoslovakia * Poland * The Second World War * relations Subject RIV: AB - History

  10. Heat transfer in transitional high-temperature gas plumes

    Czech Academy of Sciences Publication Activity Database

    Krejčí, Luděk; Dolínek, Vladimír; Sopuch, Pavel; Něnička, V.; Hlína, J.

    Pisa : Edizioni ETS Pisa, Italy, 2000 - (Hahne, E.; Heidemann, W.; Spindler, K.), s. 233-237 - (1). [European thermal sciences conference 2000 /3./. Heidelberg (NE), 10.09.2000-13.09.2000] Institutional research plan: CEZ:AV0Z2076919 Keywords : arc * heat transfer * plasma plume Subject RIV: BK - Fluid Dynamics

  11. IR and Near IR Laser Ablative Deposition of Amorphous Titanium Coats Containing Nanocrystalline Grains of Titanium and Titanium Suboxides

    Czech Academy of Sciences Publication Activity Database

    Urbanová, Markéta; Pokorná, Dana; Kupčík, Jaroslav; Medlín, R.; Křenek, T.; Pola, Josef

    2014-01-01

    Roč. 67, NOV 2014 (2014), s. 237-244. ISSN 1350-4495 Grant ostatní: GA MŠMT(CZ) CZ.1.05/2.1.00/03.0088 Institutional support: RVO:67985858 Keywords : laser ablation * laser deposition * amorphous titanium coats Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 1.550, year: 2014

  12. Gas dynamic lasers (a bibliography with abstracts). Report for 1964-July 1978

    Energy Technology Data Exchange (ETDEWEB)

    Smith, M.F.

    1978-08-01

    The citations cover research on kinetic and energy transfer processes, design, optics, nozzles, and performance of gas and chemical lasers relying on gas dynamic effects for lasing enhancement. Diffusion and flow studies specifically applicable to such lasers are also included. (This updated bibliography contains 237 abstracts, 21 of which are new entries to the previous edition.)

  13. The PADME experiment

    CERN Document Server

    ,

    2016-01-01

    The PADME experiment, hosted at the Laboratori Nazionali di Frascati, will search for a Dark Photon that decays in invisible channels with a mass up to $23.7\\,\\mbox{MeV}$ and coupling constant down to $10^{-3}$.

  14. Bacterial utilization of size-fractionated dissolved organic matter

    Digital Repository Service at National Institute of Oceanography (India)

    Khodse, V.B; Bhosle, N.B

    ), dissolved uronic acid (DURA), delta13C, bacterial abundance (BA), and bacterial production (BP). The LMW fraction was isotopically heavier (delta13C = −23.7 to −21.7ppt) than the HMW fraction (delta13C = −27.0 to −26.2ppt), and the initial TDCHO content...

  15. Local species richness of leaf-chewing insects feeding on woody plants from one hectare of a lowland rainforest

    Czech Academy of Sciences Publication Activity Database

    Novotný, Vojtěch; Basset, Y.; Miller, S. E.; Kitching, R. L.; Laidlaw, M.; Drozd, P.; Čížek, Lukáš

    2004-01-01

    Roč. 18, č. 1 (2004), s. 227-237. ISSN 0888-8892 R&D Projects: GA AV ČR(CZ) IAA6007106 Keywords : Papua-New-Guinea * quantifying biodiversity Subject RIV: EH - Ecology, Behaviour Impact factor: 3.672, year: 2004

  16. Social Justice Perceptions of Teacher Candidates

    Science.gov (United States)

    Turhan, Muhammed

    2010-01-01

    This study aims to determine the social justice perceptions of teacher candidates being trained in an education faculty. For this purpose, national and international literature was reviewed by the researcher and a 32-item questionnaire was developed and implemented on 237 senior year education faculty students. Data from the questionnaires were…

  17. Gaussian Filtering with Tapered Oil-Filled Photonic Bandgap Fibers

    DEFF Research Database (Denmark)

    Brunetti, Anna Chiara; Scolari, Lara; Weirich, Johannes;

    2008-01-01

    A tunable Gaussian filter based on a tapered oil-filled photonic crystal fiber is demonstrated. The filter is centered at X=1364nm with a bandwidth (FWHM) of 237nm. Tunability is achieved by changing the temperature of the filter. A shift of 210nm of the central wavelength has been observed by...

  18. Seasonality of cardiovascular risk factors

    DEFF Research Database (Denmark)

    Marti-Soler, Helena; Gubelmann, Cédric; Aeschbacher, Stefanie;

    2014-01-01

    OBJECTIVE: To assess the seasonality of cardiovascular risk factors (CVRF) in a large set of population-based studies. METHODS: Cross-sectional data from 24 population-based studies from 15 countries, with a total sample size of 237 979 subjects. CVRFs included Body Mass Index (BMI) and waist...

  19. Department of Commerce Semiannual Regulatory Agenda

    Science.gov (United States)

    2010-12-20

    ... Aquaculture in the Gulf of 0648-AS65 Mexico 268 Provide Regulations for Permits for Capture, Transport, Import... 237 Amendment 10 to the Fishery Management Plan for Spiny Lobster in the Gulf of Mexico 0648-AY72 and...-Open the Recreational Red Snapper Season in the Gulf of Mexico... 0648-BA06 262 Protective...

  20. A previously undescribed jasmonate compound in flowering Arabidopsis thaliana - The identification of cis-(+)-OPDA-Ile

    Czech Academy of Sciences Publication Activity Database

    Floková, K.; Feussner, K.; Herrfurth, C.; Miersch, O.; Mik, V.; Tarkowská, Danuše; Strnad, Miroslav; Feussner, I.; Wasternack, Claus; Novák, Ondřej

    2016-01-01

    Roč. 122, FEB (2016), s. 230-237. ISSN 0031-9422 R&D Projects: GA MŠk(CZ) LO1204; GA MŠk LK21306 Institutional support: RVO:61389030 Keywords : Arabidopsis thaliana (Brassicaceae) * Jasmonates * Cis-(+)-12-oxo-phytodienoyl-L-isoleucine Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 2.547, year: 2014