Chemistry of berkelium: a review
International Nuclear Information System (INIS)
Hobart, D.E.; Peterson, J.R.
1985-01-01
Element 97 was first produced in December 1949, by the bombardment of americium-241 with accelerated alpha particles. This new element was named berkelium (Bk) after Berkeley, California, the city of its discovery [Thompson, Ghiorso, and Seaborg, Phys. Rev. 77, 838 (1950); 80, 781 (1950)]. In the 36 years since the discovery of Bk, a substantial amount of knowledge concerning the physicochemical properties of this relatively scarce transplutonium element has been acquired. All of the Bk isotopes of mass numbers 240 and 242 through 251 are presently known, but only berkelium-249 (β - decay, 0.125 MeV, t/sub 1/2/ = 325 days) is available in sufficient quantities for bulk chemical studies. About 0.7 gram of this isotope has been isolated at the HFIR/TRU Complex in Oak Ridge, Tennessee in the last 18 years. Over the same time period, the scale of experimental work using berkelium-249 has increased from the tracer level to bulk studies at the microgram level to solution and solid state investigations with milligram quantities. Extended knowledge of the physicochemical behavior of berkelium is important in its own right, because Bk is the first member of the second half of the actinide series. In addition, such information should enable more accurate extrapolations to the predicted behavior of heavier elements for which experimental studies are severely limited by lack of material and/or by intense radioactivity
Berkelium (4) and cerium (4) extraction with tertiary amines
International Nuclear Information System (INIS)
Milyukova, M.S.; Malikov, D.A.; Myasoedov, B.V.
1978-01-01
Oxidation of indicator quantities of berkelium and cerium by a mixture of silver nitrate and ammonium persulfate in the solutions of nitric and sulfuric acid has been examined. The stability of the elements in a tetravalent state and their extraction by the solutions of ternary amines have been investigated. It has been established that berkelium and cerium oxidation under these conditions occurs under the effect of ions of divalent silver which is formed owing to oxidation of monovalent silver by peroxide sulfate ions. The following supposition has been put forward: a difference in the behaviour of tetravalent berkelium and cerium during their extraction by ternary amines is explained by their different stability in this state, but not by the formation of complex compounds with nitrate ions
Citric complexes of trivalent cerium and berkelium
International Nuclear Information System (INIS)
Boulhassa, S.
1977-01-01
The extraction by thenoyltrifluoroacetone (TTA) in benzene of trivalent cerium, berkelium and californium, at the indicator scale, hydrolysis and complexation by citric acid of these cations are studied. The radionuclides used were 144 Ce, 249 Bk and 249 Cf respectively γ, β and α emitters. The solvent extraction technique of the elements by TTA in benzene from a perchloric medium at the ionic stength 0.1 was employed. The distribution coefficients D were measured by the γ, β or α radiometry. Cerium and berkelium, which have a comparable redox behavior, show in solution a relatively stable valency IV. Therefore the study by solvent extraction of their trivalent form required the standing up of complete reducing conditions of these elements and their stabilization in solution at the valency III. The thermodynamic data obtained for berkelium and californium contribute to understand the chemistry of these elements and permit to complete the third 'tetrad branch' of 5f elements from Cm 3+ to Es 3+ . This tetrad effect is a manifestation of thermodynamic consequence of the 'nephelauxetic effect'. As for Ce(III), the data confirm the pronounced acid property and may be show no neglected ligand effect for f 1 configuration [fr
Chelation and stabilization of berkelium in oxidation state +IV
Deblonde, Gauthier J.-P.; Sturzbecher-Hoehne, Manuel; Rupert, Peter B.; An, Dahlia D.; Illy, Marie-Claire; Ralston, Corie Y.; Brabec, Jiri; de Jong, Wibe A.; Strong, Roland K.; Abergel, Rebecca J.
2017-09-01
Berkelium (Bk) has been predicted to be the only transplutonium element able to exhibit both +III and +IV oxidation states in solution, but evidence of a stable oxidized Bk chelate has so far remained elusive. Here we describe the stabilization of the heaviest 4+ ion of the periodic table, under mild aqueous conditions, using a siderophore derivative. The resulting Bk(IV) complex exhibits luminescence via sensitization through an intramolecular antenna effect. This neutral Bk(IV) coordination compound is not sequestered by the protein siderocalin—a mammalian metal transporter—in contrast to the negatively charged species obtained with neighbouring trivalent actinides americium, curium and californium (Cf). The corresponding Cf(III)-ligand-protein ternary adduct was characterized by X-ray diffraction analysis. Combined with theoretical predictions, these data add significant insight to the field of transplutonium chemistry, and may lead to innovative Bk separation and purification processes.
International Nuclear Information System (INIS)
Payne, G.F.; Peterson, J.R.
1987-01-01
It appears that we may have prepared Bk(IV) nitrate.nTPAs0 and Bk(IV) perchlorate.nTPAs0 complexes which formed the corresponding Cf(IV) complexes through the beta decay of Bk-249. Definitive proof should come from similar experiments with quantities of Bk-249 large enough to allow spectrophotometric detection of the characteristic f→f transitions in these berkelium and californium species. It is clear, however, that TPAs0 and acetonitrile can play a pivotal role in the stabilization of lanact(IV) species
2010-10-01
... 49 Transportation 4 2010-10-01 2010-10-01 false Delay time. 236.563 Section 236.563 Transportation... Cab Signal Systems Rules and Instructions; Locomotives § 236.563 Delay time. Delay time of automatic... requirements of § 236.24 shall take into consideration the delay time. ...
49 CFR 236.588 - Periodic test.
2010-10-01
... 49 Transportation 4 2010-10-01 2010-10-01 false Periodic test. 236.588 Section 236.588..., Train Control and Cab Signal Systems Inspection and Tests; Locomotive § 236.588 Periodic test. Except as provided in § 236.586, periodic test of the automatic train stop, train control, or cab signal apparatus...
2010-07-01
... 36 Parks, Forests, and Public Property 1 2010-07-01 2010-07-01 false Gambling. 2.36 Section 2.36 Parks, Forests, and Public Property NATIONAL PARK SERVICE, DEPARTMENT OF THE INTERIOR RESOURCE PROTECTION, PUBLIC USE AND RECREATION § 2.36 Gambling. (a) Gambling in any form, or the operation of gambling...
2010-10-01
... 49 Transportation 4 2010-10-01 2010-10-01 false Block. 236.708 Section 236.708 Transportation... OF SIGNAL AND TRAIN CONTROL SYSTEMS, DEVICES, AND APPLIANCES Definitions § 236.708 Block. A length of track of defined limits, the use of which by trains is governed by block signals, cab signals, or both. ...
2010-04-01
... 24 Housing and Urban Development 2 2010-04-01 2010-04-01 false Audit. 236.901 Section 236.901... AND INTEREST REDUCTION PAYMENT FOR RENTAL PROJECTS Audits § 236.901 Audit. Where a State or local... mortgagor of a mortgage insured or held by the Commissioner under this part, it shall conduct audits in...
49 CFR 236.717 - Characteristics, operating.
2010-10-01
... 49 Transportation 4 2010-10-01 2010-10-01 false Characteristics, operating. 236.717 Section 236.717 Transportation Other Regulations Relating to Transportation (Continued) FEDERAL RAILROAD... § 236.717 Characteristics, operating. The measure of electrical values at which electrical or electronic...
49 CFR 236.105 - Electric lock.
2010-10-01
... 49 Transportation 4 2010-10-01 2010-10-01 false Electric lock. 236.105 Section 236.105 Transportation Other Regulations Relating to Transportation (Continued) FEDERAL RAILROAD ADMINISTRATION...: All Systems Inspections and Tests; All Systems § 236.105 Electric lock. Electric lock, except forced...
2010-10-01
... 49 Transportation 4 2010-10-01 2010-10-01 false Shoe, latch. 236.801 Section 236.801 Transportation Other Regulations Relating to Transportation (Continued) FEDERAL RAILROAD ADMINISTRATION..., MAINTENANCE, AND REPAIR OF SIGNAL AND TRAIN CONTROL SYSTEMS, DEVICES, AND APPLIANCES Definitions § 236.801...
49 CFR 236.384 - Cross protection.
2010-10-01
... 49 Transportation 4 2010-10-01 2010-10-01 false Cross protection. 236.384 Section 236.384 Transportation Other Regulations Relating to Transportation (Continued) FEDERAL RAILROAD ADMINISTRATION... and Tests § 236.384 Cross protection. Cross protection shall be tested at least once every six months...
2010-10-01
... 49 Transportation 4 2010-10-01 2010-10-01 false Chart, dog. 236.718 Section 236.718 Transportation Other Regulations Relating to Transportation (Continued) FEDERAL RAILROAD ADMINISTRATION, DEPARTMENT OF... OF SIGNAL AND TRAIN CONTROL SYSTEMS, DEVICES, AND APPLIANCES Definitions § 236.718 Chart, dog. A...
49 CFR 236.742 - Dog, locking.
2010-10-01
... 49 Transportation 4 2010-10-01 2010-10-01 false Dog, locking. 236.742 Section 236.742 Transportation Other Regulations Relating to Transportation (Continued) FEDERAL RAILROAD ADMINISTRATION..., MAINTENANCE, AND REPAIR OF SIGNAL AND TRAIN CONTROL SYSTEMS, DEVICES, AND APPLIANCES Definitions § 236.742 Dog...
8 CFR 236.13 - Ineligible aliens.
2010-01-01
... 8 Aliens and Nationality 1 2010-01-01 2010-01-01 false Ineligible aliens. 236.13 Section 236.13 Aliens and Nationality DEPARTMENT OF HOMELAND SECURITY IMMIGRATION REGULATIONS APPREHENSION AND DETENTION OF INADMISSIBLE AND DEPORTABLE ALIENS; REMOVAL OF ALIENS ORDERED REMOVED Family Unity Program § 236...
49 CFR 236.705 - Bar, locking.
2010-10-01
... 49 Transportation 4 2010-10-01 2010-10-01 false Bar, locking. 236.705 Section 236.705..., MAINTENANCE, AND REPAIR OF SIGNAL AND TRAIN CONTROL SYSTEMS, DEVICES, AND APPLIANCES Definitions § 236.705 Bar, locking. A bar in an interlocking machine to which the locking dogs are attached. ...
49 CFR 236.516 - Power supply.
2010-10-01
... 49 Transportation 4 2010-10-01 2010-10-01 false Power supply. 236.516 Section 236.516..., Train Control and Cab Signal Systems Standards § 236.516 Power supply. Automatic cab signal, train stop, or train control device hereafter installed shall operate from a separate or isolated power supply...
49 CFR 236.587 - Departure test.
2010-10-01
... 49 Transportation 4 2010-10-01 2010-10-01 false Departure test. 236.587 Section 236.587..., Train Control and Cab Signal Systems Inspection and Tests; Locomotive § 236.587 Departure test. (a) The...: (1) Operation over track elements; (2) Operation over test circuit; (3) Use of portable test...
49 CFR 236.777 - Operator, control.
2010-10-01
... 49 Transportation 4 2010-10-01 2010-10-01 false Operator, control. 236.777 Section 236.777..., MAINTENANCE, AND REPAIR OF SIGNAL AND TRAIN CONTROL SYSTEMS, DEVICES, AND APPLIANCES Definitions § 236.777 Operator, control. An employee assigned to operate the control machine of a traffic control system. ...
49 CFR 236.814 - Station, control.
2010-10-01
... 49 Transportation 4 2010-10-01 2010-10-01 false Station, control. 236.814 Section 236.814..., MAINTENANCE, AND REPAIR OF SIGNAL AND TRAIN CONTROL SYSTEMS, DEVICES, AND APPLIANCES Definitions § 236.814 Station, control. The place where the control machine of a traffic control system is located. ...
49 CFR 236.771 - Machine, control.
2010-10-01
... 49 Transportation 4 2010-10-01 2010-10-01 false Machine, control. 236.771 Section 236.771..., MAINTENANCE, AND REPAIR OF SIGNAL AND TRAIN CONTROL SYSTEMS, DEVICES, AND APPLIANCES Definitions § 236.771 Machine, control. An assemblage of manually operated devices for controlling the functions of a traffic...
2010-10-01
... OF SIGNAL AND TRAIN CONTROL SYSTEMS, DEVICES, AND APPLIANCES Definitions § 236.712 Brake pipe. A pipe running from the engineman's brake valve through the train, used for the transmission of air under... 49 Transportation 4 2010-10-01 2010-10-01 false Brake pipe. 236.712 Section 236.712 Transportation...
42 CFR 438.236 - Practice guidelines.
2010-10-01
... 42 Public Health 4 2010-10-01 2010-10-01 false Practice guidelines. 438.236 Section 438.236 Public... Improvement Standards § 438.236 Practice guidelines. (a) Basic rule: The State must ensure, through its...) Adoption of practice guidelines. Each MCO and, when applicable, each PIHP and PAHP adopts practice...
49 CFR 236.721 - Circuit, control.
2010-10-01
... 49 Transportation 4 2010-10-01 2010-10-01 false Circuit, control. 236.721 Section 236.721..., MAINTENANCE, AND REPAIR OF SIGNAL AND TRAIN CONTROL SYSTEMS, DEVICES, AND APPLIANCES Definitions § 236.721 Circuit, control. An electrical circuit between a source of electric energy and a device which it operates. ...
24 CFR 236.60 - Excess Income.
2010-04-01
... 24 Housing and Urban Development 2 2010-04-01 2010-04-01 false Excess Income. 236.60 Section 236... § 236.60 Excess Income. (a) Definition. Excess Income consists of cash collected as rent from the... Rent. The unit-by-unit requirement necessitates that, if a unit has Excess Income, the Excess Income...
2010-10-01
... 49 Transportation 4 2010-10-01 2010-10-01 false Dog, swing. 236.743 Section 236.743 Transportation... OF SIGNAL AND TRAIN CONTROL SYSTEMS, DEVICES, AND APPLIANCES Definitions § 236.743 Dog, swing. A locking dog mounted in such a manner that it is free to rotate on a trunnion which is riveted to a locking...
49 CFR 236.809 - Signal, slotted mechanical.
2010-10-01
... 49 Transportation 4 2010-10-01 2010-10-01 false Signal, slotted mechanical. 236.809 Section 236.809 Transportation Other Regulations Relating to Transportation (Continued) FEDERAL RAILROAD... § 236.809 Signal, slotted mechanical. A mechanically operated signal with an electromagnetic device...
49 CFR 236.52 - Relayed cut-section.
2010-10-01
..., MAINTENANCE, AND REPAIR OF SIGNAL AND TRAIN CONTROL SYSTEMS, DEVICES, AND APPLIANCES Rules and Instructions: All Systems Track Circuits § 236.52 Relayed cut-section. Where relayed cut-section is used in... 49 Transportation 4 2010-10-01 2010-10-01 false Relayed cut-section. 236.52 Section 236.52...
48 CFR 852.236-78 - Government supervision.
2010-10-01
... 48 Federal Acquisition Regulations System 5 2010-10-01 2010-10-01 false Government supervision. 852.236-78 Section 852.236-78 Federal Acquisition Regulations System DEPARTMENT OF VETERANS AFFAIRS CLAUSES AND FORMS SOLICITATION PROVISIONS AND CONTRACT CLAUSES Texts of Provisions and Clauses 852.236-78 Government supervision. As prescribed in...
2010-01-01
... 8 Aliens and Nationality 1 2010-01-01 2010-01-01 false Filing. 236.14 Section 236.14 Aliens and Nationality DEPARTMENT OF HOMELAND SECURITY IMMIGRATION REGULATIONS APPREHENSION AND DETENTION OF INADMISSIBLE... initial denial, to allow the alien the opportunity to file a new Form I-817 application in order to...
2010-01-01
... 15 Commerce and Foreign Trade 1 2010-01-01 2010-01-01 false Definitions. 23.6 Section 23.6 Commerce and Foreign Trade Office of the Secretary of Commerce USE OF PENALTY MAIL IN THE LOCATION AND... entities outside the Office of the Secretary charged with carrying out specified substantive functions (i.e...
48 CFR 252.236-7000 - Modification proposals-price breakdown.
2010-10-01
...-price breakdown. 252.236-7000 Section 252.236-7000 Federal Acquisition Regulations System DEFENSE... CLAUSES Text of Provisions And Clauses 252.236-7000 Modification proposals—price breakdown. As prescribed in 236.570(a), use the following clause: Modification Proposals—Price Breakdown (DEC 1991) (a) The...
48 CFR 552.236-77 - Specifications and Drawings
2010-10-01
... Drawings 552.236-77 Section 552.236-77 Federal Acquisition Regulations System GENERAL SERVICES....236-77 Specifications and Drawings As prescribed in 536.570-8, insert the following clause: Specifications and Drawings (SEP 1999) The requirements of the clause entitled “Specifications and Drawings for...
49 CFR 236.761 - Locking, electric.
2010-10-01
... 49 Transportation 4 2010-10-01 2010-10-01 false Locking, electric. 236.761 Section 236.761 Transportation Other Regulations Relating to Transportation (Continued) FEDERAL RAILROAD ADMINISTRATION... Locking, electric. The combination of one or more electric locks and controlling circuits by means of...
49 CFR 236.765 - Locking, mechanical.
2010-10-01
... 49 Transportation 4 2010-10-01 2010-10-01 false Locking, mechanical. 236.765 Section 236.765 Transportation Other Regulations Relating to Transportation (Continued) FEDERAL RAILROAD ADMINISTRATION... Locking, mechanical. An arrangement of locking bars, dogs, tappets, cross locking and other apparatus by...
49 CFR 236.707 - Blade, semaphore.
2010-10-01
... 49 Transportation 4 2010-10-01 2010-10-01 false Blade, semaphore. 236.707 Section 236.707 Transportation Other Regulations Relating to Transportation (Continued) FEDERAL RAILROAD ADMINISTRATION... Blade, semaphore. The extended part of a semaphore arm which shows the position of the arm. ...
49 CFR 236.787 - Protection, cross.
2010-10-01
... 49 Transportation 4 2010-10-01 2010-10-01 false Protection, cross. 236.787 Section 236.787 Transportation Other Regulations Relating to Transportation (Continued) FEDERAL RAILROAD ADMINISTRATION... Protection, cross. An arrangement to prevent the improper operation of a signal, switch, movable-point frog...
49 CFR 236.804 - Signal, block.
2010-10-01
... 49 Transportation 4 2010-10-01 2010-10-01 false Signal, block. 236.804 Section 236.804 Transportation Other Regulations Relating to Transportation (Continued) FEDERAL RAILROAD ADMINISTRATION... Signal, block. A roadway signal operated either automatically or manually at the entrance to a block. ...
49 CFR 236.702 - Arm, semaphore.
2010-10-01
... 49 Transportation 4 2010-10-01 2010-10-01 false Arm, semaphore. 236.702 Section 236.702 Transportation Other Regulations Relating to Transportation (Continued) FEDERAL RAILROAD ADMINISTRATION..., semaphore. The part of a semaphore signal displaying an aspect. It consists of a blade fastened to a...
49 CFR 236.790 - Release, time.
2010-10-01
... 49 Transportation 4 2010-10-01 2010-10-01 false Release, time. 236.790 Section 236.790... Release, time. A device used to prevent the operation of an operative unit until after the expiration of a predetermined time interval after the device has been actuated. ...
49 CFR 236.791 - Release, value.
2010-10-01
... 49 Transportation 4 2010-10-01 2010-10-01 false Release, value. 236.791 Section 236.791 Transportation Other Regulations Relating to Transportation (Continued) FEDERAL RAILROAD ADMINISTRATION... Release, value. The electrical value at which the movable member of an electromagnetic device will move to...
46 CFR 169.236 - Inspection and testing required.
2010-10-01
... 46 Shipping 7 2010-10-01 2010-10-01 false Inspection and testing required. 169.236 Section 169.236... Inspection and Certification Repairs and Alterations § 169.236 Inspection and testing required. (a) The... involving riveting, welding, burning, or other fire-producing actions may be made— (1) Within or on the...
49 CFR 236.776 - Movement, trailing.
2010-10-01
... 49 Transportation 4 2010-10-01 2010-10-01 false Movement, trailing. 236.776 Section 236.776 Transportation Other Regulations Relating to Transportation (Continued) FEDERAL RAILROAD ADMINISTRATION... Movement, trailing. The movement of a train over the points of a switch which face in the direction in...
49 CFR 236.774 - Movement, facing.
2010-10-01
... 49 Transportation 4 2010-10-01 2010-10-01 false Movement, facing. 236.774 Section 236.774 Transportation Other Regulations Relating to Transportation (Continued) FEDERAL RAILROAD ADMINISTRATION... Movement, facing. The movement of a train over the points of a switch which face in a direction opposite to...
48 CFR 53.236-1 - Construction.
2010-10-01
... 48 Federal Acquisition Regulations System 2 2010-10-01 2010-10-01 false Construction. 53.236-1... AND FORMS FORMS Prescription of Forms 53.236-1 Construction. The following forms are prescribed, as stated below, for use in contracting for construction, alteration, or repair, or dismantling, demolition...
49 CFR 236.806 - Signal, home.
2010-10-01
... 49 Transportation 4 2010-10-01 2010-10-01 false Signal, home. 236.806 Section 236.806 Transportation Other Regulations Relating to Transportation (Continued) FEDERAL RAILROAD ADMINISTRATION... Signal, home. A roadway signal at the entrance to a route or block to govern trains in entering and using...
49 CFR 236.768 - Locking, time.
2010-10-01
... 49 Transportation 4 2010-10-01 2010-10-01 false Locking, time. 236.768 Section 236.768... Locking, time. A method of locking, either mechanical or electrical, which, after a signal has been caused to display an aspect to proceed, prevents, until after the expiration of a predetermined time...
28 CFR 2.36 - Rescission guidelines.
2010-07-01
... 28 Judicial Administration 1 2010-07-01 2010-07-01 false Rescission guidelines. 2.36 Section 2.36... guidelines. (a) The following guidelines shall apply to the sanctioning of disciplinary infractions or new... such period of confinement has resulted from initial parole to a detainer). These guidelines specify...
48 CFR 552.236-72 - Specialist.
2010-10-01
... 48 Federal Acquisition Regulations System 4 2010-10-01 2010-10-01 false Specialist. 552.236-72... FORMS SOLICITATION PROVISIONS AND CONTRACT CLAUSES Text of Provisions and Clauses 552.236-72 Specialist. As prescribed in 536.570-3, insert the following clause: Specialist (APR 1984) The term “Specialist...
2010-10-01
... 48 Federal Acquisition Regulations System 4 2010-10-01 2010-10-01 false Heat. 552.236-80 Section... SOLICITATION PROVISIONS AND CONTRACT CLAUSES Text of Provisions and Clauses 552.236-80 Heat. As prescribed in 536.570-11, insert the following clause: Heat (APR 1984) Unless otherwise specified or unless already...
49 CFR 236.757 - Lock, electric.
2010-10-01
... 49 Transportation 4 2010-10-01 2010-10-01 false Lock, electric. 236.757 Section 236.757... Lock, electric. A device to prevent or restrict the movement of a lever, a switch or a movable bridge, unless the locking member is withdrawn by an electrical device, such as an electromagnet, solenoid or...
48 CFR 853.236 - Construction and architect-engineer contracts.
2010-10-01
... 48 Federal Acquisition Regulations System 5 2010-10-01 2010-10-01 false Construction and architect-engineer contracts. 853.236 Section 853.236 Federal Acquisition Regulations System DEPARTMENT OF VETERANS AFFAIRS CLAUSES AND FORMS FORMS Prescription of Forms 853.236 Construction and architect-engineer...
48 CFR 52.236-6 - Superintendence by the Contractor.
2010-10-01
... Contractor. 52.236-6 Section 52.236-6 Federal Acquisition Regulations System FEDERAL ACQUISITION REGULATION....236-6 Superintendence by the Contractor. As prescribed in 36.506, insert the following clause: Superintendence by the Contractor (APR 1984) At all times during performance of this contract and until the work...
49 CFR 236.766 - Locking, movable bridge.
2010-10-01
... 49 Transportation 4 2010-10-01 2010-10-01 false Locking, movable bridge. 236.766 Section 236.766... Locking, movable bridge. The rail locks, bridge locks, bolt locks, circuit controllers, and electric locks used in providing interlocking protection at a movable bridge. ...
49 CFR 236.786 - Principle, closed circuit.
2010-10-01
... 49 Transportation 4 2010-10-01 2010-10-01 false Principle, closed circuit. 236.786 Section 236.786 Transportation Other Regulations Relating to Transportation (Continued) FEDERAL RAILROAD ADMINISTRATION... Principle, closed circuit. The principle of circuit design where a normally energized electric circuit which...
Excess of {sup 236}U in the northwest Mediterranean Sea
Energy Technology Data Exchange (ETDEWEB)
Chamizo, E., E-mail: echamizo@us.es [Centro Nacional de Aceleradores, Universidad de Sevilla, Consejo Superior de Investigaciones Científicas, Junta de Andalucía, Thomas Alva Edison 7, 41092 Seville (Spain); López-Lora, M., E-mail: mlopezlora@us.es [Centro Nacional de Aceleradores, Universidad de Sevilla, Consejo Superior de Investigaciones Científicas, Junta de Andalucía, Thomas Alva Edison 7, 41092 Seville (Spain); Bressac, M., E-mail: matthieu.bressac@utas.edu.au [IAEA-Environment Laboratories, Monte Carlo 98000 (Monaco); Institute for Marine and Antarctic Studies, University of Tasmania, Hobart, TAS (Australia); Levy, I., E-mail: I.N.Levy@iaea.org [IAEA-Environment Laboratories, Monte Carlo 98000 (Monaco); Pham, M.K., E-mail: M.Pham@iaea.org [IAEA-Environment Laboratories, Monte Carlo 98000 (Monaco)
2016-09-15
In this work, we present first {sup 236}U results in the northwestern Mediterranean. {sup 236}U is studied in a seawater column sampled at DYFAMED (Dynamics of Atmospheric Fluxes in the Mediterranean Sea) station (Ligurian Sea, 43°25′N, 07°52′E). The obtained {sup 236}U/{sup 238}U atom ratios in the dissolved phase, ranging from about 2 × 10{sup −9} at 100 m depth to about 1.5 × 10{sup −9} at 2350 m depth, indicate that anthropogenic {sup 236}U dominates the whole seawater column. The corresponding deep-water column inventory (12.6 ng/m{sup 2} or 32.1 × 10{sup 12} atoms/m{sup 2}) exceeds by a factor of 2.5 the expected one for global fallout at similar latitudes (5 ng/m{sup 2} or 13 × 10{sup 12} atoms/m{sup 2}), evidencing the influence of local or regional {sup 236}U sources in the western Mediterranean basin. On the other hand, the input of {sup 236}U associated to Saharan dust outbreaks is evaluated. An additional {sup 236}U annual deposition of about 0.2 pg/m{sup 2} based on the study of atmospheric particles collected in Monaco during different Saharan dust intrusions is estimated. The obtained results in the corresponding suspended solids collected at DYFAMED station indicate that about 64% of that {sup 236}U stays in solution in seawater. Overall, this source accounts for about 0.1% of the {sup 236}U inventory excess observed at DYFAMED station. The influence of the so-called Chernobyl fallout and the radioactive effluents produced by the different nuclear installations allocated to the Mediterranean basin, might explain the inventory gap, however, further studies are necessary to come to a conclusion about its origin. - Highlights: • First {sup 236}U results in the northwest Mediterranean Sea are reported. • Anthropogenic {sup 236}U dominates the whole seawater column at DYFAMED station. • {sup 236}U deep-water column inventory exceeds by a factor of 2.5 the global fallout one. • Saharan dust intrusions are responsible for an annual
49 CFR 236.810 - Spectacle, semaphore arm.
2010-10-01
... 49 Transportation 4 2010-10-01 2010-10-01 false Spectacle, semaphore arm. 236.810 Section 236.810 Transportation Other Regulations Relating to Transportation (Continued) FEDERAL RAILROAD ADMINISTRATION... Spectacle, semaphore arm. That part of a semaphore arm which holds the roundels and to which the blade is...
7 CFR 205.236 - Origin of livestock.
2010-01-01
... 7 Agriculture 3 2010-01-01 2010-01-01 false Origin of livestock. 205.236 Section 205.236... livestock. (a) Livestock products that are to be sold, labeled, or represented as organic must be from livestock under continuous organic management from the last third of gestation or hatching: Except, That: (1...
8 CFR 236.5 - Fingerprints and photographs.
2010-01-01
... 8 Aliens and Nationality 1 2010-01-01 2010-01-01 false Fingerprints and photographs. 236.5 Section... to Order of Removal § 236.5 Fingerprints and photographs. Every alien 14 years of age or older... photographs shall be made available to Federal, State, and local law enforcement agencies upon request to the...
27 CFR 24.236 - Losses of spirits.
2010-04-01
... 27 Alcohol, Tobacco Products and Firearms 1 2010-04-01 2010-04-01 false Losses of spirits. 24.236... OF THE TREASURY LIQUORS WINE Spirits § 24.236 Losses of spirits. Losses by theft or any other cause... the losses are discovered. A physical inventory of the spirits storage tanks will be taken at the...
48 CFR 952.236-71 - Inspection in architect-engineer contracts.
2010-10-01
... 48 Federal Acquisition Regulations System 5 2010-10-01 2010-10-01 false Inspection in architect-engineer contracts. 952.236-71 Section 952.236-71 Federal Acquisition Regulations System DEPARTMENT OF....236-71 Inspection in architect-engineer contracts. As prescribed at 936.609-3 insert the following...
49 CFR 236.527 - Roadway element insulation resistance.
2010-10-01
... 49 Transportation 4 2010-10-01 2010-10-01 false Roadway element insulation resistance. 236.527 Section 236.527 Transportation Other Regulations Relating to Transportation (Continued) FEDERAL RAILROAD... element insulation resistance. Insulation resistance between roadway inductor and ground shall be...
Anthropogenic 236U in Danish Seawater: Global Fallout versus Reprocessing Discharge.
Qiao, Jixin; Steier, Peter; Nielsen, Sven; Hou, Xiaolin; Roos, Per; Golser, Robin
2017-06-20
This work focuses on the occurrence of 236 U in seawater along Danish coasts, which is the sole water-exchange region between the North Sea-Atlantic Ocean and the Baltic Sea. Seawater collected in 2013 and 2014 were analyzed for 236 U (as well as 238 U and 137 Cs). Our results indicate that 236 U concentrations in Danish seawater are distributed within a relatively narrow range of (3.6-8.2) × 10 7 atom/L and, to a certain extent, independent of salinity. 236 U/ 238 U atomic ratios in Danish seawater are more than 4 times higher than the estimated global fallout value of 1× 10 -9 . The levels of 236 U/ 238 U atomic ratios obtained are comparable to those reported for the open North Sea and much higher than several other open oceans worldwide. This indicates that besides the global fallout input, the discharges from the two major European nuclear reprocessing plants are dominating sources of 236 U in Danish seawater. However, unexpectedly high 236 U/ 238 U ratios as well as high 236 U concentrations were observed at low-salinity locations of the Baltic Sea. While this feature might be interpreted as a clue for another significant 236 U input in the Baltic Sea, it may also be caused by the complexity of water currents or slow turnover rate.
29 CFR 1952.236 - Where the plan may be inspected.
2010-07-01
... and copied during normal business hours at the following locations: Office of State Programs... 29 Labor 9 2010-07-01 2010-07-01 false Where the plan may be inspected. 1952.236 Section 1952.236..., DEPARTMENT OF LABOR (CONTINUED) APPROVED STATE PLANS FOR ENFORCEMENT OF STATE STANDARDS Kentucky § 1952.236...
Excess of "2"3"6U in the northwest Mediterranean Sea
International Nuclear Information System (INIS)
Chamizo, E.; López-Lora, M.; Bressac, M.; Levy, I.; Pham, M.K.
2016-01-01
In this work, we present first "2"3"6U results in the northwestern Mediterranean. "2"3"6U is studied in a seawater column sampled at DYFAMED (Dynamics of Atmospheric Fluxes in the Mediterranean Sea) station (Ligurian Sea, 43°25′N, 07°52′E). The obtained "2"3"6U/"2"3"8U atom ratios in the dissolved phase, ranging from about 2 × 10"−"9 at 100 m depth to about 1.5 × 10"−"9 at 2350 m depth, indicate that anthropogenic "2"3"6U dominates the whole seawater column. The corresponding deep-water column inventory (12.6 ng/m"2 or 32.1 × 10"1"2 atoms/m"2) exceeds by a factor of 2.5 the expected one for global fallout at similar latitudes (5 ng/m"2 or 13 × 10"1"2 atoms/m"2), evidencing the influence of local or regional "2"3"6U sources in the western Mediterranean basin. On the other hand, the input of "2"3"6U associated to Saharan dust outbreaks is evaluated. An additional "2"3"6U annual deposition of about 0.2 pg/m"2 based on the study of atmospheric particles collected in Monaco during different Saharan dust intrusions is estimated. The obtained results in the corresponding suspended solids collected at DYFAMED station indicate that about 64% of that "2"3"6U stays in solution in seawater. Overall, this source accounts for about 0.1% of the "2"3"6U inventory excess observed at DYFAMED station. The influence of the so-called Chernobyl fallout and the radioactive effluents produced by the different nuclear installations allocated to the Mediterranean basin, might explain the inventory gap, however, further studies are necessary to come to a conclusion about its origin. - Highlights: • First "2"3"6U results in the northwest Mediterranean Sea are reported. • Anthropogenic "2"3"6U dominates the whole seawater column at DYFAMED station. • "2"3"6U deep-water column inventory exceeds by a factor of 2.5 the global fallout one. • Saharan dust intrusions are responsible for an annual "2"3"6U flux of 0.02 pg/m"2. • Further studies are necessary to explain the
49 CFR Appendix A to Part 236 - Civil Penalties 1
2010-10-01
... 1,000 2,000 236.329Bolt lock 1,000 2,000 236.330Locking dog of switch and lock movement 1,000 2,000....338Mechanical locking required in accordance with locking sheet and dog chart 1,000 2,000 236.339Mechanical... next available point of communication after automatic train stop, train control, or cab signal device...
48 CFR 53.236 - Construction and architect-engineer contracts.
2010-10-01
... 48 Federal Acquisition Regulations System 2 2010-10-01 2010-10-01 false Construction and architect-engineer contracts. 53.236 Section 53.236 Federal Acquisition Regulations System FEDERAL ACQUISITION...-engineer contracts. ...
49 CFR 236.813a - State, most restrictive.
2010-10-01
... 49 Transportation 4 2010-10-01 2010-10-01 false State, most restrictive. 236.813a Section 236.813a Transportation Other Regulations Relating to Transportation (Continued) FEDERAL RAILROAD ADMINISTRATION... State, most restrictive. The mode of an electric or electronic device that is equivalent to a track...
49 CFR 236.825 - System, automatic train control.
2010-10-01
... 49 Transportation 4 2010-10-01 2010-10-01 false System, automatic train control. 236.825 Section..., INSPECTION, MAINTENANCE, AND REPAIR OF SIGNAL AND TRAIN CONTROL SYSTEMS, DEVICES, AND APPLIANCES Definitions § 236.825 System, automatic train control. A system so arranged that its operation will automatically...
49 CFR 236.1033 - Communications and security requirements.
2010-10-01
... Train Control Systems § 236.1033 Communications and security requirements. (a) All wireless... 49 Transportation 4 2010-10-01 2010-10-01 false Communications and security requirements. 236.1033... exceeding the security strength required to protect the data as defined in the railroad's PTCSP and required...
7 CFR 58.236 - Pasteurization and heat treatment.
2010-01-01
... 7 Agriculture 3 2010-01-01 2010-01-01 false Pasteurization and heat treatment. 58.236 Section 58... Service 1 Operations and Operating Procedures § 58.236 Pasteurization and heat treatment. All milk and... is handled according to sanitary conditions approved by the Administrator. (a) Pasteurization. (1...
48 CFR 452.236-74 - Control of Erosion, Sedimentation, and Pollution.
2010-10-01
..., Sedimentation, and Pollution. 452.236-74 Section 452.236-74 Federal Acquisition Regulations System DEPARTMENT OF....236-74 Control of Erosion, Sedimentation, and Pollution. As prescribed in 436.574, insert the following clause: Control of Erosion, Sedimentation, and Pollution (NOV 1996) (a) Operations shall be...
48 CFR 236.602 - Selection of firms for architect-engineer contracts.
2010-10-01
... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Selection of firms for architect-engineer contracts. 236.602 Section 236.602 Federal Acquisition Regulations System DEFENSE... ARCHITECT-ENGINEER CONTRACTS Architect-Engineer Services 236.602 Selection of firms for architect-engineer...
48 CFR 952.236 - Construction and architect-engineer contracts.
2010-10-01
... 48 Federal Acquisition Regulations System 5 2010-10-01 2010-10-01 false Construction and architect-engineer contracts. 952.236 Section 952.236 Federal Acquisition Regulations System DEPARTMENT OF ENERGY... Construction and architect-engineer contracts. ...
48 CFR 52.236-23 - Responsibility of the Architect-Engineer Contractor.
2010-10-01
... Architect-Engineer Contractor. 52.236-23 Section 52.236-23 Federal Acquisition Regulations System FEDERAL... Provisions and Clauses 52.236-23 Responsibility of the Architect-Engineer Contractor. As prescribed in 36.609-2(b), insert the following clause: Responsibility of the Architect-Engineer Contractor (APR 1984) (a...
7 CFR 2.36 - Director, Office of Communications.
2010-01-01
... are made by the Secretary of Agriculture to Director, Office of Communications: (1) Related to public...) Organize and direct the activities of a public affairs office to include press relations of the secretary... 7 Agriculture 1 2010-01-01 2010-01-01 false Director, Office of Communications. 2.36 Section 2.36...
49 CFR 236.18 - Software management control plan.
2010-10-01
... 49 Transportation 4 2010-10-01 2010-10-01 false Software management control plan. 236.18 Section... Instructions: All Systems General § 236.18 Software management control plan. (a) Within 6 months of June 6, 2005, each railroad shall develop and adopt a software management control plan for its signal and train...
48 CFR 52.236-24 - Work Oversight in Architect-Engineer Contracts.
2010-10-01
... Architect-Engineer Contracts. 52.236-24 Section 52.236-24 Federal Acquisition Regulations System FEDERAL... Provisions and Clauses 52.236-24 Work Oversight in Architect-Engineer Contracts. As prescribed in 36.609-3, insert the following clause: Work Oversight in Architect-Engineer Contracts (APR 1984) The extent and...
Mass and abundance 236U sensitivities at CIRCE
De Cesare, M.; De Cesare, N.; D'Onofrio, A.; Fifield, L. K.; Gialanella, L.; Terrasi, F.
2015-10-01
The actinides (e.g. 236U and xPu isotopes) are present in environmental samples at the ultra trace level since atmospheric tests of NWs (Nuclear Weapons) performed in the past, deliberate dumping of nuclear waste, nuclear fuel reprocessing, on a large scale and operation of NPPs (Nuclear Power Plants) on a small scale have led to the release of a wide range of radioactive nuclides in the environment. Their detection requires the most sensitive AMS (Accelerator Mass Spectrometry) techniques and at the Center for Isotopic Research on Cultural and Environmental heritage (CIRCE) in Caserta, Italy, an upgraded actinide AMS system, based on a 3-MV pelletron tandem accelerator, has been operated. In this paper the progress made in order to push the 236U mass sensitivity and 236U/238U isotopic ratio down to the natural levels is reported. A uranium contamination mass of about 0.05 μg and a 236U/238U isotopic ratio sensitivities at the level of 3.2 × 10-13 are presently achievable.
49 CFR 236.330 - Locking dog of switch-and-lock movement.
2010-10-01
... 49 Transportation 4 2010-10-01 2010-10-01 false Locking dog of switch-and-lock movement. 236.330 Section 236.330 Transportation Other Regulations Relating to Transportation (Continued) FEDERAL RAILROAD... Rules and Instructions § 236.330 Locking dog of switch-and-lock movement. Locking dog of switch-and-lock...
8 CFR 236.2 - Confined aliens, incompetents, and minors.
2010-01-01
... 8 Aliens and Nationality 1 2010-01-01 2010-01-01 false Confined aliens, incompetents, and minors. 236.2 Section 236.2 Aliens and Nationality DEPARTMENT OF HOMELAND SECURITY IMMIGRATION REGULATIONS APPREHENSION AND DETENTION OF INADMISSIBLE AND DEPORTABLE ALIENS; REMOVAL OF ALIENS ORDERED REMOVED Detention...
Natural and anthropogenic {sup 236}U in environmental samples
Energy Technology Data Exchange (ETDEWEB)
Steier, Peter [VERA Laboratory, Fakultaet fuer Physik - Isotopenforschung, Universitaet Wien, Waehringer Strasse 17, A-1090 Wien (Austria)], E-mail: peter.steier@univie.ac.at; Bichler, Max [Atominstitut der Osterreichischen Universitaeten, Technische Universitaet Wien, Stadionallee 2, Wien A-1020 (Austria); Keith Fifield, L. [Department of Nuclear Physics, RSPhysSE, Australian National University, Canberra, ACT 0200 (Australia); Golser, Robin; Kutschera, Walter; Priller, Alfred [VERA Laboratory, Fakultaet fuer Physik - Isotopenforschung, Universitaet Wien, Waehringer Strasse 17, A-1090 Wien (Austria); Quinto, Francesca [Dipartimento di Scienze Ambientali, Seconda Universita di Napoli, via Vivaldi 43, Caserta 81100 (Italy); Richter, Stephan [Euopean Commission, Directorate-General Joint Research Centre, Institute for Reference Materials and Measurements (IRMM), Retieseweg 111, B-2440 Geel (Belgium); Srncik, Michaela [Institut fuer Anorganische Chemie, Universitaet Wien, Waehringer Strasse 42, A-1090 Wien (Austria); Terrasi, Philippo [Dipartimento di Scienze Ambientali, Seconda Universita di Napoli, via Vivaldi 43, Caserta 81100 (Italy); Wacker, Lukas [Institute for Particle Physics, HPK H25, Schafmattstrasse 20, CH-8093 Zuerich (Switzerland); Wallner, Anton [VERA Laboratory, Fakultaet fuer Physik - Isotopenforschung, Universitaet Wien, Waehringer Strasse 17, A-1090 Wien (Austria); Wallner, Gabriele [Institut fuer Anorganische Chemie, Universitaet Wien, Waehringer Strasse 42, A-1090 Wien (Austria); Wilcken, Klaus M. [Scottish Universities Environmental Research Centre, Scottish Enterprise Technology Park, East Kilbride G75 OQF (United Kingdom); Maria Wild, Eva [VERA Laboratory, Fakultaet fuer Physik - Isotopenforschung, Universitaet Wien, Waehringer Strasse 17, A-1090 Wien (Austria)
2008-05-15
The interaction of thermal neutrons with {sup 235}U results in fission with a probability of {approx}85% and in the formation of {sup 236}U (t{sub 1/2} = 2.3 x 10{sup 7} yr) with a probability of {approx}15%. While anthropogenic {sup 236}U is, therefore, present in spent nuclear fuel at levels of {sup 236}U/U up to 10{sup -2}, the expected natural ratios in the pre-anthropogenic environment range from 10{sup -14} to 10{sup -10}. At VERA, systematic investigations suggest a detection limit below {sup 236}U/U = 5 x 10{sup -12} for samples of 0.5 mg U, while chemistry blanks of {approx}2 x 10{sup 7} atoms {sup 236}U per sample limit the sensitivity for smaller samples. We have found natural isotopic ratios in uranium reagents separated before the onset of human nuclear activities, in uranium ores from various origins and in water from a subsurface well in Bad Gastein, Austria. Anthropogenic contamination was clearly visible in soil and rivulet samples from Salzburg, Austria, whereas river sediments from Garigliano river (Southern Italy) were close to the detection limit. Finally, our natural in-house standard Vienna-KkU was calibrated against a certified reference material (IRMM REIMEP-18 A)
Anthropogenic 236U in Danish Seawater: Global Fallout versus Reprocessing Discharge
DEFF Research Database (Denmark)
Qiao, Jixin; Steier, Peter; Nielsen, Sven Poul
2017-01-01
This work focuses on the occurrence of 236U in seawater along Danish coasts, which is the sole water-exchange region between the North Sea-Atlantic Ocean and the Baltic Sea. Seawater collected in 2013 and 2014 were analyzed for 236U (as well as 238U and 137Cs). Our results indicate that 236U...... seawater. However, unexpectedly high 236U/238U ratios as well as high 236U concentrations were observed at low-salinity locations of the Baltic Sea. While this feature might be interpreted as a clue for another significant 236U input in the Baltic Sea, it may also be caused by the complexity of water...... currents or slow turnover rate....
49 CFR 236.1043 - Task analysis and basic requirements.
2010-10-01
... Train Control Systems § 236.1043 Task analysis and basic requirements. (a) Training structure and... classroom, simulator, computer-based, hands-on, or other formally structured training designed to impart the... 49 Transportation 4 2010-10-01 2010-10-01 false Task analysis and basic requirements. 236.1043...
49 CFR 236.923 - Task analysis and basic requirements.
2010-10-01
... for Processor-Based Signal and Train Control Systems § 236.923 Task analysis and basic requirements... structured training designed to impart the knowledge, skills, and abilities identified as necessary to... 49 Transportation 4 2010-10-01 2010-10-01 false Task analysis and basic requirements. 236.923...
49 CFR 236.102 - Semaphore or searchlight signal mechanism.
2010-10-01
... 49 Transportation 4 2010-10-01 2010-10-01 false Semaphore or searchlight signal mechanism. 236.102... Instructions: All Systems Inspections and Tests; All Systems § 236.102 Semaphore or searchlight signal mechanism. (a) Semaphore signal mechanism shall be inspected at least once every six months, and tests of...
Energy Technology Data Exchange (ETDEWEB)
Winkler, Stephan; Steier, Peter [University of Vienna, Faculty of Physics, Vienna (Austria); Carilli, Jessica [Australian Nuclear Science and Technology Organisation, Lucas Heights (Australia)
2012-07-01
Since uranium is known to behave conservatively in ocean waters, 236-U has great potential in application as oceanic tracer. 236-U (t1/2=23.4 Ma) was introduced into the oceans by atmospheric nuclear weapon testing with amount estimates ranging from 700 kg to 1500 kg. Thus a resulting initial average 236-U/238-U ratio of at least 5e-9 is expected for an oceanic mixed layer depth of 100 m. This ratio is already higher than the natural pre-nuclear background, which is expected to be at 10e-14 levels. Even the elevated ratios of global stratospheric fall-out are beyond the capabilities of ICPMS and TIMS methods. However, the exceptional sensitivity and ultra-low background for 236-U of the Vienna Environmental Research Accelerator's Accelerator Mass Spectrometry system allows us to measure down to 10-13 detection limits. We present a year-by-year record of 236-U/238-U for a Caribbean coral core covering years 1944 to 2006, thus allowing to us put constraints on the oceanic input of 236-U by atmospheric testing. Moreover modeling of the results also demonstrates the capabilities of 236-U as oceanic tracer.
Energy Technology Data Exchange (ETDEWEB)
Christl, Marcus, E-mail: mchristl@ethz.ch [Laboratory of Ion Beam Physics, ETH Zurich, 8093 Zurich (Switzerland); Casacuberta, Nuria; Lachner, Johannes; Maxeiner, Sascha; Vockenhuber, Christof; Synal, Hans-Arno [Laboratory of Ion Beam Physics, ETH Zurich, 8093 Zurich (Switzerland); Goroncy, Ingo; Herrmann, Jürgen [Bundesamt für Seeschifffahrt und Hydrographie, Hamburg (Germany); Daraoui, Abdelouahed; Walther, Clemens; Michel, Rolf [Institut für Radioökologie und Strahlenschutz, Leibniz Universität Hannover (Germany)
2015-10-15
Compact, low energy accelerator mass spectrometry (AMS) has evolved over the past years as one of the most sensitive, selective, and robust techniques for the analysis of heavy and long lived radionuclides. In this study, we will first focus on the analytical capabilities of the compact AMS system TANDY, mainly for {sup 236}U analyses, and then present a new dual tracer approach, that combines {sup 129}I and {sup 236}U. The measured {sup 129}I/{sup 236}U ratios of samples collected in the North Sea in 2009 are in reasonable agreement with the expectations from documented or estimated releases from the two major nuclear reprocessing plants located at Sellafield (GB) and La Hague (F), suggesting that the {sup 129}I/{sup 236}U ratio can be used as a water mass tag in the North Atlantic region. However, our results indicate that, in contrast to {sup 129}I, additional contributions of bomb produced {sup 236}U cannot be neglected in the North Sea region. This complicates the simple and straight forward use of the {sup 129}I/{sup 236}U ratio as a quantitative tool for the calculation of transport times of North Sea water in the Arctic Ocean.
Lifescience Database Archive (English)
Full Text Available SF (Link to library) SFH236 (Link to dictyBase) - G00315 DDB0191340 Contig-U16349-1...brary) Clone ID SFH236 (Link to dictyBase) Atlas ID - NBRP ID G00315 dictyBase ID DDB0191340 Link to Contig ...Contig-U16349-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/SF/SFH2-...VDCVTNSSDASCTNFQYPLANITADINNL CGSMPYMPVCTIQQSCNQESSTSGICDPFSILGDSCLHDMPGMSG--- ---ASGSVVEQCSSVDSISNLPTTMQLFAGIKSICT...ii yvvaclicqfvpfnnhviknpqqvvfvihsqflvivvfticqa*vv--- ---ASGSVVEQCSSVDSISNLPTTMQLFAGIKSICTEMAMDGCEKCSGNSPTTTC
Mass and abundance {sup 236}U sensitivities at CIRCE
Energy Technology Data Exchange (ETDEWEB)
De Cesare, M., E-mail: m.decesare@cira.it [Department of Nuclear Physics, Research School of Physics and Engineering, Australian National University, ACT 0200 Canberra (Australia); CIRCE and Dipartimento di Matematica e Fisica, Seconda Universitá di Napoli, via Vivaldi 43, 81100 Caserta (Italy); De Cesare, N.; D’Onofrio, A. [CIRCE and Dipartimento di Matematica e Fisica, Seconda Universitá di Napoli, via Vivaldi 43, 81100 Caserta (Italy); INFN Sezione di Napoli, via Cintia, Edificio G, 80126 Napoli (Italy); Fifield, L.K. [Department of Nuclear Physics, Research School of Physics and Engineering, Australian National University, ACT 0200 Canberra (Australia); Gialanella, L.; Terrasi, F. [CIRCE and Dipartimento di Matematica e Fisica, Seconda Universitá di Napoli, via Vivaldi 43, 81100 Caserta (Italy); INFN Sezione di Napoli, via Cintia, Edificio G, 80126 Napoli (Italy)
2015-10-15
The actinides (e.g. {sup 236}U and {sup x}Pu isotopes) are present in environmental samples at the ultra trace level since atmospheric tests of NWs (Nuclear Weapons) performed in the past, deliberate dumping of nuclear waste, nuclear fuel reprocessing, on a large scale and operation of NPPs (Nuclear Power Plants) on a small scale have led to the release of a wide range of radioactive nuclides in the environment. Their detection requires the most sensitive AMS (Accelerator Mass Spectrometry) techniques and at the Center for Isotopic Research on Cultural and Environmental heritage (CIRCE) in Caserta, Italy, an upgraded actinide AMS system, based on a 3-MV pelletron tandem accelerator, has been operated. In this paper the progress made in order to push the {sup 236}U mass sensitivity and {sup 236}U/{sup 238}U isotopic ratio down to the natural levels is reported. A uranium contamination mass of about 0.05 μg and a {sup 236}U/{sup 238}U isotopic ratio sensitivities at the level of 3.2 × 10{sup −13} are presently achievable.
49 CFR 236.312 - Movable bridge, interlocking of signal appliances with bridge devices.
2010-10-01
... 49 Transportation 4 2010-10-01 2010-10-01 false Movable bridge, interlocking of signal appliances with bridge devices. 236.312 Section 236.312 Transportation Other Regulations Relating to... SYSTEMS, DEVICES, AND APPLIANCES Interlocking Standards § 236.312 Movable bridge, interlocking of signal...
Uranium-236 in light water reactor spent fuel recycled to an enriching plant
International Nuclear Information System (INIS)
de la Garza, A.
1977-01-01
The introduction of 236 U to an enriching plant by recycling spent fuel uranium results in enriched products containing 236 U, a parasitic neutron absorber in reactor fuel. Convenient approximate methodology determines 235 236 U, and total uranium flowsheets with associated separative work requirements in enriching plant operations for use by investigators of the light water reactor fuel cycle not having recourse to specialized multicomponent cascade technology. Application of the methodology has been made to compensation of an enriching plant product for 236 U content and to the value at an enriching plant of spent fuel uranium. The approximate methodology was also confirmed with more exact calculations and with some experience with 236 U in an enriching plant
Srncik, M; Tims, S G; De Cesare, M; Fifield, L K
2014-06-01
The variation of the (236)U and (239)Pu concentrations as a function of depth has been studied in a soil profile at a site in the Southern Hemisphere well removed from nuclear weapon test sites. Total inventories of (236)U and (239)Pu as well as the (236)U/(239)Pu isotopic ratio were derived. For this investigation a soil core from an undisturbed forest area in the Herbert River catchment (17°30' - 19°S) which is located in north-eastern Queensland (Australia) was chosen. The chemical separation of U and Pu was carried out with a double column which has the advantage of the extraction of both elements from a relatively large soil sample (∼20 g) within a day. The samples were measured by Accelerator Mass Spectrometry using the 14UD pelletron accelerator at the Australian National University. The highest atom concentrations of both (236)U and (239)Pu were found at a depth of 2-3 cm. The (236)U/(239)Pu isotopic ratio in fallout at this site, as deduced from the ratio of the (236)U and (239)Pu inventories, is 0.085 ± 0.003 which is clearly lower than the Northern Hemisphere value of ∼0.2. The (236)U inventory of (8.4 ± 0.3) × 10(11) at/m(2) was more than an order of magnitude lower than values reported for the Northern Hemisphere. The (239)Pu activity concentrations are in excellent agreement with a previous study and the (239+240)Pu inventory was (13.85 ± 0.29) Bq/m(2). The weighted mean (240)Pu/(239)Pu isotopic ratio of 0.142 ± 0.005 is slightly lower than the value for global fallout, but our results are consistent with the average ratio of 0.173 ± 0.027 for the southern equatorial region (0-30°S). Copyright © 2014 Elsevier Ltd. All rights reserved.
49 CFR 236.16 - Electric lock, main track releasing circuit.
2010-10-01
... 49 Transportation 4 2010-10-01 2010-10-01 false Electric lock, main track releasing circuit. 236... Rules and Instructions: All Systems General § 236.16 Electric lock, main track releasing circuit. When an electric lock releasing circuit is provided on the main track to permit a train or an engine to...
Resolved resonance parameters for 236Np
International Nuclear Information System (INIS)
Morogovskij, G.B.; Bakhanovich, L.A.
2002-01-01
Multilevel Breit-Wigner parameters were obtained for fission cross-section representation in the 0.01-33 eV energy region from evaluation of a 236 Np experimental fission cross-section in the resolved resonance region. (author)
24 CFR 236.755 - Housing owner's obligation under contract to report tenant income increase.
2010-04-01
... FOR RENTAL PROJECTS Rental Assistance Payments § 236.755 Housing owner's obligation under contract to... 24 Housing and Urban Development 2 2010-04-01 2010-04-01 false Housing owner's obligation under contract to report tenant income increase. 236.755 Section 236.755 Housing and Urban Development...
24 CFR 236.252 - First, second, and third mortgage insurance premiums.
2010-04-01
... insurance premiums. 236.252 Section 236.252 Housing and Urban Development Regulations Relating to Housing... insurance premiums. All of the provisions of § 207.252 of this chapter governing the first, second, and third mortgage insurance premiums shall apply to mortgages insured under this subpart, except: (a) Where...
48 CFR 236.604 - Performance evaluation.
2010-10-01
... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Performance evaluation... Architect-Engineer Services 236.604 Performance evaluation. (a) Preparation of performance reports. Use DD Form 2631, Performance Evaluation (Architect-Engineer), instead of SF 1421. (2) Prepare a separate...
49 CFR 236.74 - Protection of insulated wire; splice in underground wire.
2010-10-01
... underground wire. 236.74 Section 236.74 Transportation Other Regulations Relating to Transportation (Continued) FEDERAL RAILROAD ADMINISTRATION, DEPARTMENT OF TRANSPORTATION RULES, STANDARDS, AND INSTRUCTIONS GOVERNING... wire; splice in underground wire. Insulated wire shall be protected from mechanical injury. The...
International Nuclear Information System (INIS)
Sakaguchi, Aya; Eto, Asuka; Takahashi, Yoshio; Steier, Peter; Yamazaki, Atsuko; Watanabe, Tsuyoshi; Sasaki, Keiichi; Yamano, Hiroya
2013-01-01
Historical 236 U/ 238 U atom ratio and concentration of 236 U were determined by Accelerator Mass Spectrometry (AMS) in skeletons of dated modern coral core sample collected from Majuro atoll, equatorial Pacific, to reconstruct anthropogenic 236 U inputs to the Equatorial Pacific. The maximum hydrogen bomb-pulses of 236 U/ 238 U and 236 U concentration, 2.83x10 -9 and 1.85x10 7 atom/g, in an annually resolved coral core were captured in 1954 (Operation Castle at Bikini and Enewetok atolls). The values were abruptly decreased in a few years, and they have been gradually decreased over time. Our results allow studies of not only the present distribution pattern, but gives access to the temporal evolution of 236 U in surface seawater of North Equatorial Current which is introduced to the Japan Sea and the North West Pacific Ocean as Kuroshio and Tsushima currents over the past decades. (author)
33 CFR 2.36 - Navigable waters of the United States, navigable waters, and territorial waters.
2010-07-01
... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Navigable waters of the United States, navigable waters, and territorial waters. 2.36 Section 2.36 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY GENERAL JURISDICTION Jurisdictional Terms § 2.36 Navigable waters...
Phenotype abnormality: 236 [Arabidopsis Phenome Database[Archive
Lifescience Database Archive (English)
Full Text Available 236 http://metadb.riken.jp/db/SciNetS_ria224i/cria224u1ria224u742i decreased susceptibility... in response to organism Agrobacterium ... Agrobacterium ... decreased susceptibility toward ...
Reference: 236 [Arabidopsis Phenome Database[Archive
Lifescience Database Archive (English)
Full Text Available 236 http://metadb.riken.jp/db/SciNetS_ria224i/cria224u4ria224u15992545i Dharmasiri...5 Jul Developmental cell Dharmasiri Nihal|Dharmasiri Sunethra|Ehrismann Jasmin S|Estelle Mark|Hobbie Lawrence|J端rgens Gerd|Lechner Esther|Weijers Dolf|Yamada Masashi
Chronology of Pu isotopes and 236U in an Arctic ice core.
Wendel, C C; Oughton, D H; Lind, O C; Skipperud, L; Fifield, L K; Isaksson, E; Tims, S G; Salbu, B
2013-09-01
In the present work, state of the art isotopic fingerprinting techniques are applied to an Arctic ice core in order to quantify deposition of U and Pu, and to identify possible tropospheric transport of debris from former Soviet Union test sites Semipalatinsk (Central Asia) and Novaya Zemlya (Arctic Ocean). An ice core chronology of (236)U, (239)Pu, and (240)Pu concentrations, and atom ratios, measured by accelerator mass spectrometry in a 28.6m deep ice core from the Austfonna glacier at Nordaustlandet, Svalbard is presented. The ice core chronology corresponds to the period 1949 to 1999. The main sources of Pu and (236)U contamination in the Arctic were the atmospheric nuclear detonations in the period 1945 to 1980, as global fallout, and tropospheric fallout from the former Soviet Union test sites Novaya Zemlya and Semipalatinsk. Activity concentrations of (239+240)Pu ranged from 0.008 to 0.254 mBq cm(-2) and (236)U from 0.0039 to 0.053 μBq cm(-2). Concentrations varied in concordance with (137)Cs concentrations in the same ice core. In contrast to previous published results, the concentrations of Pu and (236)U were found to be higher at depths corresponding to the pre-moratorium period (1949 to 1959) than to the post-moratorium period (1961 and 1962). The (240)Pu/(239)Pu ratio ranged from 0.15 to 0.19, and (236)U/(239)Pu ranged from 0.18 to 1.4. The Pu atom ratios ranged within the limits of global fallout in the most intensive period of nuclear atmospheric testing (1952 to 1962). To the best knowledge of the authors the present work is the first publication on biogeochemical cycles with respect to (236)U concentrations and (236)U/(239)Pu atom ratios in the Arctic and in ice cores. Copyright © 2013 Elsevier B.V. All rights reserved.
2010-10-01
... TRAIN CONTROL SYSTEMS, DEVICES, AND APPLIANCES Traffic Control Systems Standards § 236.401 Automatic... 49 Transportation 4 2010-10-01 2010-10-01 false Automatic block signal system and interlocking standards applicable to traffic control systems. 236.401 Section 236.401 Transportation Other Regulations...
Plutonium-236 traces determination in plutonium-238 by α spectrometry
International Nuclear Information System (INIS)
Acena, M.L.; Pottier, R.; Berger, R.
1969-01-01
Two methods are described in this report for the determination of plutonium-236 traces in plutonium-238 by a spectrometry using semi-conductor detectors. The first method involves a direct comparison of the areas under the peaks of the α spectra of plutonium-236 and plutonium-238. The electrolytic preparation of the sources is carried out after preliminary purification of the plutonium. The second method makes it possible to determine the 236 Pu/ 238 Pu ratio by comparing the areas of the α peaks of uranium-232 and uranium-234, which are the decay products of the two plutonium isotopes respectively. The uranium in the source, also deposited by electrolysis, is separated from a 1 mg amount of plutonium either by a T.L.A. extraction, or by the use of ion-exchange resins. The report ends with a discussion of the results obtained with plutonium of two different origins. (authors) [fr
48 CFR 852.236-89 - Buy American Act.
2010-10-01
... contained in this clause 852.236-89 are waived for World Trade Organization (WTO) Government Procurement... not anticipate accepting an offer that includes foreign construction material, other than WTO GPA...
48 CFR 52.236-13 - Accident Prevention.
2010-10-01
... 48 Federal Acquisition Regulations System 2 2010-10-01 2010-10-01 false Accident Prevention. 52....236-13 Accident Prevention. As prescribed in 36.513, insert the following clause: Accident Prevention... contracts for construction or dismantling, demolition, or removal of improvements, the Contractor shall— (1...
48 CFR 852.236-82 - Payments under fixed-price construction contracts (without NAS).
2010-10-01
... manner; or (iv) Failure to comply in good faith with approved subcontracting plans, certifications, or... under other provisions of the contract or in accordance with the general law and regulations regarding... construction contracts (without NAS). 852.236-82 Section 852.236-82 Federal Acquisition Regulations System...
Chronology of Pu isotopes and {sup 236}U in an Arctic ice core
Energy Technology Data Exchange (ETDEWEB)
Wendel, C.C., E-mail: cato.wendel@umb.no [Isotope Laboratory, Department of Plant and Environmental Sciences, Agricultural University of Norway, P.O. Box 5003, N-1432 Aas (Norway); Oughton, D.H., E-mail: deborah.oughton@umb.no [Isotope Laboratory, Department of Plant and Environmental Sciences, Agricultural University of Norway, P.O. Box 5003, N-1432 Aas (Norway); Lind, O.C., E-mail: ole-christian.lind@umb.no [Isotope Laboratory, Department of Plant and Environmental Sciences, Agricultural University of Norway, P.O. Box 5003, N-1432 Aas (Norway); Skipperud, L., E-mail: lindis.skipperud@umb.no [Isotope Laboratory, Department of Plant and Environmental Sciences, Agricultural University of Norway, P.O. Box 5003, N-1432 Aas (Norway); Fifield, L.K., E-mail: keith.fifield@anu.edu.au [Department of Nuclear Physics, Australian National University, Canberra ACT 0200 (Australia); Isaksson, E., E-mail: elisabeth.isaksson@npolar.no [Norwegian Polar Institute, Fram Centre, Hjalmar Johansens Gate 14, N9296 Tromsø (Norway); Tims, S.G., E-mail: steve.tims@anu.edu.au [Department of Nuclear Physics, Australian National University, Canberra ACT 0200 (Australia); Salbu, B., E-mail: brit.salbu@umb.no [Isotope Laboratory, Department of Plant and Environmental Sciences, Agricultural University of Norway, P.O. Box 5003, N-1432 Aas (Norway)
2013-09-01
In the present work, state of the art isotopic fingerprinting techniques are applied to an Arctic ice core in order to quantify deposition of U and Pu, and to identify possible tropospheric transport of debris from former Soviet Union test sites Semipalatinsk (Central Asia) and Novaya Zemlya (Arctic Ocean). An ice core chronology of {sup 236}U, {sup 239}Pu, and {sup 240}Pu concentrations, and atom ratios, measured by accelerator mass spectrometry in a 28.6 m deep ice core from the Austfonna glacier at Nordaustlandet, Svalbard is presented. The ice core chronology corresponds to the period 1949 to 1999. The main sources of Pu and {sup 236}U contamination in the Arctic were the atmospheric nuclear detonations in the period 1945 to 1980, as global fallout, and tropospheric fallout from the former Soviet Union test sites Novaya Zemlya and Semipalatinsk. Activity concentrations of {sup 239+240}Pu ranged from 0.008 to 0.254 mBq cm{sup −2} and {sup 236}U from 0.0039 to 0.053 μBq cm{sup −2}. Concentrations varied in concordance with {sup 137}Cs concentrations in the same ice core. In contrast to previous published results, the concentrations of Pu and {sup 236}U were found to be higher at depths corresponding to the pre-moratorium period (1949 to 1959) than to the post-moratorium period (1961 and 1962). The {sup 240}Pu/{sup 239}Pu ratio ranged from 0.15 to 0.19, and {sup 236}U/{sup 239}Pu ranged from 0.18 to 1.4. The Pu atom ratios ranged within the limits of global fallout in the most intensive period of nuclear atmospheric testing (1952 to 1962). To the best knowledge of the authors the present work is the first publication on biogeochemical cycles with respect to {sup 236}U concentrations and {sup 236}U/{sup 239}Pu atom ratios in the Arctic and in ice cores. - Highlights: • Concentrations and atom ratios of Pu and {sup 236}U determined in an Arctic ice core. • Concentrations of U and Pu found to be higher pre- than post-moratorium. • U and Pu concentrations
Energy Technology Data Exchange (ETDEWEB)
Lindner, M.; Dupzyk, R.J.; Hoff, R.W.; Nagle, R.J. (California Univ., Livermore (USA). Lawrence Livermore National Lab.)
1981-01-01
The half-life of long-lived /sup 236/Np, due to ..cap alpha.., ..beta.. and electron-capture decay, was found to be 1.55 x 10/sup 5/ yr. Of all decays, 88% populate excited states in /sup 236/U and 12% populate levels in /sup 236/Pu. Lifetimes measured by growth of the ground states of /sup 236/U and /sup 236/Pu agree with values from corresponding ..gamma.. de-excitations in these daughter nuclei. Therefore, nearly all the electron-capture decays populate the 6/sup +/ level of the ground-state band in /sup 236/U. Similarly, essentially all the ..beta../sup -/ decay populates an analogous 6/sup +/ level in /sup 236/Pu, which de-excites through a previously unreported transition of 158.3 keV. If a very week ..gamma..-ray at 894 keV can be ascribed to a level in /sup 232/U populated by ..beta.. decay of /sup 232/Pa, its existence establishes a 0.2% ..cap alpha..-branching decay in /sup 236/Np.
48 CFR 853.236-70 - VA Form 10-6298, Architect-Engineer Fee Proposal.
2010-10-01
... 48 Federal Acquisition Regulations System 5 2010-10-01 2010-10-01 false VA Form 10-6298, Architect-Engineer Fee Proposal. 853.236-70 Section 853.236-70 Federal Acquisition Regulations System DEPARTMENT OF...-Engineer Fee Proposal. VA Form 10-6298, Architect-Engineer Fee Proposal, shall be used as prescribed in 836...
Update neutron nuclear data evaluation for 236,238Np
International Nuclear Information System (INIS)
Chen, Guochang; Wang, Jimin; Yu, Baosheng; Cao, Wentian; Tang, Guo-you
2015-01-01
The nuclear data with high accuracy for actinides play an important role in nuclear technology applications, including reactor design and operation, fuel cycle, estimation of the amount of minor actinides (MAs) in high burnup reactors and to research to transmute the MAs to short half-lived nuclides or stable ones. The nuclides of 236 Np are generated via the α-decay of 240 Am or 237 Np(n, 2n) and 237 Np(d, t) reactions. And the nuclides of 238 Np are generated via the α-decay of 242 Am or 237 Np(n, γ) and 237 Np(d, p) reactions. In the present work, according to the systematic trend of the total cross section and elastic cross section etc. of different Np isotopes, and based on the neutron optical model parameters (OMP) of 237 Np, a new set of neutron optical model parameters were obtained for 236,238 Np. Based on the new set OMP and the systematic trend of the cross sections of different Np isotopes, a full set of 236,238 Np neutron nuclear data has been updated and improved by theoretical calculation. The present result has significant improvements over the data in CENDL-3.1
Trabesinger, Andreas
2017-09-01
The first new element produced after the Second World War has led a rather peaceful life since entering the period table -- until it became the target of those producing superheavy elements, as Andreas Trabesinger describes.
Buildup of 236U in the gaseous diffusion plant product
International Nuclear Information System (INIS)
Ford, J.S.
1975-01-01
A generalized projection of the average annual 236 U concentration that can be expected in future enriched uranium product from the US-ERDA gaseous diffusion plants when reprocessed fuels become available for cascade feeding is given. It is concluded that the buildup of 236 U is not an ever-increasing function, but approaches a limiting value. Projected concentrations result in only slight separative work losses and present no operational problem to ERDA in supplying light water reactor requirements. The use of recycle uranium from power reactor spent fuels will result in significant savings in natural uranium feed
European roe deer antlers as an environmental archive for fallout 236U and 239Pu
International Nuclear Information System (INIS)
Froehlich, M.B.; Steier, P.; Wallner, G.; Fifield, L.K.
2016-01-01
Anthropogenic 236 U and 239 Pu were measured in European roe deer antlers hunted between 1955 and 1977 which covers and extends beyond the period of intensive nuclear weapons testing (1954–1962). The antlers were hunting trophies, and hence the hunting area, the year of shooting and the approximate age of each animal is given. Uranium and plutonium are known to deposit in skeletal tissue. Since antler histology is similar to bone, both elements were expected in antlers. Furthermore, roe deer shed their antlers annually, and hence antlers may provide a time-resolved environmental archive for fallout radionuclides. The radiochemical procedure is based on a Pu separation step by anion exchange (Dowex 1 × 8) and a subsequent U purification by extraction chromatography using UTEVA ® . The samples were measured by Accelerator Mass Spectrometry at the VERA facility (University of Vienna). In addition to the 236 U and 239 Pu concentrations, the 240 Pu/ 239 Pu isotopic ratios were determined with a mean value of 0.172 ± 0.023 which is in agreement with the ratio of global fallout (∼0.18). Rather high 236 U/ 238 U ratios of the order of 10 −6 were observed. These measured ratios, where the 236 U arises only from global fallout, have implications for the use of the 236 U/ 238 U ratio as a fingerprint for nuclear accidents or releases from nuclear facilities. Our investigations have shown the potential to use antlers as a temporally resolved archive for the uptake of actinides from the environment. - Highlights: • Roe deer antlers were studied as an environmental archive for the retrospective study of fallout isotopes 236 U and 239 Pu. • The rather high 236 U/ 238 U ratios of about 10 −6 suggest 236 U as a fingerprint tool for nuclear material releases. • The 240 Pu/ 239 Pu atom ratio underpins global fallout as the main anthropogenic contributor in antlers.
Longkumer, Toshisangba; Kamireddy, Swetha; Muthyala, Venkateswar Reddy; Akbarpasha, Shaikh; Pitchika, Gopi Krishna; Kodetham, Gopinath; Ayaluru, Murali; Siddavattam, Dayananda
2013-01-01
While analyzing plasmids of Acinetobacter sp. DS002 we have detected a circular DNA molecule pTS236, which upon further investigation is identified as the genome of a phage. The phage genome has shown sequence similarity to the recently discovered Sphinx 2.36 DNA sequence co-purified with the Transmissible Spongiform Encephalopathy (TSE) particles isolated from infected brain samples collected from diverse geographical regions. As in Sphinx 2.36, the phage genome also codes for three proteins. One of them codes for RepA and is shown to be involved in replication of pTS236 through rolling circle (RC) mode. The other two translationally coupled ORFs, orf106 and orf96, code for coat proteins of the phage. Although an orf96 homologue was not previously reported in Sphinx 2.36, a closer examination of DNA sequence of Sphinx 2.36 revealed its presence downstream of orf106 homologue. TEM images and infection assays revealed existence of phage AbDs1 in Acinetobacter sp. DS002.
49 CFR 236.51 - Track circuit requirements.
2010-10-01
...: All Systems Track Circuits § 236.51 Track circuit requirements. Track relay controlling home signals shall be in deenergized position, or device that functions as a track relay controlling home signals... conditions exist: (a) When a rail is broken or a rail or switch-frog is removed except when a rail is broken...
48 CFR 552.236-74 - Working Hours.
2010-10-01
... 48 Federal Acquisition Regulations System 4 2010-10-01 2010-10-01 false Working Hours. 552.236-74... Hours. As prescribed in 536.570-5, insert the following clause: Working Hours (APR 1984) (a) It is contemplated that all work will be performed during the customary working hours of the trades involved unless...
48 CFR 1852.236-73 - Hurricane plan.
2010-10-01
... 48 Federal Acquisition Regulations System 6 2010-10-01 2010-10-01 true Hurricane plan. 1852.236-73... Hurricane plan. As prescribed in 1836.570(c), insert the following clause: Hurricane Plan (DEC 1988) In the event of a hurricane warning, the Contractor shall— (a) Inspect the area and place all materials...
49 CFR 236.338 - Mechanical locking required in accordance with locking sheet and dog chart.
2010-10-01
... locking sheet and dog chart. 236.338 Section 236.338 Transportation Other Regulations Relating to... in accordance with locking sheet and dog chart. Mechanical locking shall be in accordance with locking sheet and dog chart currently in effect. ...
Recommendation on changing interfaces of W-058 and W-236A
International Nuclear Information System (INIS)
Light, J.M.
1994-01-01
This position paper recommends changes to improve the interface between the Cross-Site Transfer System (Project W-058) and the Multi-Function Waste Tank Facility (Project W-236A) to handle planned waste retrieval and storage operations. Appendix A includes cost estimates and schedule impacts for each project. The cost estimates, schedule impacts, and this position paper will be the basis for writing a change request to formally implement these changes on Project W-236A and Project W-058/W-028. Recommendations are made on pipeline rerouting, pump and configuration, and flushing configuration
49 CFR 236.919 - Operations and Maintenance Manual.
2010-10-01
..., INSPECTION, MAINTENANCE, AND REPAIR OF SIGNAL AND TRAIN CONTROL SYSTEMS, DEVICES, AND APPLIANCES Standards for Processor-Based Signal and Train Control Systems § 236.919 Operations and Maintenance Manual. (a... identify all software versions, revisions, and revision dates. Plans must be legible and correct. (c...
49 CFR 236.1039 - Operations and Maintenance Manual.
2010-10-01
..., INSPECTION, MAINTENANCE, AND REPAIR OF SIGNAL AND TRAIN CONTROL SYSTEMS, DEVICES, AND APPLIANCES Positive Train Control Systems § 236.1039 Operations and Maintenance Manual. (a) The railroad shall catalog and... software versions, revisions, and revision dates. Plans must be legible and correct. (c) Hardware, software...
48 CFR 852.236-74 - Inspection of construction.
2010-10-01
...: (a) Inspection of materials and articles furnished under this contract will be made at the site by... 48 Federal Acquisition Regulations System 5 2010-10-01 2010-10-01 false Inspection of construction... CLAUSES AND FORMS SOLICITATION PROVISIONS AND CONTRACT CLAUSES Texts of Provisions and Clauses 852.236-74...
{sup 236}U and {sup 129}I as tracers of water masses in the Arctic Ocean
Energy Technology Data Exchange (ETDEWEB)
Casacuberta, Nuria; Christl, Marcus; Vockenhuber, Christof; Synal, Hans-Arno [Laboratory of Ion Beam Physics, ETH-Zurich (Switzerland); Walther, Clemens [Institut fuer Radiooekologie und Strahlenschutz, Leibniz Universitaet Hannover (Germany); Loeff, Michiel van der [AWI-Geochemistry, Alfred Wegener Institut Fuer Polar und Meeresforshung, Bremerhaven (Germany); Masque, Pere [Institut de Ciencia i Tecnologia Ambientals, Universitat Autonoma de Barcelona, Bellaterra (Spain)
2014-07-01
Recently {sup 236}U attested to be a new transient oceanographic tracer: it is conservative in seawater and far from having reached steady state in the oceans. Its main sources in the North Atlantic are global fallout and European reprocessing plants. In this study, concentrations of {sup 236}U and {sup 129}I of eight deep profiles in the Arctic Ocean collected in 2011-2012 were determined with a compact ETH Zurich AMS system (TANDY). Results on {sup 236}U/{sup 238}U show a steep gradient, from the lowest ever-reported {sup 236}U/{sup 238}U atomic ratio in open ocean water (5±5) x 10{sup -12} up to (3700±80) x 10{sup -12}. Whereas the very low ratios are indicative for deep old waters, high ratios in shallow and surface waters show a clear signature of Atlantic Waters (AW) penetrating to the Arctic Ocean. The combination of {sup 236}U with {sup 129}I, both being released by the nuclear reprocessing plants of Sellafield and La Hague, with a distinct temporal input function, is used to estimate transit time of AW distributions in the Arctic Ocean.
42 CFR 435.236 - Individuals in institutions who are eligible under a special income level.
2010-10-01
... a special income level. 435.236 Section 435.236 Public Health CENTERS FOR MEDICARE & MEDICAID... in institutions who are eligible under a special income level. (a) If the agency provides Medicaid... not institutionalized; but (2) Have income below a level specified in the plan under § 435.722. (See...
27 CFR 40.236 - Release from customs custody.
2010-04-01
... 27 Alcohol, Tobacco Products and Firearms 2 2010-04-01 2010-04-01 false Release from customs... on Tobacco Products § 40.236 Release from customs custody. The release of tobacco products from customs custody, in bond, for transfer to the premises of a tobacco products factory, shall be in...
Radioisotope dilution analyses of geological samples using 236U and 229Th
International Nuclear Information System (INIS)
Rosholt, J.N.
1984-01-01
The use of 236 U and 229 Th in alpha spectrometric measurements has some advantages over the use of other tracers and measurement techniques in isotope dilution analyses of most geological samples. The advantages are: 1) these isotopes do not occur in terrestrial rocks, 2) they have negligible decay losses because of their long half lives, 3) they cause minimal recoil contamination to surface-barrier detectors, 4) they allow for simultaneous determination of the concentration and isotopic composition of uranium and thorium in a variety of sample types, and 5) they allow for simple and constant corrections for spectral interferences, 0.5% of the 238 U activity is subtracted for the contribution of 235 U in the 236 U peak and 1% of the 229 Th activity is subtracted from the 230 Th activity. Disadvantages in using 236 U and 229 Th are: 1) individual separates of uranium and thorium must be prepared as very thin sources for alpha spectrometry, 2) good resolution in the spectrometer system is required for thorium isotopic measurements where measurement times may extend to 300 h, and 3) separate calibrations of the 236 U and 229 Th spike solution with both uranium and thorium standards are required. The use of these tracers in applications of uranium-series disequilibrium studies has simplified the measurements required for the determination of the isotopic composition of uranium and thorium because of the minimal corrections needed for alpha spectral interferences. (orig.)
Radioisotope dilution analyses of geological samples using 236U and 229Th
Rosholt, J.N.
1984-01-01
The use of 236U and 229Th in alpha spectrometric measurements has some advantages over the use of other tracers and measurement techniques in isotope dilution analyses of most geological samples. The advantages are: (1) these isotopes do not occur in terrestrial rocks, (2) they have negligible decay losses because of their long half lives, (3) they cause minimal recoil contamination to surface-barrier detectors, (4) they allow for simultaneous determination of the concentration and isotopic composition of uranium and thorium in a variety of sample types, and (5) they allow for simple and constant corrections for spectral inferences, 0.5% of the 238U activity is subtracted for the contribution of 235U in the 236U peak and 1% of the 229Th activity is subtracted from the 230Th activity. Disadvantages in using 236U and 229Th are: (1) individual separates of uranium and thorium must be prepared as very thin sources for alpha spectrometry, (2) good resolution in the spectrometer system is required for thorium isotopic measurements where measurement times may extend to 300 h, and (3) separate calibrations of the 236U and 229Th spike solution with both uranium and thorium standards are required. The use of these tracers in applications of uranium-series disequilibrium studies has simplified the measurements required for the determination of the isotopic composition of uranium and thorium because of the minimal corrections needed for alpha spectral interferences. ?? 1984.
48 CFR 52.236-17 - Layout of Work.
2010-10-01
... 48 Federal Acquisition Regulations System 2 2010-10-01 2010-10-01 false Layout of Work. 52.236-17... Layout of Work. As prescribed in 36.517, insert the following clause in solicitations and contracts when... need for accurate work layout and for siting verification during work performance: Layout of Work (APR...
Energy Technology Data Exchange (ETDEWEB)
Yang, Guosheng [Department of Radiation Chemistry, Institute of Radiation Emergency Medicine, Hirosaki University, 66-1 Hon-cho, Hirosaki, Aomori, 036-8564 (Japan); Division of Nuclear Technology and Applications, Institute of High Energy Physics, Chinese Academy of Sciences (China); Beijing Engineering Research Center of Radiographic Techniques and Equipment, Beijing, 100049 (China); Tazoe, Hirofumi [Department of Radiation Chemistry, Institute of Radiation Emergency Medicine, Hirosaki University, 66-1 Hon-cho, Hirosaki, Aomori, 036-8564 (Japan); Yamada, Masatoshi, E-mail: myamada@hirosaki-u.ac.jp [Department of Radiation Chemistry, Institute of Radiation Emergency Medicine, Hirosaki University, 66-1 Hon-cho, Hirosaki, Aomori, 036-8564 (Japan)
2016-11-09
In order to measure trace {sup 236}U and {sup 236}U/{sup 238}U in environmental samples with a high matrix effect, a novel and simple method was developed that makes the digestion and purification procedures compatible with advanced triple-quadrupole inductively coupled plasma-mass spectrometry. A total dissolution of sample with HF + HNO{sub 3} + HClO{sub 4} was followed by chromatographic separation with a single resin column containing normal type DGA resin (N,N,N′,N’-tetra-n-octyldiglycolamide) as the extractant system. The analytical accuracy and precision of {sup 236}U/{sup 238}U ratios, measured as {sup 236}U{sup 16}O{sup +}/{sup 238}U{sup 16}O{sup +}, were examined by using the reference materials IAEA-135, IAEA-385, IAEA-447, and JSAC 0471. The low method detection limit (3.50 × 10{sup −6} Bq kg{sup −1}) makes it possible to perform routine monitoring of environmental {sup 236}U due to global fallout combined with the Fukushima Daiichi Nuclear Power Plant accident fallout (>10{sup −5} Bq kg{sup −1}). Finally, the developed method was successfully applied to measure {sup 236}U/{sup 238}U ratios and {sup 236}U activities in soil samples contaminated by the accident. The low {sup 236}U/{sup 238}U atom ratios ((1.50–13.5) × 10{sup −8}) and {sup 236}U activities ((2.25–14.1) × 10{sup −2} mBq kg{sup −1}) indicate {sup 236}U contamination was mainly derived from global fallout in the examined samples. - Highlights: • A simple {sup 236}U/{sup 238}U analytical method has been developed. • The separation required just one DGA column chromatography. • {sup 236}U/{sup 238}U atom ratios in soil were measured by ICP-MS/MS. • {sup 236}U/{sup 238}U atom ratios of (1.50–13.5) × 10{sup −8} were observed in Japanese samples. • {sup 236}U activities of (2.25–14.1) × 10{sup −2} mBq kg{sup −1} were found in Japanese samples.
MODELING AND DESIGN STUDY USING HFC-236EA AS AN ALTERNATIVE REFRIGERANT IN A CENTRIFUGAL COMPRESSOR
The report gives results of an investigation of the operation of a centrifugal compressor--part of a chlorofluorocarbon (CFC)-114 chiller installation--with the new refrigerant hydrofluorocarbon (HFC)-236ea, a proposed alternative to CFC-114. A large set of CFC-236ea operating da...
24 CFR 236.253 - Premiums-operating loss loans.
2010-04-01
... Obligations for Mortgage Insurance § 236.253 Premiums—operating loss loans. All of the provisions of § 207.252a of this chapter relating to mortgage insurance premiums on operating loss loans shall apply to... Act the mortgage insurance premiums due in accordance with § 207.252a shall be calculated on the basis...
236-Z canyon utilization study
International Nuclear Information System (INIS)
Dixon, D.R.
1977-01-01
The 236-Z canyon contains equipment for repurification of plutonium and recovery of plutonium from scrap material. To meet production requirements of Fast Flux Test Facility/Clinch River Breeder Reactor oxide with the existing plant, several new pieces of equipment will be needed in the future. More storage space and a better accountability system are needed to support this increased production. The available canyon space needs to be utilized to its fullest in order to accommodate the new equipment. The purpose of this document is to identify the new pieces of equipment, show how they fit into the flowsheet, and locate them in the canyon
27 CFR 46.236 - Articles in a warehouse.
2010-04-01
... 27 Alcohol, Tobacco Products and Firearms 2 2010-04-01 2010-04-01 false Articles in a warehouse... Tubes Held for Sale on April 1, 2009 Filing Requirements § 46.236 Articles in a warehouse. (a) Articles... articles will be offered for sale. (b) Articles offered for sale at several locations must be reported on a...
48 CFR 236.271 - Cost-plus-fixed-fee contracts.
2010-10-01
... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Cost-plus-fixed-fee... CONTRACTS Special Aspects of Contracting for Construction 236.271 Cost-plus-fixed-fee contracts. Annual military construction appropriations acts restrict the use of cost-plus-fixed-fee contracts (see 216.306(c...
236U and 239,240Pu ratios from soils around an Australian nuclear weapons test site
International Nuclear Information System (INIS)
Tims, S.G.; Froehlich, M.B.; Fifield, L.K.; Wallner, A.; De Cesare, M.
2016-01-01
The isotopes 236 U, 239 Pu and 240 Pu are present in surface soils as a result of global fallout from nuclear weapons tests carried out in the 1950's and 1960's. These isotopes potentially constitute artificial tracers of recent soil erosion and sediment movement. Only Accelerator Mass Spectrometry has the requisite sensitivity to measure all three isotopes at these environmental levels. Coupled with its relatively high throughput capabilities, this makes it feasible to conduct studies of erosion across the geographical extent of the Australian continent. In the Australian context, however, global fallout is not the only source of these isotopes. As part of its weapons development program the United Kingdom carried out a series of atmospheric and surface nuclear weapons tests at Maralinga, South Australia in 1956 and 1957. The tests have made a significant contribution to the Pu isotopic abundances present in the region around Maralinga and out to distances ∼1000 km, and impact on the assessment techniques used in the soil and sediment tracer studies. Quantification of the relative fallout contribution derived from detonations at Maralinga is complicated owing to significant contamination around the test site from numerous nuclear weapons safety trials that were also carried out around the site. We show that 236 U can provide new information on the component of the fallout that is derived from the local nuclear weapons tests, and highlight the potential of 236 U as a new fallout tracer. - Highlights: • Measured 236 U inventories around the Maralinga Test Nuclear weapons test site. • Comparison of 236 U and 239 Pu soil depth profiles at Maralinga. • Differences in 236 U and 239 Pu inventories indicate most Pu fallout is from the safety trials, rather than the weapons tests.
GERRITSE, J; GOTTSCHAL, JC
1992-01-01
Bacteria from an anaerobic enrichment reductively removed chlorine from the ortho- position of 2,3,6-trichlorobenzoic acid (2,3,6-TBA) producing 2,5-dichlorobenzoate (2,5-DBA). The strictly aerobic bacterium Pseudomonas aeruginosa JB2 subsequently used 2,5-DBA as a growth substrate in the presence
49 CFR 236.1045 - Training specific to office control personnel.
2010-10-01
... control system, including provision for movement and protection of roadway workers, unequipped trains... 49 Transportation 4 2010-10-01 2010-10-01 false Training specific to office control personnel. 236... INSTALLATION, INSPECTION, MAINTENANCE, AND REPAIR OF SIGNAL AND TRAIN CONTROL SYSTEMS, DEVICES, AND APPLIANCES...
49 CFR 236.925 - Training specific to control office personnel.
2010-10-01
... applicable to the train control system, including provision for movement and protection of roadway workers... 49 Transportation 4 2010-10-01 2010-10-01 false Training specific to control office personnel. 236... INSTALLATION, INSPECTION, MAINTENANCE, AND REPAIR OF SIGNAL AND TRAIN CONTROL SYSTEMS, DEVICES, AND APPLIANCES...
Study of 236U/238U ratio at CIRCE using a 16-strip silicon detector with a TOF system
De Cesare, M.; De Cesare, N.; D'Onofrio, A.; Gialanella, L.; Terrasi, F.
2015-04-01
Accelerator Mass Spectrometry (AMS) is presently the most sensitive technique for the measurement of long-lived actinides, e.g. 236U and xPu isotopes. A new actinide AMS system, based on a 3-MV pelletron tandem accelerator, is operated at the Center for Isotopic Research on Cultural and Environmental Heritage (CIRCE) in Caserta, Italy. In this paper we report on the procedure adopted to increase the 236U abundance sensitivity as low as possible. The energy and position determinations of the 236U ions, using a 16-strip silicon detector have been obtained. A 236U/238U isotopic ratio background level of about 2.9×10-11 was obtained, summing over all the strips, using a Time of Flight-Energy (TOF-E) system with a 16-strip silicon detector (4.9×10-12 just with one strip).
Energy Technology Data Exchange (ETDEWEB)
Quinto, Francesca; Hrnecek, Erich; Krachler, Michael [European Commission Joint Research Centre, Institute for Transuranium Elements, P.O. Box 2340, 76125 Karlsruhe (Germany); Shotyk, William [Department of Renewable Resources, University of Alberta, 839 General Services Building, Edmonton, AB (Canada); Steier, Peter; Winkler, Stephan; Golser, Robin [VERA Laboratory, Faculty of Physics, University of Vienna, Waehringer Strasse 17, A-1090 Vienna (Austria)
2014-07-01
U-236, Pu-239, Pu-240, Pu-241 and Pu-242 were analysed in an ombrotrophic peat core representing the last 80 years of atmospheric deposition. The determination of these isotopes at femtogram and attogram levels was possible by using ultra-clean laboratory procedures and accelerator mass spectrometry. Since the Pu isotopic composition characteristic for global fallout, as well as anthropogenic U-236, were identified in peat samples pre-dating the period of atmospheric atom bomb testing, migration of Pu and U within the peat profile is clearly indicated. The vertical profile of the U-236/U-238 isotopic ratio represents the first observation of the U-236 bomb peak in a terrestrial environment. Comparing the abundances of the global fallout derived U-236 and Pu-239 along the peat core, the post depositional migration of plutonium exceeds that of uranium. These results highlight, for the first time, the mobility of Pu and U in a peat bog with implications for their migration in other acidic, organic rich environments.
Study of 236U/238U ratio at CIRCE using a 16-strip silicon detector with a TOF system
Directory of Open Access Journals (Sweden)
De Cesare M.
2015-01-01
Full Text Available Accelerator Mass Spectrometry (AMS is presently the most sensitive technique for the measurement of long-lived actinides, e.g. 236U and xPu isotopes. A new actinide AMS system, based on a 3-MV pelletron tandem accelerator, is operated at the Center for Isotopic Research on Cultural and Environmental Heritage (CIRCE in Caserta, Italy. In this paper we report on the procedure adopted to increase the 236U abundance sensitivity as low as possible. The energy and position determinations of the 236U ions, using a 16-strip silicon detector have been obtained. A 236U/238U isotopic ratio background level of about 2.9×10−11 was obtained, summing over all the strips, using a Time of Flight-Energy (TOF-E system with a 16-strip silicon detector (4.9×10−12 just with one strip.
HEAT TRANSFER EVALUATION OF HFC-236FA IN CONDENSATION AND EVAPORATION
The report gives results of an evaluation of the shell-side heat transfer performance of hydrofluorocarbon (HFC)-236fa, which is considered to be a potential substitute for chlorofluorocarbon (CFC)-114 in Navy shipboard chillers, for both conventional finned [1024- and 1575-fpm (...
Energy Technology Data Exchange (ETDEWEB)
Christl, Marcus; Casacuberta, Nuria; Lachner, Johannes; Maxeiner, Sascha; Vockenhuber, Christof; Synal, Hans-Arno [Labor fuer Ionenstrahlphysik, ETH Zuerich (Switzerland); Herrmann, Juergen [Bundesamt fuer Seeschifffahrt und Hydroghraphie, Hamburg (Germany); Castrillejo, Maxi; Masque, Pere [Universitat Autonoma de Barcelona (Spain); Rutgers van der Loeff, Michiel [Alfred-Wegener-Institut, Bremerhaven (Germany)
2015-07-01
The technical developments of recent years, such as the introduction of helium as a stripping gas, make compact AMS systems probably among the most sensitive analyzers available for ultra-trace analyzes of actinides in the environment. Such systems are particularly suitable for the trace analysis of {sup 236}U since conventional mass spectrometry does not provide the necessary suppression of the substrate caused by molecules or neighboring masses. Over the past few years, unique data sets of {sup 236}U/{sup 238}U have been produced at the AMS System Tandy of the ETH Zurich in the Atlantic and Arctic Ocean as well as in the Mediterranean and the North Sea. This lecture will provide a brief overview of the latest technical developments in the field of heavy ion analysis at compact AMS plants at ETH Zurich. In the second part, the produced data sets are then assembled and the current understanding of this new ocean tracer discussed. [German] Die technischen Entwicklungen der letzten Jahre, wie zum Beispiel die Einfuehrung von Helium als stripper Gas, machen kompakte AMS Systeme wahrscheinlich zu den sensitivsten verfuegbaren Analysegeraeten fuer Ultra-Spurenstoffanalysen von Aktiniden in der Umwelt. Solche Systeme eignen sich im Besonderen zur Spurenanalyse von {sup 236}U, da konventionelle Massenspektrometrie hier nicht die erforderliche Unterdrueckung des durch Molekuele oder Nachbarmassen verursachten Untergrundes bietet. Am AMS System Tandy der ETH Zuerich wurden waehrend der letzten Jahre einzigartige Datensaetze von {sup 236}U/{sup 238}U im Atlantischen und Arktischen Ozean, sowie im Mittelmeer und der Nordsee produziert. In diesem Vortrag soll zunaechst ein kurzer Ueberblick ueber die neuesten technischen Entwicklungen im Bezug auf Schwerionen Analysen an kompakten AMS Anlagen der ETH Zuerich gegeben werden. Im zweiten Teil werden dann die produzierten Datensaetze zusammengefuegt und das gegenwaertige Verstaendnis dieses neuen Ozean-Tracers diskutiert.
24 CFR 1000.236 - What are eligible administrative and planning expenses?
2010-04-01
... administrative management; (2) Coordination monitoring and evaluation; (3) Preparation of the IHP including data... 24 Housing and Urban Development 4 2010-04-01 2010-04-01 false What are eligible administrative...) § 1000.236 What are eligible administrative and planning expenses? (a) Eligible administrative and...
Directory of Open Access Journals (Sweden)
J. Konki
2017-01-01
Full Text Available The new neutron-deficient nuclei 240Es and 236Bk were synthesised at the gas-filled recoil separator RITU. They were identified by their radioactive decay chains starting from 240Es produced in the fusion–evaporation reaction 209Bi(34S,3n240Es. Half-lives of 6(2s and 22−6+13s were obtained for 240Es and 236Bk, respectively. Two groups of α particles with energies Eα=8.19(3MeV and 8.09(3MeV were unambiguously assigned to 240Es. Electron-capture delayed fission branches with probabilities of 0.16(6 and 0.04(2 were measured for 240Es and 236Bk, respectively. These new data show a continuation of the exponential increase of ECDF probabilities in more neutron-deficient isotopes.
49 CFR 236.335 - Dogs, stops and trunnions of mechanical locking.
2010-10-01
... 49 Transportation 4 2010-10-01 2010-10-01 false Dogs, stops and trunnions of mechanical locking..., AND APPLIANCES Interlocking Rules and Instructions § 236.335 Dogs, stops and trunnions of mechanical locking. Driving pieces, dogs, stops and trunnions shall be rigidly secured to locking bars. Swing dogs...
49 CFR 236.207 - Electric lock on hand-operated switch; control.
2010-10-01
..., AND APPLIANCES Automatic Block Signal Systems Standards § 236.207 Electric lock on hand-operated switch; control. Electric lock on hand-operated switch shall be controlled so that it cannot be unlocked... 49 Transportation 4 2010-10-01 2010-10-01 false Electric lock on hand-operated switch; control...
48 CFR 652.236-71 - Foreign Service Buildings Act, as Amended.
2010-10-01
... 48 Federal Acquisition Regulations System 4 2010-10-01 2010-10-01 false Foreign Service Buildings....236-71 Foreign Service Buildings Act, as Amended. As prescribed in 636.570(a), insert the following provision: Foreign Service Buildings Act, as Amended (APR 2004) (a) This solicitation is subject to Section...
49 CFR 236.22 - Semaphore signal arm; clearance to other objects.
2010-10-01
... 49 Transportation 4 2010-10-01 2010-10-01 false Semaphore signal arm; clearance to other objects... Rules and Instructions: All Systems Roadway Signals and Cab Signals § 236.22 Semaphore signal arm; clearance to other objects. At least one-half inch clearance shall be provided between semaphore signal arm...
48 CFR 852.236-72 - Performance of work by the contractor.
2010-10-01
... 48 Federal Acquisition Regulations System 5 2010-10-01 2010-10-01 false Performance of work by the....236-72 Performance of work by the contractor. As prescribed in 836.501, insert the following clause: Performance of Work by the Contractor (JUL 2002) The clause entitled “Performance of Work by the Contractor...
48 CFR 52.236-1 - Performance of Work by the Contractor.
2010-10-01
... 48 Federal Acquisition Regulations System 2 2010-10-01 2010-10-01 false Performance of Work by the....236-1 Performance of Work by the Contractor. As prescribed in 36.501(b), insert the following clause... the work and customary or necessary specialty subcontracting (see 36.501(a)).] Performance of Work by...
49 CFR 236.308 - Mechanical or electric locking or electric circuits; requisites.
2010-10-01
..., AND APPLIANCES Interlocking Standards § 236.308 Mechanical or electric locking or electric circuits; requisites. Mechanical or electric locking or electric circuits shall be installed to prevent signals from... 49 Transportation 4 2010-10-01 2010-10-01 false Mechanical or electric locking or electric...
48 CFR 53.236-2 - Architect-engineer services (SF's 252 and 330).
2010-10-01
... 48 Federal Acquisition Regulations System 2 2010-10-01 2010-10-01 false Architect-engineer... ACQUISITION REGULATION (CONTINUED) CLAUSES AND FORMS FORMS Prescription of Forms 53.236-2 Architect-engineer...-engineer and related services: (a) SF 252 (Rev. 10/83), Architect-Engineer Contract. SF 252 is prescribed...
Position paper: Live load design criteria for Project W-236A Multi-Function Waste Tank Facility
International Nuclear Information System (INIS)
Giller, R.A.
1995-01-01
The purpose of this paper is to discuss the live loads applied to the underground storage tanks of the Multi Function Waste Tank Facility, and to provide the basis for Project W-236A live load criteria. Project 236A provides encompasses building a Weather Enclosure over the two underground storage tanks at the 200-West area. According to the Material Handling Study, the Groves AT 1100 crane used within the Weather Enclosure will have a gross vehicle weight of 66.5 tons. Therefore, a 100-ton concentrated live load is being used for the planning of the construction of the Weather Enclosure
Isotope shift of 234U, 236U, 238U in U I
International Nuclear Information System (INIS)
Gagne, J.M.; Nguyen Van, S.; Saint-Dizier, J.P.; Pianarosa, P.
1976-01-01
New and very accurate data of isotope shifts and relative isotope shifts in 234 U, 236 U, 238 U are presented. The invariance of the relative isotope shift, for the transitions we have investigated, supports the hypothesis that the so called specific mass effect is negligible in uranium
International Nuclear Information System (INIS)
Kim, Su-Jin; Jeong, Hyun-Ja; Park, Rae-Kil; Lee, Kang-Min; Kim, Hyung-Min; Um, Jae-Young; Hong, Seung-Heon
2007-01-01
SC-236 (4-[5-(4-chlorophenyl)-3-(trifluoromethyl)-1-pyrazol-1-]benzenesulfonamide; C 16 H 11 ClF 3 N 3 O 2 S), is a highly selective cyclooxygenase (COX)-2 inhibitor. Recently, there have been reports that SC-236 protects against cartilage damage in addition to reducing inflammation and pain in osteoarthritis. However, the mechanism involved in the inflammatory allergic reaction has not been examined. Mast cells accumulation can be related to inflammatory conditions, including allergic rhinitis, asthma, and rheumatoid arthritis. The aim of the present study is to investigate the effects of SC-236 on stem cell factor (SCF)-induced migration, morphological alteration, and cytokine production of rat peritoneal mast cells (RPMCs). We observed that SCF significantly induced the migration and morphological alteration. The ability of SCF to enhance migration and morphological alteration was abolished by treatment with SC-236. In addition, production of tumor necrosis factor (TNF)-α, interleukin (IL)-1β, and vascular endothelial growth factor (VEGF) production induced by SCF was significantly inhibited by treatment with SC-236. Previous work has demonstrated that SCF-induced migration and cytokine production of mast cells require p38 MAPK activation. We also showed that SC-236 suppresses the SCF-induced p38 MAPK activation in RPMCs. These data suggest that SC-236 inhibits migration and cytokine production through suppression of p38 MAPK activation. These results provided new insight into the pharmacological actions of SC-236 and its potential therapeutic role in the treatment of inflammatory allergic diseases
Neutron widths for 236U from high resolution transmission measurements at a 100M flightpath
International Nuclear Information System (INIS)
Carraro, G.; Brusegan, A.
1975-01-01
A series of neutron transmission measurements has been performed on 236 U aiming at a determination of the resonance parameters and their statistical properties. The analysis range covered neutron energies from 40eV to 4.1 keV. The experiments were carried out at about 100 m flightpath of the 80 MeV electron linear accelerator of CBNM using a 10 B slab-NaI detector and 2 236 U-oxyde samples on loan from the USAEC. A table displays the details of 6 experimental runs, 3 of which were arranged in such a way that the effect of the 235 U and 238 U impurities in the sample on the transmission was automatically compensated
International Nuclear Information System (INIS)
Sawant, Pramilla D.; Prabhu, Supreetha P.; Kalsi, P.C.
2008-01-01
236 Pu and 242 Pu are routinely used as radiochemical yield monitors in India for bioassay monitoring of occupational workers by alpha spectrometry. Fission Track Analysis (FTA) is also being standardized for trace level determination of Pu in bioassay samples. The present study, reports the utility of 236 Pu and 242 Pu as radiochemical tracers in estimation of Pu in bioassay samples by FTA technique. The advantages of using 236 Pu tracer in FTA over 242 Pu as well as the interference caused due to presence of 241 Pu in the bioassay samples of occupational workers handling power reactor grade Pu is discussed. (author)
Shape Isomer in 236U Populated by Thermal Neutron Capture
DEFF Research Database (Denmark)
Andersen, Verner; Christensen, Carl Jørgen; Borggreen, J.
1976-01-01
The 116 ns shape isomer in 236U was populated by thermal neutron capture. Conversion electrons and X-rays were detected simultaneously in delayed coincidence with fission. The ratio of delayed to prompt fission was measured with the result, σIIf/σf = (1.0±0.2) × 10−5. A branching of the isomeric ...... decay σIIγ/σIIf = 7±2 was deduced from this number. No definite electron line structure was observed....
17 CFR 230.236 - Exemption of shares offered in connection with certain transactions.
2010-04-01
... Exemptions § 230.236 Exemption of shares offered in connection with certain transactions. Shares of stock or... securities in lieu of issuing fractional shares, script certificates or order forms, in connection with a stock dividend, stock split, reverse stock split, conversion, merger or similar transaction, shall be...
Fission Fragment Angular Distributions in the $^{234}$U(n,f) and $^{236}$U(n,f) reactions
We propose to measure the fission fragment angular distribution (FFAD) of the $^{234}$U(n,f) and $^{236}$U (n,f) reactions with the PPAC detection setup used in previous n_TOF-14 experiment. This experiment would take advantage of the high resolution of the n_TOF facility to investigate the FFAD behaviour in the pronounced vibrational resonances that have been observed between 0.1 and 2 MeV for the thorium cycle isotopes. In addition, the angular distribution of these isotopes will be measured for the first time beyond 14 MeV. Furthermore, the experiment will also provide the fission cross section with reduced statistical uncertainty, extending the $^{236}$U(n,f) data up to 1 GeV
49 CFR 236.206 - Battery or power supply with respect to relay; location.
2010-10-01
... 49 Transportation 4 2010-10-01 2010-10-01 false Battery or power supply with respect to relay..., AND APPLIANCES Automatic Block Signal Systems Standards § 236.206 Battery or power supply with respect to relay; location. The battery or power supply for each signal control relay circuit, where an open...
International Nuclear Information System (INIS)
Denyak, V.V.; Khvastunov, V.M.; Paschuk, S.A.; Schelin, H.R.
2013-01-01
Fission of the even-even nuclei 232 Th, 236,238 U and even-odd nuclei 233,235 U by linearly polarized photons has been studied at excitation energies in the region of a giant dipole resonance. The performed investigations unambiguously showed the existence of the fragment mass dependence of the cross section azimuthal asymmetry in the photofission of 236 U and 238 U. In addition, the obtained results provided the first evidence for the possible difference between the asymmetry values in asymmetric and symmetric mass distribution regions in the case of 236 U. The measured cross section azimuthal asymmetry of the fission of 232 Th does not show any fragment mass dependence. In the even-odd nuclei 233 U and 235 U the difference between the far-asymmetric and other mass distribution regions was also observed but with the statistical uncertainty not small enough for definitive conclusion. (orig.)
HEAT TRANSFER EVALUATION OF HFC-236EA AND CFC-114 IN CONDENSATION AND EVAPORATION
The report gives results of a heat transfer evaluation of the refrigerants hexafluoropropane (HFC-236ea) and 1,1,2,2-dichloro-tetrafluoroethane (CFC-114). (NOTE: With the mandatory phase-out of chlorofluorocarbons (CFCs), as dictated by the Montreal Protocol and Clean Air Act Ame...
International Nuclear Information System (INIS)
Boulyga, Sergei F.; Heumann, Klaus G.
2006-01-01
A method by inductively coupled plasma mass spectrometry (Icp-Ms) was developed which allows the measurement of 236 U at concentration ranges down to 3 x 10 -14 g g -1 and extremely low 236 U/ 238 U isotope ratios in soil samples of 10 -7 . By using the high-efficiency solution introduction system APEX in connection with a sector-field ICP-MS a sensitivity of more than 5000 counts fg -1 uranium was achieved. The use of an aerosol desolvating unit reduced the formation rate of uranium hydride ions UH + /U + down to a level of 10 -6 . An abundance sensitivity of 3 x 10 -7 was observed for 236 U/ 238 U isotope ratio measurements at mass resolution 4000. The detection limit for 236 U and the lowest detectable 236 U/ 238 U isotope ratio were improved by more than two orders of magnitude compared with corresponding values by alpha spectrometry. Determination of uranium in soil samples collected in the vicinity of Chernobyl nuclear power plant (NPP) resulted in that the 236 U/ 238 U isotope ratio is a much more sensitive and accurate marker for environmental contamination by spent uranium in comparison to the 235 U/ 238 U isotope ratio. The ICP-MS technique allowed for the first time detection of irradiated uranium in soil samples even at distances more than 200 km to the north of Chernobyl NPP (Mogilev region). The concentration of 236 U in the upper 0-10 cm soil layers varied from 2 x 10 -9 g g -1 within radioactive spots close to the Chernobyl NPP to 3 x 10 -13 g g -1 on a sampling site located by >200 km from Chernobyl
Boulyga, Sergei F; Heumann, Klaus G
2006-01-01
A method by inductively coupled plasma mass spectrometry (ICP-MS) was developed which allows the measurement of (236)U at concentration ranges down to 3 x 10(-14)g g(-1) and extremely low (236)U/(238)U isotope ratios in soil samples of 10(-7). By using the high-efficiency solution introduction system APEX in connection with a sector-field ICP-MS a sensitivity of more than 5,000 counts fg(-1) uranium was achieved. The use of an aerosol desolvating unit reduced the formation rate of uranium hydride ions UH(+)/U(+) down to a level of 10(-6). An abundance sensitivity of 3 x 10(-7) was observed for (236)U/(238)U isotope ratio measurements at mass resolution 4000. The detection limit for (236)U and the lowest detectable (236)U/(238)U isotope ratio were improved by more than two orders of magnitude compared with corresponding values by alpha spectrometry. Determination of uranium in soil samples collected in the vicinity of Chernobyl nuclear power plant (NPP) resulted in that the (236)U/(238)U isotope ratio is a much more sensitive and accurate marker for environmental contamination by spent uranium in comparison to the (235)U/(238)U isotope ratio. The ICP-MS technique allowed for the first time detection of irradiated uranium in soil samples even at distances more than 200 km to the north of Chernobyl NPP (Mogilev region). The concentration of (236)U in the upper 0-10 cm soil layers varied from 2 x 10(-9)g g(-1) within radioactive spots close to the Chernobyl NPP to 3 x 10(-13)g g(-1) on a sampling site located by >200 km from Chernobyl.
Energy Technology Data Exchange (ETDEWEB)
Boulyga, Sergei F. [Institute of Inorganic Chemistry and Analytical Chemistry, Johannes Gutenberg-University Mainz, Duesbergweg 10-14, 55099 Mainz (Germany)]. E-mail: sergei.boulyga@univie.ac.at; Heumann, Klaus G. [Institute of Inorganic Chemistry and Analytical Chemistry, Johannes Gutenberg-University Mainz, Duesbergweg 10-14, 55099 Mainz (Germany)
2006-07-01
A method by inductively coupled plasma mass spectrometry (Icp-Ms) was developed which allows the measurement of {sup 236}U at concentration ranges down to 3 x 10{sup -14} g g{sup -1} and extremely low {sup 236}U/{sup 238}U isotope ratios in soil samples of 10{sup -7}. By using the high-efficiency solution introduction system APEX in connection with a sector-field ICP-MS a sensitivity of more than 5000 counts fg{sup -1} uranium was achieved. The use of an aerosol desolvating unit reduced the formation rate of uranium hydride ions UH{sup +}/U{sup +} down to a level of 10{sup -6}. An abundance sensitivity of 3 x 10{sup -7} was observed for {sup 236}U/{sup 238}U isotope ratio measurements at mass resolution 4000. The detection limit for {sup 236}U and the lowest detectable {sup 236}U/{sup 238}U isotope ratio were improved by more than two orders of magnitude compared with corresponding values by alpha spectrometry. Determination of uranium in soil samples collected in the vicinity of Chernobyl nuclear power plant (NPP) resulted in that the {sup 236}U/{sup 238}U isotope ratio is a much more sensitive and accurate marker for environmental contamination by spent uranium in comparison to the {sup 235}U/{sup 238}U isotope ratio. The ICP-MS technique allowed for the first time detection of irradiated uranium in soil samples even at distances more than 200 km to the north of Chernobyl NPP (Mogilev region). The concentration of {sup 236}U in the upper 0-10 cm soil layers varied from 2 x 10{sup -9} g g{sup -1} within radioactive spots close to the Chernobyl NPP to 3 x 10{sup -13} g g{sup -1} on a sampling site located by >200 km from Chernobyl.
The report gives results of an evaluation of the heat transfer performance of pure hydrofluorocarbon (HFC)-236ea for high performance enhanced tubes which had not been previously used in Navy shipboard chillers. Shell-side heat transfer coefficient data are presented for condensa...
(236)U and (239,)(240)Pu ratios from soils around an Australian nuclear weapons test site.
Tims, S G; Froehlich, M B; Fifield, L K; Wallner, A; De Cesare, M
2016-01-01
The isotopes (236)U, (239)Pu and (240)Pu are present in surface soils as a result of global fallout from nuclear weapons tests carried out in the 1950's and 1960's. These isotopes potentially constitute artificial tracers of recent soil erosion and sediment movement. Only Accelerator Mass Spectrometry has the requisite sensitivity to measure all three isotopes at these environmental levels. Coupled with its relatively high throughput capabilities, this makes it feasible to conduct studies of erosion across the geographical extent of the Australian continent. In the Australian context, however, global fallout is not the only source of these isotopes. As part of its weapons development program the United Kingdom carried out a series of atmospheric and surface nuclear weapons tests at Maralinga, South Australia in 1956 and 1957. The tests have made a significant contribution to the Pu isotopic abundances present in the region around Maralinga and out to distances ∼1000 km, and impact on the assessment techniques used in the soil and sediment tracer studies. Quantification of the relative fallout contribution derived from detonations at Maralinga is complicated owing to significant contamination around the test site from numerous nuclear weapons safety trials that were also carried out around the site. We show that (236)U can provide new information on the component of the fallout that is derived from the local nuclear weapons tests, and highlight the potential of (236)U as a new fallout tracer. Crown Copyright © 2015. Published by Elsevier Ltd. All rights reserved.
Energy Technology Data Exchange (ETDEWEB)
Denyak, V.V. [National Science Center ' ' Kharkov Institute of Physics and Technology' ' , Kharkiv (Ukraine); Pele Pequeno Principe Research Institute, Curitiba (Brazil); Khvastunov, V.M. [National Science Center ' ' Kharkov Institute of Physics and Technology' ' , Kharkiv (Ukraine); Paschuk, S.A. [Federal University of Technology - Parana, Curitiba (Brazil); Schelin, H.R. [Federal University of Technology - Parana, Curitiba (Brazil); Pele Pequeno Principe Research Institute, Curitiba (Brazil)
2013-04-15
Fission of the even-even nuclei {sup 232}Th, {sup 236,238}U and even-odd nuclei {sup 233,235}U by linearly polarized photons has been studied at excitation energies in the region of a giant dipole resonance. The performed investigations unambiguously showed the existence of the fragment mass dependence of the cross section azimuthal asymmetry in the photofission of {sup 236}U and {sup 238}U. In addition, the obtained results provided the first evidence for the possible difference between the asymmetry values in asymmetric and symmetric mass distribution regions in the case of {sup 236}U. The measured cross section azimuthal asymmetry of the fission of {sup 232}Th does not show any fragment mass dependence. In the even-odd nuclei {sup 233}U and {sup 235}U the difference between the far-asymmetric and other mass distribution regions was also observed but with the statistical uncertainty not small enough for definitive conclusion. (orig.)
Khachatryan, Vardan; Tumasyan, Armen; Adam, Wolfgang; Bergauer, Thomas; Dragicevic, Marko; Ero, Janos; Friedl, Markus; Fruehwirth, Rudolf; Ghete, Vasile Mihai; Hammer, Josef; Haensel, Stephan; Hoch, Michael; Hormann, Natascha; Hrubec, Josef; Jeitler, Manfred; Kasieczka, Gregor; Krammer, Manfred; Liko, Dietrich; Mikulec, Ivan; Pernicka, Manfred; Rohringer, Herbert; Schofbeck, Robert; Strauss, Josef; Taurok, Anton; Teischinger, Florian; Waltenberger, Wolfgang; Walzel, Gerhard; Widl, Edmund; Wulz, Claudia-Elisabeth; Mossolov, Vladimir; Shumeiko, Nikolai; Suarez Gonzalez, Juan; Benucci, Leonardo; De Wolf, Eddi A.; Hashemi, Majid; Janssen, Xavier; Maes, Thomas; Mucibello, Luca; Ochesanu, Silvia; Rougny, Romain; Selvaggi, Michele; Van Haevermaet, Hans; Van Mechelen, Pierre; Van Remortel, Nick; Adler, Volker; Beauceron, Stephanie; D'Hondt, Jorgen; Devroede, Olivier; Kalogeropoulos, Alexis; Maes, Joris; Mozer, Matthias Ulrich; Tavernier, Stefaan; Van Doninck, Walter; Van Mulders, Petra; Villella, Ilaria; Chabert, Eric Christian; Charaf, Otman; Clerbaux, Barbara; De Lentdecker, Gilles; Dero, Vincent; Gay, Arnaud; Hammad, Gregory Habib; Marage, Pierre Edouard; Vander Velde, Catherine; Vanlaer, Pascal; Wickens, John; Grunewald, Martin; Klein, Benjamin; Marinov, Andrey; Ryckbosch, Dirk; Thyssen, Filip; Tytgat, Michael; Vanelderen, Lukas; Verwilligen, Piet; Walsh, Sinead; Basegmez, Suzan; Bruno, Giacomo; Caudron, Julien; Cortina Gil, Eduardo; De Favereau De Jeneret, Jerome; Delaere, Christophe; Demin, Pavel; Favart, Denis; Giammanco, Andrea; Gregoire, Ghislain; Hollar, Jonathan; Lemaitre, Vincent; Militaru, Otilia; Ovyn, Severine; Piotrzkowski, Krzysztof; Quertenmont, Loic; Schul, Nicolas; Beliy, Nikita; Caebergs, Thierry; Daubie, Evelyne; Herquet, Philippe; Alves, Gilvan; Pol, Maria Elena; Henrique Gomes e Souza, Moacyr; Carvalho, Wagner; Melo Da Costa, Eliza; De Jesus Damiao, Dilson; De Oliveira Martins, Carley; Fonseca De Souza, Sandro; Mundim, Luiz; Oguri, Vitor; Santoro, Alberto; Silva Do Amaral, Sheila Mara; Sznajder, Andre; Torres Da Silva De Araujo, Felipe; De Almeida Dias, Flavia; Dias, Marco Andre Ferreira; Tomei, Thiago; De Moraes Gregores, Eduardo; Da Cunha Marinho, Franciole; Novaes, Sergio F.; Padula, Sandra; Damgov, Jordan; Darmenov, Nikolay; Dimitrov, Lubomir; Genchev, Vladimir; Iaydjiev, Plamen; Piperov, Stefan; Stoykova, Stefka; Sultanov, Georgi; Trayanov, Rumen; Vankov, Ivan; Hadjiiska, Roumyana; Kozhuharov, Venelin; Litov, Leandar; Mateev, Matey; Pavlov, Borislav; Petkov, Peicho; Chen, Guo-Ming; Chen, He-Sheng; Jiang, Chun-Hua; Liang, Dong; Liang, Song; Meng, Xiangwei; Tao, Junquan; Wang, Jian; Wang, Xianyou; Wang, Zheng; Zang, Jingjing; Zhang, Zhen; Ban, Yong; Guo, Shuang; Hu, Zhen; Mao, Yajun; Qian, Si-Jin; Teng, Haiyun; Zhu, Bo; Andres Carrillo Montoya, Camilo; Gomez Moreno, Bernardo; Andres Ocampo Rios, Alberto; Sanabria, Juan Carlos; Godinovic, Nikola; Lelas, Karlo; Plestina, Roko; Polic, Dunja; Puljak, Ivica; Antunovic, Zeljko; Dzelalija, Mile; Brigljevic, Vuko; Duric, Senka; Kadija, Kreso; Morovic, Srecko; Attikis, Alexandros; Fereos, Reginos; Galanti, Mario; Mousa, Jehad; Papadakis, Antonakis; Ptochos, Fotios; Razis, Panos A.; Tsiakkouri, Demetra; Zinonos, Zinonas; Hektor, Andi; Kadastik, Mario; Kannike, Kristjan; Muntel, Mait; Raidal, Martti; Rebane, Liis; Eerola, Paula; Czellar, Sandor; Harkonen, Jaakko; Heikkinen, Mika Aatos; Karimaki, Veikko; Kinnunen, Ritva; Klem, Jukka; Kortelainen, Matti J.; Lampen, Tapio; Lassila-Perini, Kati; Lehti, Sami; Linden, Tomas; Luukka, Panja-Riina; Maenpaa, Teppo; Tuominen, Eija; Tuominiemi, Jorma; Tuovinen, Esa; Ungaro, Donatella; Wendland, Lauri; Banzuzi, Kukka; Korpela, Arja; Tuuva, Tuure; Sillou, Daniel; Besancon, Marc; Dejardin, Marc; Denegri, Daniel; Descamps, Julien; Fabbro, Bernard; Faure, Jean-Louis; Ferri, Federico; Ganjour, Serguei; Gentit, Francois-Xavier; Givernaud, Alain; Gras, Philippe; Hamel de Monchenault, Gautier; Jarry, Patrick; Locci, Elizabeth; Malcles, Julie; Marionneau, Matthieu; Millischer, Laurent; Rander, John; Rosowsky, Andre; Rousseau, Delphine; Titov, Maksym; Verrecchia, Patrice; Baffioni, Stephanie; Bianchini, Lorenzo; Broutin, Clementine; Busson, Philippe; Charlot, Claude; Dobrzynski, Ludwik; Elgammal, Sherif; Granier de Cassagnac, Raphael; Haguenauer, Maurice; Mine, Philippe; Paganini, Pascal; Sirois, Yves; Thiebaux, Christophe; Zabi, Alexandre; Agram, Jean-Laurent; Besson, Auguste; Bloch, Daniel; Bodin, David; Brom, Jean-Marie; Cardaci, Marco; Conte, Eric; Drouhin, Frederic; Ferro, Cristina; Fontaine, Jean-Charles; Gele, Denis; Goerlach, Ulrich; Greder, Sebastien; Juillot, Pierre; Le Bihan, Anne-Catherine; Mikami, Yoshinari; Ripp-Baudot, Isabelle; Speck, Joaquim; Van Hove, Pierre; Baty, Clement; Bedjidian, Marc; Bondu, Olivier; Boudoul, Gaelle; Boumediene, Djamel; Brun, Hugues; Chanon, Nicolas; Chierici, Roberto; Contardo, Didier; Depasse, Pierre; El Mamouni, Houmani; Fassi, Farida; Fay, Jean; Gascon, Susan; Ille, Bernard; Kurca, Tibor; Le Grand, Thomas; Lethuillier, Morgan; Mirabito, Laurent; Perries, Stephane; Tosi, Silvano; Tschudi, Yohann; Verdier, Patrice; Xiao, Hong; Roinishvili, Vladimir; Anagnostou, Georgios; Edelhoff, Matthias; Feld, Lutz; Heracleous, Natalie; Hindrichs, Otto; Jussen, Ruediger; Klein, Katja; Merz, Jennifer; Mohr, Niklas; Ostapchuk, Andrey; Pandoulas, Demetrios; Perieanu, Adrian; Raupach, Frank; Sammet, Jan; Schael, Stefan; Sprenger, Daniel; Weber, Hendrik; Weber, Martin; Wittmer, Bruno; Actis, Oxana; Bender, Walter; Biallass, Philipp; Erdmann, Martin; Frangenheim, Jens; Hebbeker, Thomas; Hinzmann, Andreas; Hoepfner, Kerstin; Hof, Carsten; Kirsch, Matthias; Klimkovich, Tatsiana; Kreuzer, Peter; Lanske, Dankfried; Merschmeyer, Markus; Meyer, Arnd; Pieta, Holger; Reithler, Hans; Schmitz, Stefan Antonius; Sowa, Michael; Steggemann, Jan; Teyssier, Daniel; Zeidler, Clemens; Bontenackels, Michael; Davids, Martina; Duda, Markus; Flugge, Gunter; Geenen, Heiko; Giffels, Manuel; Haj Ahmad, Wael; Heydhausen, Dirk; Kress, Thomas; Kuessel, Yvonne; Linn, Alexander; Nowack, Andreas; Perchalla, Lars; Pooth, Oliver; Sauerland, Philip; Stahl, Achim; Thomas, Maarten; Tornier, Daiske; Zoeller, Marc Henning; Aldaya Martin, Maria; Behrens, Ulf; Borras, Kerstin; Campbell, Alan; Castro, Elena; Dammann, Dirk; Eckerlin, Guenter; Flossdorf, Alexander; Flucke, Gero; Geiser, Achim; Hauk, Johannes; Jung, Hannes; Kasemann, Matthias; Katkov, Igor; Kleinwort, Claus; Kluge, Hannelies; Knutsson, Albert; Kuznetsova, Ekaterina; Lange, Wolfgang; Lohmann, Wolfgang; Mankel, Rainer; Marienfeld, Markus; Meyer, Andreas Bernhard; Mnich, Joachim; Olzem, Jan; Parenti, Andrea; Schmidt, Ringo; Schoerner-Sadenius, Thomas; Sen, Niladri; Stein, Matthias; Volyanskyy, Dmytro; Wissing, Christoph; Autermann, Christian; Draeger, Jula; Eckstein, Doris; Enderle, Holger; Gebbert, Ulla; Kaschube, Kolja; Kaussen, Gordon; Klanner, Robert; Mura, Benedikt; Naumann-Emme, Sebastian; Nowak, Friederike; Sander, Christian; Schleper, Peter; Schroder, Matthias; Schum, Torben; Stadie, Hartmut; Steinbruck, Georg; Thomsen, Jan; Wolf, Roger; Bauer, Julia; Blum, Peter; Buege, Volker; Cakir, Altan; Chwalek, Thorsten; Daeuwel, Daniel; De Boer, Wim; Dierlamm, Alexander; Dirkes, Guido; Feindt, Michael; Frey, Martin; Gruschke, Jasmin; Hackstein, Christoph; Hartmann, Frank; Heinrich, Michael; Hoffmann, Karl-heinz; Honc, Simon; Kuhr, Thomas; Martschei, Daniel; Mueller, Steffen; Muller, Thomas; Niegel, Martin; Oberst, Oliver; Oehler, Andreas; Ott, Jochen; Peiffer, Thomas; Piparo, Danilo; Quast, Gunter; Rabbertz, Klaus; Renz, Manuel; Sabellek, Andreas; Saout, Christophe; Scheurer, Armin; Schieferdecker, Philipp; Schilling, Frank-Peter; Schott, Gregory; Simonis, Hans-Jurgen; Stober, Fred-Markus; Wagner-Kuhr, Jeannine; Zeise, Manuel; Zhukov, Valery; Ziebarth, Eva Barbara; Daskalakis, Georgios; Geralis, Theodoros; Karafasoulis, Konstantinos; Kyriakis, Aristoteles; Loukas, Demitrios; Markou, Athanasios; Markou, Christos; Mavrommatis, Charalampos; Petrakou, Eleni; Zachariadou, Aikaterini; Agapitos, Antonis; Gouskos, Loukas; Katsas, Panagiotis; Panagiotou, Apostolos; Saganis, Konstantinos; Xaxiris, Evangelos; Evangelou, Ioannis; Kokkas, Panagiotis; Manthos, Nikolaos; Papadopoulos, Ioannis; Triantis, Frixos A.; Aranyi, Attila; Bencze, Gyorgy; Boldizsar, Laszlo; Debreczeni, Gergely; Hajdu, Csaba; Horvath, Dezso; Kapusi, Anita; Krajczar, Krisztian; Laszlo, Andras; Sikler, Ferenc; Vesztergombi, Gyorgy; Beni, Noemi; Molnar, Jozsef; Palinkas, Jozsef; Szillasi, Zoltan; Veszpremi, Viktor; Raics, Peter; Trocsanyi, Zoltan Laszlo; Ujvari, Balazs; Bansal, Sunil; Beri, Suman Bala; Bhatnagar, Vipin; Jindal, Monika; Kaur, Manjit; Kohli, Jatinder Mohan; Mehta, Manuk Zubin; Nishu, Nishu; Saini, Lovedeep Kaur; Sharma, Archana; Sharma, Richa; Singh, Anil; Singh, Jas Bir; Singh, Supreet Pal; Ahuja, Sudha; Bhattacharya, Satyaki; Chauhan, Sushil; Choudhary, Brajesh C.; Gupta, Pooja; Jain, Sandhya; Jain, Shilpi; Kumar, Ashok; Ranjan, Kirti; Shivpuri, Ram Krishen; Choudhury, Rajani Kant; Dutta, Dipanwita; Kailas, Swaminathan; Kataria, Sushil Kumar; Mohanty, Ajit Kumar; Pant, Lalit Mohan; Shukla, Prashant; Suggisetti, Praveenkumar; Aziz, Tariq; Guchait, Monoranjan; Gurtu, Atul; Maity, Manas; Majumder, Devdatta; Majumder, Gobinda; Mazumdar, Kajari; Nayak, Aruna; Saha, Anirban; Sudhakar, Katta; Wickramage, Nadeesha; Banerjee, Sudeshna; Dugad, Shashikant; Mondal, Naba Kumar; Arfaei, Hessamaddin; Bakhshiansohi, Hamed; Fahim, Ali; Jafari, Abideh; Mohammadi Najafabadi, Mojtaba; Moshaii, Ahmad; Paktinat Mehdiabadi, Saeid; Zeinali, Maryam; Felcini, Marta; Abbrescia, Marcello; Barbone, Lucia; Colaleo, Anna; Creanza, Donato; De Filippis, Nicola; De Palma, Mauro; Dimitrov, Anton; Fedele, Francesca; Fiore, Luigi; Iaselli, Giuseppe; Lusito, Letizia; Maggi, Giorgio; Maggi, Marcello; Manna, Norman; Marangelli, Bartolomeo; My, Salvatore; Nuzzo, Salvatore; Pierro, Giuseppe Antonio; Polese, Giovanni; Pompili, Alexis; Pugliese, Gabriella; Romano, Francesco; Roselli, Giuseppe; Selvaggi, Giovanna; Silvestris, Lucia; Tupputi, Salvatore; Zito, Giuseppe; Abbiendi, Giovanni; Bonacorsi, Daniele; Braibant-Giacomelli, Sylvie; Capiluppi, Paolo; Cavallo, Francesca Romana; Codispoti, Giuseppe; Cuffiani, Marco; Dallavalle, Gaetano-Marco; Fabbri, Fabrizio; Fanfani, Alessandra; Fasanella, Daniele; Giacomelli, Paolo; Giunta, Marina; Grandi, Claudio; Marcellini, Stefano; Masetti, Gianni; Montanari, Alessandro; Navarria, Francesco; Odorici, Fabrizio; Perrotta, Andrea; Rossi, Antonio; Rovelli, Tiziano; Siroli, Gianni; Travaglini, Riccardo; Albergo, Sebastiano; Chiorboli, Massimiliano; Costa, Salvatore; Potenza, Renato; Tricomi, Alessia; Tuve, Cristina; Barbagli, Giuseppe; Broccolo, Giuseppe; Ciulli, Vitaliano; Civinini, Carlo; D'Alessandro, Raffaello; Focardi, Ettore; Frosali, Simone; Gallo, Elisabetta; Genta, Chiara; Landi, Gregorio; Lenzi, Piergiulio; Meschini, Marco; Paoletti, Simone; Sguazzoni, Giacomo; Tropiano, Antonio; Bianco, Stefano; Colafranceschi, Stefano; Fabbri, Franco; Piccolo, Davide; Fabbricatore, Pasquale; Musenich, Riccardo; Benaglia, Andrea; Cerati, Giuseppe Benedetto; De Guio, Federico; Ghezzi, Alessio; Govoni, Pietro; Malberti, Martina; Malvezzi, Sandra; Martelli, Arabella; Menasce, Dario; Miccio, Vincenzo; Moroni, Luigi; Negri, Pietro; Paganoni, Marco; Pedrini, Daniele; Pullia, Antonino; Ragazzi, Stefano; Redaelli, Nicola; Sala, Silvano; Salerno, Roberto; Tabarelli de Fatis, Tommaso; Tancini, Valentina; Taroni, Silvia; Cimmino, Anna; De Gruttola, Michele; Fabozzi, Francesco; Iorio, Alberto Orso Maria; Lista, Luca; Noli, Pasquale; Paolucci, Pierluigi; Azzi, Patrizia; Bacchetta, Nicola; Bellan, Paolo; Biasotto, Massimo; Carlin, Roberto; Checchia, Paolo; De Mattia, Marco; Dorigo, Tommaso; Fanzago, Federica; Gasparini, Fabrizio; Giubilato, Piero; Gonella, Franco; Gresele, Ambra; Gulmini, Michele; Lacaprara, Stefano; Lazzizzera, Ignazio; Maron, Gaetano; Mattiazzo, Serena; Meneguzzo, Anna Teresa; Passaseo, Marina; Pegoraro, Matteo; Pozzobon, Nicola; Ronchese, Paolo; Torassa, Ezio; Tosi, Mia; Vanini, Sara; Ventura, Sandro; Zotto, Pierluigi; Baesso, Paolo; Berzano, Umberto; Pagano, Davide; Ratti, Sergio P.; Riccardi, Cristina; Torre, Paola; Vitulo, Paolo; Viviani, Claudio; Biasini, Maurizio; Bilei, Gian Mario; Caponeri, Benedetta; Fano, Livio; Lariccia, Paolo; Lucaroni, Andrea; Mantovani, Giancarlo; Nappi, Aniello; Santocchia, Attilio; Servoli, Leonello; Volpe, Roberta; Azzurri, Paolo; Bagliesi, Giuseppe; Bernardini, Jacopo; Boccali, Tommaso; Bocci, Andrea; Castaldi, Rino; Dell'Orso, Roberto; Dutta, Suchandra; Fiori, Francesco; Foa, Lorenzo; Gennai, Simone; Giassi, Alessandro; Kraan, Aafke; Ligabue, Franco; Lomtadze, Teimuraz; Martini, Luca; Messineo, Alberto; Palla, Fabrizio; Palmonari, Francesco; Sarkar, Subir; Segneri, Gabriele; Serban, Alin Titus; Spagnolo, Paolo; Tenchini, Roberto; Tonelli, Guido; Venturi, Andrea; Verdini, Piero Giorgio; Barone, Luciano; Cavallari, Francesca; del Re, Daniele; Di Marco, Emanuele; Diemoz, Marcella; Franci, Daniele; Grassi, Marco; Longo, Egidio; Organtini, Giovanni; Palma, Alessandro; Pandolfi, Francesco; Paramatti, Riccardo; Rahatlou, Shahram; Rovelli, Chiara; Amapane, Nicola; Arcidiacono, Roberta; Argiro, Stefano; Arneodo, Michele; Biino, Cristina; Borgia, Maria Assunta; Botta, Cristina; Cartiglia, Nicolo; Castello, Roberto; Costa, Marco; Dellacasa, Giulio; Demaria, Natale; Graziano, Alberto; Mariotti, Chiara; Marone, Matteo; Maselli, Silvia; Migliore, Ernesto; Mila, Giorgia; Monaco, Vincenzo; Musich, Marco; Obertino, Maria Margherita; Pastrone, Nadia; Romero, Alessandra; Ruspa, Marta; Sacchi, Roberto; Solano, Ada; Staiano, Amedeo; Trocino, Daniele; Vilela Pereira, Antonio; Ambroglini, Filippo; Belforte, Stefano; Cossutti, Fabio; Della Ricca, Giuseppe; Gobbo, Benigno; Penzo, Aldo; Chang, Sunghyun; Chung, Jin Hyuk; Kim, Dong Hee; Kim, Gui Nyun; Kong, Dae Jung; Park, Hyangkyu; Son, Dong-Chul; Kim, Jaeho; Song, Sanghyeon; Jung, Seung Yong; Hong, Byung-Sik; Kim, Hyunchul; Kim, Ji Hyun; Lee, Kyong Sei; Moon, Dong Ho; Park, Sung Keun; Rhee, Han-Bum; Sim, Kwang Souk; Kim, Jangho; Choi, Minkyoo; Park, In Kyu; Choi, Suyong; Choi, Young-Il; Choi, Young Kyu; Goh, Junghwan; Jo, Youngkwon; Kwon, Jeongteak; Lee, Jongseok; Lee, Sungeun; Janulis, Mindaugas; Martisiute, Dalia; Petrov, Pavel; Sabonis, Tomas; Castilla Valdez, Heriberto; Sanchez Hernandez, Alberto; Carrillo Moreno, Salvador; Ibarguen, Humberto Antonio Salazar; Casimiro Linares, Edgar; Morelos Pineda, Antonio; Allfrey, Philip; Krofcheck, David; Aumeyr, Thomas; Butler, Philip H.; Signal, Tony; Williams, Jennifer C.; Ahmad, Muhammad; Ahmed, Ijaz; Asghar, Muhammad Irfan; Hoorani, Hafeez R.; Khan, Wajid Ali; Khurshid, Taimoor; Qazi, Shamona; Cwiok, Mikolaj; Dominik, Wojciech; Doroba, Krzysztof; Konecki, Marcin; Krolikowski, Jan; Frueboes, Tomasz; Gokieli, Ryszard; Gorski, Maciej; Kazana, Malgorzata; Nawrocki, Krzysztof; Szleper, Michal; Wrochna, Grzegorz; Zalewski, Piotr; Almeida, Nuno; Bargassa, Pedrame; David Tinoco Mendes, Andre; Faccioli, Pietro; Ferreira Parracho, Pedro Guilherme; Gallinaro, Michele; Musella, Pasquale; Ribeiro, Pedro Quinaz; Seixas, Joao; Silva, Pedro; Varela, Joao; Wohri, Hermine Katharina; Altsybeev, Igor; Belotelov, Ivan; Bunin, Pavel; Finger, Miroslav; Finger, Michael, Jr.; Golutvin, Igor; Kamenev, Alexey; Karjavin, Vladimir; Kozlov, Guennady; Lanev, Alexander; Moisenz, Petr; Palichik, Vladimir; Perelygin, Victor; Shmatov, Sergey; Smirnov, Vitaly; Vishnevskiy, Alexander; Volodko, Anton; Zarubin, Anatoli; Ivanov, Yury; Kim, Victor; Levchenko, Petr; Obrant, Gennady; Shcheglov, Yury; Shchetkovskiy, Alexander; Smirnov, Igor; Sulimov, Valentin; Vavilov, Sergey; Vorobyev, Alexey; Andreev, Yuri; Gninenko, Sergei; Golubev, Nikolai; Karneyeu, Anton; Kirsanov, Mikhail; Krasnikov, Nikolai; Matveev, Viktor; Pashenkov, Anatoli; Toropin, Alexander; Troitsky, Sergey; Epshteyn, Vladimir; Gavrilov, Vladimir; Ilina, Natalia; Kaftanov, Vitali; Kossov, Mikhail; Krokhotin, Andrey; Kuleshov, Sergey; Oulianov, Alexei; Safronov, Grigory; Semenov, Sergey; Shreyber, Irina; Stolin, Viatcheslav; Vlasov, Evgueni; Zhokin, Alexander; Boos, Edouard; Dubinin, Mikhail; Dudko, Lev; Ershov, Alexander; Gribushin, Andrey; Kodolova, Olga; Lokhtin, Igor; Petrushanko, Sergey; Sarycheva, Ludmila; Savrin, Viktor; Vardanyan, Irina; Dremin, Igor; Kirakosyan, Martin; Konovalova, Nina; Rusakov, Sergey V.; Vinogradov, Alexey; Azhgirey, Igor; Bitioukov, Sergei; Datsko, Kirill; Kachanov, Vassili; Konstantinov, Dmitri; Krychkine, Victor; Petrov, Vladimir; Ryutin, Roman; Slabospitsky, Sergey; Sobol, Andrei; Sytine, Alexandre; Tourtchanovitch, Leonid; Troshin, Sergey; Tyurin, Nikolay; Uzunian, Andrey; Volkov, Alexey; Adzic, Petar; Djordjevic, Milos; Maletic, Dimitrije; Puzovic, Jovan; Aguilar-Benitez, Manuel; Alcaraz Maestre, Juan; Arce, Pedro; Battilana, Carlo; Calvo, Enrique; Cepeda, Maria; Cerrada, Marcos; Chamizo Llatas, Maria; Colino, Nicanor; De La Cruz, Begona; Diez Pardos, Carmen; Fernandez Bedoya, Cristina; Fernandez Ramos, Juan Pablo; Ferrando, Antonio; Flix, Jose; Fouz, Maria Cruz; Garcia-Abia, Pablo; Gonzalez Lopez, Oscar; Goy Lopez, Silvia; Hernandez, Jose M.; Josa, Maria Isabel; Merino, Gonzalo; Pelayo, Jesus Puerta; Romero, Luciano; Santaolalla, Javier; Willmott, Carlos; Albajar, Carmen; de Troconiz, Jorge F.; Cuevas, Javier; Fernandez Menendez, Javier; Gonzalez Caballero, Isidro; Iglesias, Lara Lloret; Vizan Garcia, Jesus Manuel; Cabrillo, Iban Jose; Calderon, Alicia; Chuang, Shan-Huei; Diaz Merino, Irma; Diez Gonzalez, Carlos; Duarte Campderros, Jordi; Fernandez, Marcos; Gomez, Gervasio; Gonzalez Sanchez, Javier; Gonzalez Suarez, Rebeca; Jorda, Clara; Pardo, Patricia Lobelle; Lopez Virto, Amparo; Marco, Jesus; Marco, Rafael; Martinez Rivero, Celso; Martinez Ruiz del Arbol, Pablo; Matorras, Francisco; Rodrigo, Teresa; Jimeno, Alberto Ruiz; Scodellaro, Luca; Sanudo, Mar Sobron; Vila, Ivan; Vilar Cortabitarte, Rocio; Abbaneo, Duccio; Auffray, Etiennette; Baillon, Paul; Ball, Austin; Barney, David; Beaudette, Florian; Beccati, Barbara; Bell, Alan James; Bellan, Riccardo; Benedetti, Daniele; Bernet, Colin; Bialas, Wojciech; Bloch, Philippe; Bolognesi, Sara; Bona, Marcella; Breuker, Horst; Bunkowski, Karol; Camporesi, Tiziano; Cano, Eric; Cattai, Ariella; Cerminara, Gianluca; Christiansen, Tim; Coarasa Perez, Jose Antonio; Covarelli, Roberto; Cure, Benoit; Dahms, Torsten; De Roeck, Albert; Elliott-Peisert, Anna; Funk, Wolfgang; Gaddi, Andrea; Gerwig, Hubert; Gigi, Dominique; Gill, Karl; Giordano, Domenico; Glege, Frank; Gowdy, Stephen; Guiducci, Luigi; Gutleber, Johannes; Hartl, Christian; Harvey, John; Hegner, Benedikt; Henderson, Conor; Hoffmann, Hans Falk; Honma, Alan; Huhtinen, Mika; Innocente, Vincenzo; Janot, Patrick; Lecoq, Paul; Leonidopoulos, Christos; Lourenco, Carlos; Macpherson, Alick; Maki, Tuula; Malgeri, Luca; Mannelli, Marcello; Masetti, Lorenzo; Meijers, Frans; Meridiani, Paolo; Mersi, Stefano; Meschi, Emilio; Moser, Roland; Mulders, Martijn; Noy, Matthew; Orimoto, Toyoko; Orsini, Luciano; Perez, Emmanuelle; Petrilli, Achille; Pfeiffer, Andreas; Pierini, Maurizio; Pimia, Martti; Racz, Attila; Rolandi, Gigi; Rovere, Marco; Ryjov, Vladimir; Sakulin, Hannes; Schafer, Christoph; Schlatter, Wolf-Dieter; Schwick, Christoph; Segoni, Ilaria; Sharma, Archana; Siegrist, Patrice; Simon, Michal; Sphicas, Paraskevas; Spiga, Daniele; Spiropulu, Maria; Stockli, Fabian; Traczyk, Piotr; Tropea, Paola; Tsirou, Andromachi; Istvan Veres, Gabor; Vichoudis, Paschalis; Voutilainen, Mikko; Zeuner, Wolfram Dietrich; Bertl, Willi; Deiters, Konrad; Erdmann, Wolfram; Gabathuler, Kurt; Horisberger, Roland; Ingram, Quentin; Kaestli, Hans-Christian; Konig, Stefan; Kotlinski, Danek; Langenegger, Urs; Meier, Frank; Renker, Dieter; Rohe, Tilman; Sibille, Jennifer; Starodumov, Andrei; Caminada, Lea; Casella, Maria Chiara; Chen, Zhiling; Cittolin, Sergio; Dambach, Sarah; Dissertori, Gunther; Dittmar, Michael; Eggel, Christina; Eugster, Jurg; Freudenreich, Klaus; Grab, Christoph; Herve, Alain; Hintz, Wieland; Lecomte, Pierre; Lustermann, Werner; Marchica, Carmelo; Milenovic, Predrag; Moortgat, Filip; Nardulli, Alessandro; Nessi-Tedaldi, Francesca; Pape, Luc; Pauss, Felicitas; Punz, Thomas; Rizzi, Andrea; Ronga, Frederic Jean; Sala, Leonardo; Sanchez, Ann-Karin; Sawley, Marie-Christine; Schinzel, Dietrich; Sordini, Viola; Stieger, Benjamin; Tauscher, Ludwig; Thea, Alessandro; Theofilatos, Konstantinos; Treille, Daniel; Trub, Peter; Weber, Matthias; Wehrli, Lukas; Weng, Joanna; Amsler, Claude; Chiochia, Vincenzo; De Visscher, Simon; Rikova, Mirena Ivova; Regenfus, Christian; Robmann, Peter; Rommerskirchen, Tanja; Schmidt, Alexander; Snoek, Hella; Tsirigkas, Dimitrios; Wilke, Lotte; Chang, Yuan-Hann; Chen, E.Augustine; Chen, Wan-Ting; Go, Apollo; Kuo, Chia-Ming; Li, Syue-Wei; Lin, Willis; Liu, Ming-Hsiung; Wu, Jing-Han; Bartalini, Paolo; Chang, Paoti; Chang, You-Hao; Chao, Yuan; Chen, Kai-Feng; Hou, George Wei-Shu; Hsiung, Yee; Lei, Yeong-Jyi; Lin, Sheng-wen; Lu, Rong-Shyang; Shiu, Jing-Ge; Tzeng, Yeng-ming; Ueno, Koji; Wang, Chin-chi; Wang, Minzu; Adiguzel, Aytul; Ayhan, Aydin; Bakirci, Mustafa Numan; Cerci, Salim; Demir, Zahide; Dozen, Candan; Dumanoglu, Isa; Eskut, Eda; Girgis, Semiray; Gurpinar, Emine; Karaman, Turker; Kayis Topaksu, Aysel; Onengut, Gulsen; Ozdemir, Kadri; Ozturk, Sertac; Polatoz, Ayse; Sahin, Ozge; Sengul, Ozden; Sogut, Kenan; Tali, Bayram; Topakli, Huseyin; Uzun, Dilber; Vergili, Latife Nukhet; Vergili, Mehmet; Akin, Ilina Vasileva; Aliev, Takhmasib; Bilmis, Selcuk; Deniz, Muhammed; Gamsizkan, Halil; Guler, Ali Murat; Ocalan, Kadir; Serin, Meltem; Sever, Ramazan; Surat, Ugur Emrah; Zeyrek, Mehmet; Deliomeroglu, Mehmet; Demir, Durmus; Gulmez, Erhan; Halu, Arda; Isildak, Bora; Kaya, Mithat; Kaya, Ozlem; Ozkorucuklu, Suat; Sonmez, Nasuf; Levchuk, Leonid; Bell, Peter; Bostock, Francis; Brooke, James John; Cheng, Teh Lee; Cussans, David; Frazier, Robert; Goldstein, Joel; Hansen, Maria; Heath, Greg P.; Heath, Helen F.; Hill, Christopher; Huckvale, Benedickt; Jackson, James; Kreczko, Lukasz; Mackay, Catherine Kirsty; Metson, Simon; Newbold, Dave M.; Nirunpong, Kachanon; Smith, Vincent J.; Ward, Simon; Basso, Lorenzo; Bell, Ken W.; Brew, Christopher; Brown, Robert M.; Camanzi, Barbara; Cockerill, David J.A.; Coughlan, John A.; Harder, Kristian; Harper, Sam; Kennedy, Bruce W.; Shepherd-Themistocleous, Claire; Tomalin, Ian R.; Womersley, William John; Worm, Steven; Bainbridge, Robert; Ball, Gordon; Ballin, Jamie; Beuselinck, Raymond; Buchmuller, Oliver; Colling, David; Cripps, Nicholas; Davies, Gavin; Della Negra, Michel; Foudas, Costas; Fulcher, Jonathan; Futyan, David; Hall, Geoffrey; Hays, Jonathan; Iles, Gregory; Karapostoli, Georgia; Lyons, Louis; MacEvoy, Barry C.; Magnan, Anne-Marie; Marrouche, Jad; Nash, Jordan; Nikitenko, Alexander; Papageorgiou, Anastasios; Pesaresi, Mark; Petridis, Konstantinos; Pioppi, Michele; Raymond, David Mark; Rompotis, Nikolaos; Rose, Andrew; Ryan, Matthew John; Seez, Christopher; Sharp, Peter; Stoye, Markus; Tapper, Alexander; Tourneur, Stephane; Vazquez Acosta, Monica; Virdee, Tejinder; Wakefield, Stuart; Wardrope, David; Whyntie, Tom; Barrett, Matthew; Chadwick, Matthew; Cole, Joanne; Hobson, Peter R.; Khan, Akram; Kyberd, Paul; Leslie, Dawn; Reid, Ivan; Teodorescu, Liliana; Bose, Tulika; Clough, Andrew; Heister, Arno; St. John, Jason; Lawson, Philip; Lazic, Dragoslav; Rohlf, James; Sulak, Lawrence; Andrea, Jeremy; Avetisyan, Aram; Bhattacharya, Saptaparna; Chou, John Paul; Cutts, David; Esen, Selda; Kukartsev, Gennadiy; Landsberg, Greg; Narain, Meenakshi; Nguyen, Duong; Speer, Thomas; Tsang, Ka Vang; Breedon, Richard; Calderon de la Barca Sanchez, Manuel; Cebra, Daniel; Chertok, Maxwell; Conway, John; Cox, Peter Timothy; Dolen, James; Erbacher, Robin; Friis, Evan; Ko, Winston; Kopecky, Alexandra; Lander, Richard; Liu, Haidong; Maruyama, Sho; Miceli, Tia; Nikolic, Milan; Pellett, Dave; Robles, Jorge; Searle, Matthew; Smith, John; Squires, Michael; Tripathi, Mani; Vasquez Sierra, Ricardo; Veelken, Christian; Andreev, Valeri; Arisaka, Katsushi; Cline, David; Cousins, Robert; Erhan, Samim; Farrell, Chris; Hauser, Jay; Ignatenko, Mikhail; Jarvis, Chad; Rakness, Gregory; Schlein, Peter; Tucker, Jordan; Valuev, Vyacheslav; Wallny, Rainer; Babb, John; Chandra, Avdhesh; Clare, Robert; Ellison, John Anthony; Gary, J.William; Hanson, Gail; Jeng, Geng-Yuan; Kao, Shih-Chuan; Liu, Feng; Liu, Hongliang; Luthra, Arun; Nguyen, Harold; Shen, Benjamin C.; Stringer, Robert; Sturdy, Jared; Wilken, Rachel; Wimpenny, Stephen; Andrews, Warren; Branson, James G.; Dusinberre, Elizabeth; Evans, David; Golf, Frank; Holzner, Andre; Kelley, Ryan; Lebourgeois, Matthew; Letts, James; Mangano, Boris; Muelmenstaedt, Johannes; Norman, Matthew; Padhi, Sanjay; Petrucciani, Giovanni; Pi, Haifeng; Pieri, Marco; Ranieri, Riccardo; Sani, Matteo; Sharma, Vivek; Simon, Sean; Vartak, Adish; Wurthwein, Frank; Yagil, Avraham; Barge, Derek; Blume, Michael; Campagnari, Claudio; D'Alfonso, Mariarosaria; Danielson, Thomas; Garberson, Jeffrey; Incandela, Joe; Justus, Christopher; Kalavase, Puneeth; Koay, Sue Ann; Kovalskyi, Dmytro; Krutelyov, Vyacheslav; Lamb, James; Lowette, Steven; Pavlunin, Viktor; Rebassoo, Finn; Ribnik, Jacob; Richman, Jeffrey; Rossin, Roberto; Stuart, David; To, Wing; Vlimant, Jean-Roch; Witherell, Michael; Apresyan, Artur; Bornheim, Adolf; Bunn, Julian; Gataullin, Marat; Litvine, Vladimir; Ma, Yousi; Newman, Harvey B.; Rogan, Christopher; Timciuc, Vladlen; Veverka, Jan; Wilkinson, Richard; Yang, Yong; Zhu, Ren-Yuan; Akgun, Bora; Carroll, Ryan; Ferguson, Thomas; Jang, Dong Wook; Jun, Soon Yung; Paulini, Manfred; Russ, James; Terentyev, Nikolay; Vogel, Helmut; Vorobiev, Igor; Cumalat, John Perry; Dinardo, Mauro Emanuele; Drell, Brian Robert; Ford, William T.; Heyburn, Bernadette; Luiggi Lopez, Eduardo; Nauenberg, Uriel; Stenson, Kevin; Ulmer, Keith; Wagner, Stephen Robert; Zang, Shi-Lei; Agostino, Lorenzo; Alexander, James; Blekman, Freya; Cassel, David; Chatterjee, Avishek; Das, Souvik; Eggert, Nicholas; Gibbons, Lawrence Kent; Heltsley, Brian; Hopkins, Walter; Khukhunaishvili, Aleko; Kreis, Benjamin; Patterson, Juliet Ritchie; Puigh, Darren; Ryd, Anders; Shi, Xin; Sun, Werner; Teo, Wee Don; Thom, Julia; Vaughan, Jennifer; Weng, Yao; Wittich, Peter; Biselli, Angela; Cirino, Guy; Winn, Dave; Albrow, Michael; Apollinari, Giorgio; Atac, Muzaffer; Bakken, Jon Alan; Banerjee, Sunanda; Bauerdick, Lothar A.T.; Beretvas, Andrew; Berryhill, Jeffrey; Bhat, Pushpalatha C.; Binkley, Morris; Bloch, Ingo; Borcherding, Frederick; Burkett, Kevin; Butler, Joel Nathan; Chetluru, Vasundhara; Cheung, Harry; Chlebana, Frank; Cihangir, Selcuk; Demarteau, Marcel; Eartly, David P.; Elvira, Victor Daniel; Fisk, Ian; Freeman, Jim; Gottschalk, Erik; Green, Dan; Gutsche, Oliver; Hahn, Alan; Hanlon, Jim; Harris, Robert M.; James, Eric; Jensen, Hans; Johnson, Marvin; Joshi, Umesh; Klima, Boaz; Kousouris, Konstantinos; Kunori, Shuichi; Kwan, Simon; Limon, Peter; Lueking, Lee; Lykken, Joseph; Maeshima, Kaori; Marraffino, John Michael; Mason, David; McBride, Patricia; McCauley, Thomas; Miao, Ting; Mishra, Kalanand; Mrenna, Stephen; Musienko, Yuri; Newman-Holmes, Catherine; O'Dell, Vivian; Popescu, Sorina; Prokofyev, Oleg; Sexton-Kennedy, Elizabeth; Sharma, Seema; Smith, Richard P.; Soha, Aron; Spalding, William J.; Spiegel, Leonard; Tan, Ping; Taylor, Lucas; Tkaczyk, Slawek; Uplegger, Lorenzo; Vaandering, Eric Wayne; Vidal, Richard; Whitmore, Juliana; Wu, Weimin; Yumiceva, Francisco; Yun, Jae Chul; Acosta, Darin; Avery, Paul; Bourilkov, Dimitri; Chen, Mingshui; Piero Di Giovanni, Gian; Dobur, Didar; Drozdetskiy, Alexey; Field, Richard D.; Fu, Yu; Furic, Ivan-Kresimir; Gartner, Joseph; Kim, Bockjoo; Klimenko, Sergey; Konigsberg, Jacobo; Korytov, Andrey; Kotov, Khristian; Kropivnitskaya, Anna; Kypreos, Theodore; Matchev, Konstantin; Mitselmakher, Guenakh; Pakhotin, Yuriy; Piedra Gomez, Jonatan; Prescott, Craig; Rapsevicius, Valdas; Remington, Ronald; Schmitt, Michael; Scurlock, Bobby; Wang, Dayong; Yelton, John; Zakaria, Mohammed; Ceron, Cristobal; Gaultney, Vanessa; Kramer, Laird; Lebolo, Luis Miguel; Linn, Stephan; Markowitz, Pete; Martinez, German; Luis Rodriguez, Jorge; Adams, Todd; Askew, Andrew; Chen, Jie; Dharmaratna, Welathantri G.D.; Diamond, Brendan; Gleyzer, Sergei V.; Haas, Jeff; Hagopian, Sharon; Hagopian, Vasken; Jenkins, Merrill; Johnson, Kurtis F.; Prosper, Harrison; Sekmen, Sezen; Baarmand, Marc M.; Guragain, Samir; Hohlmann, Marcus; Kalakhety, Himali; Mermerkaya, Hamit; Ralich, Robert; Vodopiyanov, Igor; Adams, Mark Raymond; Anghel, Ioana Maria; Apanasevich, Leonard; Bazterra, Victor Eduardo; Betts, Russell Richard; Callner, Jeremy; Cavanaugh, Richard; Dragoiu, Cosmin; Garcia-Solis, Edmundo Javier; Gerber, Cecilia Elena; Hofman, David Jonathan; Khalatian, Samvel; Mironov, Camelia; Shabalina, Elizaveta; Smoron, Agata; Varelas, Nikos; Akgun, Ugur; Albayrak, Elif Asli; Bilki, Burak; Cankocak, Kerem; Chung, Kwangzoo; Clarida, Warren; Duru, Firdevs; Lae, Chung Khim; McCliment, Edward; Merlo, Jean-Pierre; Mestvirishvili, Alexi; Moeller, Anthony; Nachtman, Jane; Newsom, Charles Ray; Norbeck, Edwin; Olson, Jonathan; Onel, Yasar; Ozok, Ferhat; Sen, Sercan; Wetzel, James; Yetkin, Taylan; Yi, Kai; Barnett, Bruce Arnold; Blumenfeld, Barry; Bonato, Alessio; Eskew, Christopher; Fehling, David; Giurgiu, Gavril; Gritsan, Andrei; Guo, Zijin; Hu, Guofan; Maksimovic, Petar; Rappoccio, Salvatore; Swartz, Morris; Tran, Nhan Viet; Baringer, Philip; Bean, Alice; Benelli, Gabriele; Grachov, Oleg; Murray, Michael; Radicci, Valeria; Sanders, Stephen; Wood, Jeffrey Scott; Zhukova, Victoria; Bandurin, Dmitry; Barfuss, Anne-fleur; Bolton, Tim; Chakaberia, Irakli; Kaadze, Ketino; Maravin, Yurii; Shrestha, Shruti; Svintradze, Irakli; Wan, Zongru; Gronberg, Jeffrey; Lange, David; Wright, Douglas; Baden, Drew; Boutemeur, Madjid; Eno, Sarah Catherine; Ferencek, Dinko; Hadley, Nicholas John; Kellogg, Richard G.; Kirn, Malina; Rossato, Kenneth; Rumerio, Paolo; Santanastasio, Francesco; Skuja, Andris; Temple, Jeffrey; Tonjes, Marguerite; Tonwar, Suresh C.; Twedt, Elizabeth; Alver, Burak; Bauer, Gerry; Bendavid, Joshua; Busza, Wit; Butz, Erik; Cali, Ivan Amos; Chan, Matthew; D'Enterria, David; Everaerts, Pieter; Gomez Ceballos, Guillelmo; Goncharov, Maxim; Hahn, Kristian Allan; Harris, Philip; Kim, Yongsun; Klute, Markus; Lee, Yen-Jie; Li, Wei; Loizides, Constantinos; Luckey, Paul David; Ma, Teng; Nahn, Steve; Paus, Christoph; Roland, Christof; Roland, Gunther; Rudolph, Matthew; Stephans, George; Sumorok, Konstanty; Sung, Kevin; Wenger, Edward Allen; Wyslouch, Bolek; Xie, Si; Yilmaz, Yetkin; Yoon, Sungho; Zanetti, Marco; Cole, Perrie; Cooper, Seth; Cushman, Priscilla; Dahmes, Bryan; De Benedetti, Abraham; Dudero, Phillip Russell; Franzoni, Giovanni; Haupt, Jason; Klapoetke, Kevin; Kubota, Yuichi; Mans, Jeremy; Petyt, David; Rekovic, Vladimir; Rusack, Roger; Sasseville, Michael; Singovsky, Alexander; Cremaldi, Lucien Marcus; Godang, Romulus; Kroeger, Rob; Perera, Lalith; Rahmat, Rahmat; Sanders, David A.; Sonnek, Peter; Summers, Don; Bloom, Kenneth; Bose, Suvadeep; Butt, Jamila; Claes, Daniel R.; Dominguez, Aaron; Eads, Michael; Keller, Jason; Kelly, Tony; Kravchenko, Ilya; Lazo-Flores, Jose; Lundstedt, Carl; Malbouisson, Helena; Malik, Sudhir; Snow, Gregory R.; Baur, Ulrich; Iashvili, Ia; Kharchilava, Avto; Kumar, Ashish; Smith, Kenneth; Strang, Michael; Alverson, George; Barberis, Emanuela; Baumgartel, Darin; Boeriu, Oana; Reucroft, Steve; Swain, John; Wood, Darien; Anastassov, Anton; Kubik, Andrew; Ofierzynski, Radoslaw Adrian; Pozdnyakov, Andrey; Schmitt, Michael; Stoynev, Stoyan; Velasco, Mayda; Won, Steven; Antonelli, Louis; Berry, Douglas; Hildreth, Michael; Jessop, Colin; Karmgard, Daniel John; Kolb, Jeff; Kolberg, Ted; Lannon, Kevin; Lynch, Sean; Marinelli, Nancy; Morse, David Michael; Ruchti, Randy; Valls, Nil; Warchol, Jadwiga; Wayne, Mitchell; Ziegler, Jill; Bylsma, Ben; Durkin, Lloyd Stanley; Gu, Jianhui; Killewald, Phillip; Ling, Ta-Yung; Williams, Grayson; Adam, Nadia; Berry, Edmund; Elmer, Peter; Gerbaudo, Davide; Halyo, Valerie; Hunt, Adam; Jones, John; Laird, Edward; Lopes Pegna, David; Marlow, Daniel; Medvedeva, Tatiana; Mooney, Michael; Olsen, James; Piroue, Pierre; Stickland, David; Tully, Christopher; Werner, Jeremy Scott; Zuranski, Andrzej; Acosta, Jhon Gabriel; Huang, Xing Tao; Lopez, Angel; Mendez, Hector; Oliveros, Sandra; Ramirez Vargas, Juan Eduardo; Zatzerklyaniy, Andriy; Alagoz, Enver; Barnes, Virgil E.; Bolla, Gino; Borrello, Laura; Bortoletto, Daniela; Everett, Adam; Garfinkel, Arthur F.; Gecse, Zoltan; Gutay, Laszlo; Jones, Matthew; Koybasi, Ozhan; Laasanen, Alvin T.; Leonardo, Nuno; Liu, Chang; Maroussov, Vassili; Merkel, Petra; Miller, David Harry; Neumeister, Norbert; Potamianos, K.; Sedov, Alexey; Shipsey, Ian; Silvers, David; Yoo, Hwi Dong; Zheng, Yu; Jindal, Pratima; Parashar, Neeti; Cuplov, Vesna; Ecklund, Karl Matthew; Geurts, Frank J.M.; Liu, Jinghua H.; Matveev, Mikhail; Morales, Jafet; Padley, Brian Paul; Redjimi, Radia; Roberts, Jay; Betchart, Burton; Bodek, Arie; Chung, Yeon Sei; de Barbaro, Pawel; Demina, Regina; Flacher, Henning; Garcia-Bellido, Aran; Gotra, Yury; Han, Jiyeon; Harel, Amnon; Korjenevski, Sergey; Miner, Daniel Carl; Orbaker, Douglas; Petrillo, Gianluca; Vishnevskiy, Dmitry; Zielinski, Marek; Bhatti, Anwar; Demortier, Luc; Goulianos, Konstantin; Hatakeyama, Kenichi; Lungu, Gheorghe; Mesropian, Christina; Yan, Ming; Atramentov, Oleksiy; Gershtein, Yuri; Halkiadakis, Eva; Hits, Dmitry; Lath, Amitabh; Rose, Keith; Schnetzer, Steve; Somalwar, Sunil; Stone, Robert; Thomas, Scott; Cerizza, Giordano; Hollingsworth, Matthew; Spanier, Stefan; Yang, Zong-Chang; York, Andrew; Asaadi, Jonathan; Eusebi, Ricardo; Gilmore, Jason; Gurrola, Alfredo; Kamon, Teruki; Khotilovich, Vadim; Nguyen, Chi Nhan; Pivarski, James; Safonov, Alexei; Sengupta, Sinjini; Toback, David; Weinberger, Michael; Akchurin, Nural; Jeong, Chiyoung; Lee, Sung Won; Roh, Youn; Sill, Alan; Volobouev, Igor; Wigmans, Richard; Yazgan, Efe; Brownson, Eric; Engh, Daniel; Florez, Carlos; Johns, Willard; Kurt, Pelin; Sheldon, Paul; Arenton, Michael Wayne; Balazs, Michael; Buehler, Marc; Conetti, Sergio; Cox, Bradley; Hirosky, Robert; Ledovskoy, Alexander; Neu, Christopher; Yohay, Rachel; Gollapinni, Sowjanya; Gunthoti, Kranti; Harr, Robert; Karchin, Paul Edmund; Mattson, Mark; Anderson, Michael; Bachtis, Michail; Bellinger, James Nugent; Carlsmith, Duncan; Dasu, Sridhara; Efron, Jonathan; Flood, Kevin; Gray, Lindsey; Grogg, Kira Suzanne; Grothe, Monika; Hall-Wilton, Richard; Klabbers, Pamela; Klukas, Jeffrey; Lanaro, Armando; Lazaridis, Christos; Leonard, Jessica; Lomidze, David; Loveless, Richard; Mohapatra, Ajit; Reeder, Don; Savin, Alexander; Smith, Wesley H.; Swanson, Joshua; Weinberg, Marc
2010-01-01
Measurements of inclusive charged-hadron transverse-momentum and pseudorapidity distributions are presented for proton-proton collisions at sqrt(s) = 0.9 and 2.36 TeV. The data were collected with the CMS detector during the LHC commissioning in December 2009. For non-single-diffractive interactions, the average charged-hadron transverse momentum is measured to be 0.46 +/- 0.01 (stat.) +/- 0.01 (syst.) GeV/c at 0.9 TeV and 0.50 +/- 0.01 (stat.) +/- 0.01 (syst.) GeV/c at 2.36 TeV, for pseudorapidities between -2.4 and +2.4. At these energies, the measured pseudorapidity densities in the central region, dN(charged)/d(eta) for |eta| < 0.5, are 3.48 +/- 0.02 (stat.) +/- 0.13 (syst.) and 4.47 +/- 0.04 (stat.) +/- 0.16 (syst.), respectively. The results at 0.9 TeV are in agreement with previous measurements and confirm the expectation of near equal hadron production in p-pbar and pp collisions. The results at 2.36 TeV represent the highest-energy measurements at a particle collider to date.
Feasibility studies to assess the use of 236Pu as a radiochemical yield monitor in bioassay samples
International Nuclear Information System (INIS)
Sawant, P.D.; Kalsi, P.C.
2007-01-01
Various plutonium compounds are handled in nuclear facilities of BARC. Hence, there is a possibility of occupational workers getting exposed to Pu. In vitro bioassay monitoring in which Pu is separated by chemical procedures from excreta samples and estimated by alpha-spectrometry, is the method of choice for the evaluation of internal dose to the occupational workers handling Pu. However, this method requires a suitable Pu tracer for reducing the uncertainties due to chemical yield in the separation, electro-deposition and counting efficiency. 242 Pu is commonly used as a tracer but due to its non-availability, efforts were made earlier to indigenously synthesis 236 Pu by proton irradiation of 237 Np in BARC-TIFR pelletron facility. The present study, reports the feasibility of using 236 Pu as a radiochemical yield monitor (tracer) in bioassay samples. (author)
The 236U neutron capture cross-section measured at the n_TOF CERN facility
Directory of Open Access Journals (Sweden)
Mastromarco M.
2017-01-01
Full Text Available The 236U isotope plays an important role in nuclear systems, both for future and currently operating ones. The actual knowledge of the capture reaction of this isotope is satisfactory in the thermal region, but it is considered insufficient for Fast Reactor and ADS applications. For this reason the 236U(n, γ reaction cross-section has been measured for the first time in the whole energy region from thermal energy up to 1 MeV at the n_TOF facility with two different detection systems: an array of C6D6 detectors, employing the total energy deposited method, and a FX1 total absorption calorimeter (TAC, made of 40 BaF2 crystals. The two n_TOF data sets agree with each other within the statistical uncertainty in the Resolved Resonance Region up to 800 eV, while sizable differences (up to ≃ 20% are found relative to the current evaluated data libraries. Moreover two new resonances have been found in the n_TOF data. In the Unresolved Resonance Region up to 200 keV, the n_TOF results show a reasonable agreement with previous measurements and evaluated data.
Boulyga, S F; Becker, J S
2001-07-01
As a result of the accident at the Chernobyl nuclear power plant (NPP) the environment was contaminated with spent nuclear fuel. The 236U isotope was used in this study to monitor the spent uranium from nuclear fallout in soil samples collected in the vicinity of the Chernobyl NPP. Nuclear track radiography was applied for the identification and extraction of hot radioactive particles from soil samples. A rapid and sensitive analytical procedure was developed for uranium isotopic ratio measurement in environmental samples based on double-focusing inductively coupled plasma mass spectrometry (DF-ICP-MS) with a MicroMist nebulizer and a direct injection high-efficiency nebulizer (DIHEN). The performance of the DF-ICP-MS with a quartz DIHEN and plasma shielded torch was studied. Overall detection efficiencies of 4 x 10(-4) and 10(-3) counts per atom were achieved for 238U in DF-ICP-QMS with the MicroMist nebulizer and DIHEN, respectively. The rate of formation of uranium hydride ions UH+/U+ was 1.2 x 10(-4) and 1.4 x 10(-4), respectively. The precision of short-term measurements of uranium isotopic ratios (n = 5) in 1 microg L(-1) NBS U-020 standard solution was 0.11% (238U/235U) and 1.4% (236U/238U) using a MicroMist nebulizer and 0.25% (235U/238U) and 1.9% (236U/P38U) using a DIHEN. The isotopic composition of all investigated Chernobyl soil samples differed from those of natural uranium; i.e. in these samples the 236U/238U ratio ranged from 10(-5) to 10(-3). Results obtained with ICP-MS, alpha- and gamma-spectrometry showed differences in the migration properties of spent uranium, plutonium, and americium. The isotopic ratio of uranium was also measured in hot particles extracted from soil samples.
International Nuclear Information System (INIS)
Boulyga, S.F.; Becker, J.S.
2001-01-01
As a result of the accident at the Chernobyl nuclear power plant (NPP) the environment was contaminated with spent nuclear fuel. The 236 U isotope was used in this study to monitor the spent uranium from nuclear fallout in soil samples collected in the vicinity of the Chernobyl NPP. Nuclear track radiography was applied for the identification and extraction of hot radioactive particles from soil samples. A rapid and sensitive analytical procedure was developed for uranium isotopic ratio measurement in environmental samples based on double-focusing inductively coupled plasma mass spectrometry (DF-ICP-MS) with a MicroMist nebulizer and a direct injection high-efficiency nebulizer (DIHEN). The performance of the DF-ICP-MS with a quartz DIHEN and plasma shielded torch was studied. Overall detection efficiencies of 4 x 10 -4 and 10 -3 counts per atom were achieved for 238 U in DF-ICP-QMS with the MicroMist nebulizer and DIHEN, respectively. The rate of formation of uranium hydride ions UH + /U + was 1.2 x 10 -4 and 1.4 x 10 -4 , respectively. The precision of short-term measurements of uranium isotopic ratios (n = 5) in 1 μg L -1 NBS U-020 standard solution was 0.11% ( 238 U/ 235 U) and 1.4% ( 236 U/ 238 U) using a MicroMist nebulizer and 0.25% ( 235 U/ 238 U) and 1.9% ( 236 U/ 238 U) using a DIHEN. The isotopic composition of all investigated Chernobyl soil samples differed from those of natural uranium; i.e. in these samples the 236 U/ 238 U ratio ranged from 10 -5 to 10 -3 . Results obtained with ICP-MS, α- and γ-spectrometry showed differences in the migration properties of spent uranium, plutonium, and americium. The isotopic ratio of uranium was also measured in hot particles extracted from soil samples. (orig.)
International Nuclear Information System (INIS)
Waris, R.; Bhatti, N.; Nisar, Y. B.
2016-01-01
Background: Despite reduction in ld mortality during last decade, lower respiratory tract infection (LRTI) remained number one killer of under-five. The current study aimed to assess the association of haematological and radiological findings with clinical outcome in hospitalized children 2-36 months old with severe LRTI. Methods: In the current cross sectional study, 581 children 2-36 months old with severe LRTI were enrolled and followed at the Children Hospital, Islamabad, between 2011 and 2014. At the time of enrolment, complete history of present illness, anthropometric measurements, blood sample and chest radiograph were obtained. The primary outcome was either early clinical response (within 72 hours) or delayed clinical response (>72 hours). Multivariable logistic regression was performed to examine the association between haematological and radiological findings with clinical outcome, adjusted for potential confounding factors. Results: Of 581 enrolled children, 292 (50.3 percent) children had early, and 289 (49.7 percent) had delayed clinical response. The multivariable logistic regression showed that leucocytosis (OR 1.79, 95 percent CI 1.15-2.79), neutrophilia (OR 1.91, 95 percent CI 1.29-2.84), radiological interstitial pneumonia (OR 2.49, 95 percent CI 1.70-3.64), and lobar consolidation (OR 6.00, 95 percent CI 2.41-14.96) were significantly associated with delayed clinical response, after adjusted for potential confounding factors. Conclusions: Delayed clinical response was significantly associated with abnormal haematological and radiological findings at the time of admission in children 2-36 months old with severe LRTI. Haematological and radiological findings at the time of presentation are useful for predicting delayed clinical response in children 2-36 months old with severe LRTI. (author)
2010-07-01
... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Pacific Ocean off Barbers Point... Grounds § 110.236 Pacific Ocean off Barbers Point, Island of Oahu, Hawaii: Offshore pipeline terminal... regulations. (1) No vessels may anchor, moor, or navigate in anchorages A, B, C, or D except: (i) Vessels...
Energy Technology Data Exchange (ETDEWEB)
Chamizo, Elena; López-Lora, Mercedes [Centro Nacional de Aceleradores (Universidad de Sevilla, Consejo Superior de Investigaciones Científicas, Junta de Andalucía), Thomas Alva Edison 7, 41092 Seville (Spain); Villa, María [Departamento de Física Aplicada II, Universidad de Sevilla, Av. Reina Mercedes 4A, 41012 Seville (Spain); Servicio de Radioisótopos, Centro de Investigación, Tecnología e Innovación, Universidad de Sevilla, Av. Reina Mercedes 4B, 41012 Seville (Spain); Casacuberta, Núria [Laboratory of Ion Beam Physics, ETH Zürich, Otto-Stern-Weg 5, CH-8093 Zürich (Switzerland); López-Gutiérrez, José María [Centro Nacional de Aceleradores (Universidad de Sevilla, Consejo Superior de Investigaciones Científicas, Junta de Andalucía), Thomas Alva Edison 7, 41092 Seville (Spain); Departamento de Física Aplicada I, Escuela Universitaria Politécnica, Universidad de Sevilla, Virgen de África 7, 41011 Seville (Spain); Pham, Mai Khanh [IAEA-Environment Laboratories, Monte Carlo 98000 (Monaco)
2015-10-15
The performance of the 1 MV AMS system at the CNA (Centro Nacional de Aceleradores, Seville, Spain) for {sup 236}U and {sup 239,240}Pu measurements has been extensively investigated. A very promising {sup 236}U/{sup 238}U abundance sensitivity of about 3 × 10{sup −11} has been recently achieved, and background figures for {sup 239}Pu of about 10{sup 6} atoms were reported in the past. These promising results lead to the use of conventional low energy AMS systems for the analysis of {sup 236}U and {sup 239}Pu and its further application in environmental studies. First {sup 236}U results obtained on our AMS system for marine samples (sediments and water) are presented here. Results of two new IAEA reference materials (IAEA-410 and IAEA-412, marine sediments from Pacific Ocean) are reported. The obtained {sup 236}U/{sup 239}Pu atom ratios, of 0.12 and 0.022, respectively, show a dependency with the contamination source (i.e. local fallout from the US tests performed at the Bikini Atoll and general fallout). The results obtained for a third IAEA reference material (IAEA-381, seawater from the Irish Sea), are also presented. In the following, the uranium and plutonium isotopic compositions obtained on a set of 5 intercomparison seawater samples from the Arctic Ocean provided by the ETH Zürich are discussed. By comparing them with the obtained results on the 600 kV AMS facility Tandy at the ETH Zürich, we demonstrate the solidity of the CNA technique for {sup 236}U/{sup 238}U determinations at, at least, 7 × 10{sup −10} level. Finally, these results are discussed in their environmental context.
International Nuclear Information System (INIS)
Stepanov, A.; Belyaev, B.; Buljanitsa, L.
1989-11-01
The Khlopin Radium Institute prepared on behalf of the IAEA a synthetic mixture of 233 U, 236 U, 242 Pu and 244 Pu isotopes. The isotopic composition and elemental concentration of uranium and plutonium were certified on the basis of analyses done by four laboratories of the IAEA Network, using mass spectrometry with internal standardization. The certified values for 233 U/ 236 U ratio and the 236 U chemical concentration have a coefficient of variation of 0.05%. The latter is fixed by the uncertainty in the 235 U/ 238 U ratio of NBS500 used as internal standard. The coefficients of variation of the 244 Pu/ 242 Pu ratio and the 242 Pu chemical concentration are respectively 0.10% and 0.16% and limited by the uncertainty in the 240 Pu/ 239 Pu ratio of NBS947. This four isotope mixture was used as an internal standard as well as a spike, to analyze 30 batches of LWR spent fuel solutions. The repeatability of the mass spectrometric measurements have a coefficient of variation of 0.025% for the uranium concentration, and of 0.039% for the plutonium concentration. The spiking and treatment errors had a coefficient of variation of 0.048%. (author). Refs, figs and tabs
236 children with developmental hydrocephalus: causes and clinical consequences
Tully, Hannah M; Ishak, Gisele E; Rue, Tessa C; Dempsey, Jennifer C; Browd, Samuel R; Millen, Kathleen J; Doherty, Dan; Dobyns, William B
2016-01-01
Few systematic assessments of developmental forms of hydrocephalus exist. We reviewed MRIs and clinical records of patients with infancy-onset hydrocephalus. Among 411 infants, 236 had hydrocephalus with no recognizable extrinsic cause. These children were assigned to one of five subtypes and compared on the basis of clinical characteristics, developmental and surgical outcomes. At an average age of 5.3 years, 72% of children were walking independently and 87% could eat by mouth. 18% had epilepsy. Distinct patterns of associated malformations and syndromes were observed within each subtype. On average, children with aqueductal obstruction, cysts and encephaloceles had worse clinical outcomes than those with other forms of developmental hydrocephalus. 53% of surgically-treated patients experienced at least one shunt failure, but hydrocephalus associated with posterior fossa crowding required fewer shunt revisions. We conclude that each subtype of developmental hydrocephalus is associated with distinct clinical characteristics, syndromology, and outcomes, suggesting differences in underlying mechanisms. PMID:26184484
Larijani, Cyrus Kouroush
This thesis is based on the development of a radiochemical separation scheme capable of separating both 236gNp and 236Pu from a uranium target of natural isotopic composition ( 1 g uranium) and 200 MBq of fission decay products. The isobaric distribution of fission residues produced following the bombardment of a natural uranium target with a beam of 25 MeV protons has been evaluated. Decay analysis of thirteen isobarically distinct fission residues were carried out using high-resolution gamma-ray spectrometry at the UK National Physical Laboratory. Stoichiometric abundances were calculated via the determination of absolute activity concentrations associated with the longest-lived members of each isobaric chain. This technique was validated by computational modelling of likely sequential decay processes through an isobaric decay chain. The results were largely in agreement with previously published values for neutron bombardments on natural uranium at energies of 14 MeV. Higher relative yields of products with mass numbers A 110-130 were found, consistent with the increasing yield of these radionuclides as the bombarding energy is increased. Using literature values for the production cross-section for fusion of protons with uranium targets, it is estimated that an upper limit of approximately 250 Bq of activity from the 236Np ground state was produced in this experiment. Using a radiochemical separation scheme, Np and Pu fractions were separated from the produced fission decay products, with analyses of the target-based final reaction products made using Inductively Couple Plasma Mass Spectrometry (ICP-MS) and high-resolution alpha and gamma-ray spectrometry. In a separate research theme, reliable measurement of Naturally Occurring Radioactive Materials is of significance in order to comply with environmental regulations and for radiological protection purposes. The thesis describes the standardisation of three reference materials, namely Sand, Tuff and TiO2 which
Epidemiological and clinical features of primary liver cancer: an analysis of 236 patients
Directory of Open Access Journals (Sweden)
ZHAO Rongrong
2016-08-01
Full Text Available ObjectiveTo investigate the epidemiological and clinical features of patients with primary liver cancer (PLC. MethodsA retrospective analysis was performed for the clinical data of 236 patients with complete information who were admitted to The First Hospital of Lanzhou University and diagnosed with PLC for the first time form August 2012 to August 2014, and their epidemiological and clinical features were analyzed. The chi-square test was used for comparison of categorical data between groups. ResultsAmong the 236 PLC patients, there were 198 male patients (83.9% and 38 female patients (16.1%, and the patients aged 41-60 years has the highest incidence rate (58.5%, 138/236. Nineteen patients had a family history of liver cancer, 28 had a history of heavy drinking, 34 were complicated by type 2 diabetes, and 44 were complicated by hypertension. Among these patients, 232 (98.3% developed PLC on the basis of chronic liver disease, and 4 (1.7% had no chronic liver disease. There were 207 patients (87.7% with chronic HBV infection, and most of them had HBeAg-negative infection. Fourteen patients (5.9% had chronic HCV infection, 5 (2.1% had HBV/HCV co-infection, and 6 (2.5% had chronic alcoholic hepatitis. Among the 212 patients with HBV infection, 51(241% had HBeAg-positive chronic hepatitis B, and 95(448% had HBeAg-negative chronic hepatitis B; there was significant difference in HBV DNA level between the two groups (χ2=40687,Ρ=0001. Among all the PLC patients, 104 had an alpha-fetoprotein(AFP level of >400 IU/ml, 48 had an AFP level of 200-400 IU/ml, and 84 had an AFP level of <200 IU/ml; 154 (62.3% had a single lesion, and 72 (30.5% had multiple lesions; most (72.7% of patients with a single lesion had the single lesion in the right lobe, and the proportions of patients with multiple lesions in the right lobe and in both lobes accounted for 58.3% and 41.7%, respectively. Among the 80 PLC patients with
Froehlich, M B; Chan, W Y; Tims, S G; Fallon, S J; Fifield, L K
2016-12-01
A comprehensive series of nuclear tests were carried out by the United States at Enewetak Atoll in the Marshall Islands, especially between 1952 and 1958. A Porites Lutea coral that was growing in the Enewetak lagoon within a few km of all of the high-yield tests contains a continuous record of isotopes, which are of interest (e.g. 14 C, 236 U, 239,240 Pu) through the testing period. Prior to the present work, 14 C measurements at ∼2-month resolution had shown pronounced peaks in the Δ 14 C data that coincided with the times at which tests were conducted. Here we report measurements of 236 U and 239,240 Pu on the same coral using accelerator mass spectrometry, and again find prominent peaks in the concentrations of these isotopes that closely follow those in 14 C. Consistent with the 14 C data, the magnitudes of these peaks do not, however, correlate well with the explosive yields of the corresponding tests, indicating that smaller tests probably contributed disproportionately to the debris that fell in the lagoon. Additional information about the different tests can also be obtained from the 236 U/ 239 Pu and 240 Pu/ 239 Pu ratios, which are found to vary dramatically over the testing period. In particular, the first thermonuclear test, Ivy-Mike, has characteristic 236 U/ 239 Pu and 240 Pu/ 239 Pu signatures which are diagnostic of the first arrival of nuclear test material in various archives. Copyright © 2016 Elsevier Ltd. All rights reserved.
Energy Technology Data Exchange (ETDEWEB)
Boulyga, S.F. [Radiation Physics and Chemistry Problems Inst., Minsk (Belarus); Becker, J.S. [Central Department for Analytical Chemistry, Research Centre Juelich (Germany)
2001-07-01
As a result of the accident at the Chernobyl nuclear power plant (NPP) the environment was contaminated with spent nuclear fuel. The {sup 236}U isotope was used in this study to monitor the spent uranium from nuclear fallout in soil samples collected in the vicinity of the Chernobyl NPP. Nuclear track radiography was applied for the identification and extraction of hot radioactive particles from soil samples. A rapid and sensitive analytical procedure was developed for uranium isotopic ratio measurement in environmental samples based on double-focusing inductively coupled plasma mass spectrometry (DF-ICP-MS) with a MicroMist nebulizer and a direct injection high-efficiency nebulizer (DIHEN). The performance of the DF-ICP-MS with a quartz DIHEN and plasma shielded torch was studied. Overall detection efficiencies of 4 x 10{sup -4} and 10{sup -3} counts per atom were achieved for {sup 238}U in DF-ICP-QMS with the MicroMist nebulizer and DIHEN, respectively. The rate of formation of uranium hydride ions UH{sup +}/U{sup +} was 1.2 x 10{sup -4} and 1.4 x 10{sup -4}, respectively. The precision of short-term measurements of uranium isotopic ratios (n = 5) in 1 {mu}g L{sup -1} NBS U-020 standard solution was 0.11% ({sup 238}U/{sup 235}U) and 1.4% ({sup 236}U/{sup 238}U) using a MicroMist nebulizer and 0.25% ({sup 235}U/{sup 238}U) and 1.9% ({sup 236}U/{sup 238}U) using a DIHEN. The isotopic composition of all investigated Chernobyl soil samples differed from those of natural uranium; i.e. in these samples the {sup 236}U/{sup 238}U ratio ranged from 10{sup -5} to 10{sup -3}. Results obtained with ICP-MS, {alpha}- and {gamma}-spectrometry showed differences in the migration properties of spent uranium, plutonium, and americium. The isotopic ratio of uranium was also measured in hot particles extracted from soil samples. (orig.)
H-alpha observations of Sh2-190, Sh2-222, Sh2-229, Sh2-236 HII regions
Sahan, Muhittin
2018-02-01
Hα spectral line (6563Å) profiles of four northern HII regions in the our galaxy (Sh2-190, Sh2-222, Sh2-229, Sh2-236) have been obtained using DEFPOS spectrometer, located at coude focus of 150 cm RTT150 telescope at TUBITAK National Observatory (TUG, Antalya, Turkey). Observations were carried out at nights of 2015 December 24-27 with long exposure times ranging from 900s to 3600s. The LSR velocities and the linewidths (Full Width Half Maximum: FWHM) of the Hα emission lines were found to be in the range of -45.46 kms-1 to +3.57 kms-1 and 38.50 kms-1 to 44.10 kms-1, respectively. The Sh2-229 HII region is the faintest one (211.16 R), while the Sh2-236 HII region (IC410) is brightest source (535.75 R). The LSR velocity and the line width (FWHM) results of the DEFPOS/RTT150 system were compared with the data by several authors given in literature and results of DEFPOS data were found to be in good agreement with data given in literature.
Tsai, Yi-Ming; Wu, Pei-Shan; Lo, Wen-Sui; Kuo, Chih-Horng
2018-04-19
Spiroplasma floricola 23-6 T (ATCC 29989) was isolated from the flower surface of a tulip tree ( Liriodendron tulipifera L.). Here, we report the complete genome sequence of this bacterium to facilitate the investigation of its biology and the comparative genomics among Spiroplasma species. Copyright © 2018 Tsai et al.
International Nuclear Information System (INIS)
Tan, Yingying; Wang, Lin; Liang, Kunfeng
2015-01-01
In this paper, an auto-cascade ejector refrigeration cycle (ACERC) is proposed to obtain lower refrigeration temperature based on conventional ejector refrigeration and auto-cascade refrigeration principle. The thermodynamic performance of ACERC is investigated theoretically. The zeotropic refrigerant mixture R32 + R236fa is used as its working fluid. A parametric analysis is conducted to evaluate the effects of some thermodynamic parameters on the cycle performance. The study shows that refrigerant mixture composition, condenser outlet temperature and evaporation pressure have effects on performance of ACERC. The theoretical results also indicate that the ACERC can achieve the lowest refrigeration temperature at the temperature level of −30 °C. The application of zeotropic refrigerant mixture auto-cascade refrigeration in the ejector refrigeration cycle can provide a new way to obtain lower refrigeration temperature utilizing low-grade thermal energy. - Highlights: • An auto-cascade ejector refrigerator with R32 + R236fa mixed refrigerant is proposed. • The cycle can obtain a refrigeration temperature at −30 °C temperature range. • The effects of some thermodynamic parameters on the cycle performance are evaluated
Directed evolution of the periodic table: probing the electronic structure of late actinides.
Marsh, M L; Albrecht-Schmitt, T E
2017-07-25
Recent investigations of the coordination chemistry and physical properties of berkelium (Z = 97) and californium (Z = 98) have revealed fundamental differences between post-curium elements and lighter members of the actinide series. This review highlights these developments and chronicles key findings and concepts from the last half-century that have helped usher in a new understanding of the evolution of electronic structure in the periodic table.
Sobanska, Marta; Scholz, Stefan; Nyman, Anna-Maija; Cesnaitis, Romanas; Gutierrez Alonso, Simon; Klüver, Nils; Kühne, Ralph; Tyle, Henrik; de Knecht, Joop; Dang, Zhichao; Lundbergh, Ivar; Carlon, Claudio; De Coen, Wim
In 2013 the Organisation for Economic Co-operation and Development (OECD) test guideline (236) for fish embryo acute toxicity (FET) was adopted. It determines the acute toxicity of chemicals to embryonic fish. Previous studies show a good correlation of FET with the standard acute fish toxicity
International Nuclear Information System (INIS)
Mironov, V.P.; Matusevich, Zh.L.; Kudryashov, V.P.; Ananich, P.I.; Zhuravkov, V.V.
2002-01-01
Experiments and calculations for determination of depth of burnup of fuel are carried out on separate sites in Belarus. As a tracer of Chernobyl deposition the uranium-236 was used. The average depth of burnup of fuel in 30 km zone is 9,4 MW*d/kgU
DEFF Research Database (Denmark)
Qiao, Jixin; Hou, Xiaolin; Steier, Peter
2013-01-01
An automated analytical method implemented in a novel dual-column tandem sequential injection (SI) system was developed for simultaneous determination of 236U, 237Np, 239Pu, and 240Pu in seawater samples. A combination of TEVA and UTEVA extraction chromatography was exploited to separate and purify...... target analytes, whereupon plutonium and neptunium were simultaneously isolated and purified on TEVA, while uranium was collected on UTEVA. The separation behavior of U, Np, and Pu on TEVA–UTEVA columns was investigated in detail in order to achieve high chemical yields and complete purification...
Design review plan for Multi-Function Waste Tank Facility (Project W-236A)
International Nuclear Information System (INIS)
Renfro, G.G.
1994-01-01
This plan describes how the Multi-Function Waste Tank Facility (MWTF) Project conducts reviews of design media; describes actions required by Project participants; and provides the methodology to ensure that the design is complete, meets the technical baseline of the Project, is operable and maintainable, and is constructable. Project W-236A is an integrated project wherein the relationship between the operating contractor and architect-engineer is somewhat different than that of a conventional project. Working together, Westinghouse Hanford Company (WHC) and ICF Karser Hanford (ICF KH) have developed a relationship whereby ICF KH performs extensive design reviews and design verification. WHC actively participates in over-the-shoulder reviews during design development, performs a final review of the completed design, and conducts a formal design review of the Safety Class I, ASME boiler and Pressure Vessel Code items in accordance with WHC-CM-6-1, Standard Engineering Practices
Aamodt, K.; Abeysekara, U.; Abrahantes Quintana, A.; Abramyan, A.; Adamova, D.; Aggarwal, M.M.; Aglieri Rinella, G.; Agocs, A.G.; Aguilar Salazar, S.; Ahammed, Z.; Ahmad, A.; Ahmad, N.; Ahn, S.U.; Akimoto, R.; Akindinov, A.; Aleksandrov, D.; Alessandro, B.; Alfaro Molina, R.; Alici, A.; Avina, E.Almaraz; Alme, J.; Alt, T.; Altini, V.; Altinpinar, S.; Andrei, C.; Andronic, A.; Anelli, G.; Angelov, V.; Anson, C.; Anticic, T.; Antinori, F.; Antinori, S.; Antipin, K.; Antonczyk, D.; Antonioli, P.; Anzo, A.; Aphecetche, L.; Appelshauser, H.; Arcelli, S.; Arceo, R.; Arend, A.; Armesto, N.; Arnaldi, R.; Aronsson, T.; Arsene, I.C.; Asryan, A.; Augustinus, A.; Averbeck, R.; Awes, T.C.; Aysto, J.; Azmi, M.D.; Bablok, S.; Bach, M.; Badala, A.; Baek, Y.W.; Bagnasco, S.; Bailhache, R.; Bala, R.; Baldisseri, A.; Baldit, A.; Ban, J.; Barbera, R.; Barnafoldi, G.G.; Barnby, L.; Barret, V.; Bartke, J.; Barile, F.; Basile, M.; Basmanov, V.; Bastid, N.; Bathen, B.; Batigne, G.; Batyunya, B.; Baumann, C.; Bearden, I.G.; Becker, B.; Belikov, I.; Bellwied, R.; Belmont-Moreno, E.; Belogianni, A.; Benhabib, L.; Beole, S.; Berceanu, I.; Bercuci, A.; Berdermann, E.; Berdnikov, Y.; Betev, L.; Bhasin, A.; Bhati, A.K.; Bianchi, L.; Bianchi, N.; Bianchin, C.; Bielcik, J.; Bielcikova, J.; Bilandzic, A.; Bimbot, L.; Biolcati, E.; Blanc, A.; Blanco, F.; Blanco, F.; Blau, D.; Blume, C.; Boccioli, M.; Bock, N.; Bogdanov, A.; Boggild, H.; Bogolyubsky, M.; Bohm, J.; Boldizsar, L.; Bombara, M.; Bombonati, C.; Bondila, M.; Borel, H.; Borshchov, V.; Borisov, A.; Bortolin, C.; Bose, S.; Bosisio, L.; Bossu, F.; Botje, M.; Bottger, S.; Bourdaud, G.; Boyer, B.; Braun, M.; Braun-Munzinger, P.; Bravina, L.; Bregant, M.; Breitner, T.; Bruckner, G.; Brun, R.; Bruna, E.; Bruno, G.E.; Budnikov, D.; Buesching, H.; Buncic, P.; Busch, O.; Buthelezi, Z.; Caffarri, D.; Cai, X.; Caines, H.; Camacho, E.; Camerini, P.; Campbell, M.; Canoa Roman, V.; Capitani, G.P.; Cara Romeo, G.; Carena, F.; Carena, W.; Carminati, F.; Casanova Diaz, A.; Caselle, M.; Castellanos, J.Castillo; Castillo Hernandez, J.F.; Catanescu, V.; Cattaruzza, E.; Cavicchioli, C.; Cerello, P.; Chambert, V.; Chang, B.; Chapeland, S.; Charpy, A.; Charvet, J.L.; Chattopadhyay, S.; Chattopadhyay, S.; Cherney, M.; Cheshkov, C.; Cheynis, B.; Chiavassa, E.; Chibante Barroso, V.; Chinellato, D.D.; Chochula, P.; Choi, K.; Chojnacki, M.; Christakoglou, P.; Christensen, C.H.; Christiansen, P.; Chujo, T.; Chuman, F.; Cicalo, C.; Cifarelli, L.; Cindolo, F.; Cleymans, J.; Cobanoglu, O.; Coffin, J.P.; Coli, S.; Colla, A.; Conesa Balbastre, G.; Conesa del Valle, Z.; Conner, E.S.; Constantin, P.; Contin, G.; Contreras, J.G.; Corrales Morales, Y.; Cormier, T.M.; Cortese, P.; Cortes Maldonado, I.; Cosentino, M.R.; Costa, F.; Cotallo, M.E.; Crescio, E.; Crochet, P.; Cuautle, E.; Cunqueiro, L.; Cussonneau, J.; Dainese, A.; Dalsgaard, H.H.; Danu, A.; Das, I.; Das, S.; Dash, A.; Dash, S.; de Barros, G.O.V.; De Caro, A.; de Cataldo, G.; de Cuveland, J.; De Falco, A.; De Gaspari, M.; de Groot, J.; De Gruttola, D.; de Haas, A.P.; De Marco, N.; De Pasquale, S.; De Remigis, R.; de Rooij, R.; de Vaux, G.; Delagrange, H.; Dellacasa, G.; Deloff, A.; Demanov, V.; Denes, E.; Deppman, A.; D'Erasmo, G.; Derkach, D.; Devaux, A.; Di Bari, D.; Di Giglio, C.; Di Liberto, S.; Di Mauro, A.; Di Nezza, P.; Dialinas, M.; Diaz, L.; Diaz, R.; Dietel, T.; Divia, R.; Djuvsland, O.; Dobretsov, V.; Dobrin, A.; Dobrowolski, T.; Donigus, B.; Dominguez, I.; Dordic, O.; Dubey, A.K.; Dubuisson, J.; Ducroux, L.; Dupieux, P.; Dutta Majumdar, A.K.; Dutta Majumdar, M.R.; Elia, D.; Emschermann, D.; Enokizono, A.; Espagnon, B.; Estienne, M.; Esumi, S.; Evans, D.; Evrard, S.; Eyyubova, G.; Fabjan, C.W.; Fabris, D.; Faivre, J.; Falchieri, D.; Fantoni, A.; Fasel, M.; Fateev, O.; Fearick, R.; Fedunov, A.; Fehlker, D.; Fekete, V.; Felea, D.; Fenton-Olsen, B.; Feofilov, G.; Fernandez Tellez, A.; Ferreiro, E.G.; Ferretti, A.; Ferretti, R.; Figueredo, M.A.S.; Filchagin, S.; Fini, R.; Fionda, F.M.; Fiore, E.M.; Floris, M.; Fodor, Z.; Foertsch, S.; Foka, P.; Fokin, S.; Formenti, F.; Fragiacomo, E.; Fragkiadakis, M.; Frankenfeld, U.; Frolov, A.; Fuchs, U.; Furano, F.; Furget, C.; Fusco Girard, M.; Gaardhoje, J.J.; Gadrat, S.; Gagliardi, M.; Gago, A.; Gallio, M.; Ganoti, P.; Ganti, M.S.; Garabatos, C.; Garcia Trapaga, C.; Gebelein, J.; Gemme, R.; Germain, M.; Gheata, A.; Gheata, M.; Ghidini, B.; Ghosh, P.; Giraudo, G.; Giubellino, P.; Gladysz-Dziadus, E.; Glasow, R.; Glassel, P.; Glenn, A.; Gomez Jimenez, R.; Gonzalez Santos, H.; Gonzalez-Trueba, L.H.; Gonzalez-Zamora, P.; Gorbunov, S.; Gorbunov, Y.; Gotovac, S.; Gottschlag, H.; Grabski, V.; Grajcarek, R.; Grelli, A.; Grigoras, A.; Grigoras, C.; Grigoriev, V.; Grigoryan, A.; Grigoryan, S.; Grinyov, B.; Grion, N.; Gros, P.; Grosse-Oetringhaus, J.F.; Grossiord, J.Y.; Grosso, R.; Guber, F.; Guernane, R.; Guerzoni, B.; Gulbrandsen, K.; Gulkanyan, H.; Gunji, T.; Gupta, A.; Gupta, R.; Gustafsson, H.A.; Gutbrod, H.; Haaland, O.; Hadjidakis, C.; Haiduc, M.; Hamagaki, H.; Hamar, G.; Hamblen, J.; Han, B.H.; Harris, J.W.; Hartig, M.; Harutyunyan, A.; Hasch, D.; Hasegan, D.; Hatzifotiadou, D.; Hayrapetyan, A.; Heide, M.; Heinz, M.; Helstrup, H.; Herghelegiu, A.; Hernandez, C.; Herrera Corral, G.; Herrmann, N.; Hetland, K.F.; Hicks, B.; Hiei, A.; Hille, P.T.; Hippolyte, B.; Horaguchi, T.; Hori, Y.; Hristov, P.; Hrivnacova, I.; Hu, S.; Huang, M.; Huber, S.; Humanic, T.J.; Hutter, D.; Hwang, D.S.; Ichou, R.; Ilkaev, R.; Ilkiv, I.; Inaba, M.; Innocenti, P.G.; Ippolitov, M.; Irfan, M.; Ivan, C.; Ivanov, A.; Ivanov, M.; Ivanov, V.; Iwasaki, T.; Jacholkowski, A.; Jacobs, P.; Jancurova, L.; Jangal, S.; Janik, R.; Jena, C.; Jena, S.; Jirden, L.; Jones, G.T.; Jones, P.G.; Jovanovic, P.; Jung, H.; Jung, W.; Jusko, A.; Kaidalov, A.B.; Kalcher, S.; Kalinak, P.; Kalisky, M.; Kalliokoski, T.; Kalweit, A.; Kamal, A.; Kamermans, R.; Kanaki, K.; Kang, E.; Kang, J.H.; Kapitan, J.; Kaplin, V.; Kapusta, S.; Karavichev, O.; Karavicheva, T.; Karpechev, E.; Kazantsev, A.; Kebschull, U.; Keidel, R.; Khan, M.M.; Khan, S.A.; Khanzadeev, A.; Kharlov, Y.; Kikola, D.; Kileng, B.; Kim, D.J.; Kim, D.S.; Kim, D.W.; Kim, H.N.; Kim, J.; Kim, J.H.; Kim, J.S.; Kim, M.; Kim, M.; Kim, S.H.; Kim, S.; Kim, Y.; Kirsch, S.; Kisel, I.; Kiselev, S.; Kisiel, A.; Klay, J.L.; Klein, J.; Klein-Bosing, C.; Kliemant, M.; Klovning, A.; Kluge, A.; Kniege, S.; Koch, K.; Kolevatov, R.; Kolojvari, A.; Kondratiev, V.; Kondratyeva, N.; Konevskih, A.; Kornas, E.; Kour, R.; Kowalski, M.; Kox, S.; Kozlov, K.; Kral, J.; Kralik, I.; Kramer, F.; Kraus, I.; Kravcakova, A.; Krawutschke, T.; Krivda, M.; Krumbhorn, D.; Krus, M.; Kryshen, E.; Krzewicki, M.; Kucheriaev, Y.; Kuhn, C.; Kuijer, P.G.; Kumar, L.; Kumar, N.; Kupczak, R.; Kurashvili, P.; Kurepin, A.; Kurepin, A.N.; Kuryakin, A.; Kushpil, S.; Kushpil, V.; Kutouski, M.; Kvaerno, H.; Kweon, M.J.; Kwon, Y.; La Rocca, P.; Lackner, F.; Ladron de Guevara, P.; Lafage, V.; Lal, C.; Lara, C.; Larsen, D.T.; Laurenti, G.; Lazzeroni, C.; Le Bornec, Y.; Le Bris, N.; Lee, H.; Lee, K.S.; Lee, S.C.; Lefevre, F.; Lenhardt, M.; Leistam, L.; Lehnert, J.; Lenti, V.; Leon, H.; Leon Monzon, I.; Leon Vargas, H.; Levai, P.; Li, X.; Li, Y.; Lietava, R.; Lindal, S.; Lindenstruth, V.; Lippmann, C.; Lisa, M.A.; Listratenko, O.; Liu, L.; Loginov, V.; Lohn, S.; Lopez, X.; Lopez Noriega, M.; Lopez-Ramirez, R.; Lopez Torres, E.; Lovhoiden, G.; Lozea Feijo Soares, A.; Lu, S.; Lunardon, M.; Luparello, G.; Luquin, L.; Lutz, J.R.; Ma, K.; Ma, R.; Madagodahettige-Don, D.M.; Maevskaya, A.; Mager, M.; Mahapatra, D.P.; Maire, A.; Makhlyueva, I.; Mal'Kevich, D.; Malaev, M.; Malagalage, K.J.; Maldonado Cervantes, I.; Malek, M.; Malkiewicz, T.; Malzacher, P.; Mamonov, A.; Manceau, L.; Mangotra, L.; Manko, V.; Manso, F.; Manzari, V.; Mao, Y.; Mares, J.; Margagliotti, G.V.; Margotti, A.; Marin, A.; Martashvili, I.; Martinengo, P.; Martinez Hernandez, M.I.; Martinez Davalos, A.; Martinez Garcia, G.; Maruyama, Y.; Marzari Chiesa, A.; Masciocchi, S.; Masera, M.; Masetti, M.; Masoni, A.; Massacrier, L.; Mastromarco, M.; Mastroserio, A.; Matthews, Z.L.; Matyja, A.; Mayani, D.; Mazza, G.; Mazzoni, M.A.; Meddi, F.; Menchaca-Rocha, A.; Mendez Lorenzo, P.; Meoni, M.; Mercado Perez, J.; Mereu, P.; Miake, Y.; Michalon, A.; Miftakhov, N.; Milosevic, J.; Minafra, F.; Mischke, A.; Miskowiec, D.; Mitu, C.; Mizoguchi, K.; Mlynarz, J.; Mohanty, B.; Molnar, L.; Mondal, M.M.; Montano Zetina, L.; Monteno, M.; Montes, E.; Morando, M.; Moretto, S.; Morsch, A.; Moukhanova, T.; Muccifora, V.; Mudnic, E.; Muhuri, S.; Muller, H.; Munhoz, M.G.; Munoz, J.; Musa, L.; Musso, A.; Nandi, B.K.; Nania, R.; Nappi, E.; Navach, F.; Navin, S.; Nayak, T.K.; Nazarenko, S.; Nazarov, G.; Nedosekin, A.; Nendaz, F.; Newby, J.; Nianine, A.; Nicassio, M.; Nielsen, B.S.; Nikolaev, S.; Nikolic, V.; Nikulin, S.; Nikulin, V.; Nilsen, B.S.; Nilsson, M.S.; Noferini, F.; Nomokonov, P.; Nooren, G.; Novitzky, N.; Nyatha, A.; Nygaard, C.; Nyiri, A.; Nystrand, J.; Ochirov, A.; Odyniec, G.; Oeschler, H.; Oinonen, M.; Okada, K.; Okada, Y.; Oldenburg, M.; Oleniacz, J.; Oppedisano, C.; Orsini, F.; Ortiz Velasquez, A.; Ortona, G.; Oskamp, C.J.; Oskarsson, A.; Osmic, F.; Osterman, L.; Ostrowski, P.; Otterlund, I.; Otwinowski, J.; Ovrebekk, G.; Oyama, K.; Ozawa, K.; Pachmayer, Y.; Pachr, M.; Padilla, F.; Pagano, P.; Paic, G.; Painke, F.; Pajares, C.; Pal, S.; Pal, S.K.; Palaha, A.; Palmeri, A.; Panse, R.; Papikyan, V.; Pappalardo, G.S.; Park, W.J.; Pastircak, B.; Pastore, C.; Paticchio, V.; Pavlinov, A.; Pawlak, T.; Peitzmann, T.; Pepato, A.; Pereira, H.; Peressounko, D.; Perez, C.; Perini, D.; Perrino, D.; Peryt, W.; Peschek, J.; Pesci, A.; Peskov, V.; Pestov, Y.; Peters, A.J.; Petracek, V.; Petridis, A.; Petris, M.; Petrov, P.; Petrovici, M.; Petta, C.; Peyre, J.; Piano, S.; Piccotti, A.; Pikna, M.; Pillot, P.; Pinazza, O.; Pinsky, L.; Pitz, N.; Piuz, F.; Platt, R.; Ploskon, M.; Pluta, J.; Pocheptsov, T.; Pochybova, S.; Podesta Lerma, P.L.M.; Poggio, F.; Poghosyan, M.G.; Polak, K.; Polichtchouk, B.; Polozov, P.; Polyakov, V.; Pommeresch, B.; Pop, A.; Posa, F.; Pospisil, V.; Potukuchi, B.; Pouthas, J.; Prasad, S.K.; Preghenella, R.; Prino, F.; Pruneau, C.A.; Pshenichnov, I.; Puddu, G.; Pujahari, P.; Pulvirenti, A.; Punin, A.; Punin, V.; Putis, M.; Putschke, J.; Quercigh, E.; Rachevski, A.; Rademakers, A.; Radomski, S.; Raiha, T.S.; Rak, J.; Rakotozafindrabe, A.; Ramello, L.; Ramirez Reyes, A.; Rammler, M.; Raniwala, R.; Raniwala, S.; Rasanen, S.S.; Rashevskaya, I.; Rath, S.; Read, K.F.; Real, J.S.; Redlich, K.; Renfordt, R.; Reolon, A.R.; Reshetin, A.; Rettig, F.; Revol, J.P.; Reygers, K.; Ricaud, H.; Riccati, L.; Ricci, R.A.; Richter, M.; Riedler, P.; Riegler, W.; Riggi, F.; Rivetti, A.; Rodriguez Cahuantzi, M.; Roed, K.; Rohrich, D.; Roman Lopez, S.; Romita, R.; Ronchetti, F.; Rosinsky, P.; Rosnet, P.; Rossegger, S.; Rossi, A.; Roukoutakis, F.; Rousseau, S.; Roy, C.; Roy, P.; Rubio-Montero, A.J.; Rui, R.; Rusanov, I.; Russo, G.; Ryabinkin, E.; Rybicki, A.; Sadovsky, S.; Safarik, K.; Sahoo, R.; Saini, J.; Saiz, P.; Sakata, D.; Salgado, C.A.; Salgueiro Domingues da Silva, R.; Salur, S.; Samanta, T.; Sambyal, S.; Samsonov, V.; Sandor, L.; Sandoval, A.; Sano, M.; Sano, S.; Santo, R.; Santoro, R.; Sarkamo, J.; Saturnini, P.; Scapparone, E.; Scarlassara, F.; Scharenberg, R.P.; Schiaua, C.; Schicker, R.; Schindler, H.; Schmidt, C.; Schmidt, H.R.; Schossmaier, K.; Schreiner, S.; Schuchmann, S.; Schukraft, J.; Schutz, Y.; Schwarz, K.; Schweda, K.; Scioli, G.; Scomparin, E.; Segato, G.; Semenov, D.; Senyukov, S.; Seo, J.; Serci, S.; Serkin, L.; Serradilla, E.; Sevcenco, A.; Sgura, I.; Shabratova, G.; Shahoyan, R.; Sharkov, G.; Sharma, N.; Sharma, S.; Shigaki, K.; Shimomura, M.; Shtejer, K.; Sibiriak, Y.; Siciliano, M.; Sicking, E.; Siddi, E.; Siemiarczuk, T.; Silenzi, A.; Silvermyr, D.; Simili, E.; Simonetti, G.; Singaraju, R.; Singh, R.; Singhal, V.; Sinha, B.C.; Sinha, T.; Sitar, B.; Sitta, M.; Skaali, T.B.; Skjerdal, K.; Smakal, R.; Smirnov, N.; Snellings, R.; Snow, H.; Sogaard, C.; Soloviev, A.; Soltveit, H.K.; Soltz, R.; Sommer, W.; Son, C.W.; Son, H.; Song, M.; Soos, C.; Soramel, F.; Soyk, D.; Spyropoulou-Stassinaki, M.; Srivastava, B.K.; Stachel, J.; Staley, F.; Stan, E.; Stefanek, G.; Stefanini, G.; Steinbeck, T.; Stenlund, E.; Steyn, G.; Stocco, D.; Stock, R.; Stolpovsky, P.; Strmen, P.; Suaide, A.A.P.; Subieta Vasquez, M.A.; Sugitate, T.; Suire, C.; Sumbera, M.; Susa, T.; Swoboda, D.; Symons, J.; Szanto de Toledo, A.; Szarka, I.; Szostak, A.; Szuba, M.; Tadel, M.; Tagridis, C.; Takahara, A.; Takahashi, J.; Tanabe, R.; Takaki, D.J.Tapia; Taureg, H.; Tauro, A.; Tavlet, M.; Tejeda Munoz, G.; Telesca, A.; Terrevoli, C.; Thader, J.; Tieulent, R.; Tlusty, D.; Toia, A.; Tolyhy, T.; Torcato de Matos, C.; Torii, H.; Torralba, G.; Toscano, L.; Tosello, F.; Tournaire, A.; Traczyk, T.; Tribedy, P.; Troger, G.; Truesdale, D.; Trzaska, W.H.; Tsiledakis, G.; Tsilis, E.; Tsuji, T.; Tumkin, A.; Turrisi, R.; Turvey, A.; Tveter, T.S.; Tydesjo, H.; Tywoniuk, K.; Ulery, J.; Ullaland, K.; Uras, A.; Urban, J.; Urciuoli, G.M.; Usai, G.L.; Vacchi, A.; Vala, M.; Valencia Palomo, L.; Vallero, S.; van den Brink, A.; van der Kolk, N.; Vyvre, P.Vande; van Leeuwen, M.; Vannucci, L.; Vargas, A.; Varma, R.; Vasiliev, A.; Vassiliev, I.; Vasileiou, M.; Vechernin, V.; Venaruzzo, M.; Vercellin, E.; Vergara, S.; Vernet, R.; Verweij, M.; Vetlitskiy, I.; Vickovic, L.; Viesti, G.; Vikhlyantsev, O.; Vilakazi, Z.; Villalobos Baillie, O.; Vinogradov, A.; Vinogradov, L.; Vinogradov, Y.; Virgili, T.; Viyogi, Y.P.; Vodopianov, A.; Voloshin, K.; Voloshin, S.; Volpe, G.; von Haller, B.; Vranic, D.; Vrlakova, J.; Vulpescu, B.; Wagner, B.; Wagner, V.; Wallet, L.; Wan, R.; Wang, D.; Wang, Y.; Watanabe, K.; Wen, Q.; Wessels, J.; Westerhoff, U.; Wiechula, J.; Wikne, J.; Wilk, A.; Wilk, G.; Williams, M.C.S.; Willis, N.; Windelband, B.; Xu, C.; Yang, C.; Yang, H.; Yasnopolskiy, S.; Yermia, F.; Yi, J.; Yin, Z.; Yokoyama, H.; Yoo, I-K.; Yuan, X.; Yurevich, V.; Yushmanov, I.; Zabrodin, E.; Zagreev, B.; Zalite, A.; Zampolli, C.; Zanevsky, Yu.; Zaporozhets, S.; Zarochentsev, A.; Zavada, P.; Zbroszczyk, H.; Zelnicek, P.; Zenin, A.; Zepeda, A.; Zgura, I.; Zhalov, M.; Zhang, X.; Zhou, D.; Zhou, S.; Zhu, J.; Zichichi, A.; Zinchenko, A.; Zinovjev, G.; Zoccarato, Y.; Zychacek, V.; Zynovyev, M.
2010-01-01
Charged-particle production was studied in proton-proton collisions collected at the LHC with the ALICE detector at centre-of-mass energies 0.9 TeV and 2.36 TeV in the pseudorapidity range |eta| < 1.4. In the central region (|eta| < 0.5), at 0.9 TeV, we measure charged-particle pseudorapidity density dNch/deta = 3.02 +- 0.01 (stat.) +0.08 -0.05 (syst.) for inelastic interactions, and dNch/deta = 3.58 +- 0.01 (stat.) +0.12 -0.12 (syst.) for non-single-diffractive interactions. At 2.36 TeV, we find dNch/deta = 3.77 +- 0.01 (stat.) +0.25 -0.12 (syst.) for inelastic, and dNch/deta = 4.43 +- 0.01 (stat.) +0.17 -0.12 (syst.) for non-single-diffractive collisions. The relative increase in charged-particle multiplicity from the lower to higher energy is 24.7% +- 0.5% (stat.) +5.7% -2.8% (syst.) for inelastic and 23.7% +- 0.5% (stat.) +4.6% -1.1% (syst.) for non-single-diffractive interactions. This increase is consistent with that reported by the CMS collaboration for non-single-diffractive events and larger th...
International Nuclear Information System (INIS)
Isaev, S.G.; Piksaikin, L.E.; Kazakov, L.E.; Tarasko, M.Z.
2000-01-01
The measurements of relative abundances and periods of delayed neutrons from fast neutron induced fission of 235 U and 236 U have been made at the electrostatic accelerator CG-2.5 at IPPE. The preliminary results were obtained and discussed in the frame of the systematics of the average half-life of delayed neutron precursors. It was shown that the average half-life value in both reactions depends on the energy of primary neutrons [ru
A-type central stars of planetary nebulae. 2. The central stars of NGC 2346, He 2-36 and NGC 3132
Energy Technology Data Exchange (ETDEWEB)
Mendez, R H [Instituto de Astronomia y Fisica del Espacio, Buenos Aires (Argentina)
1978-12-01
Spectrograms, scanner, uvby and ANS ultraviolet measurements of the central stars of NGC 2346, He 2-36 and NGC 3132 are analysed. The observations suggest that the first one is a foreground horizontal-branch star, and the second is above the horizontal branch, presumably in a rapid evolutionary phase. Both objects are probably variable. The central star of NGC 3132 is a slightly evolved main-sequence star with a hot visual companion. The evolutionary status of this system is briefly discussed.
Data Evaluation of Actinide Cross Sections: 238Pu, 237Pu, and 236Pu
Energy Technology Data Exchange (ETDEWEB)
Guaglioni, S. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States); Jurgenson, E. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States); Descalle, M. A. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States); Thompson, I. J. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States); Ormand, E. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States); Escher, J. E. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States); Younes, W. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States); Mattoon, C. M. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States); Beck, B. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States); Burke, J. T. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States); Bailey, T. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States)
2017-10-04
This report documents the recent evaluation of the 236Pu, 237Pu, and 238Pu cross section sets. Nuclear data evaluation is the fundamental interface that takes measured nuclear cross section data and turns them into a continuous curve that 1) is consistent with other measurements and nuclear reaction theory/models, and 2) is required by down-stream users. All experiments that generate nuclear data need to include an evaluation step for their data to be broadly useful to the end users.
Safety analysis report for packaging: neutron shipping cask, model 0.5T
International Nuclear Information System (INIS)
Peterson, R.T.
1976-01-01
The Safety Analysis Report for Packaging demonstrates that the neutron shipping cask can safely transport, in solid or powder form, all isotopes of uranium, plutonium, americium, curium, berkelium, californium, einsteinium, and fermium. The shipping cask and its contents are described. It also evaluates transport conditions, structural parameters (e.g., load resistance, pressure and impact effects, lifting and tiedown devices), and shielding. Finally, it discusses compliance with Chapter 0529 of the Energy Research and Development Administration Manual
Vollmer, M. K.; Miller, B. R.; Rigby, M. L.; Reimann, S.; Muhle, J.; Agage, Soge, Snu Members, Kopri Members
2010-12-01
We report on the atmospheric measurements and global emissions of the hydrofluorocarbons (HFCs) HFC-365mfc (CH3CH2CF2CF3, 1,1,1,3,3-pentafluorobutane), HFC-245fa (CHF2CH2CF3, 1,1,1,3,3-pentafluoropropane), HFC-227ea (CF3CHFCF3, 1,1,1,2,3,3,3-heptafluoropropane), and HFC-236fa (CF3CH2CF3, 1,1,1,3,3,3-hexafluoropropane). These measurements are from in-situ observations at stations of AGAGE (Advanced Global Atmospheric Gases Experiment) and SOGE (System for Observations of Halogenated Greenhouse Gases in Europe), and from the Korean station Gosan. We also report on flask sample measurements from the Antarctic stations King Sejong and Troll, and extend our records back to the 1970s using archived air samples of both hemispheres. All data are used in a global 12-box 2-dimensional atmospheric transport model to derive global abundances and emission estimates. All four HFCs have strongly increased in the atmosphere in recent years with growth rates at nearly 10 %, resulting in dry air mole fractions at the end of 2009 of 0.49 ppt for HFC-365mfc, 1.00 ppt for HFC-245fa, and 0.51 ppt for HFC-227ea. HFC-236fa, for which we report the first atmospheric measurements, is less abundant and has grown to 0.069 ppt at the end of 2009. Our model results show rapidly growing emissions of HFC-365mfc and HFC-245fa after 2002 but surprisingly these have now started to decline to globally 2.7 kt/yr (HFC-365mfc) and 6.1 kt/yr (HFC-245fa). On the other hand HFC-227ea and HFC-236fa show uninterrupted growth in their emissions of 2.5 kt/yr and 0.2 kt/yr at the end of 2009.
Khachatryan, V; Sirunyan, A M; Tumasyan, A; Adam, W; Bergauer, T; Dragicevic, M; Erö, J; Fabjan, C; Friedl, M; Frühwirth, R; Ghete, V M; Hammer, J; Hänsel, S; Hoch, M; Hörmann, N; Hrubec, J; Jeitler, M; Kasieczka, G; Kiesenhofer, W; Krammer, M; Liko, D; Mikulec, I; Pernicka, M; Rohringer, H; Schöfbeck, R; Strauss, J; Taurok, A; Teischinger, F; Waltenberger, W; Walzel, G; Widl, E; Wulz, C-E; Mossolov, V; Shumeiko, N; Suarez Gonzalez, J; Benucci, L; Ceard, L; De Wolf, E A; Hashemi, M; Janssen, X; Maes, T; Mucibello, L; Ochesanu, S; Roland, B; Rougny, R; Selvaggi, M; Van Haevermaet, H; Van Mechelen, P; Van Remortel, N; Adler, V; Beauceron, S; Blyweert, S; D'Hondt, J; Devroede, O; Kalogeropoulos, A; Maes, J; Maes, M; Tavernier, S; Van Doninck, W; Van Mulders, P; Villella, I; Chabert, E C; Charaf, O; Clerbaux, B; De Lentdecker, G; Dero, V; Gay, A P R; Hammad, G H; Marage, P E; Vander Velde, C; Vanlaer, P; Wickens, J; Costantini, S; Grunewald, M; Klein, B; Marinov, A; Ryckbosch, D; Thyssen, F; Tytgat, M; Vanelderen, L; Verwilligen, P; Walsh, S; Zaganidis, N; Basegmez, S; Bruno, G; Caudron, J; De Favereau De Jeneret, J; Delaere, C; Demin, P; Favart, D; Giammanco, A; Grégoire, G; Hollar, J; Lemaitre, V; Militaru, O; Ovyn, S; Pagano, D; Pin, A; Piotrzkowski, K; Quertenmont, L; Schul, N; Beliy, N; Caebergs, T; Daubie, E; Alves, G A; Pol, M E; Souza, M H G; Carvalho, W; Da Costa, E M; De Jesus Damiao, D; De Oliveira Martins, C; Fonseca De Souza, S; Mundim, L; Oguri, V; Santoro, A; Silva Do Amaral, S M; Sznajder, A; Torres Da Silva De Araujo, F; Dias, F A; Dias, M A F; Fernandez Perez Tomei, T R; Gregores, E M; Marinho, F; Novaes, S F; Padula, Sandra S; Darmenov, N; Dimitrov, L; Genchev, V; Iaydjiev, P; Piperov, S; Stoykova, S; Sultanov, G; Trayanov, R; Vankov, I; Dyulendarova, M; Hadjiiska, R; Kozhuharov, V; Litov, L; Marinova, E; Mateev, M; Pavlov, B; Petkov, P; Bian, J G; Chen, G M; Chen, H S; Jiang, C H; Liang, D; Liang, S; Wang, J; Wang, J; Wang, X; Wang, Z; Yang, M; Zang, J; Zhang, Z; Ban, Y; Guo, S; Hu, Z; Mao, Y; Qian, S J; Teng, H; Zhu, B; Cabrera, A; Carrillo Montoya, C A; Gomez Moreno, B; Ocampo Rios, A A; Osorio Oliveros, A F; Sanabria, J C; Godinovic, N; Lelas, D; Lelas, K; Plestina, R; Polic, D; Puljak, I; Antunovic, Z; Dzelalija, M; Brigljevic, V; Duric, S; Kadija, K; Morovic, S; Attikis, A; Fereos, R; Galanti, M; Mousa, J; Nicolaou, C; Papadakis, A; Ptochos, F; Razis, P A; Rykaczewski, H; Tsiakkouri, D; Zinonos, Z; Mahmoud, M; Hektor, A; Kadastik, M; Kannike, K; Müntel, M; Raidal, M; Rebane, L; Azzolini, V; Eerola, P; Czellar, S; Härkönen, J; Heikkinen, A; Karimäki, V; Kinnunen, R; Klem, J; Kortelainen, M J; Lampén, T; Lassila-Perini, K; Lehti, S; Lindén, T; Luukka, P; Mäenpää, T; Tuominen, E; Tuominiemi, J; Tuovinen, E; Ungaro, D; Wendland, L; Banzuzi, K; Korpela, A; Tuuva, T; Sillou, D; Besancon, M; Dejardin, M; Denegri, D; Descamps, J; Fabbro, B; Faure, J L; Ferri, F; Ganjour, S; Gentit, F X; Givernaud, A; Gras, P; Hamel de Monchenault, G; Jarry, P; Locci, E; Malcles, J; Marionneau, M; Millischer, L; Rander, J; Rosowsky, A; Rousseau, D; Titov, M; Verrecchia, P; Baffioni, S; Bianchini, L; Bluj, M; Broutin, C; Busson, P; Charlot, C; Dobrzynski, L; Elgammal, S; Granier de Cassagnac, R; Haguenauer, M; Kalinowski, A; Miné, P; Paganini, P; Sabes, D; Sirois, Y; Thiebaux, C; Zabi, A; Agram, J-L; Besson, A; Bloch, D; Bodin, D; Brom, J-M; Cardaci, M; Conte, E; Drouhin, F; Ferro, C; Fontaine, J-C; Gelé, D; Goerlach, U; Greder, S; Juillot, P; Karim, M; Le Bihan, A-C; Mikami, Y; Speck, J; Van Hove, P; Fassi, F; Mercier, D; Baty, C; Beaupere, N; Bedjidian, M; Bondu, O; Boudoul, G; Boumediene, D; Brun, H; Chanon, N; Chierici, R; Contardo, D; Depasse, P; El Mamouni, H; Fay, J; Gascon, S; Ille, B; Kurca, T; Le Grand, T; Lethuillier, M; Mirabito, L; Perries, S; Sordini, V; Tosi, S; Tschudi, Y; Verdier, P; Xiao, H; Roinishvili, V; Anagnostou, G; Edelhoff, M; Feld, L; Heracleous, N; Hindrichs, O; Jussen, R; Klein, K; Merz, J; Mohr, N; Ostapchuk, A; Perieanu, A; Raupach, F; Sammet, J; Schael, S; Sprenger, D; Weber, H; Weber, M; Wittmer, B; Actis, O; Ata, M; Bender, W; Biallass, P; Erdmann, M; Frangenheim, J; Hebbeker, T; Hinzmann, A; Hoepfner, K; Hof, C; Kirsch, M; Klimkovich, T; Kreuzer, P; Lanske, D; Magass, C; Merschmeyer, M; Meyer, A; Papacz, P; Pieta, H; Reithler, H; Schmitz, S A; Sonnenschein, L; Sowa, M; Steggemann, J; Teyssier, D; Zeidler, C; Bontenackels, M; Davids, M; Duda, M; Flügge, G; Geenen, H; Giffels, M; Haj Ahmad, W; Heydhausen, D; Kress, T; Kuessel, Y; Linn, A; Nowack, A; Perchalla, L; Pooth, O; Sauerland, P; Stahl, A; Thomas, M; Tornier, D; Zoeller, M H; Aldaya Martin, M; Behrenhoff, W; Behrens, U; Bergholz, M; Borras, K; Campbell, A; Castro, E; Dammann, D; Eckerlin, G; Flossdorf, A; Flucke, G; Geiser, A; Hauk, J; Jung, H; Kasemann, M; Katkov, I; Kleinwort, C; Kluge, H; Knutsson, A; Kuznetsova, E; Lange, W; Lohmann, W; Mankel, R; Marienfeld, M; Melzer-Pellmann, I-A; Meyer, A B; Mnich, J; Mussgiller, A; Olzem, J; Parenti, A; Raspereza, A; Schmidt, R; Schoerner-Sadenius, T; Sen, N; Stein, M; Tomaszewska, J; Volyanskyy, D; Wissing, C; Autermann, C; Draeger, J; Eckstein, D; Enderle, H; Gebbert, U; Kaschube, K; Kaussen, G; Klanner, R; Mura, B; Naumann-Emme, S; Nowak, F; Sander, C; Schettler, H; Schleper, P; Schröder, M; Schum, T; Schwandt, J; Stadie, H; Steinbrück, G; Thomsen, J; Wolf, R; Bauer, J; Buege, V; Cakir, A; Chwalek, T; Daeuwel, D; De Boer, W; Dierlamm, A; Dirkes, G; Feindt, M; Gruschke, J; Hackstein, C; Hartmann, F; Heinrich, M; Held, H; Hoffmann, K H; Honc, S; Kuhr, T; Martschei, D; Mueller, S; Müller, Th; Niegel, M; Oberst, O; Oehler, A; Ott, J; Peiffer, T; Piparo, D; Quast, G; Rabbertz, K; Ratnikov, F; Renz, M; Sabellek, A; Saout, C; Scheurer, A; Schieferdecker, P; Schilling, F-P; Schott, G; Simonis, H J; Stober, F M; Troendle, D; Wagner-Kuhr, J; Zeise, M; Zhukov, V; Ziebarth, E B; Daskalakis, G; Geralis, T; Kyriakis, A; Loukas, D; Manolakos, I; Markou, A; Markou, C; Mavrommatis, C; Petrakou, E; Gouskos, L; Katsas, P; Panagiotou, A; Evangelou, I; Kokkas, P; Manthos, N; Papadopoulos, I; Patras, V; Triantis, F A; Aranyi, A; Bencze, G; Boldizsar, L; Debreczeni, G; Hajdu, C; Horvath, D; Kapusi, A; Krajczar, K; Laszlo, A; Sikler, F; Vesztergombi, G; Beni, N; Molnar, J; Palinkas, J; Szillasi, Z; Veszpremi, V; Raics, P; Trocsanyi, Z L; Ujvari, B; Bansal, S; Beri, S B; Bhatnagar, V; Jindal, M; Kaur, M; Kohli, J M; Mehta, M Z; Nishu, N; Saini, L K; Sharma, A; Sharma, R; Singh, A P; Singh, J B; Singh, S P; Ahuja, S; Bhattacharya, S; Chauhan, S; Choudhary, B C; Gupta, P; Jain, S; Jain, S; Kumar, A; Ranjan, K; Shivpuri, R K; Choudhury, R K; Dutta, D; Kailas, S; Kataria, S K; Mohanty, A K; Pant, L M; Shukla, P; Suggisetti, P; Aziz, T; Guchait, M; Gurtu, A; Maity, M; Majumder, D; Majumder, G; Mazumdar, K; Mohanty, G B; Saha, A; Sudhakar, K; Wickramage, N; Banerjee, S; Dugad, S; Mondal, N K; Arfaei, H; Bakhshiansohi, H; Fahim, A; Jafari, A; Mohammadi Najafabadi, M; Paktinat Mehdiabadi, S; Safarzadeh, B; Zeinali, M; Abbrescia, M; Barbone, L; Colaleo, A; Creanza, D; De Filippis, N; De Palma, M; Dimitrov, A; Fedele, F; Fiore, L; Iaselli, G; Lusito, L; Maggi, G; Maggi, M; Manna, N; Marangelli, B; My, S; Nuzzo, S; Pierro, G A; Pompili, A; Pugliese, G; Romano, F; Roselli, G; Selvaggi, G; Silvestris, L; Trentadue, R; Tupputi, S; Zito, G; Abbiendi, G; Benvenuti, A C; Bonacorsi, D; Braibant-Giacomelli, S; Capiluppi, P; Castro, A; Cavallo, F R; Codispoti, G; Cuffiani, M; Fanfani, A; Fasanella, D; Giacomelli, P; Giunta, M; Grandi, C; Marcellini, S; Masetti, G; Montanari, A; Navarria, F L; Odorici, F; Perrotta, A; Rossi, A M; Rovelli, T; Siroli, G; Travaglini, R; Albergo, S; Cappello, G; Chiorboli, M; Costa, S; Tricomi, A; Tuve, C; Barbagli, G; Broccolo, G; Ciulli, V; Civinini, C; D'Alessandro, R; Focardi, E; Frosali, S; Gallo, E; Genta, C; Lenzi, P; Meschini, M; Paoletti, S; Sguazzoni, G; Tropiano, A; Benussi, L; Bianco, S; Colafranceschi, S; Fabbri, F; Piccolo, D; Fabbricatore, P; Musenich, R; Benaglia, A; Cerati, G B; De Guio, F; Di Matteo, L; Ghezzi, A; Govoni, P; Malberti, M; Malvezzi, S; Martelli, A; Massironi, A; Menasce, D; Miccio, V; Moroni, L; Negri, P; Paganoni, M; Pedrini, D; Ragazzi, S; Redaelli, N; Sala, S; Salerno, R; Tabarelli de Fatis, T; Tancini, V; Taroni, S; Buontempo, S; Cimmino, A; De Cosa, A; De Gruttola, M; Fabozzi, F; Iorio, A O M; Lista, L; Noli, P; Paolucci, P; Azzi, P; Bacchetta, N; Bellan, P; Bisello, D; Carlin, R; Checchia, P; Conti, E; De Mattia, M; Dorigo, T; Dosselli, U; Gasparini, F; Gasparini, U; Giubilato, P; Gresele, A; Lacaprara, S; Lazzizzera, I; Margoni, M; Mazzucato, M; Meneguzzo, A T; Nespolo, M; Perrozzi, L; Pozzobon, N; Ronchese, P; Simonetto, F; Torassa, E; Tosi, M; Vanini, S; Zotto, P; Zumerle, G; Baesso, P; Berzano, U; Riccardi, C; Torre, P; Vitulo, P; Viviani, C; Biasini, M; Bilei, G M; Caponeri, B; Fanò, L; Lariccia, P; Lucaroni, A; Mantovani, G; Menichelli, M; Nappi, A; Santocchia, A; Servoli, L; Valdata, M; Volpe, R; Azzurri, P; Bagliesi, G; Bernardini, J; Boccali, T; Castaldi, R; Dagnolo, R T; Dell'orso, R; Fiori, F; Foà, L; Giassi, A; Kraan, A; Ligabue, F; Lomtadze, T; Martini, L; Messineo, A; Palla, F; Palmonari, F; Segneri, G; Serban, A T; Spagnolo, P; Tenchini, R; Tonelli, G; Venturi, A; Verdini, P G; Barone, L; Cavallari, F; Del Re, D; Di Marco, E; Diemoz, M; Franci, D; Grassi, M; Longo, E; Organtini, G; Palma, A; Pandolfi, F; Paramatti, R; Rahatlou, S; Amapane, N; Arcidiacono, R; Argiro, S; Arneodo, M; Biino, C; Botta, C; Cartiglia, N; Castello, R; Costa, M; Demaria, N; Graziano, A; Mariotti, C; Marone, M; Maselli, S; Migliore, E; Mila, G; Monaco, V; Musich, M; Obertino, M M; Pastrone, N; Pelliccioni, M; Romero, A; Ruspa, M; Sacchi, R; Solano, A; Staiano, A; Trocino, D; Vilela Pereira, A; Ambroglini, F; Belforte, S; Cossutti, F; Della Ricca, G; Gobbo, B; Montanino, D; Penzo, A; Chang, S; Chung, J; Kim, D H; Kim, G N; Kim, J E; Kong, D J; Park, H; Son, D C; Kim, Zero; Kim, J Y; Song, S; Hong, B; Kim, H; Kim, J H; Kim, T J; Lee, K S; Moon, D H; Park, S K; Rhee, H B; Sim, K S; Choi, M; Kang, S; Kim, H; Park, C; Park, I C; Park, S; Choi, S; Choi, Y; Choi, Y K; Goh, J; Lee, J; Lee, S; Seo, H; Yu, I; Janulis, M; Martisiute, D; Petrov, P; Sabonis, T; Castilla Valdez, H; De La Cruz Burelo, E; Lopez-Fernandez, R; Sánchez Hernández, A; Villaseñor-Cendejas, L M; Carrillo Moreno, S; Salazar Ibarguen, H A; Casimiro Linares, E; Morelos Pineda, A; Reyes-Santos, M A; Allfrey, P; Krofcheck, D; Tam, J; Butler, P H; Signal, T; Williams, J C; Ahmad, M; Ahmed, I; Asghar, M I; Hoorani, H R; Khan, W A; Khurshid, T; Qazi, S; Cwiok, M; Dominik, W; Doroba, K; Konecki, M; Krolikowski, J; Frueboes, T; Gokieli, R; Górski, M; Kazana, M; Nawrocki, K; Szleper, M; Wrochna, G; Zalewski, P; Almeida, N; David, A; Faccioli, P; Ferreira Parracho, P G; Gallinaro, M; Mini, G; Musella, P; Nayak, A; Raposo, L; Ribeiro, P Q; Seixas, J; Silva, P; Soares, D; Varela, J; Wöhri, H K; Altsybeev, I; Belotelov, I; Bunin, P; Finger, M; Finger, M; Golutvin, I; Kamenev, A; Karjavin, V; Kozlov, G; Lanev, A; Moisenz, P; Palichik, V; Perelygin, V; Shmatov, S; Smirnov, V; Volodko, A; Zarubin, A; Bondar, N; Golovtsov, V; Ivanov, Y; Kim, V; Levchenko, P; Smirnov, I; Sulimov, V; Uvarov, L; Vavilov, S; Vorobyev, A; Andreev, Yu; Gninenko, S; Golubev, N; Kirsanov, M; Krasnikov, N; Matveev, V; Pashenkov, A; Toropin, A; Troitsky, S; Epshteyn, V; Gavrilov, V; Ilina, N; Kaftanov, V; Kossov, M; Krokhotin, A; Kuleshov, S; Oulianov, A; Safronov, G; Semenov, S; Shreyber, I; Stolin, V; Vlasov, E; Zhokin, A; Boos, E; Dubinin, M; Dudko, L; Ershov, A; Gribushin, A; Kodolova, O; Lokhtin, I; Obraztsov, S; Petrushanko, S; Sarycheva, L; Savrin, V; Snigirev, A; Andreev, V; Dremin, I; Kirakosyan, M; Rusakov, S V; Vinogradov, A; Azhgirey, I; Bitioukov, S; Datsko, K; Grishin, V; Kachanov, V; Konstantinov, D; Krychkine, V; Petrov, V; Ryutin, R; Slabospitsky, S; Sobol, A; Sytine, A; Tourtchanovitch, L; Troshin, S; Tyurin, N; Uzunian, A; Volkov, A; Adzic, P; Djordjevic, M; Krpic, D; Maletic, D; Milosevic, J; Puzovic, J; Aguilar-Benitez, M; Alcaraz Maestre, J; Arce, P; Battilana, C; Calvo, E; Cepeda, M; Cerrada, M; Chamizo Llatas, M; Colino, N; De La Cruz, B; Diez Pardos, C; Fernandez Bedoya, C; Fernández Ramos, J P; Ferrando, A; Flix, J; Fouz, M C; Garcia-Abia, P; Gonzalez Lopez, O; Goy Lopez, S; Hernandez, J M; Josa, M I; Merino, G; Puerta Pelayo, J; Redondo, I; Romero, L; Santaolalla, J; Willmott, C; Albajar, C; de Trocóniz, J F; Cuevas, J; Fernandez Menendez, J; Gonzalez Caballero, I; Lloret Iglesias, L; Vizan Garcia, J M; Cabrillo, I J; Calderon, A; Chuang, S H; Diaz Merino, I; Diez Gonzalez, C; Duarte Campderros, J; Fernandez, M; Gomez, G; Gonzalez Sanchez, J; Gonzalez Suarez, R; Jorda, C; Lobelle Pardo, P; Lopez Virto, A; Marco, J; Marco, R; Martinez Rivero, C; Martinez Ruiz Del Arbol, P; Matorras, F; Rodrigo, T; Ruiz Jimeno, A; Scodellaro, L; Sobron Sanudo, M; Vila, I; Vilar Cortabitarte, R; Abbaneo, D; Auffray, E; Baillon, P; Ball, A H; Barney, D; Beaudette, F; Bellan, R; Benedetti, D; Bernet, C; Bialas, W; Bloch, P; Bocci, A; Bolognesi, S; Breuker, H; Brona, G; Bunkowski, K; Camporesi, T; Cano, E; Cattai, A; Cerminara, G; Christiansen, T; Coarasa Perez, J A; Covarelli, R; Curé, B; Dahms, T; De Roeck, A; Elliott-Peisert, A; Funk, W; Gaddi, A; Gennai, S; Gerwig, H; Gigi, D; Gill, K; Giordano, D; Glege, F; Gomez-Reino Garrido, R; Gowdy, S; Guiducci, L; Hansen, M; Hartl, C; Harvey, J; Hegner, B; Henderson, C; Hoffmann, H F; Honma, A; Innocente, V; Janot, P; Lecoq, P; Leonidopoulos, C; Lourenço, C; Macpherson, A; Mäki, T; Malgeri, L; Mannelli, M; Masetti, L; Mavromanolakis, G; Meijers, F; Mersi, S; Meschi, E; Moser, R; Mozer, M U; Mulders, M; Nesvold, E; Orsini, L; Perez, E; Petrilli, A; Pfeiffer, A; Pierini, M; Pimiä, M; Racz, A; Rolandi, G; Rovelli, C; Rovere, M; Sakulin, H; Schäfer, C; Schwick, C; Segoni, I; Sharma, A; Siegrist, P; Simon, M; Sphicas, P; Spiga, D; Spiropulu, M; Stöckli, F; Traczyk, P; Tropea, P; Tsirou, A; Veres, G I; Vichoudis, P; Voutilainen, M; Zeuner, W D; Bertl, W; Deiters, K; Erdmann, W; Gabathuler, K; Horisberger, R; Ingram, Q; Kaestli, H C; König, S; Kotlinski, D; Langenegger, U; Meier, F; Renker, D; Rohe, T; Sibille, J; Starodumov, A; Caminada, L; Chen, Z; Cittolin, S; Dissertori, G; Dittmar, M; Eugster, J; Freudenreich, K; Grab, C; Hervé, A; Hintz, W; Lecomte, P; Lustermann, W; Marchica, C; Meridiani, P; Milenovic, P; Moortgat, F; Nardulli, A; Nef, P; Nessi-Tedaldi, F; Pape, L; Pauss, F; Punz, T; Rizzi, A; Ronga, F J; Sala, L; Sanchez, A K; Sawley, M-C; Schinzel, D; Stieger, B; Tauscher, L; Thea, A; Theofilatos, K; Treille, D; Weber, M; Wehrli, L; Weng, J; Amsler, C; Chiochia, V; De Visscher, S; Ivova Rikova, M; Millan Mejias, B; Regenfus, C; Robmann, P; Rommerskirchen, T; Schmidt, A; Tsirigkas, D; Wilke, L; Chang, Y H; Chen, K H; Chen, W T; Go, A; Kuo, C M; Li, S W; Lin, W; Liu, M H; Lu, Y J; Wu, J H; Yu, S S; Bartalini, P; Chang, P; Chang, Y H; Chang, Y W; Chao, Y; Chen, K F; Hou, W-S; Hsiung, Y; Kao, K Y; Lei, Y J; Lin, S W; Lu, R-S; Shiu, J G; Tzeng, Y M; Ueno, K; Wang, C C; Wang, M; Wei, J T; Adiguzel, A; Ayhan, A; Bakirci, M N; Cerci, S; Demir, Z; Dozen, C; Dumanoglu, I; Eskut, E; Girgis, S; Gökbulut, G; Güler, Y; Gurpinar, E; Hos, I; Kangal, E E; Karaman, T; Kayis Topaksu, A; Nart, A; Onengüt, G; Ozdemir, K; Ozturk, S; Polatöz, A; Sahin, O; Sengul, O; Sogut, K; Tali, B; Topakli, H; Uzun, D; Vergili, L N; Vergili, M; Zorbilmez, C; Akin, I V; Aliev, T; Bilmis, S; Deniz, M; Gamsizkan, H; Guler, A M; Ocalan, K; Ozpineci, A; Serin, M; Sever, R; Surat, U E; Yildirim, E; Zeyrek, M; Deliomeroglu, M; Demir, D; Gülmez, E; Halu, A; Isildak, B; Kaya, M; Kaya, O; Ozbek, M; Ozkorucuklu, S; Sonmez, N; Levchuk, L; Bell, P; Bostock, F; Brooke, J J; Cheng, T L; Cussans, D; Frazier, R; Goldstein, J; Hansen, M; Heath, G P; Heath, H F; Hill, C; Huckvale, B; Jackson, J; Kreczko, L; Mackay, C K; Metson, S; Newbold, D M; Nirunpong, K; Smith, V J; Ward, S; Basso, L; Bell, K W; Belyaev, A; Brew, C; Brown, R M; Camanzi, B; Cockerill, D J A; Coughlan, J A; Harder, K; Harper, S; Kennedy, B W; Olaiya, E; Petyt, D; Radburn-Smith, B C; Shepherd-Themistocleous, C H; Tomalin, I R; Womersley, W J; Worm, S D; Bainbridge, R; Ball, G; Ballin, J; Beuselinck, R; Buchmuller, O; Colling, D; Cripps, N; Cutajar, M; Davies, G; Della Negra, M; Foudas, C; Fulcher, J; Futyan, D; Guneratne Bryer, A; Hall, G; Hatherell, Z; Hays, J; Iles, G; Karapostoli, G; Lyons, L; Magnan, A-M; Marrouche, J; Nandi, R; Nash, J; Nikitenko, A; Papageorgiou, A; Pesaresi, M; Petridis, K; Pioppi, M; Raymond, D M; Rompotis, N; Rose, A; Ryan, M J; Seez, C; Sharp, P; Sparrow, A; Stoye, M; Tapper, A; Tourneur, S; Vazquez Acosta, M; Virdee, T; Wakefield, S; Wardrope, D; Whyntie, T; Barrett, M; Chadwick, M; Cole, J E; Hobson, P R; Khan, A; Kyberd, P; Leslie, D; Reid, I D; Teodorescu, L; Bose, T; Clough, A; Heister, A; St John, J; Lawson, P; Lazic, D; Rohlf, J; Sulak, L; Andrea, J; Avetisyan, A; Bhattacharya, S; Chou, J P; Cutts, D; Esen, S; Heintz, U; Jabeen, S; Kukartsev, G; Landsberg, G; Narain, M; Nguyen, D; Speer, T; Tsang, K V; Borgia, M A; Breedon, R; Calderon De La Barca Sanchez, M; Cebra, D; Chertok, M; Conway, J; Cox, P T; Dolen, J; Erbacher, R; Friis, E; Ko, W; Kopecky, A; Lander, R; Liu, H; Maruyama, S; Miceli, T; Nikolic, M; Pellett, D; Robles, J; Schwarz, T; Searle, M; Smith, J; Squires, M; Tripathi, M; Vasquez Sierra, R; Veelken, C; Andreev, V; Arisaka, K; Cline, D; Cousins, R; Deisher, A; Erhan, S; Farrell, C; Felcini, M; Hauser, J; Ignatenko, M; Jarvis, C; Plager, C; Rakness, G; Schlein, P; Tucker, J; Valuev, V; Wallny, R; Babb, J; Clare, R; Ellison, J; Gary, J W; Hanson, G; Jeng, G Y; Kao, S C; Liu, F; Liu, H; Luthra, A; Nguyen, H; Pasztor, G; Satpathy, A; Shen, B C; Stringer, R; Sturdy, J; Sumowidagdo, S; Wilken, R; Wimpenny, S; Andrews, W; Branson, J G; Dusinberre, E; Evans, D; Golf, F; Holzner, A; Kelley, R; Lebourgeois, M; Letts, J; Mangano, B; Muelmenstaedt, J; Padhi, S; Palmer, C; Petrucciani, G; Pi, H; Pieri, M; Ranieri, R; Sani, M; Sharma, V; Simon, S; Tu, Y; Vartak, A; Würthwein, F; Yagil, A; Barge, D; Blume, M; Campagnari, C; D'Alfonso, M; Danielson, T; Garberson, J; Incandela, J; Justus, C; Kalavase, P; Koay, S A; Kovalskyi, D; Krutelyov, V; Lamb, J; Lowette, S; Pavlunin, V; Rebassoo, F; Ribnik, J; Richman, J; Rossin, R; Stuart, D; To, W; Vlimant, J R; Witherell, M; Bornheim, A; Bunn, J; Gataullin, M; Kcira, D; Litvine, V; Ma, Y; Newman, H B; Rogan, C; Shin, K; Timciuc, V; Veverka, J; Wilkinson, R; Yang, Y; Zhu, R Y; Akgun, B; Carroll, R; Ferguson, T; Jang, D W; Jun, S Y; Paulini, M; Russ, J; Terentyev, N; Vogel, H; Vorobiev, I; Cumalat, J P; Dinardo, M E; Drell, B R; Ford, W T; Heyburn, B; Luiggi Lopez, E; Nauenberg, U; Smith, J G; Stenson, K; Ulmer, K A; Wagner, S R; Zang, S L; Agostino, L; Alexander, J; Blekman, F; Chatterjee, A; Das, S; Eggert, N; Fields, L J; Gibbons, L K; Heltsley, B; Hopkins, W; Khukhunaishvili, A; Kreis, B; Kuznetsov, V; Nicolas Kaufman, G; Patterson, J R; Puigh, D; Riley, D; Ryd, A; Shi, X; Sun, W; Teo, W D; Thom, J; Thompson, J; Vaughan, J; Weng, Y; Wittich, P; Biselli, A; Cirino, G; Winn, D; Abdullin, S; Albrow, M; Anderson, J; Apollinari, G; Atac, M; Bakken, J A; Banerjee, S; Bauerdick, L A T; Beretvas, A; Berryhill, J; Bhat, P C; Bloch, I; Borcherding, F; Burkett, K; Butler, J N; Chetluru, V; Cheung, H W K; Chlebana, F; Cihangir, S; Demarteau, M; Eartly, D P; Elvira, V D; Fisk, I; Freeman, J; Gao, Y; Gottschalk, E; Green, D; Gutsche, O; Hahn, A; Hanlon, J; Harris, R M; James, E; Jensen, H; Johnson, M; Joshi, U; Khatiwada, R; Kilminster, B; Klima, B; Kousouris, K; Kunori, S; Kwan, S; Limon, P; Lipton, R; Lykken, J; Maeshima, K; Marraffino, J M; Mason, D; McBride, P; McCauley, T; Miao, T; Mishra, K; Mrenna, S; Musienko, Y; Newman-Holmes, C; O'Dell, V; Popescu, S; Pordes, R; Prokofyev, O; Saoulidou, N; Sexton-Kennedy, E; Sharma, S; Smith, R P; Soha, A; Spalding, W J; Spiegel, L; Tan, P; Taylor, L; Tkaczyk, S; Uplegger, L; Vaandering, E W; Vidal, R; Whitmore, J; Wu, W; Yumiceva, F; Yun, J C; Acosta, D; Avery, P; Bourilkov, D; Chen, M; Di Giovanni, G P; Dobur, D; Drozdetskiy, A; Field, R D; Fu, Y; Furic, I K; Gartner, J; Kim, B; Klimenko, S; Konigsberg, J; Korytov, A; Kotov, K; Kropivnitskaya, A; Kypreos, T; Matchev, K; Mitselmakher, G; Pakhotin, Y; Piedra Gomez, J; Prescott, C; Remington, R; Schmitt, M; Scurlock, B; Sellers, P; Wang, D; Yelton, J; Zakaria, M; Ceron, C; Gaultney, V; Kramer, L; Lebolo, L M; Linn, S; Markowitz, P; Martinez, G; Mesa, D; Rodriguez, J L; Adams, T; Askew, A; Chen, J; Diamond, B; Gleyzer, S V; Haas, J; Hagopian, S; Hagopian, V; Jenkins, M; Johnson, K F; Prosper, H; Sekmen, S; Veeraraghavan, V; Baarmand, M M; Guragain, S; Hohlmann, M; Kalakhety, H; Mermerkaya, H; Ralich, R; Vodopiyanov, I; Adams, M R; Anghel, I M; Apanasevich, L; Bazterra, V E; Betts, R R; Callner, J; Cavanaugh, R; Dragoiu, C; Garcia-Solis, E J; Gerber, C E; Hofman, D J; Khalatian, S; Lacroix, F; Shabalina, E; Smoron, A; Strom, D; Varelas, N; Akgun, U; Albayrak, E A; Bilki, B; Cankocak, K; Clarida, W; Duru, F; Lae, C K; McCliment, E; Merlo, J-P; Mestvirishvili, A; Moeller, A; Nachtman, J; Newsom, C R; Norbeck, E; Olson, J; Onel, Y; Ozok, F; Sen, S; Wetzel, J; Yetkin, T; Yi, K; Barnett, B A; Blumenfeld, B; Bonato, A; Eskew, C; Fehling, D; Giurgiu, G; Gritsan, A V; Guo, Z J; Hu, G; Maksimovic, P; Rappoccio, S; Swartz, M; Tran, N V; Whitbeck, A; Baringer, P; Bean, A; Benelli, G; Grachov, O; Murray, M; Radicci, V; Sanders, S; Wood, J S; Zhukova, V; Bandurin, D; Bolton, T; Chakaberia, I; Ivanov, A; Kaadze, K; Maravin, Y; Shrestha, S; Svintradze, I; Wan, Z; Gronberg, J; Lange, D; Wright, D; Baden, D; Boutemeur, M; Eno, S C; Ferencek, D; Hadley, N J; Kellogg, R G; Kirn, M; Mignerey, A; Rossato, K; Rumerio, P; Santanastasio, F; Skuja, A; Temple, J; Tonjes, M B; Tonwar, S C; Twedt, E; Alver, B; Bauer, G; Bendavid, J; Busza, W; Butz, E; Cali, I A; Chan, M; D'Enterria, D; Everaerts, P; Gomez Ceballos, G; Goncharov, M; Hahn, K A; Harris, P; Kim, Y; Klute, M; Lee, Y-J; Li, W; Loizides, C; Luckey, P D; Ma, T; Nahn, S; Paus, C; Roland, C; Roland, G; Rudolph, M; Stephans, G S F; Sumorok, K; Sung, K; Wenger, E A; Wyslouch, B; Xie, S; Yilmaz, Y; Yoon, A S; Zanetti, M; Cole, P; Cooper, S I; Cushman, P; Dahmes, B; De Benedetti, A; Dudero, P R; Franzoni, G; Haupt, J; Klapoetke, K; Kubota, Y; Mans, J; Rekovic, V; Rusack, R; Sasseville, M; Singovsky, A; Cremaldi, L M; Godang, R; Kroeger, R; Perera, L; Rahmat, R; Sanders, D A; Sonnek, P; Summers, D; Bloom, K; Bose, S; Butt, J; Claes, D R; Dominguez, A; Eads, M; Keller, J; Kelly, T; Kravchenko, I; Lazo-Flores, J; Lundstedt, C; Malbouisson, H; Malik, S; Snow, G R; Baur, U; Iashvili, I; Kharchilava, A; Kumar, A; Smith, K; Strang, M; Zennamo, J; Alverson, G; Barberis, E; Baumgartel, D; Boeriu, O; Reucroft, S; Swain, J; Wood, D; Zhang, J; Anastassov, A; Kubik, A; Ofierzynski, R A; Pozdnyakov, A; Schmitt, M; Stoynev, S; Velasco, M; Won, S; Antonelli, L; Berry, D; Hildreth, M; Jessop, C; Karmgard, D J; Kolb, J; Kolberg, T; Lannon, K; Lynch, S; Marinelli, N; Morse, D M; Ruchti, R; Slaunwhite, J; Valls, N; Warchol, J; Wayne, M; Ziegler, J; Bylsma, B; Durkin, L S; Gu, J; Killewald, P; Ling, T Y; Williams, G; Adam, N; Berry, E; Elmer, P; Gerbaudo, D; Halyo, V; Hunt, A; Jones, J; Laird, E; Lopes Pegna, D; Marlow, D; Medvedeva, T; Mooney, M; Olsen, J; Piroué, P; Stickland, D; Tully, C; Werner, J S; Zuranski, A; Acosta, J G; Huang, X T; Lopez, A; Mendez, H; Oliveros, S; Ramirez Vargas, J E; Zatzerklyaniy, A; Alagoz, E; Barnes, V E; Bolla, G; Borrello, L; Bortoletto, D; Everett, A; Garfinkel, A F; Gecse, Z; Gutay, L; Jones, M; Koybasi, O; Laasanen, A T; Leonardo, N; Liu, C; Maroussov, V; Merkel, P; Miller, D H; Neumeister, N; Potamianos, K; Shipsey, I; Silvers, D; Yoo, H D; Zablocki, J; Zheng, Y; Jindal, P; Parashar, N; Cuplov, V; Ecklund, K M; Geurts, F J M; Liu, J H; Morales, J; Padley, B P; Redjimi, R; Roberts, J; Betchart, B; Bodek, A; Chung, Y S; de Barbaro, P; Demina, R; Flacher, H; Garcia-Bellido, A; Gotra, Y; Han, J; Harel, A; Miner, D C; Orbaker, D; Petrillo, G; Vishnevskiy, D; Zielinski, M; Bhatti, A; Demortier, L; Goulianos, K; Hatakeyama, K; Lungu, G; Mesropian, C; Yan, M; Atramentov, O; Gershtein, Y; Gray, R; Halkiadakis, E; Hidas, D; Hits, D; Lath, A; Rose, K; Schnetzer, S; Somalwar, S; Stone, R; Thomas, S; Cerizza, G; Hollingsworth, M; Spanier, S; Yang, Z C; York, A; Asaadi, J; Eusebi, R; Gilmore, J; Gurrola, A; Kamon, T; Khotilovich, V; Montalvo, R; Nguyen, C N; Pivarski, J; Safonov, A; Sengupta, S; Toback, D; Weinberger, M; Akchurin, N; Bardak, C; Damgov, J; Jeong, C; Kovitanggoon, K; Lee, S W; Mane, P; Roh, Y; Sill, A; Volobouev, I; Wigmans, R; Yazgan, E; Appelt, E; Brownson, E; Engh, D; Florez, C; Gabella, W; Johns, W; Kurt, P; Maguire, C; Melo, A; Sheldon, P; Velkovska, J; Arenton, M W; Balazs, M; Buehler, M; Conetti, S; Cox, B; Hirosky, R; Ledovskoy, A; Neu, C; Yohay, R; Gollapinni, S; Gunthoti, K; Harr, R; Karchin, P E; Mattson, M; Milstène, C; Sakharov, A; Anderson, M; Bachtis, M; Bellinger, J N; Carlsmith, D; Dasu, S; Dutta, S; Efron, J; Gray, L; Grogg, K S; Grothe, M; Herndon, M; Klabbers, P; Klukas, J; Lanaro, A; Lazaridis, C; Leonard, J; Lomidze, D; Loveless, R; Mohapatra, A; Polese, G; Reeder, D; Savin, A; Smith, W H; Swanson, J; Weinberg, M
2010-07-16
Bose-Einstein correlations have been measured using samples of proton-proton collisions at 0.9 and 2.36 TeV center-of-mass energies, recorded by the CMS experiment at the CERN Large Hadron Collider. The signal is observed in the form of an enhancement of pairs of same-sign charged particles with small relative four-momentum. The size of the correlated particle emission region is seen to increase significantly with the particle multiplicity of the event.
Khachatryan, Vardan; Tumasyan, Armen; Adam, Wolfgang; Bergauer, Thomas; Dragicevic, Marko; Erö, Janos; Fabjan, Christian; Friedl, Markus; Fruehwirth, Rudolf; Ghete, Vasile Mihai; Hammer, Josef; Haensel, Stephan; Hoch, Michael; Hörmann, Natascha; Hrubec, Josef; Jeitler, Manfred; Kasieczka, Gregor; Kiesenhofer, Wolfgang; Krammer, Manfred; Liko, Dietrich; Mikulec, Ivan; Pernicka, Manfred; Rohringer, Herbert; Schöfbeck, Robert; Strauss, Josef; Taurok, Anton; Teischinger, Florian; Waltenberger, Wolfgang; Walzel, Gerhard; Widl, Edmund; Wulz, Claudia-Elisabeth; Mossolov, Vladimir; Shumeiko, Nikolai; Suarez Gonzalez, Juan; Benucci, Leonardo; Ceard, Ludivine; De Wolf, Eddi A.; Hashemi, Majid; Janssen, Xavier; Maes, Thomas; Mucibello, Luca; Ochesanu, Silvia; Roland, Benoit; Rougny, Romain; Selvaggi, Michele; Van Haevermaet, Hans; Van Mechelen, Pierre; Van Remortel, Nick; Adler, Volker; Beauceron, Stephanie; Blyweert, Stijn; D'Hondt, Jorgen; Devroede, Olivier; Kalogeropoulos, Alexis; Maes, Joris; Maes, Michael; Tavernier, Stefaan; Van Doninck, Walter; Van Mulders, Petra; Villella, Ilaria; Chabert, Eric Christian; Charaf, Otman; Clerbaux, Barbara; De Lentdecker, Gilles; Dero, Vincent; Gay, Arnaud; Hammad, Gregory Habib; Marage, Pierre Edouard; Vander Velde, Catherine; Vanlaer, Pascal; Wickens, John; Costantini, Silvia; Grunewald, Martin; Klein, Benjamin; Marinov, Andrey; Ryckbosch, Dirk; Thyssen, Filip; Tytgat, Michael; Vanelderen, Lukas; Verwilligen, Piet; Walsh, Sinead; Zaganidis, Nicolas; Basegmez, Suzan; Bruno, Giacomo; Caudron, Julien; De Favereau De Jeneret, Jerome; Delaere, Christophe; Demin, Pavel; Favart, Denis; Giammanco, Andrea; Grégoire, Ghislain; Hollar, Jonathan; Lemaitre, Vincent; Militaru, Otilia; Ovyn, Severine; Pagano, Davide; Pin, Arnaud; Piotrzkowski, Krzysztof; Quertenmont, Loic; Schul, Nicolas; Beliy, Nikita; Caebergs, Thierry; Daubie, Evelyne; Alves, Gilvan; Pol, Maria Elena; Henrique Gomes E Souza, Moacyr; Carvalho, Wagner; Melo Da Costa, Eliza; De Jesus Damiao, Dilson; De Oliveira Martins, Carley; Fonseca De Souza, Sandro; Mundim, Luiz; Oguri, Vitor; Santoro, Alberto; Silva Do Amaral, Sheila Mara; Sznajder, Andre; Torres Da Silva De Araujo, Felipe; De Almeida Dias, Flavia; Ferreira Dias, Marco Andre; Tomei, Thiago; De Moraes Gregores, Eduardo; Da Cunha Marinho, Franciole; Novaes, Sergio F.; Padula, Sandra; Darmenov, Nikolay; Dimitrov, Lubomir; Genchev, Vladimir; Iaydjiev, Plamen; Piperov, Stefan; Stoykova, Stefka; Sultanov, Georgi; Trayanov, Rumen; Vankov, Ivan; Dyulendarova, Milena; Hadjiiska, Roumyana; Kozhuharov, Venelin; Litov, Leander; Marinova, Evelina; Mateev, Matey; Pavlov, Borislav; Petkov, Peicho; Bian, Jian-Guo; Chen, Guo-Ming; Chen, He-Sheng; Jiang, Chun-Hua; Liang, Dong; Liang, Song; Wang, Jian; Wang, Xianyou; Wang, Zheng; Yang, Min; Zang, Jingjing; Zhang, Zhen; Ban, Yong; Guo, Shuang; Hu, Zhen; Mao, Yajun; Qian, Si-Jin; Teng, Haiyun; Zhu, Bo; Cabrera, Andrés; Carrillo Montoya, Camilo Andres; Gomez Moreno, Bernardo; Ocampo Rios, Alberto Andres; Osorio Oliveros, Andres Felipe; Sanabria, Juan Carlos; Godinovic, Nikola; Lelas, Damir; Lelas, Karlo; Plestina, Roko; Polic, Dunja; Puljak, Ivica; Antunovic, Zeljko; Dzelalija, Mile; Brigljevic, Vuko; Duric, Senka; Kadija, Kreso; Morovic, Srecko; Attikis, Alexandros; Fereos, Reginos; Galanti, Mario; Mousa, Jehad; Nicolaou, Charalambos; Papadakis, Antonakis; Ptochos, Fotios; Razis, Panos A.; Rykaczewski, Hans; Tsiakkouri, Demetra; Zinonos, Zinonas; Mahmoud, Mohammed; Hektor, Andi; Kadastik, Mario; Kannike, Kristjan; Müntel, Mait; Raidal, Martti; Rebane, Liis; Azzolini, Virginia; Eerola, Paula; Czellar, Sandor; Härkönen, Jaakko; Heikkinen, Mika Aatos; Karimäki, Veikko; Kinnunen, Ritva; Klem, Jukka; Kortelainen, Matti J.; Lampén, Tapio; Lassila-Perini, Kati; Lehti, Sami; Lindén, Tomas; Luukka, Panja-Riina; Mäenpää, Teppo; Tuominen, Eija; Tuominiemi, Jorma; Tuovinen, Esa; Ungaro, Donatella; Wendland, Lauri; Banzuzi, Kukka; Korpela, Arja; Tuuva, Tuure; Sillou, Daniel; Besancon, Marc; Dejardin, Marc; Denegri, Daniel; Descamps, Julien; Fabbro, Bernard; Faure, Jean-Louis; Ferri, Federico; Ganjour, Serguei; Gentit, François-Xavier; Givernaud, Alain; Gras, Philippe; Hamel de Monchenault, Gautier; Jarry, Patrick; Locci, Elizabeth; Malcles, Julie; Marionneau, Matthieu; Millischer, Laurent; Rander, John; Rosowsky, André; Rousseau, Delphine; Titov, Maksym; Verrecchia, Patrice; Baffioni, Stephanie; Bianchini, Lorenzo; Bluj, Michal; Broutin, Clementine; Busson, Philippe; Charlot, Claude; Dobrzynski, Ludwik; Elgammal, Sherif; Granier de Cassagnac, Raphael; Haguenauer, Maurice; Kalinowski, Artur; Miné, Philippe; Paganini, Pascal; Sabes, David; Sirois, Yves; Thiebaux, Christophe; Zabi, Alexandre; Agram, Jean-Laurent; Besson, Auguste; Bloch, Daniel; Bodin, David; Brom, Jean-Marie; Cardaci, Marco; Conte, Eric; Drouhin, Frédéric; Ferro, Cristina; Fontaine, Jean-Charles; Gelé, Denis; Goerlach, Ulrich; Greder, Sebastien; Juillot, Pierre; Karim, Mehdi; Le Bihan, Anne-Catherine; Mikami, Yoshinari; Speck, Joaquim; Van Hove, Pierre; Fassi, Farida; Mercier, Damien; Baty, Clement; Beaupere, Nicolas; Bedjidian, Marc; Bondu, Olivier; Boudoul, Gaelle; Boumediene, Djamel; Brun, Hugues; Chanon, Nicolas; Chierici, Roberto; Contardo, Didier; Depasse, Pierre; El Mamouni, Houmani; Fay, Jean; Gascon, Susan; Ille, Bernard; Kurca, Tibor; Le Grand, Thomas; Lethuillier, Morgan; Mirabito, Laurent; Perries, Stephane; Sordini, Viola; Tosi, Silvano; Tschudi, Yohann; Verdier, Patrice; Xiao, Hong; Roinishvili, Vladimir; Anagnostou, Georgios; Edelhoff, Matthias; Feld, Lutz; Heracleous, Natalie; Hindrichs, Otto; Jussen, Ruediger; Klein, Katja; Merz, Jennifer; Mohr, Niklas; Ostapchuk, Andrey; Perieanu, Adrian; Raupach, Frank; Sammet, Jan; Schael, Stefan; Sprenger, Daniel; Weber, Hendrik; Weber, Martin; Wittmer, Bruno; Actis, Oxana; Ata, Metin; Bender, Walter; Biallass, Philipp; Erdmann, Martin; Frangenheim, Jens; Hebbeker, Thomas; Hinzmann, Andreas; Hoepfner, Kerstin; Hof, Carsten; Kirsch, Matthias; Klimkovich, Tatsiana; Kreuzer, Peter; Lanske, Dankfried; Magass, Carsten; Merschmeyer, Markus; Meyer, Arnd; Papacz, Paul; Pieta, Holger; Reithler, Hans; Schmitz, Stefan Antonius; Sonnenschein, Lars; Sowa, Michael; Steggemann, Jan; Teyssier, Daniel; Zeidler, Clemens; Bontenackels, Michael; Davids, Martina; Duda, Markus; Flügge, Günter; Geenen, Heiko; Giffels, Manuel; Haj Ahmad, Wael; Heydhausen, Dirk; Kress, Thomas; Kuessel, Yvonne; Linn, Alexander; Nowack, Andreas; Perchalla, Lars; Pooth, Oliver; Sauerland, Philip; Stahl, Achim; Thomas, Maarten; Tornier, Daiske; Zoeller, Marc Henning; Aldaya Martin, Maria; Behrenhoff, Wolf; Behrens, Ulf; Bergholz, Matthias; Borras, Kerstin; Campbell, Alan; Castro, Elena; Dammann, Dirk; Eckerlin, Guenter; Flossdorf, Alexander; Flucke, Gero; Geiser, Achim; Hauk, Johannes; Jung, Hannes; Kasemann, Matthias; Katkov, Igor; Kleinwort, Claus; Kluge, Hannelies; Knutsson, Albert; Kuznetsova, Ekaterina; Lange, Wolfgang; Lohmann, Wolfgang; Mankel, Rainer; Marienfeld, Markus; Melzer-Pellmann, Isabell-Alissandra; Meyer, Andreas Bernhard; Mnich, Joachim; Mussgiller, Andreas; Olzem, Jan; Parenti, Andrea; Raspereza, Alexei; Schmidt, Ringo; Schoerner-Sadenius, Thomas; Sen, Niladri; Stein, Matthias; Tomaszewska, Justyna; Volyanskyy, Dmytro; Wissing, Christoph; Autermann, Christian; Draeger, Jula; Eckstein, Doris; Enderle, Holger; Gebbert, Ulla; Kaschube, Kolja; Kaussen, Gordon; Klanner, Robert; Mura, Benedikt; Naumann-Emme, Sebastian; Nowak, Friederike; Sander, Christian; Schettler, Hannes; Schleper, Peter; Schröder, Matthias; Schum, Torben; Schwandt, Joern; Stadie, Hartmut; Steinbrück, Georg; Thomsen, Jan; Wolf, Roger; Bauer, Julia; Buege, Volker; Cakir, Altan; Chwalek, Thorsten; Daeuwel, Daniel; De Boer, Wim; Dierlamm, Alexander; Dirkes, Guido; Feindt, Michael; Gruschke, Jasmin; Hackstein, Christoph; Hartmann, Frank; Heinrich, Michael; Held, Hauke; Hoffmann, Karl-Heinz; Honc, Simon; Kuhr, Thomas; Martschei, Daniel; Mueller, Steffen; Müller, Thomas; Niegel, Martin; Oberst, Oliver; Oehler, Andreas; Ott, Jochen; Peiffer, Thomas; Piparo, Danilo; Quast, Gunter; Rabbertz, Klaus; Ratnikov, Fedor; Renz, Manuel; Sabellek, Andreas; Saout, Christophe; Scheurer, Armin; Schieferdecker, Philipp; Schilling, Frank-Peter; Schott, Gregory; Simonis, Hans-Jürgen; Stober, Fred-Markus Helmut; Troendle, Daniel; Wagner-Kuhr, Jeannine; Zeise, Manuel; Zhukov, Valery; Ziebarth, Eva Barbara; Daskalakis, Georgios; Geralis, Theodoros; Kyriakis, Aristotelis; Loukas, Demetrios; Manolakos, Ioannis; Markou, Athanasios; Markou, Christos; Mavrommatis, Charalampos; Petrakou, Eleni; Gouskos, Loukas; Katsas, Panagiotis; Panagiotou, Apostolos; Evangelou, Ioannis; Kokkas, Panagiotis; Manthos, Nikolaos; Papadopoulos, Ioannis; Patras, Vaios; Triantis, Frixos A.; Aranyi, Attila; Bencze, Gyorgy; Boldizsar, Laszlo; Debreczeni, Gergely; Hajdu, Csaba; Horvath, Dezso; Kapusi, Anita; Krajczar, Krisztian; Laszlo, Andras; Sikler, Ferenc; Vesztergombi, Gyorgy; Beni, Noemi; Molnar, Jozsef; Palinkas, Jozsef; Szillasi, Zoltan; Veszpremi, Viktor; Raics, Peter; Trocsanyi, Zoltan Laszlo; Ujvari, Balazs; Bansal, Sunil; Beri, Suman Bala; Bhatnagar, Vipin; Jindal, Monika; Kaur, Manjit; Kohli, Jatinder Mohan; Mehta, Manuk Zubin; Nishu, Nishu; Saini, Lovedeep Kaur; Sharma, Archana; Sharma, Richa; Singh, Anil; Singh, Jas Bir; Singh, Supreet Pal; Ahuja, Sudha; Bhattacharya, Satyaki; Chauhan, Sushil; Choudhary, Brajesh C.; Gupta, Pooja; Jain, Shilpi; Jain, Sandhya; Kumar, Ashok; Ranjan, Kirti; Shivpuri, Ram Krishen; Choudhury, Rajani Kant; Dutta, Dipanwita; Kailas, Swaminathan; Kataria, Sushil Kumar; Mohanty, Ajit Kumar; Pant, Lalit Mohan; Shukla, Prashant; Suggisetti, Praveenkumar; Aziz, Tariq; Guchait, Monoranjan; Gurtu, Atul; Maity, Manas; Majumder, Devdatta; Majumder, Gobinda; Mazumdar, Kajari; Mohanty, Gagan Bihari; Saha, Anirban; Sudhakar, Katta; Wickramage, Nadeesha; Banerjee, Sudeshna; Dugad, Shashikant; Mondal, Naba Kumar; Arfaei, Hessamaddin; Bakhshiansohi, Hamed; Fahim, Ali; Jafari, Abideh; Mohammadi Najafabadi, Mojtaba; Paktinat Mehdiabadi, Saeid; Safarzadeh, Batool; Zeinali, Maryam; Abbrescia, Marcello; Barbone, Lucia; Colaleo, Anna; Creanza, Donato; De Filippis, Nicola; De Palma, Mauro; Dimitrov, Anton; Fedele, Francesca; Fiore, Luigi; Iaselli, Giuseppe; Lusito, Letizia; Maggi, Giorgio; Maggi, Marcello; Manna, Norman; Marangelli, Bartolomeo; My, Salvatore; Nuzzo, Salvatore; Pierro, Giuseppe Antonio; Pompili, Alexis; Pugliese, Gabriella; Romano, Francesco; Roselli, Giuseppe; Selvaggi, Giovanna; Silvestris, Lucia; Trentadue, Raffaello; Tupputi, Salvatore; Zito, Giuseppe; Abbiendi, Giovanni; Benvenuti, Alberto; Bonacorsi, Daniele; Braibant-Giacomelli, Sylvie; Capiluppi, Paolo; Castro, Andrea; Cavallo, Francesca Romana; Codispoti, Giuseppe; Cuffiani, Marco; Fanfani, Alessandra; Fasanella, Daniele; Giacomelli, Paolo; Giunta, Marina; Grandi, Claudio; Marcellini, Stefano; Masetti, Gianni; Montanari, Alessandro; Navarria, Francesco; Odorici, Fabrizio; Perrotta, Andrea; Rossi, Antonio; Rovelli, Tiziano; Siroli, Gianni; Travaglini, Riccardo; Albergo, Sebastiano; Cappello, Gigi; Chiorboli, Massimiliano; Costa, Salvatore; Tricomi, Alessia; Tuve, Cristina; Barbagli, Giuseppe; Broccolo, Giuseppe; Ciulli, Vitaliano; Civinini, Carlo; D'Alessandro, Raffaello; Focardi, Ettore; Frosali, Simone; Gallo, Elisabetta; Genta, Chiara; Lenzi, Piergiulio; Meschini, Marco; Paoletti, Simone; Sguazzoni, Giacomo; Tropiano, Antonio; Benussi, Luigi; Bianco, Stefano; Colafranceschi, Stefano; Fabbri, Franco; Piccolo, Davide; Fabbricatore, Pasquale; Musenich, Riccardo; Benaglia, Andrea; Cerati, Giuseppe Benedetto; De Guio, Federico; Di Matteo, Leonardo; Ghezzi, Alessio; Govoni, Pietro; Malberti, Martina; Malvezzi, Sandra; Martelli, Arabella; Massironi, Andrea; Menasce, Dario; Miccio, Vincenzo; Moroni, Luigi; Negri, Pietro; Paganoni, Marco; Pedrini, Daniele; Ragazzi, Stefano; Redaelli, Nicola; Sala, Silvano; Salerno, Roberto; Tabarelli de Fatis, Tommaso; Tancini, Valentina; Taroni, Silvia; Buontempo, Salvatore; Cimmino, Anna; De Cosa, Annapaola; De Gruttola, Michele; Fabozzi, Francesco; Iorio, Alberto Orso Maria; Lista, Luca; Noli, Pasquale; Paolucci, Pierluigi; Azzi, Patrizia; Bacchetta, Nicola; Bellan, Paolo; Bisello, Dario; Carlin, Roberto; Checchia, Paolo; Conti, Enrico; De Mattia, Marco; Dorigo, Tommaso; Dosselli, Umberto; Gasparini, Fabrizio; Gasparini, Ugo; Giubilato, Piero; Gresele, Ambra; Lacaprara, Stefano; Lazzizzera, Ignazio; Margoni, Martino; Mazzucato, Mirco; Meneguzzo, Anna Teresa; Nespolo, Massimo; Perrozzi, Luca; Pozzobon, Nicola; Ronchese, Paolo; Simonetto, Franco; Torassa, Ezio; Tosi, Mia; Vanini, Sara; Zotto, Pierluigi; Zumerle, Gianni; Baesso, Paolo; Berzano, Umberto; Riccardi, Cristina; Torre, Paola; Vitulo, Paolo; Viviani, Claudio; Biasini, Maurizio; Bilei, Gian Mario; Caponeri, Benedetta; Fanò, Livio; Lariccia, Paolo; Lucaroni, Andrea; Mantovani, Giancarlo; Menichelli, Mauro; Nappi, Aniello; Santocchia, Attilio; Servoli, Leonello; Valdata, Marisa; Volpe, Roberta; Azzurri, Paolo; Bagliesi, Giuseppe; Bernardini, Jacopo; Boccali, Tommaso; Castaldi, Rino; Tito DAgnolo, Raffaele; Dell'Orso, Roberto; Fiori, Francesco; Foà, Lorenzo; Giassi, Alessandro; Kraan, Aafke; Ligabue, Franco; Lomtadze, Teimuraz; Martini, Luca; Messineo, Alberto; Palla, Fabrizio; Palmonari, Francesco; Segneri, Gabriele; Serban, Alin Titus; Spagnolo, Paolo; Tenchini, Roberto; Tonelli, Guido; Venturi, Andrea; Verdini, Piero Giorgio; Barone, Luciano; Cavallari, Francesca; Del Re, Daniele; Di Marco, Emanuele; Diemoz, Marcella; Franci, Daniele; Grassi, Marco; Longo, Egidio; Organtini, Giovanni; Palma, Alessandro; Pandolfi, Francesco; Paramatti, Riccardo; Rahatlou, Shahram; Amapane, Nicola; Arcidiacono, Roberta; Argiro, Stefano; Arneodo, Michele; Biino, Cristina; Botta, Cristina; Cartiglia, Nicolo; Castello, Roberto; Costa, Marco; Demaria, Natale; Graziano, Alberto; Mariotti, Chiara; Marone, Matteo; Maselli, Silvia; Migliore, Ernesto; Mila, Giorgia; Monaco, Vincenzo; Musich, Marco; Obertino, Maria Margherita; Pastrone, Nadia; Pelliccioni, Mario; Romero, Alessandra; Ruspa, Marta; Sacchi, Roberto; Solano, Ada; Staiano, Amedeo; Trocino, Daniele; Vilela Pereira, Antonio; Ambroglini, Filippo; Belforte, Stefano; Cossutti, Fabio; Della Ricca, Giuseppe; Gobbo, Benigno; Montanino, Damiana; Penzo, Aldo; Chang, Sunghyun; Chung, Jin Hyuk; Kim, Dong Hee; Kim, Gui Nyun; Kim, Ji Eun; Kong, Dae Jung; Park, Hyangkyu; Son, Dong-Chul; Kim, Jaeho; Kim, Jae Yool; Song, Sanghyeon; Hong, Byung-Sik; Kim, Hyunchul; Kim, Ji Hyun; Kim, Tae Jeong; Lee, Kyong Sei; Moon, Dong Ho; Park, Sung Keun; Rhee, Han-Bum; Sim, Kwang Souk; Choi, Minkyoo; Kang, Seokon; Kim, Hyunyong; Park, Chawon; Park, Inkyu; Park, Sangnam; Choi, Suyong; Choi, Young-Il; Choi, Young Kyu; Goh, Junghwan; Lee, Jongseok; Lee, Sungeun; Seo, Hyunkwan; Yu, Intae; Janulis, Mindaugas; Martisiute, Dalia; Petrov, Pavel; Sabonis, Tomas; Castilla Valdez, Heriberto; De La Cruz Burelo, Eduard; Lopez-Fernandez, Ricardo; Sánchez Hernández, Alberto; Villaseñor-Cendejas, Luis Manuel; Carrillo Moreno, Salvador; Salazar Ibarguen, Humberto Antonio; Casimiro Linares, Edgar; Morelos Pineda, Antonio; Reyes-Santos, Marco A.; Allfrey, Philip; Krofcheck, David; Tam, Jason; Butler, Philip H.; Signal, Tony; Williams, Jennifer C.; Ahmad, Muhammad; Ahmed, Ijaz; Asghar, Muhammad Irfan; Hoorani, Hafeez R.; Khan, Wajid Ali; Khurshid, Taimoor; Qazi, Shamona; Cwiok, Mikolaj; Dominik, Wojciech; Doroba, Krzysztof; Konecki, Marcin; Krolikowski, Jan; Frueboes, Tomasz; Gokieli, Ryszard; Górski, Maciej; Kazana, Malgorzata; Nawrocki, Krzysztof; Szleper, Michal; Wrochna, Grzegorz; Zalewski, Piotr; Almeida, Nuno; David Tinoco Mendes, Andre; Faccioli, Pietro; Ferreira Parracho, Pedro Guilherme; Gallinaro, Michele; Mini, Giuliano; Musella, Pasquale; Nayak, Aruna; Raposo, Luis; Ribeiro, Pedro Quinaz; Seixas, Joao; Silva, Pedro; Soares, David; Varela, Joao; Wöhri, Hermine Katharina; Altsybeev, Igor; Belotelov, Ivan; Bunin, Pavel; Finger, Miroslav; Finger Jr., Michael; Golutvin, Igor; Kamenev, Alexey; Karjavin, Vladimir; Kozlov, Guennady; Lanev, Alexander; Moisenz, Petr; Palichik, Vladimir; Perelygin, Victor; Shmatov, Sergey; Smirnov, Vitaly; Volodko, Anton; Zarubin, Anatoli; Bondar, Nikolai; Golovtsov, Victor; Ivanov, Yury; Kim, Victor; Levchenko, Petr; Smirnov, Igor; Sulimov, Valentin; Uvarov, Lev; Vavilov, Sergey; Vorobyev, Alexey; Andreev, Yuri; Gninenko, Sergei; Golubev, Nikolai; Kirsanov, Mikhail; Krasnikov, Nikolai; Matveev, Viktor; Pashenkov, Anatoli; Toropin, Alexander; Troitsky, Sergey; Epshteyn, Vladimir; Gavrilov, Vladimir; Ilina, Natalia; Kaftanov, Vitali; Kossov, Mikhail; Krokhotin, Andrey; Kuleshov, Sergey; Oulianov, Alexei; Safronov, Grigory; Semenov, Sergey; Shreyber, Irina; Stolin, Viatcheslav; Vlasov, Evgueni; Zhokin, Alexander; Boos, Edouard; Dubinin, Mikhail; Dudko, Lev; Ershov, Alexander; Gribushin, Andrey; Kodolova, Olga; Lokhtin, Igor; Obraztsov, Stepan; Petrushanko, Sergey; Sarycheva, Ludmila; Savrin, Viktor; Snigirev, Alexander; Andreev, Vladimir; Dremin, Igor; Kirakosyan, Martin; Rusakov, Sergey V.; Vinogradov, Alexey; Azhgirey, Igor; Bitioukov, Sergei; Datsko, Kirill; Grishin, Viatcheslav; Kachanov, Vassili; Konstantinov, Dmitri; Krychkine, Victor; Petrov, Vladimir; Ryutin, Roman; Slabospitsky, Sergey; Sobol, Andrei; Sytine, Alexandre; Tourtchanovitch, Leonid; Troshin, Sergey; Tyurin, Nikolay; Uzunian, Andrey; Volkov, Alexey; Adzic, Petar; Djordjevic, Milos; Krpic, Dragomir; Maletic, Dimitrije; Milosevic, Jovan; Puzovic, Jovan; Aguilar-Benitez, Manuel; Alcaraz Maestre, Juan; Arce, Pedro; Battilana, Carlo; Calvo, Enrique; Cepeda, Maria; Cerrada, Marcos; Chamizo Llatas, Maria; Colino, Nicanor; De La Cruz, Begona; Diez Pardos, Carmen; Fernandez Bedoya, Cristina; Fernández Ramos, Juan Pablo; Ferrando, Antonio; Flix, Jose; Fouz, Maria Cruz; Garcia-Abia, Pablo; Gonzalez Lopez, Oscar; Goy Lopez, Silvia; Hernandez, Jose M.; Josa, Maria Isabel; Merino, Gonzalo; Puerta Pelayo, Jesus; Redondo, Ignacio; Romero, Luciano; Santaolalla, Javier; Willmott, Carlos; Albajar, Carmen; de Trocóniz, Jorge F; Cuevas, Javier; Fernandez Menendez, Javier; Gonzalez Caballero, Isidro; Lloret Iglesias, Lara; Vizan Garcia, Jesus Manuel; Cabrillo, Iban Jose; Calderon, Alicia; Chuang, Shan-Huei; Diaz Merino, Irma; Diez Gonzalez, Carlos; Duarte Campderros, Jordi; Fernandez, Marcos; Gomez, Gervasio; Gonzalez Sanchez, Javier; Gonzalez Suarez, Rebeca; Jorda, Clara; Lobelle Pardo, Patricia; Lopez Virto, Amparo; Marco, Jesus; Marco, Rafael; Martinez Rivero, Celso; Martinez Ruiz del Arbol, Pablo; Matorras, Francisco; Rodrigo, Teresa; Ruiz Jimeno, Alberto; Scodellaro, Luca; Sobron Sanudo, Mar; Vila, Ivan; Vilar Cortabitarte, Rocio; Abbaneo, Duccio; Auffray, Etiennette; Baillon, Paul; Ball, Austin; Barney, David; Beaudette, Florian; Bellan, Riccardo; Benedetti, Daniele; Bernet, Colin; Bialas, Wojciech; Bloch, Philippe; Bocci, Andrea; Bolognesi, Sara; Breuker, Horst; Brona, Grzegorz; Bunkowski, Karol; Camporesi, Tiziano; Cano, Eric; Cattai, Ariella; Cerminara, Gianluca; Christiansen, Tim; Coarasa Perez, Jose Antonio; Covarelli, Roberto; Curé, Benoît; Dahms, Torsten; De Roeck, Albert; Elliott-Peisert, Anna; Funk, Wolfgang; Gaddi, Andrea; Gennai, Simone; Gerwig, Hubert; Gigi, Dominique; Gill, Karl; Giordano, Domenico; Glege, Frank; Gomez-Reino Garrido, Robert; Gowdy, Stephen; Guiducci, Luigi; Hansen, Magnus; Hartl, Christian; Harvey, John; Hegner, Benedikt; Henderson, Conor; Hoffmann, Hans Falk; Honma, Alan; Innocente, Vincenzo; Janot, Patrick; Lecoq, Paul; Leonidopoulos, Christos; Lourenco, Carlos; Macpherson, Alick; Maki, Tuula; Malgeri, Luca; Mannelli, Marcello; Masetti, Lorenzo; Mavromanolakis, Georgios; Meijers, Frans; Mersi, Stefano; Meschi, Emilio; Moser, Roland; Mozer, Matthias Ulrich; Mulders, Martijn; Nesvold, Erik; Orsini, Luciano; Perez, Emmanuelle; Petrilli, Achille; Pfeiffer, Andreas; Pierini, Maurizio; Pimiä, Martti; Racz, Attila; Rolandi, Gigi; Rovelli, Chiara; Rovere, Marco; Sakulin, Hannes; Schäfer, Christoph; Schwick, Christoph; Segoni, Ilaria; Sharma, Archana; Siegrist, Patrice; Simon, Michal; Sphicas, Paraskevas; Spiga, Daniele; Spiropulu, Maria; Stöckli, Fabian; Traczyk, Piotr; Tropea, Paola; Tsirou, Andromachi; Veres, Gabor Istvan; Vichoudis, Paschalis; Voutilainen, Mikko; Zeuner, Wolfram Dietrich; Bertl, Willi; Deiters, Konrad; Erdmann, Wolfram; Gabathuler, Kurt; Horisberger, Roland; Ingram, Quentin; Kaestli, Hans-Christian; König, Stefan; Kotlinski, Danek; Langenegger, Urs; Meier, Frank; Renker, Dieter; Rohe, Tilman; Sibille, Jennifer; Starodumov, Andrei; Caminada, Lea; Chen, Zhiling; Cittolin, Sergio; Dissertori, Günther; Dittmar, Michael; Eugster, Jürg; Freudenreich, Klaus; Grab, Christoph; Hervé, Alain; Hintz, Wieland; Lecomte, Pierre; Lustermann, Werner; Marchica, Carmelo; Meridiani, Paolo; Milenovic, Predrag; Moortgat, Filip; Nardulli, Alessandro; Nef, Pascal; Nessi-Tedaldi, Francesca; Pape, Luc; Pauss, Felicitas; Punz, Thomas; Rizzi, Andrea; Ronga, Frederic Jean; Sala, Leonardo; Sanchez, Ann - Karin; Sawley, Marie-Christine; Schinzel, Dietrich; Stieger, Benjamin; Tauscher, Ludwig; Thea, Alessandro; Theofilatos, Konstantinos; Treille, Daniel; Weber, Matthias; Wehrli, Lukas; Weng, Joanna; Amsler, Claude; Chiochia, Vincenzo; De Visscher, Simon; Ivova Rikova, Mirena; Millan Mejias, Barbara; Regenfus, Christian; Robmann, Peter; Rommerskirchen, Tanja; Schmidt, Alexander; Tsirigkas, Dimitrios; Wilke, Lotte; Chang, Yuan-Hann; Chen, Kuan-Hsin; Chen, Wan-Ting; Go, Apollo; Kuo, Chia-Ming; Li, Syue-Wei; Lin, Willis; Liu, Ming-Hsiung; Lu, Yun-Ju; Wu, Jing-Han; Yu, Shin-Shan; Bartalini, Paolo; Chang, Paoti; Chang, You-Hao; Chang, Yu-Wei; Chao, Yuan; Chen, Kai-Feng; Hou, George Wei-Shu; Hsiung, Yee; Kao, Kai-Yi; Lei, Yeong-Jyi; Lin, Sheng-Wen; Lu, Rong-Shyang; Shiu, Jing-Ge; Tzeng, Yeng-Ming; Ueno, Koji; Wang, Chin-chi; Wang, Minzu; Wei, Jui-Te; Adiguzel, Aytul; Ayhan, Aydin; Bakirci, Mustafa Numan; Cerci, Salim; Demir, Zahide; Dozen, Candan; Dumanoglu, Isa; Eskut, Eda; Girgis, Semiray; Gökbulut, Gül; Güler, Yalcin; Gurpinar, Emine; Hos, Ilknur; Kangal, Evrim Ersin; Karaman, Turker; Kayis Topaksu, Aysel; Nart, Alisah; Önengüt, Gülsen; Ozdemir, Kadri; Ozturk, Sertac; Polatöz, Ayse; Sahin, Ozge; Sengul, Ozden; Sogut, Kenan; Tali, Bayram; Topakli, Huseyin; Uzun, Dilber; Vergili, Latife Nukhet; Vergili, Mehmet; Zorbilmez, Caglar; Akin, Ilina Vasileva; Aliev, Takhmasib; Bilmis, Selcuk; Deniz, Muhammed; Gamsizkan, Halil; Guler, Ali Murat; Ocalan, Kadir; Ozpineci, Altug; Serin, Meltem; Sever, Ramazan; Surat, Ugur Emrah; Yildirim, Eda; Zeyrek, Mehmet; Deliomeroglu, Mehmet; Demir, Durmus; Gülmez, Erhan; Halu, Arda; Isildak, Bora; Kaya, Mithat; Kaya, Ozlem; Özbek, Melih; Ozkorucuklu, Suat; Sonmez, Nasuf; Levchuk, Leonid; Bell, Peter; Bostock, Francis; Brooke, James John; Cheng, Teh Lee; Cussans, David; Frazier, Robert; Goldstein, Joel; Hansen, Maria; Heath, Greg P.; Heath, Helen F.; Hill, Christopher; Huckvale, Benedickt; Jackson, James; Kreczko, Lukasz; Mackay, Catherine Kirsty; Metson, Simon; Newbold, Dave M.; Nirunpong, Kachanon; Smith, Vincent J.; Ward, Simon; Basso, Lorenzo; Bell, Ken W.; Belyaev, Alexander; Brew, Christopher; Brown, Robert M.; Camanzi, Barbara; Cockerill, David J.A.; Coughlan, John A.; Harder, Kristian; Harper, Sam; Kennedy, Bruce W.; Olaiya, Emmanuel; Petyt, David; Radburn-Smith, Benjamin Charles; Shepherd-Themistocleous, Claire; Tomalin, Ian R.; Womersley, William John; Worm, Steven; Bainbridge, Robert; Ball, Gordon; Ballin, Jamie; Beuselinck, Raymond; Buchmuller, Oliver; Colling, David; Cripps, Nicholas; Cutajar, Michael; Davies, Gavin; Della Negra, Michel; Foudas, Costas; Fulcher, Jonathan; Futyan, David; Guneratne Bryer, Arlo; Hall, Geoffrey; Hatherell, Zoe; Hays, Jonathan; Iles, Gregory; Karapostoli, Georgia; Lyons, Louis; Magnan, Anne-Marie; Marrouche, Jad; Nandi, Robin; Nash, Jordan; Nikitenko, Alexander; Papageorgiou, Anastasios; Pesaresi, Mark; Petridis, Konstantinos; Pioppi, Michele; Raymond, David Mark; Rompotis, Nikolaos; Rose, Andrew; Ryan, Matthew John; Seez, Christopher; Sharp, Peter; Sparrow, Alex; Stoye, Markus; Tapper, Alexander; Tourneur, Stephane; Vazquez Acosta, Monica; Virdee, Tejinder; Wakefield, Stuart; Wardrope, David; Whyntie, Tom; Barrett, Matthew; Chadwick, Matthew; Cole, Joanne; Hobson, Peter R.; Khan, Akram; Kyberd, Paul; Leslie, Dawn; Reid, Ivan; Teodorescu, Liliana; Bose, Tulika; Clough, Andrew; Heister, Arno; St. John, Jason; Lawson, Philip; Lazic, Dragoslav; Rohlf, James; Sulak, Lawrence; Andrea, Jeremy; Avetisyan, Aram; Bhattacharya, Saptaparna; Chou, John Paul; Cutts, David; Esen, Selda; Heintz, Ulrich; Jabeen, Shabnam; Kukartsev, Gennadiy; Landsberg, Greg; Narain, Meenakshi; Nguyen, Duong; Speer, Thomas; Tsang, Ka Vang; Borgia, Maria Assunta; Breedon, Richard; Calderon De La Barca Sanchez, Manuel; Cebra, Daniel; Chertok, Maxwell; Conway, John; Cox, Peter Timothy; Dolen, James; Erbacher, Robin; Friis, Evan; Ko, Winston; Kopecky, Alexandra; Lander, Richard; Liu, Haidong; Maruyama, Sho; Miceli, Tia; Nikolic, Milan; Pellett, Dave; Robles, Jorge; Schwarz, Thomas; Searle, Matthew; Smith, John; Squires, Michael; Tripathi, Mani; Vasquez Sierra, Ricardo; Veelken, Christian; Andreev, Valeri; Arisaka, Katsushi; Cline, David; Cousins, Robert; Deisher, Amanda; Erhan, Samim; Farrell, Chris; Felcini, Marta; Hauser, Jay; Ignatenko, Mikhail; Jarvis, Chad; Plager, Charles; Rakness, Gregory; Schlein, Peter; Tucker, Jordan; Valuev, Vyacheslav; Wallny, Rainer; Babb, John; Clare, Robert; Ellison, John Anthony; Gary, J William; Hanson, Gail; Jeng, Geng-Yuan; Kao, Shih-Chuan; Liu, Feng; Liu, Hongliang; Luthra, Arun; Nguyen, Harold; Pasztor, Gabriella; Satpathy, Asish; Shen, Benjamin C.; Stringer, Robert; Sturdy, Jared; Sumowidagdo, Suharyo; Wilken, Rachel; Wimpenny, Stephen; Andrews, Warren; Branson, James G.; Dusinberre, Elizabeth; Evans, David; Golf, Frank; Holzner, André; Kelley, Ryan; Lebourgeois, Matthew; Letts, James; Mangano, Boris; Muelmenstaedt, Johannes; Padhi, Sanjay; Palmer, Christopher; Petrucciani, Giovanni; Pi, Haifeng; Pieri, Marco; Ranieri, Riccardo; Sani, Matteo; Sharma, Vivek; Simon, Sean; Tu, Yanjun; Vartak, Adish; Würthwein, Frank; Yagil, Avraham; Barge, Derek; Blume, Michael; Campagnari, Claudio; D'Alfonso, Mariarosaria; Danielson, Thomas; Garberson, Jeffrey; Incandela, Joe; Justus, Christopher; Kalavase, Puneeth; Koay, Sue Ann; Kovalskyi, Dmytro; Krutelyov, Vyacheslav; Lamb, James; Lowette, Steven; Pavlunin, Viktor; Rebassoo, Finn; Ribnik, Jacob; Richman, Jeffrey; Rossin, Roberto; Stuart, David; To, Wing; Vlimant, Jean-Roch; Witherell, Michael; Bornheim, Adolf; Bunn, Julian; Gataullin, Marat; Kcira, Dorian; Litvine, Vladimir; Ma, Yousi; Newman, Harvey B.; Rogan, Christopher; Shin, Kyoungha; Timciuc, Vladlen; Veverka, Jan; Wilkinson, Richard; Yang, Yong; Zhu, Ren-Yuan; Akgun, Bora; Carroll, Ryan; Ferguson, Thomas; Jang, Dong Wook; Jun, Soon Yung; Paulini, Manfred; Russ, James; Terentyev, Nikolay; Vogel, Helmut; Vorobiev, Igor; Cumalat, John Perry; Dinardo, Mauro Emanuele; Drell, Brian Robert; Ford, William T.; Heyburn, Bernadette; Luiggi Lopez, Eduardo; Nauenberg, Uriel; Smith, James; Stenson, Kevin; Ulmer, Keith; Wagner, Stephen Robert; Zang, Shi-Lei; Agostino, Lorenzo; Alexander, James; Blekman, Freya; Chatterjee, Avishek; Das, Souvik; Eggert, Nicholas; Fields, Laura Johanna; Gibbons, Lawrence Kent; Heltsley, Brian; Hopkins, Walter; Khukhunaishvili, Aleko; Kreis, Benjamin; Kuznetsov, Valentin; Nicolas Kaufman, Gala; Patterson, Juliet Ritchie; Puigh, Darren; Riley, Daniel; Ryd, Anders; Shi, Xin; Sun, Werner; Teo, Wee Don; Thom, Julia; Thompson, Joshua; Vaughan, Jennifer; Weng, Yao; Wittich, Peter; Biselli, Angela; Cirino, Guy; Winn, Dave; Abdullin, Salavat; Albrow, Michael; Anderson, Jacob; Apollinari, Giorgio; Atac, Muzaffer; Bakken, Jon Alan; Banerjee, Sunanda; Bauerdick, Lothar A.T.; Beretvas, Andrew; Berryhill, Jeffrey; Bhat, Pushpalatha C.; Bloch, Ingo; Borcherding, Frederick; Burkett, Kevin; Butler, Joel Nathan; Chetluru, Vasundhara; Cheung, Harry; Chlebana, Frank; Cihangir, Selcuk; Demarteau, Marcel; Eartly, David P.; Elvira, Victor Daniel; Fisk, Ian; Freeman, Jim; Gao, Yanyan; Gottschalk, Erik; Green, Dan; Gutsche, Oliver; Hahn, Alan; Hanlon, Jim; Harris, Robert M.; James, Eric; Jensen, Hans; Johnson, Marvin; Joshi, Umesh; Khatiwada, Rakshya; Kilminster, Benjamin; Klima, Boaz; Kousouris, Konstantinos; Kunori, Shuichi; Kwan, Simon; Limon, Peter; Lipton, Ron; Lykken, Joseph; Maeshima, Kaori; Marraffino, John Michael; Mason, David; McBride, Patricia; McCauley, Thomas; Miao, Ting; Mishra, Kalanand; Mrenna, Stephen; Musienko, Yuri; Newman-Holmes, Catherine; O'Dell, Vivian; Popescu, Sorina; Pordes, Ruth; Prokofyev, Oleg; Saoulidou, Niki; Sexton-Kennedy, Elizabeth; Sharma, Seema; Smith, Richard P.; Soha, Aron; Spalding, William J.; Spiegel, Leonard; Tan, Ping; Taylor, Lucas; Tkaczyk, Slawek; Uplegger, Lorenzo; Vaandering, Eric Wayne; Vidal, Richard; Whitmore, Juliana; Wu, Weimin; Yumiceva, Francisco; Yun, Jae Chul; Acosta, Darin; Avery, Paul; Bourilkov, Dimitri; Chen, Mingshui; Di Giovanni, Gian Piero; Dobur, Didar; Drozdetskiy, Alexey; Field, Richard D.; Fu, Yu; Furic, Ivan-Kresimir; Gartner, Joseph; Kim, Bockjoo; Klimenko, Sergey; Konigsberg, Jacobo; Korytov, Andrey; Kotov, Khristian; Kropivnitskaya, Anna; Kypreos, Theodore; Matchev, Konstantin; Mitselmakher, Guenakh; Pakhotin, Yuriy; Piedra Gomez, Jonatan; Prescott, Craig; Remington, Ronald; Schmitt, Michael; Scurlock, Bobby; Sellers, Paul; Wang, Dayong; Yelton, John; Zakaria, Mohammed; Ceron, Cristobal; Gaultney, Vanessa; Kramer, Laird; Lebolo, Luis Miguel; Linn, Stephan; Markowitz, Pete; Martinez, German; Mesa, Dalgis; Rodriguez, Jorge Luis; Adams, Todd; Askew, Andrew; Chen, Jie; Diamond, Brendan; Gleyzer, Sergei V; Haas, Jeff; Hagopian, Sharon; Hagopian, Vasken; Jenkins, Merrill; Johnson, Kurtis F.; Prosper, Harrison; Sekmen, Sezen; Veeraraghavan, Venkatesh; Baarmand, Marc M.; Guragain, Samir; Hohlmann, Marcus; Kalakhety, Himali; Mermerkaya, Hamit; Ralich, Robert; Vodopiyanov, Igor; Adams, Mark Raymond; Anghel, Ioana Maria; Apanasevich, Leonard; Bazterra, Victor Eduardo; Betts, Russell Richard; Callner, Jeremy; Cavanaugh, Richard; Dragoiu, Cosmin; Garcia-Solis, Edmundo Javier; Gerber, Cecilia Elena; Hofman, David Jonathan; Khalatian, Samvel; Lacroix, Florent; Shabalina, Elizaveta; Smoron, Agata; Strom, Derek; Varelas, Nikos; Akgun, Ugur; Albayrak, Elif Asli; Bilki, Burak; Cankocak, Kerem; Clarida, Warren; Duru, Firdevs; Lae, Chung Khim; McCliment, Edward; Merlo, Jean-Pierre; Mestvirishvili, Alexi; Moeller, Anthony; Nachtman, Jane; Newsom, Charles Ray; Norbeck, Edwin; Olson, Jonathan; Onel, Yasar; Ozok, Ferhat; Sen, Sercan; Wetzel, James; Yetkin, Taylan; Yi, Kai; Barnett, Bruce Arnold; Blumenfeld, Barry; Bonato, Alessio; Eskew, Christopher; Fehling, David; Giurgiu, Gavril; Gritsan, Andrei; Guo, Zijin; Hu, Guofan; Maksimovic, Petar; Rappoccio, Salvatore; Swartz, Morris; Tran, Nhan Viet; Whitbeck, Andrew; Baringer, Philip; Bean, Alice; Benelli, Gabriele; Grachov, Oleg; Murray, Michael; Radicci, Valeria; Sanders, Stephen; Wood, Jeffrey Scott; Zhukova, Victoria; Bandurin, Dmitry; Bolton, Tim; Chakaberia, Irakli; Ivanov, Andrew; Kaadze, Ketino; Maravin, Yurii; Shrestha, Shruti; Svintradze, Irakli; Wan, Zongru; Gronberg, Jeffrey; Lange, David; Wright, Douglas; Baden, Drew; Boutemeur, Madjid; Eno, Sarah Catherine; Ferencek, Dinko; Hadley, Nicholas John; Kellogg, Richard G.; Kirn, Malina; Mignerey, Alice; Rossato, Kenneth; Rumerio, Paolo; Santanastasio, Francesco; Skuja, Andris; Temple, Jeffrey; Tonjes, Marguerite; Tonwar, Suresh C.; Twedt, Elizabeth; Alver, Burak; Bauer, Gerry; Bendavid, Joshua; Busza, Wit; Butz, Erik; Cali, Ivan Amos; Chan, Matthew; D'Enterria, David; Everaerts, Pieter; Gomez Ceballos, Guillelmo; Goncharov, Maxim; Hahn, Kristan Allan; Harris, Philip; Kim, Yongsun; Klute, Markus; Lee, Yen-Jie; Li, Wei; Loizides, Constantinos; Luckey, Paul David; Ma, Teng; Nahn, Steve; Paus, Christoph; Roland, Christof; Roland, Gunther; Rudolph, Matthew; Stephans, George; Sumorok, Konstanty; Sung, Kevin; Wenger, Edward Allen; Wyslouch, Bolek; Xie, Si; Yilmaz, Yetkin; Yoon, Sungho; Zanetti, Marco; Cole, Perrie; Cooper, Seth; Cushman, Priscilla; Dahmes, Bryan; De Benedetti, Abraham; Dudero, Phillip Russell; Franzoni, Giovanni; Haupt, Jason; Klapoetke, Kevin; Kubota, Yuichi; Mans, Jeremy; Rekovic, Vladimir; Rusack, Roger; Sasseville, Michael; Singovsky, Alexander; Cremaldi, Lucien Marcus; Godang, Romulus; Kroeger, Rob; Perera, Lalith; Rahmat, Rahmat; Sanders, David A; Sonnek, Peter; Summers, Don; Bloom, Kenneth; Bose, Suvadeep; Butt, Jamila; Claes, Daniel R.; Dominguez, Aaron; Eads, Michael; Keller, Jason; Kelly, Tony; Kravchenko, Ilya; Lazo-Flores, Jose; Lundstedt, Carl; Malbouisson, Helena; Malik, Sudhir; Snow, Gregory R.; Baur, Ulrich; Iashvili, Ia; Kharchilava, Avto; Kumar, Ashish; Smith, Kenneth; Strang, Michael; Zennamo, Joseph; Alverson, George; Barberis, Emanuela; Baumgartel, Darin; Boeriu, Oana; Reucroft, Steve; Swain, John; Wood, Darien; Zhang, Jinzhong; Anastassov, Anton; Kubik, Andrew; Ofierzynski, Radoslaw Adrian; Pozdnyakov, Andrey; Schmitt, Michael; Stoynev, Stoyan; Velasco, Mayda; Won, Steven; Antonelli, Louis; Berry, Douglas; Hildreth, Michael; Jessop, Colin; Karmgard, Daniel John; Kolb, Jeff; Kolberg, Ted; Lannon, Kevin; Lynch, Sean; Marinelli, Nancy; Morse, David Michael; Ruchti, Randy; Slaunwhite, Jason; Valls, Nil; Warchol, Jadwiga; Wayne, Mitchell; Ziegler, Jill; Bylsma, Ben; Durkin, Lloyd Stanley; Gu, Jianhui; Killewald, Phillip; Ling, Ta-Yung; Williams, Grayson; Adam, Nadia; Berry, Edmund; Elmer, Peter; Gerbaudo, Davide; Halyo, Valerie; Hunt, Adam; Jones, John; Laird, Edward; Lopes Pegna, David; Marlow, Daniel; Medvedeva, Tatiana; Mooney, Michael; Olsen, James; Piroué, Pierre; Stickland, David; Tully, Christopher; Werner, Jeremy Scott; Zuranski, Andrzej; Acosta, Jhon Gabriel; Huang, Xing Tao; Lopez, Angel; Mendez, Hector; Oliveros, Sandra; Ramirez Vargas, Juan Eduardo; Zatzerklyaniy, Andriy; Alagoz, Enver; Barnes, Virgil E.; Bolla, Gino; Borrello, Laura; Bortoletto, Daniela; Everett, Adam; Garfinkel, Arthur F.; Gecse, Zoltan; Gutay, Laszlo; Jones, Matthew; Koybasi, Ozhan; Laasanen, Alvin T.; Leonardo, Nuno; Liu, Chang; Maroussov, Vassili; Merkel, Petra; Miller, David Harry; Neumeister, Norbert; Potamianos, Karolos; Shipsey, Ian; Silvers, David; Yoo, Hwi Dong; Zablocki, Jakub; Zheng, Yu; Jindal, Pratima; Parashar, Neeti; Cuplov, Vesna; Ecklund, Karl Matthew; Geurts, Frank J.M.; Liu, Jinghua H.; Morales, Jafet; Padley, Brian Paul; Redjimi, Radia; Roberts, Jay; Betchart, Burton; Bodek, Arie; Chung, Yeon Sei; de Barbaro, Pawel; Demina, Regina; Flacher, Henning; Garcia-Bellido, Aran; Gotra, Yury; Han, Jiyeon; Harel, Amnon; Miner, Daniel Carl; Orbaker, Douglas; Petrillo, Gianluca; Vishnevskiy, Dmitry; Zielinski, Marek; Bhatti, Anwar; Demortier, Luc; Goulianos, Konstantin; Hatakeyama, Kenichi; Lungu, Gheorghe; Mesropian, Christina; Yan, Ming; Atramentov, Oleksiy; Gershtein, Yuri; Gray, Richard; Halkiadakis, Eva; Hidas, Dean; Hits, Dmitry; Lath, Amitabh; Rose, Keith; Schnetzer, Steve; Somalwar, Sunil; Stone, Robert; Thomas, Scott; Cerizza, Giordano; Hollingsworth, Matthew; Spanier, Stefan; Yang, Zong-Chang; York, Andrew; Asaadi, Jonathan; Eusebi, Ricardo; Gilmore, Jason; Gurrola, Alfredo; Kamon, Teruki; Khotilovich, Vadim; Montalvo, Roy; Nguyen, Chi Nhan; Pivarski, James; Safonov, Alexei; Sengupta, Sinjini; Toback, David; Weinberger, Michael; Akchurin, Nural; Bardak, Cemile; Damgov, Jordan; Jeong, Chiyoung; Kovitanggoon, Kittikul; Lee, Sung Won; Mane, Poonam; Roh, Youn; Sill, Alan; Volobouev, Igor; Wigmans, Richard; Yazgan, Efe; Appelt, Eric; Brownson, Eric; Engh, Daniel; Florez, Carlos; Gabella, William; Johns, Willard; Kurt, Pelin; Maguire, Charles; Melo, Andrew; Sheldon, Paul; Velkovska, Julia; Arenton, Michael Wayne; Balazs, Michael; Buehler, Marc; Conetti, Sergio; Cox, Bradley; Hirosky, Robert; Ledovskoy, Alexander; Neu, Christopher; Yohay, Rachel; Gollapinni, Sowjanya; Gunthoti, Kranti; Harr, Robert; Karchin, Paul Edmund; Mattson, Mark; Milstène, Caroline; Sakharov, Alexandre; Anderson, Michael; Bachtis, Michail; Bellinger, James Nugent; Carlsmith, Duncan; Dasu, Sridhara; Dutta, Suchandra; Efron, Jonathan; Gray, Lindsey; Grogg, Kira Suzanne; Grothe, Monika; Herndon, Matthew; Klabbers, Pamela; Klukas, Jeffrey; Lanaro, Armando; Lazaridis, Christos; Leonard, Jessica; Lomidze, David; Loveless, Richard; Mohapatra, Ajit; Polese, Giovanni; Reeder, Don; Savin, Alexander; Smith, Wesley H.; Swanson, Joshua; Weinberg, Marc
2010-01-01
Bose-Einstein correlations have been measured using samples of proton-proton collisions at 0.9 and 2.36 TeV center-of-mass energies, recorded by the CMS experiment at the CERN Large Hadron Collider. The signal is observed in the form of an enhancement of pairs of same-sign charged particles with small relative four-momentum. The size of the correlated particle emission region is seen to increase significantly with the particle multiplicity of the event.
DEFF Research Database (Denmark)
Qiao, Jixin; Hou, Xiaolin; Steier, Peter
2015-01-01
An automated analytical method implemented in a flow injection (FI) system was developed for rapid determination of 236U in 10 L seawater samples. 238U was used as a chemical yield tracer for the whole procedure, in which extraction chromatography (UTEVA) was exploited to purify uranium, after...... experimental parameters affecting the analytical effectiveness were investigated and optimized in order to achieve high chemical yields and simple and rapid analysis as well as low procedure background. Besides, the operational conditions for the target preparation prior to the AMS measurement were optimized......, on the basis of studying the coprecipitation behavior of uranium with iron hydroxide. The analytical results indicate that the developed method is simple and robust, providing satisfactory chemical yields (80−100%) and high analysis speed (4 h/sample), which could be an appealing alternative to conventional...
Safety analysis report for packaging: neutron shipping cask, model 4T
International Nuclear Information System (INIS)
Peterson, R.T.
1977-01-01
This Safety Analysis Report for Packaging demonstrates that the neutron shipping cask can safely transport, in solid or powder form, all isotopes of uranium, plutonium, americium, curium, berkelium, californium, einsteinium, and fermium. The cask and its contents are described. It also evaluates transport conditions, structural parameters (e.g., load resistance, pressure and impact effects, lifting and tiedown devices), and shielding. Finally, it discusses compliance with Chapter 0529 of the Energy Research and Development Administration Manual, Safety Standards for the Packaging of Fissile and Other Radioactive Materials
Mironov, Vladislav P; Matusevich, Janna L; Kudrjashov, Vladimir P; Boulyga, Sergei F; Becker, J Sabine
2002-12-01
This work presents experimental results on the distribution of irradiated reactor uranium from fallout after the accident at Chernobyl Nuclear Power Plant (NPP) in comparison to natural uranium distribution in different soil types. Oxidation processes and vertical migration of irradiated uranium in soils typical of the 30 km relocation area around Chernobyl NPP were studied using 236U as the tracer for irradiated reactor uranium and inductively coupled plasma mass spectrometry as the analytical method for uranium isotope ratio measurements. Measurements of natural uranium yielded significant variations of its concentration in upper soil layers from 2 x 10(-7) g g(-1) to 3.4 x 10(-6) g g(-1). Concentrations of irradiated uranium in the upper 0-10 cm soil layers at the investigated sampling sites varied from 5 x 10(-12) g g(-1) to 2 x 10(-6) g g(-1) depending on the distance from Chernobyl NPP. In the majority of investigated soil profiles 78% to 97% of irradiated "Chernobyl" uranium is still contained in the upper 0-10 cm soil layers. The physical and chemical characteristics of the soil do not have any significant influence on processes of fuel particle destruction. Results obtained using carbonate leaching of 236U confirmed that more than 60% of irradiated "Chernobyl" uranium is still in a tetravalent form, ie. it is included in the fuel matrix (non-oxidized fuel UO2). The average value of the destruction rate of fuel particles determined for the Western radioactive trace (k = 0.030 +/- 0.005 yr(-1)) and for the Northern radioactive trace (k = 0.035 + 0.009 yr(-1)) coincide within experimental errors. Use of leaching of fission products in comparison to leaching of uranium for study of the destruction rate of fuel particles yielded poor coincidence due to the fact that use of fission products does not take into account differences in the chemical properties of fission products and fuel matrix (uranium).
International Nuclear Information System (INIS)
Desideri, D.; Meli, M.A.; Roselli, C.; Testa, C.; Boulyga, S.F.; Becker, J.S.
2002-01-01
It is well known that ammunition containing depleted uranium (DU) was used by NATO during the Balkan conflict. To evaluate the origin of DU (the enrichment of natural uranium or the reprocessing of spent nuclear fuel) it is necessary to directly detect the presence of activation products ( 236 U, 239 Pu, 240 Pu, 241 Am, and 237 Np) in the ammunition. In this work the analysis of actinides by α-spectrometry was compared with that by inductively coupled plasma mass spectrometry (ICP-MS) after selective separation of ultratraces of transuranium elements from the uranium matrix. 242 Pu and 243 Am were added to calculate the chemical yield. Plutonium was separated from uranium by extraction chromatography, using tri-n-octylamine (TNOA), with a decontamination factor higher than 10 6 ; after elution plutonium was determined by ICP-MS ( 239 Pu and 240 Pu) and α-spectrometry ( 239+240 Pu) after electroplating. The concentration of Pu in two DU penetrator samples was 7 x 10 -12 g g -1 and 2 x 10 -11 g g -1 . The 240 Pu/ 239 Pu isotope ratio in one penetrator sample (0.12±0.04) was significantly lower than the 240 Pu/ 239 Pu ratios found in two soil samples from Kosovo (0.35±0.10 and 0.27±0.07). 241 Am was separated by extraction chromatography, using di(2-ethylhexyl)phosphoric acid (HDEHP), with a decontamination factor as high as 10 7 . The concentration of 241 Am in the penetrator samples was 2.7 x 10 -14 g g -1 and -15 g g -1 . In addition 237 Np was detected at ultratrace levels. In general, ICP-MS and α-spectrometry results were in good agreement.The presence of anthropogenic radionuclides ( 236 U, 239 Pu, 240 Pu, 241 Am, and 237 Np) in the penetrators indicates that at least part of the uranium originated from the reprocessing of nuclear fuel. Because the concentrations of radionuclides are very low, their radiotoxicological effect is negligible. (orig.)
Desideri, D; Meli, M A; Roselli, C; Testa, C; Boulyga, S F; Becker, J S
2002-11-01
It is well known that ammunition containing depleted uranium (DU) was used by NATO during the Balkan conflict. To evaluate the origin of DU (the enrichment of natural uranium or the reprocessing of spent nuclear fuel) it is necessary to directly detect the presence of activation products ((236)U, (239)Pu, (240)Pu, (241)Am, and (237)Np) in the ammunition. In this work the analysis of actinides by alpha-spectrometry was compared with that by inductively coupled plasma mass spectrometry (ICP-MS) after selective separation of ultratraces of transuranium elements from the uranium matrix. (242)Pu and (243)Am were added to calculate the chemical yield. Plutonium was separated from uranium by extraction chromatography, using tri- n-octylamine (TNOA), with a decontamination factor higher than 10(6); after elution plutonium was determined by ICP-MS ((239)Pu and (240)Pu) and alpha-spectrometry ((239+240)Pu) after electroplating. The concentration of Pu in two DU penetrator samples was 7 x 10(-12) g g(-1) and 2 x 10(-11) g g(-1). The (240)Pu/(239)Pu isotope ratio in one penetrator sample (0.12+/-0.04) was significantly lower than the (240)Pu/(239)Pu ratios found in two soil samples from Kosovo (0.35+/-0.10 and 0.27+/-0.07). (241)Am was separated by extraction chromatography, using di(2-ethylhexyl)phosphoric acid (HDEHP), with a decontamination factor as high as 10(7). The concentration of (241)Am in the penetrator samples was 2.7 x 10(-14) g g(-1) and <9.4 x 10(-15) g g(-1). In addition (237)Np was detected at ultratrace levels. In general, ICP-MS and alpha-spectrometry results were in good agreement. The presence of anthropogenic radionuclides ((236)U, (239)Pu,(240)Pu, (241)Am, and (237)Np) in the penetrators indicates that at least part of the uranium originated from the reprocessing of nuclear fuel. Because the concentrations of radionuclides are very low, their radiotoxicological effect is negligible.
Chelation and stabilization of berkelium in oxidation state +IV
Czech Academy of Sciences Publication Activity Database
Deblonde, G. J.-P.; Sturzbecher-Hoehne, M.; Rupert, P. B.; An, D. D.; Illy, M.-C.; Ralston, C. Y.; Brabec, Jiří; de Jong, W. A.; Strong, R. K.; Abergel, R. J.
2017-01-01
Roč. 9, č. 9 (2017), s. 843-849 ISSN 1755-4330 Institutional support: RVO:61388955 Keywords : bioorganic chemistry * chemical bonding * mass spectrometry Subject RIV: CF - Physical ; Theoretical Chemistry OBOR OECD: Physical chemistry Impact factor: 25.870, year: 2016
Vollmer, Martin K.; Miller, Benjamin R.; Rigby, Matthew; Reimann, Stefan; Mühle, Jens; Krummel, Paul B.; O'Doherty, Simon; Kim, Jooil; Rhee, Tae Siek; Weiss, Ray F.; Fraser, Paul J.; Simmonds, Peter G.; Salameh, Peter K.; Harth, Christina M.; Wang, Ray H. J.; Steele, L. Paul; Young, Dickon; Lunder, Chris R.; Hermansen, Ove; Ivy, Diane; Arnold, Tim; Schmidbauer, Norbert; Kim, Kyung-Ryul; Greally, Brian R.; Hill, Matthias; Leist, Michael; Wenger, Angelina; Prinn, Ronald G.
2011-04-01
We report on ground-based atmospheric measurements and emission estimates of the four anthropogenic hydrofluorocarbons (HFCs) HFC-365mfc (CH3CF2CH2CF3, 1,1,1,3,3-pentafluorobutane), HFC-245fa (CHF2CH2CF3, 1,1,1,3,3-pentafluoropropane), HFC-227ea (CF3CHFCF3, 1,1,1,2,3,3,3-heptafluoropropane), and HFC-236fa (CF3CH2CF3, 1,1,1,3,3,3-hexafluoropropane). In situ measurements are from the global monitoring sites of the Advanced Global Atmospheric Gases Experiment (AGAGE), the System for Observations of Halogenated Greenhouse Gases in Europe (SOGE), and Gosan (South Korea). We include the first halocarbon flask sample measurements from the Antarctic research stations King Sejong and Troll. We also present measurements of archived air samples from both hemispheres back to the 1970s. We use a two-dimensional atmospheric transport model to simulate global atmospheric abundances and to estimate global emissions. HFC-365mfc and HFC-245fa first appeared in the atmosphere only ˜1 decade ago; they have grown rapidly to globally averaged dry air mole fractions of 0.53 ppt (in parts per trillion, 10-12) and 1.1 ppt, respectively, by the end of 2010. In contrast, HFC-227ea first appeared in the global atmosphere in the 1980s and has since grown to ˜0.58 ppt. We report the first measurements of HFC-236fa in the atmosphere. This long-lived compound was present in the atmosphere at only 0.074 ppt in 2010. All four substances exhibit yearly growth rates of >8% yr-1 at the end of 2010. We find rapidly increasing emissions for the foam-blowing compounds HFC-365mfc and HFC-245fa starting in ˜2002. After peaking in 2006 (HFC-365mfc: 3.2 kt yr-1, HFC-245fa: 6.5 kt yr-1), emissions began to decline. Our results for these two compounds suggest that recent estimates from long-term projections (to the late 21st century) have strongly overestimated emissions for the early years of the projections (˜2005-2010). Global HFC-227ea and HFC-236fa emissions have grown to average values of 2.4 kt yr-1
International Nuclear Information System (INIS)
Sowinski, M.
1975-05-01
The energy distributions and relative intensities of protons, deuterons, tritons and alpha-particles emitted along the fission axis during thermal neutron fission of 236 U are measured simultaneously with the energies of the two fission fragments. The mass distributions of the fragments, the total kinetic energy (TKE), the dependence of the mean TKE on the fragment mass, as well as the mean kinetic energy dependence of polar particles on the fragment mass and energy are deduced from these data. Although some experimental results agree remarkably well with the hypothesis that polar particles are evaporated in-flight from fission fragments, the general conclusion is that these particles are emitted according to some other mechanism
International Nuclear Information System (INIS)
Martinot, L.; Fuger, J.
1985-01-01
The oxidation behavior of the actinides is explained on the basis of their electronic structure. The actinide elements, actinium, thorium, protactinium, uranium, neptunium, plutonium, americium, curium, berkelium, californium, einsteinium, fermium, mendelevium, nobelium, and laurencium are included. For all except the last three elements, the points of discussion are oxidation states, Gibbs energies and potentials, and potential diagram for the element in acid solution; and thermodynamic properties of these same elements are tabulated. References are cited following discussion of each element with a total of 97 references being cited. 13 tables
Tank 241-TX-118, core 236 analytical results for the final report
International Nuclear Information System (INIS)
ESCH, R.A.
1998-01-01
This document is the analytical laboratory report for tank 241-TX-118 push mode core segments collected between April 1, 1998 and April 13, 1998. The segments were subsampled and analyzed in accordance with the Tank 241-TX-118 Push Mode Core sampling and Analysis Plan (TSAP) (Benar, 1997), the Safety Screening Data Quality Objective (DQO) (Dukelow, et al., 1995), the Data Quality Objective to Support Resolution of the Organic Complexant Safety Issue (Organic DQO) (Turner, et al, 1995) and the Historical Model Evaluation Data Requirements (Historical DQO) (Sipson, et al., 1995). The analytical results are included in the data summary table (Table 1). None of the samples submitted for Differential Scanning Calorimetry (DSC) and Total Organic Carbon (TOC) exceeded notification limits as stated in the TSAP (Benar, 1997). One sample exceeded the Total Alpha Activity (AT) analysis notification limit of 38.4microCi/g (based on a bulk density of 1.6), core 236 segment 1 lower half solids (S98T001524). Appropriate notifications were made. Plutonium 239/240 analysis was requested as a secondary analysis. The statistical results of the 95% confidence interval on the mean calculations are provided by the Tank Waste Remediation Systems Technical Basis Group in accordance with the Memorandum of Understanding (Schreiber, 1997) and are not considered in this report
Charged particle multiplicities in pp interactions at sqrt(s) = 0.9, 2.36, and 7 TeV
Energy Technology Data Exchange (ETDEWEB)
Khachatryan, V. [Yerevan Physics Institute (Aremenia); et al.,
2011-01-01
Measurements of primary charged hadron multiplicity distributions are presented for non-single-diffractive events in proton-proton collisions at centre-of-mass energies of sqrt(s) = 0.9, 2.36, and 7 TeV, in five pseudorapidity ranges from |eta|<0.5 to |eta|<2.4. The data were collected with the minimum-bias trigger of the CMS experiment during the LHC commissioning runs in 2009 and the 7 TeV run in 2010. The multiplicity distribution at sqrt(s) = 0.9 TeV is in agreement with previous measurements. At higher energies the increase of the mean multiplicity with sqrt(s) is underestimated by most event generators. The average transverse momentum as a function of the multiplicity is also presented. The measurement of higher-order moments of the multiplicity distribution confirms the violation of Koba-Nielsen-Olesen scaling that has been observed at lower energies.
Charged particle multiplicities in pp interactions at $\\sqrt{s}$ = 0.9, 2.36, and 7 TeV
Khachatryan, Vardan; Tumasyan, Armen; Adam, Wolfgang; Bergauer, Thomas; Dragicevic, Marko; Erö, Janos; Fabjan, Christian; Friedl, Markus; Fruehwirth, Rudolf; Ghete, Vasile Mihai; Hammer, Josef; Haensel, Stephan; Hartl, Christian; Hoch, Michael; Hörmann, Natascha; Hrubec, Josef; Jeitler, Manfred; Kasieczka, Gregor; Kiesenhofer, Wolfgang; Krammer, Manfred; Liko, Dietrich; Mikulec, Ivan; Pernicka, Manfred; Rohringer, Herbert; Schöfbeck, Robert; Strauss, Josef; Taurok, Anton; Teischinger, Florian; Waltenberger, Wolfgang; Walzel, Gerhard; Widl, Edmund; Wulz, Claudia-Elisabeth; Mossolov, Vladimir; Shumeiko, Nikolai; Suarez Gonzalez, Juan; Benucci, Leonardo; Ceard, Ludivine; Cerny, Karel; De Wolf, Eddi A.; Janssen, Xavier; Maes, Thomas; Mucibello, Luca; Ochesanu, Silvia; Roland, Benoit; Rougny, Romain; Selvaggi, Michele; Van Haevermaet, Hans; Van Mechelen, Pierre; Van Remortel, Nick; Adler, Volker; Beauceron, Stephanie; Blekman, Freya; Blyweert, Stijn; D'Hondt, Jorgen; Devroede, Olivier; Kalogeropoulos, Alexis; Maes, Joris; Maes, Michael; Tavernier, Stefaan; Van Doninck, Walter; Van Mulders, Petra; Van Onsem, Gerrit Patrick; Villella, Ilaria; Charaf, Otman; Clerbaux, Barbara; De Lentdecker, Gilles; Dero, Vincent; Gay, Arnaud; Hammad, Gregory Habib; Hreus, Tomas; Marage, Pierre Edouard; Thomas, Laurent; Vander Velde, Catherine; Vanlaer, Pascal; Wickens, John; Costantini, Silvia; Grunewald, Martin; Klein, Benjamin; Marinov, Andrey; Ryckbosch, Dirk; Thyssen, Filip; Tytgat, Michael; Vanelderen, Lukas; Verwilligen, Piet; Walsh, Sinead; Zaganidis, Nicolas; Basegmez, Suzan; Bruno, Giacomo; Caudron, Julien; De Favereau De Jeneret, Jerome; Delaere, Christophe; Demin, Pavel; Favart, Denis; Giammanco, Andrea; Grégoire, Ghislain; Hollar, Jonathan; Lemaitre, Vincent; Liao, Junhui; Militaru, Otilia; Ovyn, Severine; Pagano, Davide; Pin, Arnaud; Piotrzkowski, Krzysztof; Quertenmont, Loic; Schul, Nicolas; Beliy, Nikita; Caebergs, Thierry; Daubie, Evelyne; Alves, Gilvan; De Jesus Damiao, Dilson; Pol, Maria Elena; Henrique Gomes E Souza, Moacyr; Carvalho, Wagner; Da Costa, Eliza Melo; De Oliveira Martins, Carley; Fonseca De Souza, Sandro; Mundim, Luiz; Nogima, Helio; Oguri, Vitor; Prado Da Silva, Wanda Lucia; Santoro, Alberto; Silva Do Amaral, Sheila Mara; Sznajder, Andre; Torres Da Silva De Araujo, Felipe; De Almeida Dias, Flavia; Ferreira Dias, Marco Andre; Tomei, Thiago; De Moraes Gregores, Eduardo; Da Cunha Marinho, Franciole; Novaes, Sergio F.; Padula, Sandra; Darmenov, Nikolay; Dimitrov, Lubomir; Genchev, Vladimir; Iaydjiev, Plamen; Piperov, Stefan; Rodozov, Mircho; Stoykova, Stefka; Sultanov, Georgi; Tcholakov, Vanio; Trayanov, Rumen; Vankov, Ivan; Dyulendarova, Milena; Hadjiiska, Roumyana; Kozhuharov, Venelin; Litov, Leander; Marinova, Evelina; Mateev, Matey; Pavlov, Borislav; Petkov, Peicho; Bian, Jian-Guo; Chen, Guo-Ming; Chen, He-Sheng; Jiang, Chun-Hua; Liang, Dong; Liang, Song; Wang, Jian; Wang, Jian; Wang, Xianyou; Wang, Zheng; Yang, Min; Zang, Jingjing; Zhang, Zhen; Ban, Yong; Guo, Shuang; Li, Wenbo; Mao, Yajun; Qian, Si-Jin; Teng, Haiyun; Zhu, Bo; Cabrera, Andrés; Gomez Moreno, Bernardo; Ocampo Rios, Alberto Andres; Osorio Oliveros, Andres Felipe; Sanabria, Juan Carlos; Godinovic, Nikola; Lelas, Damir; Lelas, Karlo; Plestina, Roko; Polic, Dunja; Puljak, Ivica; Antunovic, Zeljko; Dzelalija, Mile; Brigljevic, Vuko; Duric, Senka; Kadija, Kreso; Morovic, Srecko; Attikis, Alexandros; Fereos, Reginos; Galanti, Mario; Mousa, Jehad; Nicolaou, Charalambos; Ptochos, Fotios; Razis, Panos A.; Rykaczewski, Hans; Assran, Yasser; Mahmoud, Mohammed; Hektor, Andi; Kadastik, Mario; Kannike, Kristjan; Müntel, Mait; Raidal, Martti; Rebane, Liis; Azzolini, Virginia; Eerola, Paula; Czellar, Sandor; Härkönen, Jaakko; Heikkinen, Mika Aatos; Karimäki, Veikko; Kinnunen, Ritva; Klem, Jukka; Kortelainen, Matti J.; Lampén, Tapio; Lassila-Perini, Kati; Lehti, Sami; Lindén, Tomas; Luukka, Panja-Riina; Mäenpää, Teppo; Tuominen, Eija; Tuominiemi, Jorma; Tuovinen, Esa; Ungaro, Donatella; Wendland, Lauri; Banzuzi, Kukka; Korpela, Arja; Tuuva, Tuure; Sillou, Daniel; Besancon, Marc; Dejardin, Marc; Denegri, Daniel; Fabbro, Bernard; Faure, Jean-Louis; Ferri, Federico; Ganjour, Serguei; Gentit, François-Xavier; Givernaud, Alain; Gras, Philippe; Hamel de Monchenault, Gautier; Jarry, Patrick; Locci, Elizabeth; Malcles, Julie; Marionneau, Matthieu; Millischer, Laurent; Rander, John; Rosowsky, André; Shreyber, Irina; Titov, Maksym; Verrecchia, Patrice; Baffioni, Stephanie; Beaudette, Florian; Bianchini, Lorenzo; Bluj, Michal; Broutin, Clementine; Busson, Philippe; Charlot, Claude; Dobrzynski, Ludwik; Granier de Cassagnac, Raphael; Haguenauer, Maurice; Miné, Philippe; Mironov, Camelia; Ochando, Christophe; Paganini, Pascal; Porteboeuf, Sarah; Sabes, David; Salerno, Roberto; Sirois, Yves; Thiebaux, Christophe; Wyslouch, Bolek; Zabi, Alexandre; Agram, Jean-Laurent; Andrea, Jeremy; Besson, Auguste; Bloch, Daniel; Bodin, David; Brom, Jean-Marie; Cardaci, Marco; Chabert, Eric Christian; Collard, Caroline; Conte, Eric; Drouhin, Frédéric; Ferro, Cristina; Fontaine, Jean-Charles; Gelé, Denis; Goerlach, Ulrich; Greder, Sebastien; Juillot, Pierre; Karim, Mehdi; Le Bihan, Anne-Catherine; Mikami, Yoshinari; Van Hove, Pierre; Fassi, Farida; Mercier, Damien; Baty, Clement; Beaupere, Nicolas; Bedjidian, Marc; Bondu, Olivier; Boudoul, Gaelle; Boumediene, Djamel; Brun, Hugues; Chanon, Nicolas; Chierici, Roberto; Contardo, Didier; Depasse, Pierre; El Mamouni, Houmani; Falkiewicz, Anna; Fay, Jean; Gascon, Susan; Ille, Bernard; Kurca, Tibor; Le Grand, Thomas; Lethuillier, Morgan; Mirabito, Laurent; Perries, Stephane; Sordini, Viola; Tosi, Silvano; Tschudi, Yohann; Verdier, Patrice; Xiao, Hong; Roinishvili, Vladimir; Anagnostou, Georgios; Edelhoff, Matthias; Feld, Lutz; Heracleous, Natalie; Hindrichs, Otto; Jussen, Ruediger; Klein, Katja; Merz, Jennifer; Mohr, Niklas; Ostapchuk, Andrey; Perieanu, Adrian; Raupach, Frank; Sammet, Jan; Schael, Stefan; Sprenger, Daniel; Weber, Hendrik; Weber, Martin; Wittmer, Bruno; Ata, Metin; Bender, Walter; Erdmann, Martin; Frangenheim, Jens; Hebbeker, Thomas; Hinzmann, Andreas; Hoepfner, Kerstin; Hof, Carsten; Klimkovich, Tatsiana; Klingebiel, Dennis; Kreuzer, Peter; Lanske, Dankfried; Magass, Carsten; Masetti, Gianni; Merschmeyer, Markus; Meyer, Arnd; Papacz, Paul; Pieta, Holger; Reithler, Hans; Schmitz, Stefan Antonius; Sonnenschein, Lars; Steggemann, Jan; Teyssier, Daniel; Bontenackels, Michael; Davids, Martina; Duda, Markus; Flügge, Günter; Geenen, Heiko; Giffels, Manuel; Haj Ahmad, Wael; Heydhausen, Dirk; Kress, Thomas; Kuessel, Yvonne; Linn, Alexander; Nowack, Andreas; Perchalla, Lars; Pooth, Oliver; Rennefeld, Jörg; Sauerland, Philip; Stahl, Achim; Thomas, Maarten; Tornier, Daiske; Zoeller, Marc Henning; Aldaya Martin, Maria; Behrenhoff, Wolf; Behrens, Ulf; Bergholz, Matthias; Borras, Kerstin; Cakir, Altan; Campbell, Alan; Castro, Elena; Dammann, Dirk; Eckerlin, Guenter; Eckstein, Doris; Flossdorf, Alexander; Flucke, Gero; Geiser, Achim; Glushkov, Ivan; Hauk, Johannes; Jung, Hannes; Kasemann, Matthias; Katkov, Igor; Katsas, Panagiotis; Kleinwort, Claus; Kluge, Hannelies; Knutsson, Albert; Krücker, Dirk; Kuznetsova, Ekaterina; Lange, Wolfgang; Lohmann, Wolfgang; Mankel, Rainer; Marienfeld, Markus; Melzer-Pellmann, Isabell-Alissandra; Meyer, Andreas Bernhard; Mnich, Joachim; Mussgiller, Andreas; Olzem, Jan; Parenti, Andrea; Raspereza, Alexei; Raval, Amita; Schmidt, Ringo; Schoerner-Sadenius, Thomas; Sen, Niladri; Stein, Matthias; Tomaszewska, Justyna; Volyanskyy, Dmytro; Walsh, Roberval; Wissing, Christoph; Autermann, Christian; Bobrovskyi, Sergei; Draeger, Jula; Enderle, Holger; Gebbert, Ulla; Kaschube, Kolja; Kaussen, Gordon; Klanner, Robert; Mura, Benedikt; Naumann-Emme, Sebastian; Nowak, Friederike; Pietsch, Niklas; Sander, Christian; Schettler, Hannes; Schleper, Peter; Schröder, Matthias; Schum, Torben; Schwandt, Joern; Srivastava, Ajay Kumar; Stadie, Hartmut; Steinbrück, Georg; Thomsen, Jan; Wolf, Roger; Bauer, Julia; Buege, Volker; Chwalek, Thorsten; De Boer, Wim; Dierlamm, Alexander; Dirkes, Guido; Feindt, Michael; Gruschke, Jasmin; Hackstein, Christoph; Hartmann, Frank; Heindl, Stefan Michael; Heinrich, Michael; Held, Hauke; Hoffmann, Karl-Heinz; Honc, Simon; Kuhr, Thomas; Martschei, Daniel; Mueller, Steffen; Müller, Thomas; Niegel, Martin; Oberst, Oliver; Oehler, Andreas; Ott, Jochen; Peiffer, Thomas; Piparo, Danilo; Quast, Gunter; Rabbertz, Klaus; Ratnikov, Fedor; Renz, Manuel; Saout, Christophe; Scheurer, Armin; Schieferdecker, Philipp; Schilling, Frank-Peter; Schott, Gregory; Simonis, Hans-Jürgen; Stober, Fred-Markus Helmut; Troendle, Daniel; Wagner-Kuhr, Jeannine; Zeise, Manuel; Zhukov, Valery; Ziebarth, Eva Barbara; Daskalakis, Georgios; Geralis, Theodoros; Kesisoglou, Stilianos; Kyriakis, Aristotelis; Loukas, Demetrios; Manolakos, Ioannis; Markou, Athanasios; Markou, Christos; Mavrommatis, Charalampos; Petrakou, Eleni; Gouskos, Loukas; Mertzimekis, Theodoros; Panagiotou, Apostolos; Evangelou, Ioannis; Foudas, Costas; Kokkas, Panagiotis; Manthos, Nikolaos; Papadopoulos, Ioannis; Patras, Vaios; Triantis, Frixos A.; Aranyi, Attila; Bencze, Gyorgy; Boldizsar, Laszlo; Debreczeni, Gergely; Hajdu, Csaba; Horvath, Dezso; Kapusi, Anita; Krajczar, Krisztian; Laszlo, Andras; Sikler, Ferenc; Vesztergombi, Gyorgy; Beni, Noemi; Molnar, Jozsef; Palinkas, Jozsef; Szillasi, Zoltan; Veszpremi, Viktor; Raics, Peter; Trocsanyi, Zoltan Laszlo; Ujvari, Balazs; Bansal, Sunil; Beri, Suman Bala; Bhatnagar, Vipin; Dhingra, Nitish; Jindal, Monika; Kaur, Manjit; Kohli, Jatinder Mohan; Mehta, Manuk Zubin; Nishu, Nishu; Saini, Lovedeep Kaur; Sharma, Archana; Singh, Anil; Singh, Jas Bir; Singh, Supreet Pal; Ahuja, Sudha; Bhattacharya, Satyaki; Choudhary, Brajesh C.; Gupta, Pooja; Jain, Sandhya; Jain, Shilpi; Kumar, Ashok; Shivpuri, Ram Krishen; Choudhury, Rajani Kant; Dutta, Dipanwita; Kailas, Swaminathan; Kataria, Sushil Kumar; Mohanty, Ajit Kumar; Pant, Lalit Mohan; Shukla, Prashant; Suggisetti, Praveenkumar; Aziz, Tariq; Guchait, Monoranjan; Gurtu, Atul; Maity, Manas; Majumder, Devdatta; Majumder, Gobinda; Mazumdar, Kajari; Mohanty, Gagan Bihari; Saha, Anirban; Sudhakar, Katta; Wickramage, Nadeesha; Banerjee, Sudeshna; Dugad, Shashikant; Mondal, Naba Kumar; Arfaei, Hessamaddin; Bakhshiansohi, Hamed; Etesami, Seyed Mohsen; Fahim, Ali; Hashemi, Majid; Jafari, Abideh; Khakzad, Mohsen; Mohammadi, Abdollah; Mohammadi Najafabadi, Mojtaba; Paktinat Mehdiabadi, Saeid; Safarzadeh, Batool; Zeinali, Maryam; Abbrescia, Marcello; Barbone, Lucia; Calabria, Cesare; Colaleo, Anna; Creanza, Donato; De Filippis, Nicola; De Palma, Mauro; Dimitrov, Anton; Fedele, Francesca; Fiore, Luigi; Iaselli, Giuseppe; Lusito, Letizia; Maggi, Giorgio; Maggi, Marcello; Manna, Norman; Marangelli, Bartolomeo; My, Salvatore; Nuzzo, Salvatore; Pacifico, Nicola; Pierro, Giuseppe Antonio; Pompili, Alexis; Pugliese, Gabriella; Romano, Francesco; Roselli, Giuseppe; Selvaggi, Giovanna; Silvestris, Lucia; Trentadue, Raffaello; Tupputi, Salvatore; Zito, Giuseppe; Abbiendi, Giovanni; Benvenuti, Alberto; Bonacorsi, Daniele; Braibant-Giacomelli, Sylvie; Capiluppi, Paolo; Castro, Andrea; Cavallo, Francesca Romana; Cuffiani, Marco; Dallavalle, Gaetano-Marco; Fabbri, Fabrizio; Fanfani, Alessandra; Fasanella, Daniele; Giacomelli, Paolo; Giunta, Marina; Grandi, Claudio; Marcellini, Stefano; Meneghelli, Marco; Montanari, Alessandro; Navarria, Francesco; Odorici, Fabrizio; Perrotta, Andrea; Rossi, Antonio; Rovelli, Tiziano; Siroli, Gianni; Travaglini, Riccardo; Albergo, Sebastiano; Cappello, Gigi; Chiorboli, Massimiliano; Costa, Salvatore; Tricomi, Alessia; Tuve, Cristina; Barbagli, Giuseppe; Ciulli, Vitaliano; Civinini, Carlo; D'Alessandro, Raffaello; Focardi, Ettore; Frosali, Simone; Gallo, Elisabetta; Genta, Chiara; Lenzi, Piergiulio; Meschini, Marco; Paoletti, Simone; Sguazzoni, Giacomo; Tropiano, Antonio; Benussi, Luigi; Bianco, Stefano; Colafranceschi, Stefano; Fabbri, Franco; Piccolo, Davide; Fabbricatore, Pasquale; Musenich, Riccardo; Benaglia, Andrea; Cerati, Giuseppe Benedetto; De Guio, Federico; Di Matteo, Leonardo; Ghezzi, Alessio; Malberti, Martina; Malvezzi, Sandra; Martelli, Arabella; Massironi, Andrea; Menasce, Dario; Moroni, Luigi; Paganoni, Marco; Pedrini, Daniele; Ragazzi, Stefano; Redaelli, Nicola; Sala, Silvano; Tabarelli de Fatis, Tommaso; Tancini, Valentina; Buontempo, Salvatore; Carrillo Montoya, Camilo Andres; Cimmino, Anna; De Cosa, Annapaola; De Gruttola, Michele; Fabozzi, Francesco; Iorio, Alberto Orso Maria; Lista, Luca; Merola, Mario; Noli, Pasquale; Paolucci, Pierluigi; Azzi, Patrizia; Bacchetta, Nicola; Bellan, Paolo; Biasotto, Massimo; Bisello, Dario; Branca, Antonio; Carlin, Roberto; Checchia, Paolo; Conti, Enrico; De Mattia, Marco; Dorigo, Tommaso; Fanzago, Federica; Gasparini, Fabrizio; Giubilato, Piero; Gresele, Ambra; Lacaprara, Stefano; Lazzizzera, Ignazio; Margoni, Martino; Meneguzzo, Anna Teresa; Nespolo, Massimo; Perrozzi, Luca; Pozzobon, Nicola; Ronchese, Paolo; Simonetto, Franco; Torassa, Ezio; Tosi, Mia; Vanini, Sara; Ventura, Sandro; Zotto, Pierluigi; Zumerle, Gianni; Baesso, Paolo; Berzano, Umberto; Riccardi, Cristina; Torre, Paola; Vitulo, Paolo; Viviani, Claudio; Biasini, Maurizio; Bilei, Gian Mario; Caponeri, Benedetta; Fanò, Livio; Lariccia, Paolo; Lucaroni, Andrea; Mantovani, Giancarlo; Menichelli, Mauro; Nappi, Aniello; Santocchia, Attilio; Servoli, Leonello; Taroni, Silvia; Valdata, Marisa; Volpe, Roberta; Azzurri, Paolo; Bagliesi, Giuseppe; Bernardini, Jacopo; Boccali, Tommaso; Broccolo, Giuseppe; Castaldi, Rino; D'Agnolo, Raffaele Tito; Dell'Orso, Roberto; Fiori, Francesco; Foà, Lorenzo; Giassi, Alessandro; Kraan, Aafke; Ligabue, Franco; Lomtadze, Teimuraz; Martini, Luca; Messineo, Alberto; Palla, Fabrizio; Palmonari, Francesco; Sarkar, Subir; Segneri, Gabriele; Serban, Alin Titus; Spagnolo, Paolo; Tenchini, Roberto; Tonelli, Guido; Venturi, Andrea; Verdini, Piero Giorgio; Barone, Luciano; Cavallari, Francesca; Del Re, Daniele; Di Marco, Emanuele; Diemoz, Marcella; Franci, Daniele; Grassi, Marco; Longo, Egidio; Organtini, Giovanni; Palma, Alessandro; Pandolfi, Francesco; Paramatti, Riccardo; Rahatlou, Shahram; Amapane, Nicola; Arcidiacono, Roberta; Argiro, Stefano; Arneodo, Michele; Biino, Cristina; Botta, Cristina; Cartiglia, Nicolo; Castello, Roberto; Costa, Marco; Demaria, Natale; Graziano, Alberto; Mariotti, Chiara; Marone, Matteo; Maselli, Silvia; Migliore, Ernesto; Mila, Giorgia; Monaco, Vincenzo; Musich, Marco; Obertino, Maria Margherita; Pastrone, Nadia; Pelliccioni, Mario; Romero, Alessandra; Ruspa, Marta; Sacchi, Roberto; Sola, Valentina; Solano, Ada; Staiano, Amedeo; Trocino, Daniele; Vilela Pereira, Antonio; Ambroglini, Filippo; Belforte, Stefano; Cossutti, Fabio; Della Ricca, Giuseppe; Gobbo, Benigno; Montanino, Damiana; Penzo, Aldo; Heo, Seong Gu; Chang, Sunghyun; Chung, Jin Hyuk; Kim, Dong Hee; Kim, Gui Nyun; Kim, Ji Eun; Kong, Dae Jung; Park, Hyangkyu; Son, Dohhee; Son, Dong-Chul; Kim, Jaeho; Kim, Jae Yool; Song, Sanghyeon; Choi, Suyong; Hong, Byung-Sik; Jo, Mihee; Kim, Hyunchul; Kim, Ji Hyun; Kim, Tae Jeong; Lee, Kyong Sei; Moon, Dong Ho; Park, Sung Keun; Rhee, Han-Bum; Seo, Eunsung; Shin, Seungsu; Sim, Kwang Souk; Choi, Minkyoo; Kang, Seokon; Kim, Hyunyong; Park, Chawon; Park, Inkyu; Park, Sangnam; Ryu, Geonmo; Choi, Young-Il; Choi, Young Kyu; Goh, Junghwan; Lee, Jongseok; Lee, Sungeun; Seo, Hyunkwan; Yu, Intae; Bilinskas, Mykolas Jurgis; Grigelionis, Ignas; Janulis, Mindaugas; Martisiute, Dalia; Petrov, Pavel; Sabonis, Tomas; Castilla Valdez, Heriberto; De La Cruz Burelo, Eduard; Lopez-Fernandez, Ricardo; Sánchez Hernández, Alberto; Villasenor-Cendejas, Luis Manuel; Carrillo Moreno, Salvador; Vazquez Valencia, Fabiola; Salazar Ibarguen, Humberto Antonio; Casimiro Linares, Edgar; Morelos Pineda, Antonio; Reyes-Santos, Marco A.; Allfrey, Philip; Krofcheck, David; Tam, Jason; Butler, Philip H.; Doesburg, Robert; Silverwood, Hamish; Ahmad, Muhammad; Ahmed, Ijaz; Asghar, Muhammad Irfan; Hoorani, Hafeez R.; Khan, Wajid Ali; Khurshid, Taimoor; Qazi, Shamona; Cwiok, Mikolaj; Dominik, Wojciech; Doroba, Krzysztof; Kalinowski, Artur; Konecki, Marcin; Krolikowski, Jan; Frueboes, Tomasz; Gokieli, Ryszard; Górski, Maciej; Kazana, Malgorzata; Nawrocki, Krzysztof; Romanowska-Rybinska, Katarzyna; Szleper, Michal; Wrochna, Grzegorz; Zalewski, Piotr; Almeida, Nuno; David Tinoco Mendes, Andre; Faccioli, Pietro; Ferreira Parracho, Pedro Guilherme; Gallinaro, Michele; Sá Martins, Pedro; Musella, Pasquale; Nayak, Aruna; Ribeiro, Pedro Quinaz; Seixas, Joao; Silva, Pedro; Varela, Joao; Wöhri, Hermine Katharina; Belotelov, Ivan; Bunin, Pavel; Finger, Miroslav; Finger Jr., Michael; Golutvin, Igor; Kamenev, Alexey; Karjavin, Vladimir; Kozlov, Guennady; Lanev, Alexander; Moisenz, Petr; Palichik, Vladimir; Perelygin, Victor; Shmatov, Sergey; Smirnov, Vitaly; Volodko, Anton; Zarubin, Anatoli; Bondar, Nikolai; Golovtsov, Victor; Ivanov, Yury; Kim, Victor; Levchenko, Petr; Murzin, Victor; Oreshkin, Vadim; Smirnov, Igor; Sulimov, Valentin; Uvarov, Lev; Vavilov, Sergey; Vorobyev, Alexey; Andreev, Yuri; Gninenko, Sergei; Golubev, Nikolai; Kirsanov, Mikhail; Krasnikov, Nikolai; Matveev, Viktor; Pashenkov, Anatoli; Toropin, Alexander; Troitsky, Sergey; Epshteyn, Vladimir; Gavrilov, Vladimir; Kaftanov, Vitali; Kossov, Mikhail; Krokhotin, Andrey; Lychkovskaya, Natalia; Safronov, Grigory; Semenov, Sergey; Stolin, Viatcheslav; Vlasov, Evgueni; Zhokin, Alexander; Boos, Edouard; Dubinin, Mikhail; Dudko, Lev; Ershov, Alexander; Gribushin, Andrey; Kodolova, Olga; Lokhtin, Igor; Obraztsov, Stepan; Petrushanko, Sergey; Sarycheva, Ludmila; Savrin, Viktor; Snigirev, Alexander; Andreev, Vladimir; Azarkin, Maksim; Dremin, Igor; Kirakosyan, Martin; Rusakov, Sergey V.; Vinogradov, Alexey; Azhgirey, Igor; Bitioukov, Sergei; Grishin, Viatcheslav; Kachanov, Vassili; Konstantinov, Dmitri; Korablev, Andrey; Krychkine, Victor; Petrov, Vladimir; Ryutin, Roman; Slabospitsky, Sergey; Sobol, Andrei; Tourtchanovitch, Leonid; Troshin, Sergey; Tyurin, Nikolay; Uzunian, Andrey; Volkov, Alexey; Adzic, Petar; Djordjevic, Milos; Krpic, Dragomir; Milosevic, Jovan; Aguilar-Benitez, Manuel; Alcaraz Maestre, Juan; Arce, Pedro; Battilana, Carlo; Calvo, Enrique; Cepeda, Maria; Cerrada, Marcos; Colino, Nicanor; De La Cruz, Begona; Diez Pardos, Carmen; Fernandez Bedoya, Cristina; Fernández Ramos, Juan Pablo; Ferrando, Antonio; Flix, Jose; Fouz, Maria Cruz; Garcia-Abia, Pablo; Gonzalez Lopez, Oscar; Goy Lopez, Silvia; Hernandez, Jose M.; Josa, Maria Isabel; Merino, Gonzalo; Puerta Pelayo, Jesus; Redondo, Ignacio; Romero, Luciano; Santaolalla, Javier; Willmott, Carlos; Albajar, Carmen; Codispoti, Giuseppe; de Trocóniz, Jorge F; Cuevas, Javier; Fernandez Menendez, Javier; Folgueras, Santiago; Gonzalez Caballero, Isidro; Lloret Iglesias, Lara; Vizan Garcia, Jesus Manuel; Brochero Cifuentes, Javier Andres; Cabrillo, Iban Jose; Calderon, Alicia; Chamizo Llatas, Maria; Chuang, Shan-Huei; Duarte Campderros, Jordi; Felcini, Marta; Fernandez, Marcos; Gomez, Gervasio; Gonzalez Sanchez, Javier; Gonzalez Suarez, Rebeca; Jorda, Clara; Lobelle Pardo, Patricia; Lopez Virto, Amparo; Marco, Jesus; Marco, Rafael; Martinez Rivero, Celso; Matorras, Francisco; Munoz Sanchez, Francisca Javiela; Piedra Gomez, Jonatan; Rodrigo, Teresa; Ruiz Jimeno, Alberto; Scodellaro, Luca; Sobron Sanudo, Mar; Vila, Ivan; Vilar Cortabitarte, Rocio; Abbaneo, Duccio; Auffray, Etiennette; Auzinger, Georg; Baillon, Paul; Ball, Austin; Barney, David; Bell, Alan James; Benedetti, Daniele; Bernet, Colin; Bialas, Wojciech; Bloch, Philippe; Bocci, Andrea; Bolognesi, Sara; Breuker, Horst; Brona, Grzegorz; Bunkowski, Karol; Camporesi, Tiziano; Cano, Eric; Cerminara, Gianluca; Christiansen, Tim; Coarasa Perez, Jose Antonio; Covarelli, Roberto; Curé, Benoît; D'Enterria, David; Dahms, Torsten; De Roeck, Albert; Duarte Ramos, Fernando; Elliott-Peisert, Anna; Funk, Wolfgang; Gaddi, Andrea; Gennai, Simone; Georgiou, Georgios; Gerwig, Hubert; Gigi, Dominique; Gill, Karl; Giordano, Domenico; Glege, Frank; Gomez-Reino Garrido, Robert; Gouzevitch, Maxime; Govoni, Pietro; Gowdy, Stephen; Guiducci, Luigi; Hansen, Magnus; Harvey, John; Hegeman, Jeroen; Hegner, Benedikt; Henderson, Conor; Hoffmann, Hans Falk; Honma, Alan; Innocente, Vincenzo; Janot, Patrick; Karavakis, Edward; Lecoq, Paul; Leonidopoulos, Christos; Lourenco, Carlos; Macpherson, Alick; Maki, Tuula; Malgeri, Luca; Mannelli, Marcello; Masetti, Lorenzo; Meijers, Frans; Mersi, Stefano; Meschi, Emilio; Moser, Roland; Mozer, Matthias Ulrich; Mulders, Martijn; Nesvold, Erik; Nguyen, Matthew; Orimoto, Toyoko; Orsini, Luciano; Perez, Emmanuelle; Petrilli, Achille; Pfeiffer, Andreas; Pierini, Maurizio; Pimiä, Martti; Polese, Giovanni; Racz, Attila; Rolandi, Gigi; Rommerskirchen, Tanja; Rovelli, Chiara; Rovere, Marco; Sakulin, Hannes; Schäfer, Christoph; Schwick, Christoph; Segoni, Ilaria; Sharma, Archana; Siegrist, Patrice; Simon, Michal; Sphicas, Paraskevas; Spiga, Daniele; Spiropulu, Maria; Stöckli, Fabian; Stoye, Markus; Tropea, Paola; Tsirou, Andromachi; Tsyganov, Andrey; Veres, Gabor Istvan; Vichoudis, Paschalis; Voutilainen, Mikko; Zeuner, Wolfram Dietrich; Bertl, Willi; Deiters, Konrad; Erdmann, Wolfram; Gabathuler, Kurt; Horisberger, Roland; Ingram, Quentin; Kaestli, Hans-Christian; König, Stefan; Kotlinski, Danek; Langenegger, Urs; Meier, Frank; Renker, Dieter; Rohe, Tilman; Sibille, Jennifer; Starodumov, Andrei; Bortignon, Pierluigi; Caminada, Lea; Chen, Zhiling; Cittolin, Sergio; Dissertori, Günther; Dittmar, Michael; Eugster, Jürg; Freudenreich, Klaus; Grab, Christoph; Hervé, Alain; Hintz, Wieland; Lecomte, Pierre; Lustermann, Werner; Marchica, Carmelo; Martinez Ruiz del Arbol, Pablo; Meridiani, Paolo; Milenovic, Predrag; Moortgat, Filip; Nef, Pascal; Nessi-Tedaldi, Francesca; Pape, Luc; Pauss, Felicitas; Punz, Thomas; Rizzi, Andrea; Ronga, Frederic Jean; Sala, Leonardo; Sanchez, Ann - Karin; Sawley, Marie-Christine; Stieger, Benjamin; Tauscher, Ludwig; Thea, Alessandro; Theofilatos, Konstantinos; Treille, Daniel; Urscheler, Christina; Wallny, Rainer; Weber, Matthias; Wehrli, Lukas; Weng, Joanna; Aguiló, Ernest; Amsler, Claude; Chiochia, Vincenzo; De Visscher, Simon; Favaro, Carlotta; Ivova Rikova, Mirena; Millan Mejias, Barbara; Regenfus, Christian; Robmann, Peter; Schmidt, Alexander; Snoek, Hella; Wilke, Lotte; Chang, Yuan-Hann; Chen, Kuan-Hsin; Chen, Wan-Ting; Dutta, Suchandra; Go, Apollo; Kuo, Chia-Ming; Li, Syue-Wei; Lin, Willis; Liu, Ming-Hsiung; Liu, Zong-kai; Lu, Yun-Ju; Wu, Jing-Han; Yu, Shin-Shan; Bartalini, Paolo; Chang, Paoti; Chang, You-Hao; Chang, Yu-Wei; Chao, Yuan; Chen, Kai-Feng; Hou, George Wei-Shu; Hsiung, Yee; Kao, Kai-Yi; Lei, Yeong-Jyi; Lu, Rong-Shyang; Shiu, Jing-Ge; Tzeng, Yeng-Ming; Wang, Minzu; Adiguzel, Aytul; Bakirci, Mustafa Numan; Cerci, Salim; Dozen, Candan; Dumanoglu, Isa; Eskut, Eda; Girgis, Semiray; Gökbulut, Gül; Güler, Yalcin; Gurpinar, Emine; Hos, Ilknur; Kangal, Evrim Ersin; Karaman, Turker; Kayis Topaksu, Aysel; Nart, Alisah; Önengüt, Gülsen; Ozdemir, Kadri; Ozturk, Sertac; Polatöz, Ayse; Sogut, Kenan; Tali, Bayram; Topakli, Huseyin; Uzun, Dilber; Vergili, Latife Nukhet; Vergili, Mehmet; Zorbilmez, Caglar; Akin, Ilina Vasileva; Aliev, Takhmasib; Bilmis, Selcuk; Deniz, Muhammed; Gamsizkan, Halil; Guler, Ali Murat; Ocalan, Kadir; Ozpineci, Altug; Serin, Meltem; Sever, Ramazan; Surat, Ugur Emrah; Yildirim, Eda; Zeyrek, Mehmet; Deliomeroglu, Mehmet; Demir, Durmus; Gülmez, Erhan; Halu, Arda; Isildak, Bora; Kaya, Mithat; Kaya, Ozlem; Özbek, Melih; Ozkorucuklu, Suat; Sonmez, Nasuf; Levchuk, Leonid; Bell, Peter; Bostock, Francis; Brooke, James John; Cheng, Teh Lee; Clement, Emyr; Cussans, David; Frazier, Robert; Goldstein, Joel; Grimes, Mark; Hansen, Maria; Hartley, Dominic; Heath, Greg P.; Heath, Helen F.; Huckvale, Benedickt; Jackson, James; Kreczko, Lukasz; Metson, Simon; Newbold, Dave M.; Nirunpong, Kachanon; Poll, Anthony; Senkin, Sergey; Smith, Vincent J.; Ward, Simon; Basso, Lorenzo; Bell, Ken W.; Belyaev, Alexander; Brew, Christopher; Brown, Robert M.; Camanzi, Barbara; Cockerill, David J.A.; Coughlan, John A.; Harder, Kristian; Harper, Sam; Kennedy, Bruce W.; Olaiya, Emmanuel; Petyt, David; Radburn-Smith, Benjamin Charles; Shepherd-Themistocleous, Claire; Tomalin, Ian R.; Womersley, William John; Worm, Steven; Bainbridge, Robert; Ball, Gordon; Ballin, Jamie; Beuselinck, Raymond; Buchmuller, Oliver; Colling, David; Cripps, Nicholas; Cutajar, Michael; Davies, Gavin; Della Negra, Michel; Fulcher, Jonathan; Futyan, David; Guneratne Bryer, Arlo; Hall, Geoffrey; Hatherell, Zoe; Hays, Jonathan; Iles, Gregory; Karapostoli, Georgia; Lyons, Louis; Magnan, Anne-Marie; Marrouche, Jad; Nandi, Robin; Nash, Jordan; Nikitenko, Alexander; Papageorgiou, Anastasios; Pesaresi, Mark; Petridis, Konstantinos; Pioppi, Michele; Raymond, David Mark; Rompotis, Nikolaos; Rose, Andrew; Ryan, Matthew John; Seez, Christopher; Sharp, Peter; Sparrow, Alex; Tapper, Alexander; Tourneur, Stephane; Vazquez Acosta, Monica; Virdee, Tejinder; Wakefield, Stuart; Wardrope, David; Whyntie, Tom; Barrett, Matthew; Chadwick, Matthew; Cole, Joanne; Hobson, Peter R.; Khan, Akram; Kyberd, Paul; Leslie, Dawn; Martin, William; Reid, Ivan; Teodorescu, Liliana; Hatakeyama, Kenichi; Bose, Tulika; Carrera Jarrin, Edgar; Clough, Andrew; Fantasia, Cory; Heister, Arno; St. John, Jason; Lawson, Philip; Lazic, Dragoslav; Rohlf, James; Sperka, David; Sulak, Lawrence; Avetisyan, Aram; Bhattacharya, Saptaparna; Chou, John Paul; Cutts, David; Esen, Selda; Ferapontov, Alexey; Heintz, Ulrich; Jabeen, Shabnam; Kukartsev, Gennadiy; Landsberg, Greg; Narain, Meenakshi; Nguyen, Duong; Segala, Michael; Speer, Thomas; Tsang, Ka Vang; Borgia, Maria Assunta; Breedon, Richard; Calderon De La Barca Sanchez, Manuel; Cebra, Daniel; Chauhan, Sushil; Chertok, Maxwell; Conway, John; Cox, Peter Timothy; Dolen, James; Erbacher, Robin; Friis, Evan; Ko, Winston; Kopecky, Alexandra; Lander, Richard; Liu, Haidong; Maruyama, Sho; Miceli, Tia; Nikolic, Milan; Pellett, Dave; Robles, Jorge; Schwarz, Thomas; Searle, Matthew; Smith, John; Squires, Michael; Tripathi, Mani; Vasquez Sierra, Ricardo; Veelken, Christian; Andreev, Valeri; Arisaka, Katsushi; Cline, David; Cousins, Robert; Deisher, Amanda; Duris, Joseph; Erhan, Samim; Farrell, Chris; Hauser, Jay; Ignatenko, Mikhail; Jarvis, Chad; Plager, Charles; Rakness, Gregory; Schlein, Peter; Tucker, Jordan; Valuev, Vyacheslav; Babb, John; Clare, Robert; Ellison, John Anthony; Gary, J William; Giordano, Ferdinando; Hanson, Gail; Jeng, Geng-Yuan; Kao, Shih-Chuan; Liu, Feng; Liu, Hongliang; Luthra, Arun; Nguyen, Harold; Pasztor, Gabriella; Satpathy, Asish; Shen, Benjamin C.; Stringer, Robert; Sturdy, Jared; Sumowidagdo, Suharyo; Wilken, Rachel; Wimpenny, Stephen; Andrews, Warren; Branson, James G.; Dusinberre, Elizabeth; Evans, David; Golf, Frank; Holzner, André; Kelley, Ryan; Lebourgeois, Matthew; Letts, James; Mangano, Boris; Muelmenstaedt, Johannes; Padhi, Sanjay; Palmer, Christopher; Petrucciani, Giovanni; Pi, Haifeng; Pieri, Marco; Ranieri, Riccardo; Sani, Matteo; Sharma, Vivek; Simon, Sean; Tu, Yanjun; Vartak, Adish; Würthwein, Frank; Yagil, Avraham; Barge, Derek; Bellan, Riccardo; Campagnari, Claudio; D'Alfonso, Mariarosaria; Danielson, Thomas; Geffert, Paul; Incandela, Joe; Justus, Christopher; Kalavase, Puneeth; Koay, Sue Ann; Kovalskyi, Dmytro; Krutelyov, Vyacheslav; Lowette, Steven; Mccoll, Nickolas; Pavlunin, Viktor; Rebassoo, Finn; Ribnik, Jacob; Richman, Jeffrey; Rossin, Roberto; Stuart, David; To, Wing; Vlimant, Jean-Roch; Bornheim, Adolf; Bunn, Julian; Chen, Yi; Gataullin, Marat; Kcira, Dorian; Litvine, Vladimir; Ma, Yousi; Mott, Alexander; Newman, Harvey B.; Rogan, Christopher; Timciuc, Vladlen; Traczyk, Piotr; Veverka, Jan; Wilkinson, Richard; Yang, Yong; Zhu, Ren-Yuan; Akgun, Bora; Carroll, Ryan; Ferguson, Thomas; Iiyama, Yutaro; Jang, Dong Wook; Jun, Soon Yung; Liu, Yueh-Feng; Paulini, Manfred; Russ, James; Terentyev, Nikolay; Vogel, Helmut; Vorobiev, Igor; Cumalat, John Perry; Dinardo, Mauro Emanuele; Drell, Brian Robert; Edelmaier, Christopher; Ford, William T.; Heyburn, Bernadette; Luiggi Lopez, Eduardo; Nauenberg, Uriel; Smith, James; Stenson, Kevin; Ulmer, Keith; Wagner, Stephen Robert; Zang, Shi-Lei; Agostino, Lorenzo; Alexander, James; Chatterjee, Avishek; Das, Souvik; Eggert, Nicholas; Fields, Laura Johanna; Gibbons, Lawrence Kent; Heltsley, Brian; Hopkins, Walter; Khukhunaishvili, Aleko; Kreis, Benjamin; Kuznetsov, Valentin; Nicolas Kaufman, Gala; Patterson, Juliet Ritchie; Puigh, Darren; Riley, Daniel; Ryd, Anders; Shi, Xin; Sun, Werner; Teo, Wee Don; Thom, Julia; Thompson, Joshua; Vaughan, Jennifer; Weng, Yao; Winstrom, Lucas; Wittich, Peter; Biselli, Angela; Cirino, Guy; Winn, Dave; Abdullin, Salavat; Albrow, Michael; Anderson, Jacob; Apollinari, Giorgio; Atac, Muzaffer; Bakken, Jon Alan; Banerjee, Sunanda; Bauerdick, Lothar A.T.; Beretvas, Andrew; Berryhill, Jeffrey; Bhat, Pushpalatha C.; Bloch, Ingo; Borcherding, Frederick; Burkett, Kevin; Butler, Joel Nathan; Chetluru, Vasundhara; Cheung, Harry; Chlebana, Frank; Cihangir, Selcuk; Demarteau, Marcel; Eartly, David P.; Elvira, Victor Daniel; Fisk, Ian; Freeman, Jim; Gao, Yanyan; Gottschalk, Erik; Green, Dan; Gunthoti, Kranti; Gutsche, Oliver; Hahn, Alan; Hanlon, Jim; Harris, Robert M.; Hirschauer, James; Hooberman, Benjamin; James, Eric; Jensen, Hans; Johnson, Marvin; Joshi, Umesh; Khatiwada, Rakshya; Kilminster, Benjamin; Klima, Boaz; Kousouris, Konstantinos; Kunori, Shuichi; Kwan, Simon; Limon, Peter; Lipton, Ron; Lykken, Joseph; Maeshima, Kaori; Marraffino, John Michael; Mason, David; McBride, Patricia; McCauley, Thomas; Miao, Ting; Mishra, Kalanand; Mrenna, Stephen; Musienko, Yuri; Newman-Holmes, Catherine; O'Dell, Vivian; Popescu, Sorina; Pordes, Ruth; Prokofyev, Oleg; Saoulidou, Niki; Sexton-Kennedy, Elizabeth; Sharma, Seema; Soha, Aron; Spalding, William J.; Spiegel, Leonard; Tan, Ping; Taylor, Lucas; Tkaczyk, Slawek; Uplegger, Lorenzo; Vaandering, Eric Wayne; Vidal, Richard; Whitmore, Juliana; Wu, Weimin; Yang, Fan; Yumiceva, Francisco; Yun, Jae Chul; Acosta, Darin; Avery, Paul; Bourilkov, Dimitri; Chen, Mingshui; Di Giovanni, Gian Piero; Dobur, Didar; Drozdetskiy, Alexey; Field, Richard D.; Fisher, Matthew; Fu, Yu; Furic, Ivan-Kresimir; Gartner, Joseph; Goldberg, Sean; Kim, Bockjoo; Klimenko, Sergey; Konigsberg, Jacobo; Korytov, Andrey; Kropivnitskaya, Anna; Kypreos, Theodore; Matchev, Konstantin; Mitselmakher, Guenakh; Muniz, Lana; Pakhotin, Yuriy; Prescott, Craig; Remington, Ronald; Schmitt, Michael; Scurlock, Bobby; Sellers, Paul; Skhirtladze, Nikoloz; Wang, Dayong; Yelton, John; Zakaria, Mohammed; Ceron, Cristobal; Gaultney, Vanessa; Kramer, Laird; Lebolo, Luis Miguel; Linn, Stephan; Markowitz, Pete; Martinez, German; Rodriguez, Jorge Luis; Adams, Todd; Askew, Andrew; Bandurin, Dmitry; Bochenek, Joseph; Chen, Jie; Diamond, Brendan; Gleyzer, Sergei V; Haas, Jeff; Hagopian, Sharon; Hagopian, Vasken; Jenkins, Merrill; Johnson, Kurtis F.; Prosper, Harrison; Sekmen, Sezen; Veeraraghavan, Venkatesh; Baarmand, Marc M.; Dorney, Brian; Guragain, Samir; Hohlmann, Marcus; Kalakhety, Himali; Ralich, Robert; Vodopiyanov, Igor; Adams, Mark Raymond; Anghel, Ioana Maria; Apanasevich, Leonard; Bai, Yuting; Bazterra, Victor Eduardo; Betts, Russell Richard; Callner, Jeremy; Cavanaugh, Richard; Dragoiu, Cosmin; Garcia-Solis, Edmundo Javier; Gerber, Cecilia Elena; Hofman, David Jonathan; Khalatyan, Samvel; Lacroix, Florent; O'Brien, Christine; Silvestre, Catherine; Smoron, Agata; Strom, Derek; Varelas, Nikos; Akgun, Ugur; Albayrak, Elif Asli; Bilki, Burak; Cankocak, Kerem; Clarida, Warren; Duru, Firdevs; Lae, Chung Khim; McCliment, Edward; Merlo, Jean-Pierre; Mermerkaya, Hamit; Mestvirishvili, Alexi; Moeller, Anthony; Nachtman, Jane; Newsom, Charles Ray; Norbeck, Edwin; Olson, Jonathan; Onel, Yasar; Ozok, Ferhat; Sen, Sercan; Wetzel, James; Yetkin, Taylan; Yi, Kai; Barnett, Bruce Arnold; Blumenfeld, Barry; Bonato, Alessio; Eskew, Christopher; Fehling, David; Giurgiu, Gavril; Gritsan, Andrei; Guo, Zijin; Hu, Guofan; Maksimovic, Petar; Rappoccio, Salvatore; Swartz, Morris; Tran, Nhan Viet; Whitbeck, Andrew; Baringer, Philip; Bean, Alice; Benelli, Gabriele; Grachov, Oleg; Murray, Michael; Noonan, Daniel; Radicci, Valeria; Sanders, Stephen; Wood, Jeffrey Scott; Zhukova, Victoria; Bolton, Tim; Chakaberia, Irakli; Ivanov, Andrew; Makouski, Mikhail; Maravin, Yurii; Shrestha, Shruti; Svintradze, Irakli; Wan, Zongru; Gronberg, Jeffrey; Lange, David; Wright, Douglas; Baden, Drew; Boutemeur, Madjid; Eno, Sarah Catherine; Ferencek, Dinko; Gomez, Jaime; Hadley, Nicholas John; Kellogg, Richard G.; Kirn, Malina; Lu, Ying; Mignerey, Alice; Rossato, Kenneth; Rumerio, Paolo; Santanastasio, Francesco; Skuja, Andris; Temple, Jeffrey; Tonjes, Marguerite; Tonwar, Suresh C.; Twedt, Elizabeth; Alver, Burak; Bauer, Gerry; Bendavid, Joshua; Busza, Wit; Butz, Erik; Cali, Ivan Amos; Chan, Matthew; Dutta, Valentina; Everaerts, Pieter; Gomez Ceballos, Guillelmo; Goncharov, Maxim; Hahn, Kristan Allan; Harris, Philip; Kim, Yongsun; Klute, Markus; Lee, Yen-Jie; Li, Wei; Loizides, Constantinos; Luckey, Paul David; Ma, Teng; Nahn, Steve; Paus, Christoph; Roland, Christof; Roland, Gunther; Rudolph, Matthew; Stephans, George; Sumorok, Konstanty; Sung, Kevin; Wenger, Edward Allen; Xie, Si; Yang, Mingming; Yilmaz, Yetkin; Yoon, Sungho; Zanetti, Marco; Cole, Perrie; Cooper, Seth; Cushman, Priscilla; Dahmes, Bryan; De Benedetti, Abraham; Dudero, Phillip Russell; Franzoni, Giovanni; Haupt, Jason; Klapoetke, Kevin; Kubota, Yuichi; Mans, Jeremy; Rekovic, Vladimir; Rusack, Roger; Sasseville, Michael; Singovsky, Alexander; Cremaldi, Lucien Marcus; Godang, Romulus; Kroeger, Rob; Perera, Lalith; Rahmat, Rahmat; Sanders, David A; Summers, Don; Bloom, Kenneth; Bose, Suvadeep; Butt, Jamila; Claes, Daniel R.; Dominguez, Aaron; Eads, Michael; Keller, Jason; Kelly, Tony; Kravchenko, Ilya; Lazo-Flores, Jose; Lundstedt, Carl; Malbouisson, Helena; Malik, Sudhir; Snow, Gregory R.; Baur, Ulrich; Godshalk, Andrew; Iashvili, Ia; Kharchilava, Avto; Kumar, Ashish; Smith, Kenneth; Alverson, George; Barberis, Emanuela; Baumgartel, Darin; Boeriu, Oana; Chasco, Matthew; Kaadze, Ketino; Reucroft, Steve; Swain, John; Wood, Darien; Zhang, Jinzhong; Anastassov, Anton; Kubik, Andrew; Odell, Nathaniel; Ofierzynski, Radoslaw Adrian; Pollack, Brian; Pozdnyakov, Andrey; Schmitt, Michael; Stoynev, Stoyan; Velasco, Mayda; Won, Steven; Antonelli, Louis; Berry, Douglas; Hildreth, Michael; Jessop, Colin; Karmgard, Daniel John; Kolb, Jeff; Kolberg, Ted; Lannon, Kevin; Luo, Wuming; Lynch, Sean; Marinelli, Nancy; Morse, David Michael; Pearson, Tessa; Ruchti, Randy; Slaunwhite, Jason; Valls, Nil; Warchol, Jadwiga; Wayne, Mitchell; Ziegler, Jill; Bylsma, Ben; Durkin, Lloyd Stanley; Gu, Jianhui; Hill, Christopher; Killewald, Phillip; Kotov, Khristian; Ling, Ta-Yung; Rodenburg, Marissa; Williams, Grayson; Adam, Nadia; Berry, Edmund; Elmer, Peter; Gerbaudo, Davide; Halyo, Valerie; Hebda, Philip; Hunt, Adam; Jones, John; Laird, Edward; Lopes Pegna, David; Marlow, Daniel; Medvedeva, Tatiana; Mooney, Michael; Olsen, James; Piroué, Pierre; Quan, Xiaohang; Saka, Halil; Stickland, David; Tully, Christopher; Werner, Jeremy Scott; Zuranski, Andrzej; Acosta, Jhon Gabriel; Huang, Xing Tao; Lopez, Angel; Mendez, Hector; Oliveros, Sandra; Ramirez Vargas, Juan Eduardo; Zatserklyaniy, Andriy; Alagoz, Enver; Barnes, Virgil E.; Bolla, Gino; Borrello, Laura; Bortoletto, Daniela; Everett, Adam; Garfinkel, Arthur F.; Gecse, Zoltan; Gutay, Laszlo; Jones, Matthew; Koybasi, Ozhan; Laasanen, Alvin T.; Leonardo, Nuno; Liu, Chang; Maroussov, Vassili; Merkel, Petra; Miller, David Harry; Neumeister, Norbert; Potamianos, Karolos; Shipsey, Ian; Silvers, David; Svyatkovskiy, Alexey; Yoo, Hwi Dong; Zablocki, Jakub; Zheng, Yu; Jindal, Pratima; Parashar, Neeti; Boulahouache, Chaouki; Cuplov, Vesna; Ecklund, Karl Matthew; Geurts, Frank J.M.; Liu, Jinghua H.; Morales, Jafet; Padley, Brian Paul; Redjimi, Radia; Roberts, Jay; Zabel, James; Betchart, Burton; Bodek, Arie; Chung, Yeon Sei; de Barbaro, Pawel; Demina, Regina; Eshaq, Yossof; Flacher, Henning; Garcia-Bellido, Aran; Goldenzweig, Pablo; Gotra, Yury; Han, Jiyeon; Harel, Amnon; Miner, Daniel Carl; Orbaker, Douglas; Petrillo, Gianluca; Vishnevskiy, Dmitry; Zielinski, Marek; Bhatti, Anwar; Demortier, Luc; Goulianos, Konstantin; Lungu, Gheorghe; Mesropian, Christina; Yan, Ming; Atramentov, Oleksiy; Barker, Anthony; Duggan, Daniel; Gershtein, Yuri; Gray, Richard; Halkiadakis, Eva; Hidas, Dean; Hits, Dmitry; Lath, Amitabh; Panwalkar, Shruti; Patel, Rishi; Richards, Alan; Rose, Keith; Schnetzer, Steve; Somalwar, Sunil; Stone, Robert; Thomas, Scott; Cerizza, Giordano; Hollingsworth, Matthew; Spanier, Stefan; Yang, Zong-Chang; York, Andrew; Asaadi, Jonathan; Eusebi, Ricardo; Gilmore, Jason; Gurrola, Alfredo; Kamon, Teruki; Khotilovich, Vadim; Montalvo, Roy; Nguyen, Chi Nhan; Pivarski, James; Safonov, Alexei; Sengupta, Sinjini; Tatarinov, Aysen; Toback, David; Weinberger, Michael; Akchurin, Nural; Bardak, Cemile; Damgov, Jordan; Jeong, Chiyoung; Kovitanggoon, Kittikul; Lee, Sung Won; Mane, Poonam; Roh, Youn; Sill, Alan; Volobouev, Igor; Wigmans, Richard; Yazgan, Efe; Appelt, Eric; Brownson, Eric; Engh, Daniel; Florez, Carlos; Gabella, William; Johns, Willard; Kurt, Pelin; Maguire, Charles; Melo, Andrew; Sheldon, Paul; Velkovska, Julia; Arenton, Michael Wayne; Balazs, Michael; Boutle, Sarah; Buehler, Marc; Conetti, Sergio; Cox, Bradley; Francis, Brian; Hirosky, Robert; Ledovskoy, Alexander; Lin, Chuanzhe; Neu, Christopher; Yohay, Rachel; Gollapinni, Sowjanya; Harr, Robert; Karchin, Paul Edmund; Mattson, Mark; Milstène, Caroline; Sakharov, Alexandre; Anderson, Michael; Bachtis, Michail; Bellinger, James Nugent; Carlsmith, Duncan; Dasu, Sridhara; Efron, Jonathan; Gray, Lindsey; Grogg, Kira Suzanne; Grothe, Monika; Hall-Wilton, Richard; Herndon, Matthew; Klabbers, Pamela; Klukas, Jeffrey; Lanaro, Armando; Lazaridis, Christos; Leonard, Jessica; Lomidze, David; Loveless, Richard; Mohapatra, Ajit; Parker, William; Reeder, Don; Ross, Ian; Savin, Alexander; Smith, Wesley H.; Swanson, Joshua; Weinberg, Marc
2011-01-01
Measurements of primary charged hadron multiplicity distributions are presented for non-single-diffractive events in proton-proton collisions at centre-of-mass energies of sqrt(s) = 0.9, 2.36, and 7 TeV, in five pseudorapidity ranges from |eta|<0.5 to |eta|<2.4. The data were collected with the minimum-bias trigger of the CMS experiment during the LHC commissioning runs in 2009 and the 7 TeV run in 2010. The multiplicity distribution at sqrt(s) = 0.9 TeV is in agreement with previous measurements. At higher energies the increase of the mean multiplicity with sqrt(s) is underestimated by most event generators. The average transverse momentum as a function of the multiplicity is also presented. The measurement of higher-order moments of the multiplicity distribution confirms the violation of Koba-Nielsen-Olesen scaling that has been observed at lower energies.
Misra, S K; Andronenko, S I; Tipikin, D; Freed, J H; Somani, V; Prakash, Om
2016-03-01
Detailed EPR investigations on as-grown and annealed TiO 2 nanoparticles in the anatase and rutile phases were carried out at X-band (9.6 GHz) at 77, 120-300 K and at 236 GHz at 292 K. The analysis of EPR data for as-grown and annealed anatase and rutile samples revealed the presence of several paramagnetic centers: Ti 3+ , O - , adsorbed oxygen (O 2 - ) and oxygen vacancies. On the other hand, in as-grown rutile samples, there were observed EPR lines due to adsorbed oxygen (O 2 - ) and the Fe 3+ ions in both Ti 4+ substitutional positions, with and without coupling to an oxygen vacancy in the near neighborhood. Anatase nanoparticles were completely converted to rutile phase when annealed at 1000° C, exhibiting EPR spectra similar to those exhibited by the as-grown rutile nanoparticles. The high-frequency (236 GHz) EPR data on anatase and rutile samples, recorded in the region about g = 2.0 exhibit resolved EPR lines, due to O - and O 2 - ions enabling determination of their g-values with higher precision, as well as observation of hyperfine sextets due to Mn 2+ and Mn 4+ ions in anatase.
Collet, Florence
2017-01-01
The work of the RILEM Technical Committee (TC -236 BBM) was dedicated to the study of construction materials made from plant particles. It considered the question whether building materials containing as main raw material recyclable and easily available plant particles are renewable. This book includes a state-of-the-art report and an appendix. The state-of-the-art report relates to the description of vegetal aggregates. Then, hygrothermal properties, fire resistance, durability and finally the impact of the variability of the method of production of bio-based concrete are assessed. The appendix is a TC report which presents the experience of a working group. The goal was to define testing methods for the measurement of water absorption, bulk density, particle size distribution, and thermal conductivity of bio aggregates. The work is based on a first round robin test of the TC-BBM where the protocols in use by the different laboratories (labs) are compared. .
Functions and requirements for Project W-236B, Initial Pretreatment Module: Revision 1
International Nuclear Information System (INIS)
Swanson, L.M.
1994-01-01
Hanford Site tank waste supernatants will be pretreated to separate the low-level and high-level fractions. The low-level waste fraction, containing the bulk of the chemical constituents, must be processed into a vitrified waste product which will be disposed of onsite, in a safe, environmentally sound, and cost effective manner. The high-level waste fraction separated during supernatant pretreatment (primarily cesium) will be recombined with an additional high-level waste fraction generated from pretreatment of the tank waste sludges and solids. This combined high-level waste fraction will be immobilized as glass and disposed in a geological repository. The purpose of this document is to establish the functional requirements baseline for Project W-236B, Initial Pretreatment Module, by defining the level 5 and 6 functions and requirements for the project. A functional analysis approach has been used to break down the program functions and associated physical requirements that each function must meet. As the systems engineering process evolves, the design requirements document will replace this preliminary functions and requirements document. The design requirements document (DRD) will identify key decisions and associated uncertainties that impact the project. A revision of this document to a DRD is not expected to change the performance requirements or open issues. However, additional requirements and issues may be identified
Energy Technology Data Exchange (ETDEWEB)
Desideri, D.; Meli, M.A.; Roselli, C.; Testa, C. [General Chemistry Institute, Urbino University, Urbino (Italy); Boulyga, S.F.; Becker, J.S. [Central Department of Analytical Chemistry, Research Centre Juelich, Juelich (Germany)
2002-11-01
It is well known that ammunition containing depleted uranium (DU) was used by NATO during the Balkan conflict. To evaluate the origin of DU (the enrichment of natural uranium or the reprocessing of spent nuclear fuel) it is necessary to directly detect the presence of activation products ({sup 236}U, {sup 239}Pu, {sup 240}Pu, {sup 241}Am, and {sup 237}Np) in the ammunition. In this work the analysis of actinides by {alpha}-spectrometry was compared with that by inductively coupled plasma mass spectrometry (ICP-MS) after selective separation of ultratraces of transuranium elements from the uranium matrix. {sup 242}Pu and {sup 243}Am were added to calculate the chemical yield. Plutonium was separated from uranium by extraction chromatography, using tri-n-octylamine (TNOA), with a decontamination factor higher than 10{sup 6}; after elution plutonium was determined by ICP-MS ({sup 239}Pu and {sup 240}Pu) and {alpha}-spectrometry ({sup 239+240}Pu) after electroplating. The concentration of Pu in two DU penetrator samples was 7 x 10{sup -12} g g{sup -1} and 2 x 10{sup -11} g g{sup -1}. The {sup 240}Pu/{sup 239}Pu isotope ratio in one penetrator sample (0.12{+-}0.04) was significantly lower than the {sup 240}Pu/{sup 239}Pu ratios found in two soil samples from Kosovo (0.35{+-}0.10 and 0.27{+-}0.07). {sup 241}Am was separated by extraction chromatography, using di(2-ethylhexyl)phosphoric acid (HDEHP), with a decontamination factor as high as 10{sup 7}. The concentration of {sup 241}Am in the penetrator samples was 2.7 x 10{sup -14} g g{sup -1} and <9.4 x 10{sup -15} g g{sup -1}. In addition {sup 237}Np was detected at ultratrace levels. In general, ICP-MS and {alpha}-spectrometry results were in good agreement.The presence of anthropogenic radionuclides ({sup 236}U, {sup 239}Pu,{sup 240}Pu, {sup 241}Am, and {sup 237}Np) in the penetrators indicates that at least part of the uranium originated from the reprocessing of nuclear fuel. Because the concentrations of
Joint Institute for Nuclear Research Data Analysis Guide - Berkelium Edition
International Nuclear Information System (INIS)
Henderson, R.A.
2009-01-01
This is a data analysis guide to the JINR system developed by Roger Henderson. It is intended as a complete guide to the data format and the calibration parameters utilized for the analysis of the data. This guide will provide the basic structure of the data files, the description of the individual data items, and the basic equations developed for the calculation of the results. Currently (7/17/2009), calculation of the calibration parameters is not a covered topic. It is intended that this will be covered in a future update
Effect translational invariance in low-lying electric dipole excitations in 236U and 238U
International Nuclear Information System (INIS)
Ertugral, F.
2005-01-01
In this paper the translational invariant QRPA approach suggested by Pyatov [1] for the spherical nuclei has been extended to describe the 1 - states in deformed nuclei. The role of spurious centre-of-motion state on the Pygmy dipole resonance (PDR) has been investigated in the deformed 236 U and 238 U nuclei. It has been shown that the effect of taking into account the translational invariance of the Hamiltonians in the QRPA with separation of zero energy spurious solutions are noticeable in both the low energy density of 1 - states and in the PDR. Present investigation demonstrates the advantage of the translational invariant QRPA over the non translational invariant one. Within the translational invariant model the effect of removing spurious states on the E1 strength distribution is stronger than in none invariant QRPA (∼20%) for the states up to the neutron binding energy. It is found that the spurious state is spread over many levels, the largest admixture being situated in the region of the energy spacing between nuclear shells o w h . The giant resonance states contain, as a rule, very small admixtures of the spurious state
International Nuclear Information System (INIS)
Awadalla, N.G.
1994-01-01
Project W-236a, Multi-function waste Tank Facility (MWTF), was initiated to increase the safe waste storage capacity for the Tank Waste Remediation System (TWRS) by building two new one million gallon underground storage tanks in the 200 West Area and four tanks in the 200 East Area. Construction of the tanks was scheduled to begin in September 1994 with operations beginning in calendar year (CY) 1998. However, recent reviews have raised several issues regarding the mission, scope, and schedule of the MWTF. The decision to build new tanks must consider several elements, such as: Operational risk and needs -- Operational risk and flexibility must be managed such that any identified risk is reduced as soon as practicable; The amount of waste that will be generated in the future -- Additional needed tank capacity must be made available to support operations and maintain currently planned safety improvement activities; Safety issues -- The retrieval of waste from single-shell tanks (SSTs) and watch list tanks will add to the total amount of waste that must be stored in a double-shell tank (DST); Availability of existing DSTs -- The integrity of the 28 existing DSTs must be continuously managed; and Affect on other projects and programs -- Because MWTF systems have been integrated with other projects, a decision on one project will affect another. In addition the W-236a schedule is logically tied to support retrieval and safety program plans. Based on the above, two new tanks are needed for safe waste storage in the 200 West Area, and they need to be built as soon as practicable. Design should continue for the tanks in the 200 East Area with a decision made by September, on whether to construct them. Construction of the cross-site transfer line should proceed as scheduled. To implement this recommendation several actions need to be implemented
International Nuclear Information System (INIS)
Werner, H.
1976-12-01
A conversion ratio of near 1.0 can be achieved in a pebble-bed reactor using the OTTO (once through then out) loading scheme, having an economic burn-up of the fuel, an economic power density and a moderation ratio, which is considered realistically for the future. The flexibility of the reactor concept and of the fuel element design allows to recycle the fuel during full-power operation. In the present report first the criteria are shown, which are necessary to reach a high conversion ratio. Further it is presented that the conversion ratio increases considerably by closing the fuel cycle in consequence of the building-up of U-233. In this way the fuel inventory and the fuel consumption can considerably be diminished. It is demonstrated that the building-up and the accumulation of U-236 effects an important deterioration of the neutron economy. By taking the reprocessed uranium through an isotope separation (for example: ultra-gas-centrifugation) and by separation of U-236 from the other uranium isotopes it is possible to reduce the fuel consumption considerably. The expenditure and the cost which are necessary for the isotope separation are presented. (orig.) [de
International Nuclear Information System (INIS)
Garcia-Torano, E.
1990-01-01
A set of numerical methods to analize alpha spectra measured with semiconductor detectors are presented. The methods can be divided in two groups, the first being based in the X 2 minimization ands the second in the use of the Fourier Transform. The methods based in the minimization of X 2 can, in turn, be divided according to the model used to fit the spectra. Some of them use a monoenergetic line for the intercomparison with the other peaks in the same spectrum. The others take into account the analytical function developed to represent an alpha line. Both allow the determination of positions and areas of the components, as well as the uncertainties of the results. The Fast Fourier Transform is applied to the second group of methods, which include the smoothing of experimental data, and the deconvolution of spectra. Examples are given of the application of these methods to real spectra. The alpha spectra of 237 Np and 236 Np are studied by using some of the methods described in this work. (Author)
International Nuclear Information System (INIS)
Volkov, N.G.; Emel'yanov, V.M.; Krajnov, V.P.
1979-01-01
In a statistical fission model calculated are charge distributions of fission fragments (CDFF) of a 236 U* nucleus and their dispersions as the functions of excitation energy and angular momentum (AM) of a compound nucleus as well as the effect of one-particle potential parameter on CDFF. The potential of two-center oscillator was choosen as the one-particle potential. The function of fissioning nucleus level density, which is necessary for calculations in the statistical approach, has been determined from one-particle spectrum. The scheme of calculations is realized with a computer. Presented are the results of calculating the dependence of a neutron gap size on nuclear temperature for various projections of total AM; CDFF for different values of E* excitation energy of AM projection and others. Calculated CDFF and experimental data were compared. Notwithstanding the availability of many parameters and a large volume of numerical calculations the model under consideration permits to describe many common regularities of heavy nucleus CDFF (experimental yields of charges, dispersion dependence on excitation energies and masses of nuclear fragments)
Fission cross section ratios for 233,234,236U relative to 235U from 0.5 to 400 MeV
International Nuclear Information System (INIS)
Lisowski, P.W.; Gavron, A.; Parker, W.E.; Balestrini, S.J.; Carlson, A.D.; Wasson, O.A.; Hill, N.W.
1991-01-01
Neutron-induced fission cross section ratios from 0.5 to 400 MeV for samples of 233, 234, 236 U relative to 235 U have been measured at the WNR neutron Source at Los Alamos. The fission reaction rate was determined using a fast parallel plate ionization chamber at a 20-m flight path. Cross sections over most the energy range were also extracted using the neutron fluence determined with three different proton telescope arrangements. Those data provided the shape of the 235 U(n,f) cross section relative to the hydrogen scattering cross section. That shape was then normalized to the very accurately known value for 235 U(n,f) at 14.1 MeV to allow us to obtain cross section section values from the ratio data and our values for 235 U(n,f). 6 refs., 1 fig
Fission cross section ratios for 233,234,236U relative to 235U from 0.5 to 400 MeV
International Nuclear Information System (INIS)
Lisowski, P.W.; Gavron, A.; Parker, W.E.; Balestrini, S.J.; Carlson, A.D.; Wasson, O.A.; Hill, N.W.
1992-01-01
Neutron-induced fission cross section ratios from 0.5 to 400 MeV for samples of 233,234,236 U relative to 235 U have been measured at the WNR neutron Source at Los Alamos. The fission reaction rate was determined using a fast parallel plate ionization chamber at a 20-m flight path. Cross sections over most of the energy range were also extracted using the neutron fluence determined with three different proton telescope arrangements. Those data provided the shape of the 235 U(n, f) cross section relative to the hydrogen scattering cross section. That shape was then normalized to the very accurately known value for 235 U(n, f) at 14.1 MeV which will allow us to obtain cross section values from the ratio data and our values for 235 U(n, f). (orig.)
International Nuclear Information System (INIS)
Haynes, C.E.
1976-01-01
The Transuranium Research Laboratory (TRL) is the central facility at Oak Ridge National Laboratory (ORNL) for chemical and physical research involving transuranium elements. Transuranium Research Laboratory investigations are about equally divided between studies of inorganic and structural chemistry of the heavy elements and nuclear structure and properties of their isotopes. Elements studied include neptunium, plutonium, americium, curium, berkelium, californium, and einsteinium, each in microgram-to-gram quantities depending upon availability and experimental requirements. This paper describes an eight-step safety procedure followed in planning and approving individual research projects. This procedure should provide an optimum margin of safety and should permit the accomplishment of successful research
Composition containing transuranic elements for use in the homeopathic treatment of aids
International Nuclear Information System (INIS)
Lustig, D.
1996-01-01
A homeopathic remedy consisting of a composition containing one or more transuranic elements, particularly plutonium, for preventing and treating acquired immunodeficiency syndrome (AIDS) in humans, as well as seropositivity for human immunodeficiency virus (HIV). Said composition is characterized in that it uses any chemical or isotopic form of one or more transuranic elements (neptunium, plutonium, americium, curium, berkelium, californium or einsteinium), particularly plutonium, said form being diluted and dynamized according to conventional homeopathic methods, particularly the so-called Hahnemann and Korsakov methods, and provided preferably but not exclusively in the form of lactose and/or saccharose globules or granules impregnated with the active principle of said composition. (author)
Energy Technology Data Exchange (ETDEWEB)
Seaborg, Glenn T.; Street Jr., Kenneth; Thompson, Stanley G.; Ghiorso, Albert
1976-07-01
This volume includes the talks given on January 20, 1975, at a symposium in Berkeley on the occasion of the celebration of the 25th anniversary of the discovery of berkelium and californium. Talks were given at this symposium by the four people involved in the discovery of these elements and by a number of people who have made significant contributions in the intervening years to the investigation of their nuclear and chemical properties. The papers are being published here, without editing, in the form in which they were submitted by the authors in the months following the anniversary symposium, and they reflect rather faithfully the remarks made on that occasion.
Energy Technology Data Exchange (ETDEWEB)
Albrecht-Schmitt, Thomas
2012-03-01
This grant supported the exploratory synthesis of new actinide materials with all of the actinides from thorium to californium with the exceptions of protactinium and berkelium. We developed detailed structure-property relationships that allowed for the identification of novel materials with selective ion-exchange, selective oxidation, and long-range magnetic ordering. We found novel bonding motifs and identified periodic trends across the actinide series. We identified structural building units that would lead to desired structural features and novel topologies. We also characterized many different spectroscopic trends across the actinide series. The grant support the preparation of approximately 1200 new compounds all of which were structurally characterized.
Project W-236A, work plan for preparation of a design requirements document
International Nuclear Information System (INIS)
Groth, B.D.
1995-01-01
This work plan outlines the tasks necessary, and defines the organizational responsibilities for preparing a Design Requirements Document (DRD) for project W-236A, Multi-Function Waste Tank Facility (MWTF). A DRD is a Systems Engineering document which bounds, at a high level, the requirements of a discrete system element of the Tank Waste Remediation System (TWRS) Program. This system element is usually assigned to a specific project, in this case the MWTF. The DRD is the document that connects the TWRS program requirements with the highest level projects requirements and provides the project's link to the overall TWRS mission. The MWTF DRD effort is somewhat unique in that the project is already in detailed design, whereas a DRO is normally prepared prior to preliminary design. The MWTF design effort was initiated with a Functional Design Criteria (FDC) and a Supplemental Design Requirements Document (SDRD) bounding the high level requirements. Another unique aspect of this effort is that some of the TWRS program requirements are still in development. Because of these unique aspects of the MWTF DRD development, the MWTF will be developed from existing TWRS Program requirements and project specific requirements contained in the FDC and SDRD. The following list describes the objectives of the MWTF DRD: determine the primary functions of the tanks through a functional decomposition of the TWRS Program high level functions; allocate the primary functions to a sub-system architecture for the tanks; define the fundamental design features in terms of performance requirements for the system and subsystems; identify system interfaces and design constraints; and document the results in a DRD
The ATLAS collaboration
2010-01-01
In December 2009 data at the centre-of-mass energy of sqrt(s) = 2.36 TeV were recorded with the ATLAS detector. This was the first time the LHC had been operated at this beam energy and stable beam conditions were not declared. Therefore, to ensure detector safety, the silicon strip detector was in standby mode with reduced sensor bias voltage, which makes track reconstruction more difficult. Two complementary methods were developed to measure the charged particle multiplicity distributions and, in particular, estimate the track reconstruction efficiency under these challenging conditions. The first uses the full Inner Detector information and corrects the efficiency from the simulation using a data-driven technique. The second uses tracks reconstructed from pixel detector information only. The charged particle multiplicity and its dependence on transverse momentum and pseudorapidity are measured for events with at least one charged particle in the kinematic range |eta| 500 MeV. The average charged particle m...
Fission cross section ratios for sup 233,234,236 U relative to sup 235 U from 0. 5 to 400 MeV
Energy Technology Data Exchange (ETDEWEB)
Lisowski, P.W.; Gavron, A.; Parker, W.E.; Balestrini, S.J. (Los Alamos National Lab., NM (USA)); Carlson, A.D.; Wasson, O.A. (National Inst. of Standards and Technology, Gaithersburg, MD (USA)); Hill, N.W. (Oak Ridge National Lab., TN (USA))
1991-01-01
Neutron-induced fission cross section ratios from 0.5 to 400 MeV for samples of {sup 233, 234, 236}U relative to {sup 235}U have been measured at the WNR neutron Source at Los Alamos. The fission reaction rate was determined using a fast parallel plate ionization chamber at a 20-m flight path. Cross sections over most the energy range were also extracted using the neutron fluence determined with three different proton telescope arrangements. Those data provided the shape of the {sup 235}U(n,f) cross section relative to the hydrogen scattering cross section. That shape was then normalized to the very accurately known value for {sup 235}U(n,f) at 14.1 MeV to allow us to obtain cross section section values from the ratio data and our values for {sup 235}U(n,f). 6 refs., 1 fig.
DEFF Research Database (Denmark)
Kjellsson, Gøsta; Damgaard, Christian; Strandberg, Morten Tune
2004-01-01
"DMU finder at det nye materiale om den molekulære karakterisering af 281-24-236x3006-210-23 bomulden, ikke giver anledning til at ændre den tidligere riskovurdering. Vedr. spørgsmål 1 er det i svaret fra anmelderen blevet tilfredsstillende redegjort for hvilket materiale der blev anvendt. Vedr s...
International Nuclear Information System (INIS)
Kraft-Bermuth, S.
2004-01-01
In the thesis presented here, calorimetric low temperature detectors were for the first time applied in accelerator mass spectrometry (AMS) to determine the isotope ratio of 236 U to 238 U in several samples of natural uranium. The detectors consist of a superconducting aluminium film deposited onto a sapphire absorber which is used as thermistor. An energetic heavy ion deposits its kinetic energy as heat in the absorber. The temperature rise is detected by the resistance change of the superconductor. The AMS experiments were performed at the tandem accelerator VERA of the ''Institut fuer Isotopenforschung und Kernphysik'' of the University of Vienna. In an energy range of 10-60 MeV, a relative energy resolution of ΔE/E=7.10 -3 could be achieved, one order of magnitude better than with conventional ionization detectors. Improving thermal and electronic noise yielded in a second experiment for uranium ions with E=17 MeV a relative energy resolution of ΔE/E=4.6.10 -3 . The energy response of the detectors was linear over the whole energy range and independent of the ion mass. Down to a level of 0.1%, no pulse height defect was observed. With the energy resolution obtained it is possible to determine the isotope ratio of 236 U/ 238 U for several samples of natural uranium. With the resolution achieved it is possible furthermore to apply the detectors in several test experiments for direct mass identification of heavy ions using a combined energy/time of flight measurement. In these first tests, a mass resolution of ΔM/M=(8.5-11.0).10 -3 was achieved. In a first test to apply the detectors for detection of so called ''super heavy elements (Z>=112)'', the large dynamic range allowed to identify the reaction products and their alpha decays simultaneously and time dependent. (orig.)
International Nuclear Information System (INIS)
Young, J.P.; Haire, R.G.; Peterson, J.R.; Ensor, D.D.; Fellows, R.L.
1980-01-01
Spectrophotometric and x-ray powder diffraction methods have been applied to a study of the ingrowth of californium-249 by β - decay of berkelium-249 in crystalline 249 BkBr 3 . It was found that the Cf daughter grows in with the same oxidation state and crystal structure as the parent. Thus, six-coordinate BkBr 3 (AlCl 3 -type monoclinic structure) generates six-coordinate CfBr 3 , and eight-coordinate BkBr 3 (PuBr 3 -type orthorhombic structure) generates eight-coordinate CfBr 3 , a previously unknown form of CfBr 3 . It was also found that the daughter Cf(III) in the BkBr 3 parent compound can be reduced to Cf(II) by treatment with H 2 , as it can in pure CfBr 3 . 5 figures
Nuclear fission and the transuranium elements
International Nuclear Information System (INIS)
Seaborg, G.T.
1989-02-01
Many of the transuranium elements are produced and isolated in large quantities through the use of neutrons furnished by nuclear fission reactions: plutonium (atomic number 94) in ton quantities; neptunium (93), americium (95), and curium (96) in kilogram quantities; berkelium (97) in 100 milligram quantities; californium (98) in gram quantities; and einsteinium (99) in milligram quantities. Transuranium isotopes have found many practical applications---as nuclear fuel for the large-scale generation of electricity, as compact, long-lived power sources for use in space exploration, as means for diagnosis and treatment in the medical area, and as tools in numerous industrial processes. Of particular interest is the unusual chemistry and impact of these heaviest elements on the periodic table. This account will feature these aspects. 9 refs., 5 figs
Nuclear fission and the transuranium elements
Energy Technology Data Exchange (ETDEWEB)
Seaborg, G.T.
1989-02-01
Many of the transuranium elements are produced and isolated in large quantities through the use of neutrons furnished by nuclear fission reactions: plutonium (atomic number 94) in ton quantities; neptunium (93), americium (95), and curium (96) in kilogram quantities; berkelium (97) in 100 milligram quantities; californium (98) in gram quantities; and einsteinium (99) in milligram quantities. Transuranium isotopes have found many practical applications---as nuclear fuel for the large-scale generation of electricity, as compact, long-lived power sources for use in space exploration, as means for diagnosis and treatment in the medical area, and as tools in numerous industrial processes. Of particular interest is the unusual chemistry and impact of these heaviest elements on the periodic table. This account will feature these aspects. 9 refs., 5 figs.
EPISODIC STAR FORMATION COUPLED TO REIGNITION OF RADIO ACTIVITY IN 3C 236
International Nuclear Information System (INIS)
Tremblay, Grant R.; O'Dea, Christopher P.; Baum, Stefi A.; Koekemoer, Anton M.; Sparks, William B.; De Bruyn, Ger; Schoenmakers, Arno P.
2010-01-01
We present Hubble Space Telescope Advanced Camera for Surveys and STIS FUV/NUV/optical imaging of the radio galaxy 3C 236, whose relic ∼4 Mpc radio jet lobes and inner 2 kpc compact steep spectrum (CSS) radio source are evidence of multiple epochs of active galactic nucleus (AGN) activity. Consistent with previous results, our data confirm the presence of four bright knots of FUV emission in an arc along the edge of the inner circumnuclear dust disk in the galaxy's nucleus, as well as FUV emission cospatial with the nucleus itself. We interpret these to be sites of recent or ongoing star formation. We present photometry of these knots, as well as an estimate for the internal extinction in the source using line ratios from archival ground-based spectroscopy. We estimate the ages of the knots by comparing our extinction-corrected photometry with stellar population synthesis models. We find the four knots cospatial with the dusty disk to be young, of order ∼10 7 yr old. The FUV emission in the nucleus, to which we do not expect scattered light from the AGN to contribute significantly, is likely due to an episode of star formation triggered ∼10 9 yr ago. We argue that the young ∼10 7 yr old knots stem from an episode of star formation that was roughly coeval with the event resulting in reignition of radio activity, creating the CSS source. The ∼10 9 yr old stars in the nucleus may be associated with the previous epoch of radio activity that generated the 4 Mpc relic source, before being cut off by exhaustion or interruption. The ages of the knots, considered in the context of both the disturbed morphology of the nuclear dust and the double-double morphology of the 'old' and 'young' radio sources, present evidence for an AGN/starburst connection that is possibly episodic in nature. We suggest that the AGN fuel supply was interrupted for ∼10 7 yr due to a minor merger event and has now been restored. The resultant nonsteady flow of gas in the disk is likely
International Nuclear Information System (INIS)
Mount, M.E.; Layton, D.W.; Hamilton, T.F.; Lynn, M.
1999-01-01
Between 1965 and 1981, five objects and six naval reactor pressure vessels (RPVs) from four former Soviet Union submarines and a special container from the icebreaker Lenin, all containing damaged spent nuclear fuel (SNF) were dumped in a variety of containments, at four sites in the Kara Sea. The International Atomic Energy Agency initiated the International Arctic Seas Assessment Project (IASAP) to study the possible health and environmental effects from disposal of these objects. One outcome of the IASAP was an estimation of the radionuclide inventory and their release rates from these objects. A follow-on concern is the ability to detect the radionuclides released into the water column. The work reported here is the feasibility of using the long-lived radionuclides 59 Ni, 99 Tc, and 236 U encased within these objects, to monitor the breakdown of the containments due to corrosion
International Nuclear Information System (INIS)
Plischke, P.
1981-01-01
With the proton beam of the Hamburg isochronous cyclotron (HAIZY) thin uranium targets with the mass numbers 235, 236, and 238 were bombarded. Both fragments from the fission of the Np reaction systems and the neutrons coincident with the fragments were detected in the plane perpendicular to the beam direction. Measured and stored event by event were for all particles the times of flight. The detection of the neutron succeeded in conventional time-of-flight technique with NE213 liquid scintillators. A fission detector system with plastic scintillator foils was developed. It permits high event rates over long measuring times and allows the choice of so long neutron flight paths that a neutron energy resolution between 2% and 4% could be reached. The determination of the fragment masses is in spite of the short flight paths of 15 respectively 21 cm possible to +-2 amu. The isotropic component das discussed under the assumption that it is composed of prefission and scission neutrons which were emitted befor fission respectively during the fragmentation. From the post fission results the distribution of the excitation energy to both fragments was determined in dependence of Esup(*) and the fragment mass. (orig./HSI) [de
Tamburini, Fabrizio; Licata, Ignazio
2017-09-01
The search for dark matter (DM) is one of the most active and challenging areas of current research. Possible DM candidates are ultralight fields such as axions and weak interacting massive particles (WIMPs). Axions piled up in the center of stars are supposed to generate matter/DM configurations with oscillating geometries at a very rapid frequency, which is a multiple of the axion mass m B (Brito et al (2015); Brito et al (2016)). Borra and Trottier (2016) recently found peculiar ultrafast periodic spectral modulations in 236 main sequence stars in the sample of 2.5 million spectra of galactic halo stars of the Sloan Digital Sky Survey (˜1% of main sequence stars in the F-K spectral range) that were interpreted as optical signals from extraterrestrial civilizations, suggesting them as possible candidates for the search for extraterrestrial intelligence (SETI) program. We argue, instead, that this could be the first indirect evidence of bosonic axion-like DM fields inside main sequence stars, with a stable radiative nucleus, where a stable DM core can be hosted. These oscillations were not observed in earlier stellar spectral classes probably because of the impossibility of starting a stable oscillatory regime due to the presence of chaotic motions in their convective nuclei. The axion mass values, (50< {m}B< 2.4× {10}3) μ {eV}, obtained from the frequency range observed by Borra and Trottier, (0.6070< f< 0.6077) THz, agree with the recent theoretical results from high-temperature lattice quantum chromodynamics (Borsanyi et al (2016); Borsanyi et al (2016b)).
Charged particle multiplicities at {radical}(s)=0.9, 2.36 and 7.0 TeV with the CMS detector at LHC
Energy Technology Data Exchange (ETDEWEB)
Rougny, Romain [Universiteit Antwerpen, Gratiekapelstraat 10, BE-2000 Antwerpen (Belgium); De Wolf, E.A.; Janssen, X.; Mucibello, L.; Van Remortel, N.; Lee, Y.J.; Busza, Wit
2010-07-01
The charged particle multiplicity, n, is an essential observable in hadron collisions. It is the result of the counting of all charged particles produced by the primary proton-proton interaction. In particular, the events collected by minimum bias triggers contain soft interactions and produce mostly particles with low transverse momenta. The shape of the charged particle multiplicity spectrum is sensitive to the particle production mechanism of these soft interactions which are described by non-perturbative models, inspired by QCD. The correlations between produced hadrons are reflected in the shape of the multiplicity spectrum, while the mean multiplicity increases with the center of mass energy of the collision. We present the measurement of the charged particle multiplicity distributions, 1/s d{sigma}/dn, in increasing sub-domains of pseudorapidity and transverse momentum acceptance, for non single diffractive interactions. The data are further corrected for the trigger and event selection efficiency and the effects of tracking inefficiency and secondary tracks originating from the decay of long lived particles and products of interaction with the beam pipe and the detector material. This measurement is based on minimum bias data collected by the CMS detector at {radical}(s) = 0.9, 2.36 and 7 TeV. The data were collected during the LHC commissioning run in 2009 and at the beginning of 2010. (authors)
On the Use of 233U-236U Double-Spike for TIMS Measurements of Uranium Isotopes: A Simulation Study
International Nuclear Information System (INIS)
Williams, R W
2004-01-01
Synthetic ion beams with instantaneous and temporal characteristics appropriate to thermal ionization mass spectrometry (TIMS) were mathematically generated and analyzed to determine the effects of using a mixed 233 U- 236 U spike (double-spike) in the analysis of uranium isotopes. The instantaneous beam characteristics are the intensities (e.g., counts per second) modeled with a Poisson distribution plus a component of random noise that simulates the detection processes. Several beam intensity and mass fractionation vs. time functions were modeled to simulate a range of sample sizes and the commonly employed methods of data collection. These beam profiles were also generated with different noise levels, and signal-to-noise vs. analytical precision diagrams are presented. Modeling focused on natural uranium, where 238 U/ 235 U = 137.88, and on the ability of a given method to determine precisely and accurately small variations in this ratio. Practical limits on precision were determined to be 20-30 ppm, which is consistent with precision seen for other elements by state-of-the-art TIMS. The TIMS total evaporation method was compared directly with the double-spike method. While similar analytical precisions are obtained with either method, the double-spike method of correcting for analytical bias gives more accurate results. The results of a total evaporation analysis will deviate from true by more than the analytical precision if as little as 0.05% of the signal is not integrated, whereas the accuracy and precision of the double-spiked analyses are always linked
Total neutron cross sections of berkelium-249 and californium-249 below 100 eV
International Nuclear Information System (INIS)
Benjamin, R.W.; Harvey, J.A.; Hill, N.W.; Pandey, M.S.; Carlton, R.F.
1979-01-01
The neutron total cross sections of 249 Bk and 249 Cf have been measured from 0.03 to 100 eV using the Oak Ridge Electron Linear Accelerator (ORELA) as a source of pulsed neutrons. The 1.6 mm dia. cylindrical transmission samples contained initially up to 5.3 mg of 98% 249 Bk and 2% 249 Cf: 4.5 years later, when the final measurements were made, the composition of the samples had become 2.5% 249 Bk, 96.9% 249 Cf, and 0.6% 245 Cm. Samples were cooled with liquid nitrogen to reduce Doppler broadening. Thirty-nine resonances were identified in 249 Bk and analyzed using a single-level Breit-Wigner formalism. Fifty-five resonances were identified in 249 Cf and analyzed using an R-matrix multilevel formalism. Fifty-five resonances were identified in 249 Cf and analyzed using an R-matrix multilevel formalism. The resonance parameters obtained have been used to determine the average level spacings and the s-wave neutron and fission strength functions. Where possible, bound-level parameters were derived to fit the thermal neutron total cross section data
Identification of the new isotope sup 2 sup 4 sup 1 Bk
Asai, M; Ichikawa, S; Nagame, Y; Nishinaka, I; Akiyama, K; Toyoshima, A; Kaneko, T; Sakama, M; Haba, H; Oura, Y; Kojima, Y; Shibata, M
2003-01-01
A new neutron-deficient berkelium isotope sup 2 sup 4 sup 1 Bk produced in the sup 2 sup 3 sup 9 Pu( sup 6 Li, 4n) reaction has been identified using a gas-jet coupled on-line isotope separator. Cm K and L X-rays associated with the EC decay of sup 2 sup 4 sup 1 Bk were observed in the mass-241 fraction, and three gamma transitions were attributed to the EC decay of sup 2 sup 4 sup 1 Bk through X-gamma coincidences. The half-life of sup 2 sup 4 sup 1 Bk was determined to be 4.6+-0.4 min which is 1/2-1/4 of that of theoretical predictions. The half-life value and the observed gamma transitions can be consistently explained as a consequence of the allowed EC transition of pi 7/2 sup + [633] -> nu 7/2 sup + [624]. (orig.)
Reactor production of 252Cf and transcurium isotopes
International Nuclear Information System (INIS)
Alexander, C.W.; Halperin, J.; Walker, R.L.; Bigelow, J.E.
1990-01-01
Berkelium, californium, einsteinium, and fermium are currently produced in the High Flux Isotope Reactor (HFIR) and recovered in the Radiochemical Engineering Development Center (REDC) at the Oak Ridge National Laboratory (ORNL). All the isotopes are used for research. In addition, 252 Cf, 253 Es, and 255 Fm have been considered or are used for industrial or medical applications. ORNL is the sole producer of these transcurium isotopes in the western world. A wide range of actinide samples were irradiated in special test assemblies at the Fast Flux Test Facility (FFTF) at Hanford, Washington. The purpose of the experiments was to evaluate the usefulness of the two-group flux model for transmutations in the special assemblies with an eventual goal of determining the feasibility of producing macro amounts of transcurium isotopes in the FFTF. Preliminary results from the production of 254g Es from 252 Cf will be discussed. 14 refs., 5 tabs
Energy Technology Data Exchange (ETDEWEB)
Brown, Paul L. [Geochem Australia, Kiama, NSW (Australia); Ekberg, Christian [Chalmers Univ. of Technology, Goeteborg (Sweden). Nuclear Chemistry/Industrial Materials Recycling
2016-07-01
All isotopes of actinium are radioactive and exist in aqueous solution only in the trivalent state. There have been very few studies on the hydrolytic reactions of actinium(III). The hydrolysis reactions for uranium would only be important in alkaline pH conditions. Thermodynamic parameters for the hydrolysis species of uranium(VI) and its oxide and hydroxide phases can be determined from the stability and solubility constants. The hydrolytic behaviour of neptunium(VI) is quite similar to that of uranium(VI). The solubility constant of NpO{sub 2}OH(am) has been reported a number of times for both zero ionic strength and in fixed ionic strength media. Americium can form four oxidation states in aqueous solution, namely trivalent, tetravalent, pentavalent and hexavalent. Desire, Hussonnois and Guillaumont determined stability constants for the species AmOH{sup 2+} for the actinides, plutonium(III), americium(III), curium(III), berkelium(III) and californium(III) using a solvent extraction technique.
International Nuclear Information System (INIS)
Brown, Paul L.; Ekberg, Christian
2016-01-01
All isotopes of actinium are radioactive and exist in aqueous solution only in the trivalent state. There have been very few studies on the hydrolytic reactions of actinium(III). The hydrolysis reactions for uranium would only be important in alkaline pH conditions. Thermodynamic parameters for the hydrolysis species of uranium(VI) and its oxide and hydroxide phases can be determined from the stability and solubility constants. The hydrolytic behaviour of neptunium(VI) is quite similar to that of uranium(VI). The solubility constant of NpO 2 OH(am) has been reported a number of times for both zero ionic strength and in fixed ionic strength media. Americium can form four oxidation states in aqueous solution, namely trivalent, tetravalent, pentavalent and hexavalent. Desire, Hussonnois and Guillaumont determined stability constants for the species AmOH 2+ for the actinides, plutonium(III), americium(III), curium(III), berkelium(III) and californium(III) using a solvent extraction technique.
Nuclear Chemistry Institute, Mainz University. Annual Report 1995
International Nuclear Information System (INIS)
Denschlag, H.O.
1996-03-01
The annual report of the Institut fuer Kernchemie addresses inter alia three main research activities. The first belongs to the area of basic research, covering studies in the fields of nuclear fission, chemistry of the super-heavy elements and of heavy-ion reactions extending from the Coulomb barrier to relativistic energies, and nuclear astrophysics in connection with the ''r process''. By means of laser technology, high-precision data could be measured of the ionization energies of berkelium and californium. Studies of atomic clusters in the vacuum of an ionization trap revealed interesting aspects. The second major activity was devoted to the analysis of environmental media, applying inter alia neutron activation analysis and resonance ionization mass spectroscopy (RIMS). The third activity resulted in the development of novel processes, or the enhancement of existing processes or methods, for applications in basic research work and in environmental analytics. Another item of interest is the summarizing report on the operation of the TRIGA research reactor. (orig./SR) [de
Directory of Open Access Journals (Sweden)
Rufus W Ojewola
2013-01-01
Full Text Available Aims and Objective: This study aims at correlating different digital rectal examination (DRE abnormalities with histopathological results in patients with prostatic diseases. Materials and Methods: A prospective study of 236 patients who underwent prostate needle biopsy (PNB. Inclusion criteria were presence of abnormal DRE findings or elevated prostate specific antigen above 4 ng/ml or both. They all had 10-core extended transrectal biopsy and specimens were sent for histopathological examination. Correlations were made between DRE findings and histopathology results. Two separate multivariate logistic regression models were created; the first evaluated the relationship of predictors (DRE findings to the likelihood of detecting cancer and the second explored predictors of high-grade cancer on PNB. Results: Two hundred and thirty-six patients were enrolled with a mean age of 66.9 years and range of 43-90 years. Histopathology results were malignant in 102 (43.2% and benign in 134 (56.8%. Ninety-one (38.6% and 145 (61.4% had normal DRE and abnormal DRE findings with cancer detection rates of 23.1% and 55.8% respectively. Nodular prostate is the most common abnormality in 63.4% patients with abnormal DRE. Each sign of DRE had different predictive value with enhanced positive predictive value when combinations of abnormalities are present. Abnormal DRE is an independent predictor of high-grade tumor. Mean Gleason scores were 4.7 and 7.1 in patients with normal and abnormal DRE respectively. Conclusion: DRE is a useful and important tool in assessing patients with suspected prostate diseases who need prostate biopsy. An abnormal DRE correlated well with prostate cancer and independently predicted high-grade disease in these men.
Dau, Phuong D; Vasiliu, Monica; Peterson, Kirk A; Dixon, David A; Gibson, John K
2017-12-06
Actinyl chemistry is extended beyond Cm to BkO 2 + and CfO 2 + through transfer of an O atom from NO 2 to BkO + or CfO + , establishing a surprisingly high lower limit of 73 kcal mol -1 for the dissociation energies, D[O-(BkO + )] and D[O-(CfO + )]. CCSD(T) computations are in accord with the observed reactions, and characterize the newly observed dioxide ions as linear pentavalent actinyls; these being the first Bk and Cf species with oxidation states above IV. Computations of actinide dioxide cations AnO 2 + for An=Pa to Lr reveal an unexpected minimum for D[O-(CmO + )]. For CmO 2 + , and AnO 2 + beyond EsO 2 + , the most stable structure has side-on bonded η 2 -(O 2 ), as An III peroxides for An=Cm and Lr, and as An II superoxides for An=Fm, Md, and No. It is predicted that the most stable structure of EsO 2 + is linear [O=Es V =O] + , einsteinyl, and that FmO 2 + and MdO 2 + , like CmO 2 + , also have actinyl(V) structures as local energy minima. The results expand actinide oxidation state chemistry, the realm of the distinctive actinyl moiety, and the non-periodic character towards the end of the periodic table. © 2017 Wiley-VCH Verlag GmbH & Co. KGaA, Weinheim.
International Nuclear Information System (INIS)
Meadows, J.W.
1986-12-01
The measurement of the fission cross section ratios of nine isotopes relative to 235 U at an average neutron energy of 14.74 MeV is described with particular attention to the determination of corrections and to sources of error. The results are compared to ENDF/B-V and to other measurements of the past decade. The ratio of the neutron induced fission cross section for these isotopes to the fission cross section for 235 U are: 230 Th - 0.290 +- 1.9%; 232 Th - 0.191 +- 1.9%; 233 U - 1.132 +- 0.7%; 234 U - 0.998 +- 1.0%; 236 U - 0.791 +- 1.1%; 238 U - 0.587 +- 1.1%; 237 Np - 1.060 +- 1.4%; 239 Pu - 1.152 +- 1.1%; 242 Pu - 0.967 +- 1.0%. 40 refs., 11 tabs., 9 figs
International Nuclear Information System (INIS)
Belanova, T.S.
1994-12-01
Data on the thermal neutron fission and capture cross-sections as well as their corresponding resonance integrals are reviewed and analysed. The data are classified according to the form of neutron spectra under investigation. The weighted mean values of the cross-sections and resonance integrals for every type of neutron spectra were adopted as evaluated data. (author). 87 refs, 2 tabs
Extraction of transplutonium elements from carbonate solutions by alkylpyrocatechol
International Nuclear Information System (INIS)
Karalova, Z.K.; Myasoedov, B.F.; Rodionova, L.M.; Kuznetsova, V.S.
1983-01-01
Extraction of americium, berkelium as well as Ce, Eu, Th, U, Zr, Cs, Fe with solution of 4(α, α-dioctylethyl)pyrocatechol (DOP) in toluene from carbonate solutions to determine conditions of their separation has been studied. It is established that americium extraction is quite sensitive to the changes of potassium carbonate concentration. The maximum extraction of americium (R >90%) is observed in the case of 0.1-0.5 mol/l of K 2 CO 3 solutions and the minimum one (R=2.5%) - in the case of 8 mol/l K 2 CO 3 . Americium extraction increases sharply when sodium hydroxide is introduced in carbonate solutions. It is shown that varying sodium hydroxide concentration it is possible to achieve qualitative extraction of americium even from saturated solution of potassium carbonate. Reextraction of TPE is easily realized with 3 mol/l HCl solution. The system K 2 CO 3 (KOH)-DOP proved to be perspective for Am separation from Bk, Ce, Cs, actinoid elements as well as from Fe
Energy Technology Data Exchange (ETDEWEB)
Lee, Hwachol; Sukegawa, Hiroaki, E-mail: sukegawa.hiroaki@nims.go.jp; Mitani, Seiji; Hono, Kazuhiro [National Institute for Materials Science (NIMS), Sengen 1-2-1, Tsukuba, Ibaraki 305-0047 (Japan)
2015-07-21
We study the relationship between long range order parameters and the magnetocrystalline anisotropy of off-stoichiometric D0{sub 22} Mn{sub 2.36}Ga (MnGa) epitaxial films grown on MgO (001) and SrTiO{sub 3} (STO) (001) single crystalline substrates. MnGa films deposited on MgO (001) show rather large irregular variation in magnetization with increasing substrate temperature in spite of the improved long range order of total atomic sites. The specific site long range order of Mn-I site characterized in the [101] orientation revealed the fluctuation of the occupation fraction of two Mn atomic sites with elevated substrate temperature, which appears more relevant to the observed magnetization change than the long range order of the total atomic sites. In case of MnGa films grown on the lattice-matched STO (001), high long range order of the total atomic sites in spite of the existence of secondary phase represents that the lattice mismatch plays a crucial role in determining the atomic arrangement of Mn and Ga atoms in the off-stoichiometric compositional case of MnGa.
International Nuclear Information System (INIS)
Bergman, A.; Bamford, I.; Wachtmeister, C.A.
1981-01-01
[ 14 C]Aniline hydrogen sulphate was acetylated, and the acetanilide obtained was chlorinated with N-chlorosuccinimide to 2-chloro, 4-chloro- and 2,4-dichloroacet[ 14 C]anilide. The labelled 2- and 4-chloroacet[ 14 C]anilides were hydrolyzed and treated with aluminium chloride, hydrogen chloride and chlorine in dry dichloromethane to give the major products 2,5-dichloro-and 3,4-dichloro[ 14 C]aniline. The labelled 2,3-dichloro- and 2,3,6-trichloroanilines were obtained as minor products from the chlorination of 2-chloro[ 14 C]aniline, likewise 2,4,5-trichloroaniline was obtained from 4-chloro[ 14 C]aniline. The [ 14 C]anilines prepared were coupled with benzene, 1,4-dichloro-, 1,2-dichloro- or 1,3-dichlorobenzene to give 4-chloro-, 2,3',4',5-tetrachloro-, 2,3,3',4'-tetrachloro-, 3,3',4,4'-tetrachloro-, 2,2',5,5'-tetrachloro-, 2,2',3,3'-tetrachloro-, 2,2',3,5',6-pentachloro-, 2,2',4,4',5-pentachloro- and 2,3',4,5,5'-pentachloro[ 14 C]biphenyl. 3,4-Dichloro[ 14 C]aniline and biphenyls prepared from this aniline were found to be contaminated by bromoanalogues. The origin of these have been studied. (author)
Analysis and application of heavy isotopes in the environment
Steier, Peter; Dellinger, Franz; Forstner, Oliver; Golser, Robin; Knie, Klaus; Kutschera, Walter; Priller, Alfred; Quinto, Francesca; Srncik, Michaela; Terrasi, Filippo; Vockenhuber, Christof; Wallner, Anton; Wallner, Gabriele; Wild, Eva Maria
2010-04-01
A growing number of AMS laboratories are pursuing applications of actinides. We discuss the basic requirements of the AMS technique of heavy (i.e., above ˜150 amu) isotopes, present the setup at the Vienna Environmental Research Accelerator (VERA) which is especially well suited for the isotope 236U, and give a comparison with other AMS facilities. Special emphasis will be put on elaborating the effective detection limits for environmental samples with respect to other mass spectrometric methods. At VERA, we have carried out measurements for radiation protection and environmental monitoring ( 236U, 239,240,241,242,244Pu), astrophysics ( 182Hf, 236U, 244Pu, 247Cm), nuclear physics, and a search for long-lived super-heavy elements ( Z > 100). We are pursuing the environmental distribution of 236U, as a basis for geological applications of natural 236U.
Analysis and application of heavy isotopes in the environment
International Nuclear Information System (INIS)
Steier, Peter; Dellinger, Franz; Forstner, Oliver; Golser, Robin; Knie, Klaus; Kutschera, Walter; Priller, Alfred; Quinto, Francesca; Srncik, Michaela; Terrasi, Filippo; Vockenhuber, Christof; Wallner, Anton; Wallner, Gabriele; Wild, Eva Maria
2010-01-01
A growing number of AMS laboratories are pursuing applications of actinides. We discuss the basic requirements of the AMS technique of heavy (i.e., above ∼150 amu) isotopes, present the setup at the Vienna Environmental Research Accelerator (VERA) which is especially well suited for the isotope 236 U, and give a comparison with other AMS facilities. Special emphasis will be put on elaborating the effective detection limits for environmental samples with respect to other mass spectrometric methods. At VERA, we have carried out measurements for radiation protection and environmental monitoring ( 236 U, 239,240,241,242,244 Pu), astrophysics ( 182 Hf, 236 U, 244 Pu, 247 Cm), nuclear physics, and a search for long-lived super-heavy elements (Z > 100). We are pursuing the environmental distribution of 236 U, as a basis for geological applications of natural 236 U.
The effect of transport density and gender on stress indicators and carcass and meat quality in pigs
Energy Technology Data Exchange (ETDEWEB)
Pereira, T.L.; Corassa, A.; Komiyama, C. M.; Araújo, C.V.; Kataoka, A.
2015-07-01
A total of 168 finishing pigs were used to investigate the effects of gender (barrows and gilts) and transport densities for slaughter (236, 251, and 275 kg/m²) on stress indicators and carcass and pork quality. The animals transported at 251 kg/m² (T251) presented cortisol values below those at 236 kg/m2 (T236), but no different from those at 275 kg/m2 (T275). The lactate dehydrogenase (LDH) values in pigs transported at T236 were the lowest. The blood components did not differ between T236 and T275. The pH values at 45 min (pH45) and at 24 h (pH24) postmortem were higher for pigs subjected to T236. However, the pH45 was higher at T251 than at T275, but pH24 was lower at T251 than at T275. The lightness values in the muscles of the pigs transported at T236 and T251 were higher than those at T275. Lower drip loss values were observed in the muscle of animals at T251. Carcasses of pigs at T236 contained more 1–5 cm lesions while those at T275 contained more 5–10 cmlesions in sections of loin. No significant effects of gender were found on the stress indicators, blood components, pH45, pH24, color, drip loss or carcass lesions in general. These results indicate that the pre-slaughter transport of pigs at densities of 251 kg/m² generates less physiological damage and smaller losses on carcass and pork quality irrespective of gender. (Author)
Search for EC-decayed neutron-deficient actinide isotopes using gas-jet coupled JAERI-ISOL
Energy Technology Data Exchange (ETDEWEB)
Tsukada, Kazuaki [Japan Atomic Energy Research Inst., Tokai, Ibaraki (Japan). Tokai Research Establishment
1997-07-01
To study the nuclear properties of unknown neutron deficient actinide isotopes which decay mainly via orbital electron capture (EC), we have developed a composite system consisting of a gas-jet transport apparatus and a thermal ion-source at the JAERI-ISOL. With this system, search for {sup 236}Am produced in the {sup 235}U({sup 6}Li, 5n) reaction has been performed. Pu KX-rays associated with the EC decay of {sup 236}Am are observed at the mass-236 fraction. The half-life of {sup 236}Am is evaluated to be 4.4min. The outline of the gas-jet coupled JAERI-ISOL system and typical performance are given. (author)
International Nuclear Information System (INIS)
Behrens, R.G.; Roth, S.B.; Jones, S.R.
1991-01-01
Los Alamos National Laboratory is a multidisciplinary R ampersand D organization and, as such, its nuclear materials inventory is diverse. Accordingly, major inventories of isotopes such as Pu-238, Pu-239, Pu-242, U-235, Th, tritium, and deuterium, and lesser amounts of isotopes of Am, Cm, Np and exotic isotopes such as berkelium must be managed in accordance with Department of Energy Orders and Laboratory policies. Los Alamos also acts as a national resource for many one-of-a-kind materials which are supplied to universities, industry, and other government agencies within the US and throughout the world. Management of these materials requires effective interaction and communication with many nuclear materials custodians residing in over forty technical groups as well as effective interaction with numerous outside organizations. This paper discusses the role, philosophy, and organizational structure of Nuclear Materials Management at Los Alamos and also briefly presents results of two special nuclear materials management projects: 1- Revision of Item Description Codes for use in the Los Alamos nuclear material data base and 2- The recommendation of new economic discard limits for Pu-239. 2 refs., 1 fig
Effect of dietary supplements in American bullfrogs reared in low and high stocking densities
Directory of Open Access Journals (Sweden)
Jorgina Juliana Gradisse Freitas
2017-11-01
Full Text Available The aim of this study was to evaluate the effect of the probiotic Bacillus subtillis and beta-glucan from the fungus Agaricus blazei on survival, growth and immunological capacity in bullfrogs (Lithobates catesbeianus cultured in low and high stocking densities. Animals weighing 24.3 ± 2.38 g were randomly distributed into four treatments with four simultaneous replicates: D100: 100 frogs/m2 (control; D236: 236 frogs/m2; D236 + Prob.: 236 frogs/m2 supplemented with probiotic; and D236 + BG: 236 frogs/m2 supplemented with beta-glucan. The parameters evaluated were weight gain, survival, plasma corticosterone (CORT, phagocytic capacity (PC and phagocytic index (PI, at 24 h and 15 and 30 days. There is significant interaction between treatments and time for CORT levels. At 30 days, these values were very close for the D100 (control and D236 + BG groups. Meanwhile, no statistical differences were observed between treatments for PC and PI. These results indicate that beta-glucan reduced the effects of stress caused by high density in bullfrogs, but the probiotic did not reduce these effects. Both compounds are not efficient at increasing survival rates, weight gain and neither immune response of animals. Thus, the use of commercial food additives may not have the favorable impact desired by the farmer. Their use in aquaculture should be further studied in experiments involving a longer trial period and taking into account the cost of their use.
Energy Technology Data Exchange (ETDEWEB)
Meadows, J.W.
1986-12-01
The measurement of the fission cross section ratios of nine isotopes relative to /sup 235/U at an average neutron energy of 14.74 MeV is described with particular attention to the determination of corrections and to sources of error. The results are compared to ENDF/B-V and to other measurements of the past decade. The ratio of the neutron induced fission cross section for these isotopes to the fission cross section for /sup 235/U are: /sup 230/Th - 0.290 +- 1.9%; /sup 232/Th - 0.191 +- 1.9%; /sup 233/U - 1.132 +- 0.7%; /sup 234/U - 0.998 +- 1.0%; /sup 236/U - 0.791 +- 1.1%; /sup 238/U - 0.587 +- 1.1%; /sup 237/Np - 1.060 +- 1.4%; /sup 239/Pu - 1.152 +- 1.1%; /sup 242/Pu - 0.967 +- 1.0%. 40 refs., 11 tabs., 9 figs.
Ebner, Jennifer; Aşçı Arslan, Ayşe; Fedorova, Maria; Hoffmann, Ralf; Küçükçetin, Ahmet; Pischetsrieder, Monika
2015-03-18
Kefir has a long tradition in human nutrition due to its presupposed health promoting effects. To investigate the potential contribution of bioactive peptides to the physiological effects of kefir, comprehensive analysis of the peptide profile was performed by nano-ESI-LTQ-Orbitrap MS coupled to nano-ultrahigh-performance liquid chromatography. Thus, 257 peptides were identified, mainly released from β-casein, followed by αS1-, κ-, and αS2-casein. Most (236) peptides were uniquely detected in kefir, but not in raw milk indicating that the fermentation step does not only increase the proteolytic activity 1.7- to 2.4-fold compared to unfermented milk, but also alters the composition of the peptide fraction. The influence of the microflora was determined by analyzing kefir produced from traditional kefir grains or commercial starter culture. Kefir from starter culture featured 230 peptide sequences and showed a significantly, 1.4-fold higher proteolytic activity than kefir from kefir grains with 127 peptides. A match of 97 peptides in both varieties indicates the presence of a typical kefir peptide profile that is not influenced by the individual composition of the microflora. Sixteen of the newly identified peptides were previously described as bioactive, including angiotensin-converting enzyme (ACE)-inhibitory, antimicrobial, immunomodulating, opioid, mineral binding, antioxidant, and antithrombotic effects. The present study describes a comprehensive peptide profile of kefir comprising 257 sequences. The peptide list was used to identify 16 bioactive peptides with ACE-inhibitory, antioxidant, antithrombotic, mineral binding, antimicrobial, immunomodulating and opioid activity in kefir. Furthermore, it was shown that a majority of the kefir peptides were not endogenously present in the raw material milk, but were released from milk caseins by proteases of the microbiota and are therefore specific for the product. Consequently, the proteolytic activity and the
2010-01-01
... analysis to determine the most economical approach. (5) To foster greater economy and efficiency, grantees... characteristics and standards to which it must conform if it is to satisfy its intended use. Detailed product... grantee or subgrantee desires to have the review accomplished after a solicitation has been developed, the...
BDML Metadata: 236 [SSBD[Archive
Lifescience Database Archive (English)
Full Text Available BY-NC-SA 0.150 0ec11f69-8817-4c7f-94cf-8973a5da1081 0.105 x 0.105 x 0.5 (micrometer), 40 (second) http://ssbd.qbic.riken.jp/data.../source/Ce_KK_P002/RNAi_W06F12.1a_070215_02/ http://ssbd.qbic.riken.jp/data.../bdml/Ce_KK_P002/RNAi_W06F12.1a_070215_02.bdml0.15.xml http://ssbd.qbic.riken.jp/data/pdpml/C...e_KK_P002.pdpml0.05.xml http://ssbd.qbic.riken.jp/search/0ec11f69-8817-4c7f-94cf-8973a5da1081/ http://ssbd.qbic.riken.jp/omero/webclient/?show=dataset-168 ...
2010-10-01
... circuit, except circuits which include any track rail and except the common return wires of single-wire, single-break, signal control circuits using a grounded common, and alternating current power distribution...
2010-10-01
... the site-specific application programs, run timers, read inputs, drive outputs, perform self... validation process is to determine “whether the correct product was built.” Verification means the process of... established at the start of that phase. The goal of the verification process is to determine “whether the...
49 CFR 236.1003 - Definitions.
2010-10-01
... auxiliary or industry tracks, a segment or route of railroad tracks: (1) Of a Class I railroad, as.... Tourist, scenic, historic, or excursion operations as defined in part 238 of this chapter are not...
Zero-ODP Refrigerants for Low Tonnage Centrifugal Chiller Systems
National Research Council Canada - National Science Library
Gui, Fulin
1996-01-01
..., HFC-236cb, HFC-236fa, HFC-245cb, and HFC-254cb, for centrifugal chiller applications. We took into account the thermodynamic properties of the refrigerant and aerodynamic properties of the impeller compression process to this evaluation...
International Nuclear Information System (INIS)
Mireshghi, A.
1982-12-01
We have searched for back-decay gamma rays from the shape isomeric states in 235 U, 236 U, and 238 U possibly excited in muon radiationless transition. The energies and intensities of gamma rays following muon atomic capture were measured as a function of time after muon stopping. Background was suppressed by requiring that the candidate gamma ray be followed by another gamma ray (μ-capture gamma ray). The prompt gamma-ray spectra included the U-muonic x rays. The measured 235 U and 238 U x-ray energies were in good agreement with previously reported results. The x-ray spectrum from 236 U has not been previously reported. The 236 U spectrum is very similar to that of 238 U, except that the K x-rays exhibit an isotope shift of approximately 20 keV, the 236 U energies being higher. In the analysis of the delayed spectra of 236 U and 238 U using the GAMANL peak searching program, and with an effective lower-limit detection efficiency of .15% per stopping muon, no candidate gamma rays for the back decay transitions from the shape isomeric state were observed
Deprese v dětství a její vztah k problémům chování
Czech Academy of Sciences Publication Activity Database
Čermák, Ivo; Klimusová, Helena; Vízdalová, H.
2005-01-01
Roč. 49, 223-236 (2005), s. 223-236 ISSN 0009-062X Institutional research plan: CEZ:AV0Z70250504 Keywords : child´s depression * behavior disorder s * CBCL * CDI Subject RIV: AN - Psychology Impact factor: 0.241, year: 2005
International Nuclear Information System (INIS)
Armbruster, P.; Hessberger, F.P.
1998-01-01
In the last 60 years physicists have created 20 artificial elements beyond uranium. In 1934 Enrico Fermi predicted the creation of new elements by bombarding atoms with neutrons. This method led to the discovery of neptunium (Z=93), plutonium, americium, curium, berkelium, californium, einsteinium and fermium (Z=100). In fact the capture of a neutron is followed by a beta-decay which increases the atomic number (Z) by one unit. Beyond Z=100 beta-decay no more occurs so a new approach was necessary. Between the American Lawrence Berkeley Laboratory and the Russian Dubna Institute a fierce competition broke out to produce new elements by bombarding transuranium nuclei with light elements such as helium, carbon, nitrogen. This new method required heavy equipment: ion accelerator and detectors but led to the creation of all the elements from Z=101 to Z=106. A new idea was to provoke the fusion of heavy nuclei such as lead and bismuth with colliding argon, nickel or zinc ion beams. This method called 'cold fusion' opened the way to reach the nuclei beyond Z=107. In 1996 the element Z=112 was the last discovered. The next step could be the element Z=114 for which a particular stability is expected. (A.C.)
Characterization of a Viking Blade Fabricated by Traditional Forging Techniques
Vo, H.; Frazer, D.; Bailey, N.; Traylor, R.; Austin, J.; Pringle, J.; Bickel, J.; Connick, R.; Connick, W.; Hosemann, P.
2016-12-01
A team of students from the University of California, Berkeley, participated in a blade-smithing competition hosted by the Minerals, Metals, and Materials Society at the TMS 2015 144th annual meeting and exhibition. Motivated by ancient forging methods, the UC Berkeley team chose to fabricate our blade from historical smithing techniques utilizing naturally-occurring deposits of iron ore. This approach resulted in receiving the "Best Example of a Traditional Blade Process/Ore Smelting Technique" award for our blade named "Berkelium." First, iron-enriched sand was collected from local beaches. Magnetite (Fe3O4) was then extracted from the sand and smelted into individual high- and low-carbon steel ingots. Layers of high- and low-carbon steels were forge-welded together, predominantly by hand, to form a composite material. Optical microscopy, energy dispersive spectroscopy, and Vickers hardness mechanical testing were conducted at different stages throughout the blade-making process to evaluate the microstructure and hardness evolution during formation. It was found that the pre-heat-treated blade microstructure was composed of ferrite and pearlite, and contained many nonmetallic inclusions. A final heat treatment was performed, which caused the average hardness of the blade edge to increase by more than a factor of two, indicating a martensitic transformation.
Fluorescence and excitation spectra of Bk3+, Cf3+, and Es3+ ions in single crystals of LaCl3
International Nuclear Information System (INIS)
Hessler, J.P.; Caird, J.A.; Carnall, W.T.; Crosswhite, H.M.; Sjoblom, R.K.; Wagner, F. Jr.
1978-01-01
Dye laser techniques have been used to study the energy level structure of the heavier actinides in single crystals of lanthanum chloride. In the case of einsteinium, fluorescence was detected and measured from the following manifolds: J = 5 at 0.984 μm -1 , J = 4 at 1.572 μm -1 , J = 6 at 2.930 μm -1 . This fluorescence was observed to the five lowest manifolds: J = 8, 5, 7, 2, 6. For californium, fluorescence has been detected from the manifolds: J = 11/2 at 1.190 μm -1 , J = 7/2 at 1.389 μm -1 , J = 5/2 at 1.977 μm -1 . This fluorescence was observed to the three lowest manifolds: J = 15/2, 9/2, 11/2. The fluorescence manifolds of berkelium are J = 6 at 1.540 μm -1 , and J = 4 at 1.953 μm -1 . The three lowest manifolds, J = 6, 5, and 4, have been observed in fluorescence. Absorption spectra data have yielded crystal-field splitting measurements in the higher manifolds of Es + . The location of the manifolds in general confirmed earlier approximate free-ion level structure calculations based on assumed regularities in the energy level parameters derived from spectra of the actinide ions through Cf + . 2 figures
Major Rehabilitation of the Jetty System at the Mouth of the Columbia River
2012-06-01
coriacea (Testadines: Dermochelyidae) en playa Gandoca, Costa Rica (1990 a 1997). Revista de Biologia Tropical 47 (1-2):225-236. Chaloupka, M. 2001...coriacea (Testadines: Dermochelyidae) en playa Gandoca, Costa Rica (1990 a 1997). Revista de Biologia Tropical 47 145 (1-2):225-236. Chaloupka
Comparison of fission and capture cross sections of minor actinides
International Nuclear Information System (INIS)
Nakagawa, Tsuneo; Iwamoto, Osamu
2003-01-01
The fission and capture cross sections of minor actinides given in JENDL-3.3 are compared with other evaluated data and experimental data. The comparison was made for 32 nuclides of Th-227, 228, 229, 230, 233, 234, Pa-231, 232, 233, U-232, 234, 236, 237, Np-236, 237, 238, Pu-236, 237, 238, 242, 244, Am-241, 242, 242m, 243, Cm-242, 243, 244, 245, 246, 247 and 248. Given in the present report are figures of these cross sections and tables of cross sections at 0.0253 eV and resonance integrals. (author)
International Nuclear Information System (INIS)
Samhoun, K.
1976-01-01
The amalgamation of 5f elements from Am to Fm has been studied by using 241 Am, 244 Cm, 249 Bk, 249 Cf, 252 Cf, 253 Es, 254 Es, 252 Fm and 255 Fm with two electrochemical methods, radiocoulometry and radiopolarography, perfectly adapted to investigate extremely diluted solutions when the concentration of electroactive species is as low as 10 -16 M. The theory of radiocoulometry has been developed in the general cases of reversible and irreversible electrode process. It has been used to interpret the experimental data on the kinetic curves of amalgamation, and to estimate the standard rate constant of the electrode process in complexing medium (citric). On the other hand the radiopolarographic method has been applied to study the mechanism of reduction at the dropping mercury electrode of cations M 3+ in aqueous medium to the metal M with formation of amalgam. The results are exploited into two directions: 1- Acquisition of some data concerning the oxidation-reduction properties of elements from Am to Fm. Therefore the standard electrode E 0 [M(III-0)] potentials for Bk, Cf and Es, and the standard electrode E 0 [M(II-0)] potential for Fm are estimated and the relative stability of each oxidation state (from II to VII) of 5f elements is discussed; 2- Acquisition of unknown thermodynamic data on transcalifornium elements. Correlations between 4f and 5f elements are precised and some divergences appear for the second half of 4f and 5f series (i.e. for 65 [fr
Full Text Available ... Mask Fitting Review Demonstration FreeCPAPAdvice com - Duration: 7:36. TheLankyLefty27 101,237 views 7:36 6 Best CPAP Masks 2017 - Duration: 2:58. ... 2:58 Donn's Sleep Apnea Story - Duration: 2:36. schneiderjobs 7,691 views 2:36 Loading more ...
NCBI nr-aa BLAST: CBRC-OPRI-01-1405 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-OPRI-01-1405 ref|NP_477758.1| wsv236 [Shrimp white spot syndrome virus] gb|AAL...33240.1| wsv236 [shrimp white spot syndrome virus] gb|AAL89160.1| WSSV292 [shrimp white spot syndrome virus] NP_477758.1 2.4 29% ...
2010-04-26
... CFR part 236, as detailed below. [Docket Number FRA-2010-0081] Applicant: Mr. D. C. Francis, Canadian..., Illinois 60430. The Canadian National--North America (CN) seeks temporary relief from Sec. 236.301, where signals shall be provided, relative to CN's EJ&E Griffith Connection project involving the Matteson...
48 CFR 636.513 - Accident prevention.
2010-10-01
... CONTRACTING CONSTRUCTION AND ARCHITECT-ENGINEER CONTRACTS Contract Clauses 636.513 Accident prevention. (a) In... 48 Federal Acquisition Regulations System 4 2010-10-01 2010-10-01 false Accident prevention. 636... contracting activities shall insert DOSAR 652.236-70, Accident Prevention, in lieu of FAR clause 52.236-13...
Energy Technology Data Exchange (ETDEWEB)
Walsh, Jr., Richard M.; Polizzi, Samuel J.; Kadirvelraj, Renuka; Howard, Wesley W.; Wood, Zachary A. [Georgia
2015-03-17
The man o’ war (mow) phenotype in zebrafish is characterized by severe craniofacial defects due to a missense mutation in UDP-α-D-xylose synthase (UXS), an essential enzyme in proteoglycan biosynthesis. The mow mutation is located in the UXS dimer interface ~16 Å away from the active site, suggesting an indirect effect on the enzyme mechanism. We have examined the structural and catalytic consequences of the mow mutation (R236H) in the soluble fragment of human UXS (hUXS), which shares 93% sequence identity with the zebrafish enzyme. In solution, hUXS dimers undergo a concentration-dependent association to form a tetramer. Sedimentation velocity studies show that the R236H substitution induces the formation of a new hexameric species. Using two new crystal structures of the hexamer, we show that R236H and R236A substitutions cause a local unfolding of the active site that allows for a rotation of the dimer interface necessary to form the hexamer. The disordered active sites in the R236H and R236A mutant constructs displace Y231, the essential acid/base catalyst in the UXS reaction mechanism. The loss of Y231 favors an abortive catalytic cycle in which the reaction intermediate, UDP-α-D-4-keto-xylose, is not reduced to the final product, UDP-α-D-xylose. Surprisingly, the mow-induced hexamer is almost identical to the hexamers formed by the deeply divergent UXS homologues from Staphylococcus aureus and Helicobacter pylori (21% and 16% sequence identity, respectively). The persistence of a latent hexamer-building interface in the human enzyme suggests that the ancestral UXS may have been a hexamer.
Global weather variability affects avian phenology: a long-term analysis, 1881-2001
Czech Academy of Sciences Publication Activity Database
Hubálek, Zdeněk
2004-01-01
Roč. 53, č. 3 (2004), s. 227-236 ISSN 0139-7893 R&D Projects: GA AV ČR(CZ) KSK6005114 Keywords : migratory birds * spring arrival * North Atlantic Oscillation Subject RIV: EG - Zoology Impact factor: 0.536, year: 2004 http://www.ivb.cz/folia/53/3/227-236.pdf
International Nuclear Information System (INIS)
Boulyga, S.F.; Becker, J.S.
2000-01-01
As a result of the accident at the Chernobyl nuclear power plant (NPP) the environment was contaminated with spent nuclear fuel. The 236 U isotope was used in this study to monitor the spent uranium from nuclear fallout in soil samples collected in the vicinity of the Chernobyl NPP. A rapid and sensitive analytical procedure was developed for uranium isotopic ratio measurement in environmental samples based on inductively coupled plasma quadrupole mass spectrometry with a hexapole collision cell (HEX-ICP-QMS). The figures of merit of the HEX-ICP-QMS were studied with a plasma-shielded torch using different nebulizers (such as an ultrasonic nebulizer (USN) and Meinhard nebulizer) for solution introduction. A 238 U + ion intensity of up to 27000 MHz/ppm in HEX-ICP-QMS with USN was observed by introducing helium into the hexapole collision cell as the collision gas at a flow rate of 10 ml min -1 . The formation rate of uranium hydride ions UH + /U + of 2 x 10 -6 was obtained by using USN with a membrane desolvator. The limit of 236 U/ 238 U ratio determination in 10 μg 1 -1 uranium solution was 3 x 10 -7 corresponding to the detection limit for 236 U of 3 pg 1 -1 . The precision of uranium isotopic ratio measurements in 10 μg 1 -1 laboratory uranium isotopic standard solution was 0.13% ( 235 U/ 238 U) and 0.33% ( 236 U/ 238 U) using a Meinhard nebulizer and 0.45% ( 235 U/ 238 U) and 0.88% ( 236 U/ 238 U) using a USN. The isotopic composition of all investigated Chernobyl soil samples differed from those of natural uranium; i.e. in these samples the 236 U/ 238 U ratio ranged from 10 -5 to 10 -3 . (orig.)
Determination of irradiated uranium in far-field contaminated areas of Belarus
International Nuclear Information System (INIS)
Mironov, V.; Pribylev, S.; Hotchkis, M.; Child, D.
2006-01-01
The possibility of using U 236 as an indicator for irradiated uranium is shown. The sensitivity of AMS is high enough for measurements of 236 U/ 238 U ratios down to 10 -9 on micrograms of uranium and therefore for the detection of Chernobyl originated uranium in the remote regions of radioactive fallout. (authors)
The actinide beamline - A new AMS facility at ANTARES
International Nuclear Information System (INIS)
Hotchkis, M.A.C.; Lee, P.J.; Mino, N.
1998-01-01
At the ANTARES accelerator a new beamline has been commissioned, incorporating new magnetic and electrostatic analysers, to optimise the efficiency for Actinides detection by Accelerator Mass Spectrometry. The detection of Actinides, particularly the isotopic ratios of uranium and plutonium, provide unique signatures for nuclear safeguards purposes. We are currently engaged in a project to evaluate the application of AMS to the measurement of Actinides in environmental samples for nuclear safeguards. Measurement of 236 U is of particular interest as a means of tracing the anthropogenic component of uranium. 236 U is expected to be present in natural samples at an extremely low level ( 236 U: 238 U ratio ∼10 -10 ). It has recently been demonstrated that AMS has sufficient sensitivity to detect 236 U at this level. The principal components of the new beamline include: an electrostatic quadrupole, a 12 deg electrostatic deflector, a 90 deg electrostatic analyser, a multi-isotope detection system including ion counters and Faraday cups. The beamline was completed in September 1998 and initial tests have been performed with iodine samples
Czech Academy of Sciences Publication Activity Database
Brauner, Petr; Flachs, Pavel; Horáková, Olga; Pecina, Petr; Franssen-van Hal, N.; Rossmeisl, Martin; Keijer, J.; Houštěk, Josef; Kopecký, Jan
2005-01-01
Roč. 48, Supp.1 (2005), A236-A236 ISSN 0012-186X. [EASD Annual meting /41./. 10.09.2005-15.09.2005, Athens] R&D Projects: GA ČR GA303/05/2580; GA AV ČR KJB5011303 Institutional research plan: CEZ:AV0Z50110509 Keywords : biochemistry Subject RIV: FB - Endocrinology, Diabetology, Metabolism, Nutrition
24 CFR 236.710 - Qualified tenant.
2010-04-01
..., the income of the individual or family must be determined to be too low to permit the individual or... consent forms for the obtaining of wage and claim information from State Wage Information Collection...
Publications | Page 236 | IDRC - International Development ...
International Development Research Centre (IDRC) Digital Library (Canada)
... of Nicaragua) (restricted access). Over the last two decades indigenous peoples in the Latin American region have been struggling for state recognition of cultural difference and for the granting of collective rights. This dissertation explores the activism of indigenous women and their participation within indigenous socio-.
49 CFR 236.792 - Reservoir, equalizing.
2010-10-01
... Reservoir, equalizing. An air reservoir connected with and adding volume to the top portion of the equalizing piston chamber of the automatic brake valve, to provide uniform service reductions in brake pipe...
49 CFR 236.741 - Distance, stopping.
2010-10-01
... portion of railroad at its maximum authorized speed, will travel during a full service application of the brakes, between the point where such application is initiated and the point where the train comes to a...
17 CFR 256.236 - Taxes accrued.
2010-04-01
... credited with the amount of taxes accrued during the accounting period, corresponding debits being made to... be kept so as to show for each class of taxes the amount accrued, the basis for the accrual, the...
2010-10-01
... TRANSPORTATION RULES, STANDARDS, AND INSTRUCTIONS GOVERNING THE INSTALLATION, INSPECTION, MAINTENANCE, AND REPAIR OF SIGNAL AND TRAIN CONTROL SYSTEMS, DEVICES, AND APPLIANCES Interlocking Rules and Instructions... derail and displaying an aspect indicating stop cannot be operated to display a less restrictive aspect...
2010-01-01
..., that uses or intends to use live animals in research, tests, experiments, or for teaching. Each... names and the numbers of animals upon which teaching, research, experiments, or tests were conducted... animals upon which experiments, teaching, research, surgery, or tests were conducted involving...
Determination of enrichment of recycle uranium fuels for different burnup values
International Nuclear Information System (INIS)
Zabunoglu, Okan H.
2008-01-01
Uranium (U) recovered from spent LWR fuels by reprocessing, which contains small amounts of U-236, is to be enriched before being re-irradiated as the recycle U. During the enrichment of recovered U in U-235, the mass fraction of U-236 also increases. Since the existence of U-236 in the recycle U has a negative effect on neutron economy, a greater enrichment of U-235 in the recycle U is required for reaching the same burnup as can be reached by the fresh U fuel. Two burnup values play the most important role in determining the enrichment of recycle U: (1) discharge burnup of spent fuel from which the recycle U is obtained and (2) desired discharge burnup of the recycle U fuel. A step-by-step procedure for calculating the enrichment of the recycle U as a function of these two burnup values is introduced. The computer codes MONTEBURNS and ORIGEN-S are made use of and a three-component (U-235, U-236, U-238) enrichment scheme is applied for calculating the amount of U-236 in producing the recycle U from the recovered U. As was aimed, the resulting expression is simple enough for quick/hand calculations of the enrichment of the recycle U for any given discharge burnup of spent fuel and for any desired discharge burnup of the recycle U fuel, most accurately within the range of 33,000-50,000 MWd/tonU
Gclust Server: 93636 [Gclust Server
Lifescience Database Archive (English)
Full Text Available 93636 OSA_Os02g0125100 Cluster Sequences Related Sequences(236) 514 no annotation 1... 1.00e-28 14.29 0.0 0.0 0.0 0.0 0.0 Show 93636 Cluster ID 93636 Sequence ID OSA_Os02g0125100 Link to cluster... sequences Cluster Sequences Link to related sequences Related Sequences(236) Sequence length 514 Representa
The Transplutonium. The superheavy nuclei found in the micas of Madagascar and their interests
International Nuclear Information System (INIS)
Raoelina Andriambololona
1976-01-01
Since June 1976, evidence for the existence of superheavy elements is discussed about. After having recalled artificial elements with atomic numbers Z of wich go from Z=95 (Americium) to Z=107 (built in 1976), superheavy elements having Z greater than 110 are considered. They have been discovered by american searchers in giant halos seen in Madagascar micas. The samples have been recoked in the Fort-Dauphin region (Haut Mandrare). The corresponding numbers Z are 114, 115, 116, 124, 125, 125, 126, 127. It seems that the existence of Z=126 element should be accepted with a greater degree of confidence. But different experiences done by other groups seem to show the evidence of superheavy elements in micas looks weaker. Nevertheless, it is interesting to investigate the evidence or the non-evidence of those elements. We estimate the mass numbers A of those superheavy elements in the liquid drop model if we assume that they are stable versus β. The results thus obtained agree with the shell-model ones within 4 % approximation. We propose if the evidence of superheavies is confirmed to give the name of madagascarium to one of them (Z=126) by similitude with francium, lutetium, polonium, berkelium, americium, europium, ...Their evidence was first conjectured in Madagascar micas in 1976. Superheavy nuclei are to be distinguished from hypernuclei. [fr
Quasar-Lyman α forest cross-correlation from BOSS DR11: Baryon Acoustic Oscillations
Energy Technology Data Exchange (ETDEWEB)
Font-Ribera, Andreu [Institute of Theoretical Physics, University of Zurich, Winterthurerstrasse 190, 8057 Zurich (Switzerland); Kirkby, David; Blomqvist, Michael [Department of Physics and Astronomy, University of California, 4129 Frederick Reines Hall, Irvine, CA, 92697 (United States); Busca, Nicolas; Aubourg, Éric; Bautista, Julian [APC, Université Paris Diderot-Paris 7, CNRS/IN2P3, CEA, Observatoire de Paris, 10, rue A. Domon and L. Duquet, Paris (France); Miralda-Escudé, Jordi [Institut de Ciències del Cosmos (IEEC/UB), Martí i Franquès 1, Barcelona, 08028 Catalonia (Spain); Ross, Nicholas P.; Bailey, Stephen; Beutler, Florian; Carithers, Bill [Lawrence Berkeley National Laboratory, 1 Cyclotron Road, Berkeley, CA (United States); Slosar, Anže [Brookhaven National Laboratory, Blgd 510, Upton, NY, 11375 (United States); Rich, James; Delubac, Timothée [CEA, Centre de Saclay, IRFU, Gif-sur-Yvette, 91191 France (France); Bhardwaj, Vaishali; Bizyaev, Dmitry [Department of Astronomy, University of Washington, Box 351580, Seattle, WA, 98195 (United States); Brewington, Howard; Brinkmann, Jon [Apache Point Observatory and New Mexico State University, P.O. Box 59, Sunspot, NM, 88349-0059 (United States); Brownstein, Joel R.; Dawson, Kyle S., E-mail: font@physik.uzh.ch [Department of Physics and Astronomy, University of Utah, 115 S 1400 E, Salt Lake City, UT, 84112 (United States); and others
2014-05-01
We measure the large-scale cross-correlation of quasars with the Lyα forest absorption, using over 164,000 quasars from Data Release 11 of the SDSS-III Baryon Oscillation Spectroscopic Survey. We extend the previous study of roughly 60,000 quasars from Data Release 9 to larger separations, allowing a measurement of the Baryonic Acoustic Oscillation (BAO) scale along the line of sight c/(H(z = 2.36)r{sub s}) = 9.0±0.3 and across the line of sight D{sub A}(z = 2.36)/r{sub s} = 10.8±0.4, consistent with CMB and other BAO data. Using the best fit value of the sound horizon from Planck data (r{sub s} = 147.49 Mpc), we can translate these results to a measurement of the Hubble parameter of H(z = 2.36) = 226±8 km s{sup −1} Mpc{sup −1} and of the angular diameter distance of D{sub A}(z = 2.36) = 1590±60 Mpc. The measured cross-correlation function and an update of the code to fit the BAO scale (baofit) are made publicly available.
AMS detection of actinides at high mass separation
Energy Technology Data Exchange (ETDEWEB)
Steier, Peter; Lachner, Johannes; Priller, Alfred; Winkler, Stephan; Golser, Robin [University of Vienna, Faculty of Physics, Vienna (Austria); Eigl, Rosmarie [Hiroshima University, Earth and Planetary Systems Science, Hiroshima (Japan); Quinto, Francesca [Institut fuer Nukleare Entsorgung, KIT, Eggenstein-Leopoldshafen (Germany); Sakaguchi, Aya [University of Tsukuba, Center for Research in Isotopes and Environmental Dynamics, Tsukuba (Japan)
2015-07-01
AMS is the mass spectrometric method with the highest abundance sensitivity, which is a prerequisite for measurement of the long-lived radioisotope {sup 236}U (t{sub 1/2}=23.4 million years). The most successful application so far is oceanography, since anthropogenic {sup 236}U is present in the world oceans at {sup 236}U:{sup 238}U from 10{sup -11} to 10{sup -8}. We have explored methods to increase the sensitivity and thus to reduce the water volume required to 1 L or less, which significantly reduces the sampling effort. High sensitivity is also necessary to address the expected typical natural isotopic ratios on the order {sup 236}U:{sup 238}U = 10{sup -13}, with potential applications in geology. With a second 90 analyzer magnet and a new Time-of-Flight beam line, VERA is robust against chemical impurities in the background, which e.g. allows measuring Pu isotopes directly in a uranium matrix. This simplifies chemical sample preparation for actinide detection, and may illustrate why AMS reaches lower detection limits than other mass spectrometric methods with nominally higher detection efficiency.
Liu, Xu; Li, Xiaoming; Gao, Lixin; Cui, Chuanming; Li, Chunshun; Li, Jia; Wang, Bingui
2011-05-01
Previously, we had characterized several structurally interesting brominated phenols from the marine red alga Symphyocladia latiuscula collected from various sites. However, Phytochemical investigations on this species collected from the Weihai coastline of Shandong Province remains blank. Therefore, we characterized the chemical constituents of individuals of this species collected from the region. Eight bromophenols were isolated and identified. Using detailed spectroscopic techniques and comparisons with published data, these compounds were identified as 2,3-dibromo-4,5-dihydroxybenzyl methyl ether ( 1), 3,5-dibromo-4-hydroxybenzoic acid ( 2), 2,3,6-tribromo-4,5-dihydroxymethylbenzene ( 3), 2,3,6-tribromo-4,5-dihydroxybenzaldehyde ( 4), 2,3,6-tribromo-4,5-dihydroxybenzyl methyl ether ( 5), bis(2,3,6-tribromo-4,5-dihydroxyphenyl)methane ( 6), 1,2-bis(2,3,6-tribromo-4,5-dihydroxyphenyl)-ethane ( 7), and 1-(2,3,6-tribromo-4,5-dihydroxybenzyl)-pyrrolidin-2-one ( 8). Among these compounds, 1 and 2 were isolated for the first time from S. latiuscula. Each compound was evaluated on the ability to inhibit protein tyrosine phosphatase 1B (PTP1B), which is a potential therapeutic target in the treatment of type 2 diabetes. Bromophenols 5, 6, and 7 showed strong activities with IC50 values of 3.9, 4.3, and 3.5 μmol/L, respectively. This study provides further evidence that bromophenols are predominant among the chemical constituents of Symphyocladia, and that some of these compounds may be candidates for the development of anti-diabetes drugs.
International Nuclear Information System (INIS)
1998-01-01
ER-20-6number s ign1 was cored to determine fracture and lithologic properties proximal to the BULLION test cavity. Selected samples from ER-20-6number s ign1 were subjected to matrix and/or fracture diffusion experiments to assess solute movement in this environment. Micrographic analysis of these samples suggests that the similarity in bulk chemical composition results in very similar mineral assemblages forming along natural fractures. These samples are all part of the mafic-poor Calico Hills Formation and exhibit fracture-coating mineral assemblages dominated by mixed illite/smectite clay and illite, with local opaline silica (2,236 and 2, 812 feet), and zeolite (at 2,236 feet). Based on this small sample population, the magnitude to which secondary phases have formed on fracture surfaces bears an apparently inverse relationship to the competency of the host lithology, reflected by variations in the degree of fracturing and the development of secondary phases on fracture surfaces. In the flow breccia at 2,851 feet, thinly developed, localized coatings are developed along persistent open fracture apertures in this competent rock type. Fractures in the devitrified lava from 2,812 feet are irregular, and locally blocked by secondary mineral phases. Natural fractures on the zeolitized tuff from 2,236 feet are discontinuous and irregular and typically obstructed with secondary mineral phases. There are also a second set of clean fractures in the 2,236 foot sample which lack secondary mineral phases and are interpreted to have been induced by the BULLION test. Based on these results, it is expected that matrix diffusion will be enhanced in samples where potentially transmissive fractures exhibit the greatest degree of obstruction (2,236>2,812=2,835>2,851). It is unclear what influence the induced fractures observed at 2,236 feet may have on diffusion given the lack of knowledge on their extent. It is assumed that the bulk matrix diffusion characteristics of the
Energy Technology Data Exchange (ETDEWEB)
Boulyga, S.F. [Forschungszentrum Juelich GmbH (Germany). Zentralabteilung fuer Chemische Analysen]|[Radiation Physics and Chemistry Problems Inst., Minsk (Belarus); Becker, J.S. [Forschungszentrum Juelich GmbH (Germany). Zentralabteilung fuer Chemische Analysen
2000-11-01
As a result of the accident at the Chernobyl nuclear power plant (NPP) the environment was contaminated with spent nuclear fuel. The {sup 236}U isotope was used in this study to monitor the spent uranium from nuclear fallout in soil samples collected in the vicinity of the Chernobyl NPP. A rapid and sensitive analytical procedure was developed for uranium isotopic ratio measurement in environmental samples based on inductively coupled plasma quadrupole mass spectrometry with a hexapole collision cell (HEX-ICP-QMS). The figures of merit of the HEX-ICP-QMS were studied with a plasma-shielded torch using different nebulizers (such as an ultrasonic nebulizer (USN) and Meinhard nebulizer) for solution introduction. A {sup 238}U{sup +} ion intensity of up to 27000 MHz/ppm in HEX-ICP-QMS with USN was observed by introducing helium into the hexapole collision cell as the collision gas at a flow rate of 10 ml min{sup -1}. The formation rate of uranium hydride ions UH{sup +}/U{sup +} of 2 x 10{sup -6} was obtained by using USN with a membrane desolvator. The limit of {sup 236}U/{sup 238}U ratio determination in 10 {mu}g 1{sup -1} uranium solution was 3 x 10{sup -7} corresponding to the detection limit for {sup 236}U of 3 pg 1{sup -1}. The precision of uranium isotopic ratio measurements in 10 {mu}g 1{sup -1} laboratory uranium isotopic standard solution was 0.13% ({sup 235}U/{sup 238}U) and 0.33% ({sup 236}U/{sup 238}U) using a Meinhard nebulizer and 0.45% ({sup 235}U/{sup 238}U) and 0.88% ({sup 236}U/{sup 238}U) using a USN. The isotopic composition of all investigated Chernobyl soil samples differed from those of natural uranium; i.e. in these samples the {sup 236}U/{sup 238}U ratio ranged from 10{sup -5} to 10{sup -3}. (orig.)
Anomalous isotope effects in the U(IV)-U(VI) exchange system
International Nuclear Information System (INIS)
Fujii, Yasuhiko; Nomura, Masao; Okamoto, Makoto; Onitsuka, Hatsuki; Nakanishi, Takashi.
1992-01-01
In previous papers, the enrichment of 236 U in the U(IV) - U(VI) chemical exchange system was found to be significantly smaller than the value estimated by the normal mass dependence enrichment of 235 U. Further experiments have been carried out in the present work to confirm the strange phenomenon of the isotopic anomaly in uranium enrichment. The results have indicated that the separation coefficient of 236 U is the same value as one previously reported. To confirm the anomaly of uranium isotope separation, α-ray spectrometry was implemented to check the enrichment behavior of 234 U. Although no theoretical explanation is given for the isotopic anomaly, this is favorable phenomenon for the re-enrichment of recycled uranium which contains isotopes 232 U and 236 U. (author)
We Bomb, Therefore We Are: The Evolution of Terrorist Group Life Cycles
1994-03-24
34 Political Socialization in Left-Wing Underground Organizations: Biographies of Italian and German Militants," International Social Movement Research... Political Socialization of Terrorist Groups in West Germany," Journal of Political and Military Sociology, v. 11, n. 2, Fall 1983, 236. See also Giorgio...Love?, 30-31. 7 Quoted in Wasmund, " Political Socialization ," 236. 88Irving L. Horowitz, "The Routinization of Terrorism and Its Unanticipated
Järve Keskus : Tallinn, Pärnu mnt. 236 = Järve Centre : 236 Pärnu Rd., Tallinn / Jaak Huimerind
Huimerind, Jaak, 1957-
2003-01-01
Projekteerija: Arhitektuuribüroo Studio Paralleel. Arhitektid Jaak Huimerind, Indrek Saarepera. Kaastöötajad Kristi Põldme, Indrek Laos, Reet Viigipuu. Avalike ruumide sisekujundus: Mari Kurismaa. Konstruktiivne osa: E-Inseneribüroo. Projekt 2000-2002, valmis 2002. Asendi-, I ja II korruse plaan, 6 vaadet
Prospects of Using Reprocessed Uranium in CANDU Reactors, in the U.S. GNEP Program
International Nuclear Information System (INIS)
Ellis, Ronald James
2007-01-01
Current Global Nuclear Energy Partnership (GNEP) plans envision reprocessing spent fuel (SF) with view to minimizing high-level waste (HLW) repository use and recovering actinides (U, Np, Pu, Am, and Cm) for transmutation in reactors as fuel and targets. The reprocessed uranium (RU), however, is to be disposed of. This paper presents a limited-scope analysis of possible reuse of RU in CANDU (Canada Deuterium Uranium) Reactors, within the context of the US GNEP program. Other papers on this topic submitted to this conference discuss the possibility of RU reuse in light-water reactors (LWRs) (with enrichment) and offer an independent economic analysis of RU reuse. A representative RU uranium 'vector', from reprocessed spent LWR fuel, comprises 98.538 wt% 238U, 0.46 wt% 236 U, 0.986 wt% 235 U, and 0.006 wt% 234 U. After multiple recyclings, the concentration of 234 U can approach 0.02 wt%. The presence of 234 U and 236 U in RU reduces the reactivity and fuel lifetime (exit burnup), which is particularly an issue in LWRs. While in PWR analyses, the burnup penalty caused by the concentration of 236 U in RU needs to be offset by additional 235 U enrichment in the amount of ∼25% to 30% of the weight percentage of the 236 U; however, the effect in CANDU is much smaller. Furthermore, since the 235 U content in RU exceeds that of natural uranium, CANDU offers the advantageous option of uranium recycling without reenrichment. The exit burnup of CANDU RU-derived fuel is considerably larger than that for natural uranium-fueled scenario, despite the presence of 234 U and 236 U.
Ternary fission of spontaneously fissile uranium isomers excited by neutrons
International Nuclear Information System (INIS)
Makarenko, V.E.; Molchanov, Y.D.; Otroshchenko, G.A.; Yan'kov, G.B.
1989-01-01
Spontaneously fissile isomers (SFI) of uranium were excited in the reactions 236,238 U(n,n') at an average neutron energy 4.5 MeV. A pulsed electrostatic accelerator and time analysis of the fission events were used. Fission fragments were detected by the scintillation method, and long-range particles from fission were detected by an ionization method. The relative probability of fission of nuclei through a spontaneously fissile isomeric state was measured: (1.30±0.01)·10 -4 ( 236 U) and (1.48±0.02)·10 -4 ( 238 U). Half-lives of the isomers were determined: 121±2 nsec (the SFI 236 U) and 267±13 nsec (the SFI 238 U). In study of the ternary fission of spontaneously fissile isotopes of uranium it was established that the probability of the process amounts to one ternary fission per 163±44 binary fissions of the SFI 236 U and one ternary fission per 49±14 binary fissions of the SFI 238 U. The substantial increase of the probability of ternary fission of SFI of uranium in comparison with the case of ternary fission of nuclei which are not in an isomeric state may be related to a special nucleon configuration of the fissile isomers of uranium
Some neutron and gamma radiation characteristics of plutonium cermet fuel for isotopic power sources
Neff, R. A.; Anderson, M. E.; Campbell, A. R.; Haas, F. X.
1972-01-01
Gamma and neutron measurements on various types of plutonium sources are presented in order to show the effects of O-17, O-18 F-19, Pu-236, age of the fuel, and size of the source on the gamma and neutron spectra. Analysis of the radiation measurements shows that fluorine is the main contributor to the neutron yields from present plutonium-molybdenum cermet fuel, while both fluorine and Pu-236 daughters contribute significantly to the gamma ray intensities.
49 CFR 236.909 - Minimum performance standard.
2010-10-01
...://www.archives.gov/federal_register/code_of_federal_regulations/ibr_locations.html; (ii) The product is... exposure must be expressed as total train miles traveled per year over the relevant railroad infrastructure...
49 CFR 236.552 - Insulation resistance; requirement.
2010-10-01
... ADMINISTRATION, DEPARTMENT OF TRANSPORTATION RULES, STANDARDS, AND INSTRUCTIONS GOVERNING THE INSTALLATION... resistance between wiring and ground of continuous inductive automatic cab signal system, automatic train...
48 CFR 852.236-87 - Accident prevention.
2010-10-01
... 48 Federal Acquisition Regulations System 5 2010-10-01 2010-10-01 false Accident prevention. 852... Accident prevention. As prescribed in 836.513, insert the following clause: Accident Prevention (SEP 1993) The Resident Engineer on all assigned construction projects, or other Department of Veterans Affairs...
33 CFR 236.5 - Policy and procedure.
2010-07-01
... manage when directly integrated with the implementation or management of the water resource development... created by a water resource development to be recommended for implementation by the Corps of Engineers. (3... DEFENSE WATER RESOURCE POLICIES AND AUTHORITIES: CORPS OF ENGINEERS PARTICIPATION IN IMPROVEMENTS FOR...
48 CFR 52.236-4 - Physical Data.
2010-10-01
..., such as surveys, auger borings, core borings, test pits, probings, test tunnels]. (b) Weather... fixed-price construction contract is contemplated and physical data (e.g., test borings, hydrographic...
48 CFR 852.236-91 - Special notes.
2010-10-01
... buildings, structures, and communications facilities, or other engineering projects, including furnishing... contracts), organization (including company officers), technical qualifications, financial resources and... system component having functional or physical characteristics different from those indicated or...
49 CFR 236.23 - Aspects and indications.
2010-10-01
... shown by the position of semaphore blades, color of lights, position of lights, flashing of lights, or... light, shape and color of semaphore blades or any combination thereof, subject to the following...; day aspects by lights or semaphore arms. A single white light shall not be used. (2) Reflector lenses...
Gender | Page 236 | IDRC - International Development Research ...
International Development Research Centre (IDRC) Digital Library (Canada)
“And I thought: I'm really not making the world a better place,” she says. ... and their full potential as citizens and equal partners in decision-making and development. ... Equity issues are again attracting attention from academics and policy ...
48 CFR 652.236-70 - Accident Prevention.
2010-10-01
..., toxic, reactive or unstable, or any operations which creates any kind of contamination inside an... be responsible for its subcontractors' compliance with this clause. (d) Written program. Before... develop a mutual understanding relative to administration of the overall safety program. (e) Notification...
48 CFR 452.236-77 - Emergency Response.
2010-10-01
... contracts: Emergency Response (NOV 1996) (a) Contractor's Responsibility for Fire Fighting. (1) The... emergency work (anticipated to be restricted to fire fighting). An equitable adjustment for the temporary... 48 Federal Acquisition Regulations System 4 2010-10-01 2010-10-01 false Emergency Response. 452...
2010-01-01
... relationship of this program to ongoing planning and development efforts. (3) The organizational structure for... research program techniques, and organizational structure for planning and conducting each program... separate concise statement describing specific extension projects to be funded under each program. The...
Poths, J.; Koepf, A.; Boulyga, S. F.
2008-12-01
The minor isotopes of uranium (U-233, U-234, U-236) are increasingly useful for tracing a variety of processes: movement of anthropogenic nuclides in the environment (ref 1), sources of uranium ores (ref 2), and nuclear material attribution (ref 3). We report on improved accuracy for U-234/238 and U-236/238 by supplementing total evaporation protocol TIMS measurement on Faraday detectors (ref 4)with multiplier measurement for the minor isotopes. Measurement of small signals on Faraday detectors alone is limited by noise floors of the amplifiers and accurate measurement of the baseline offsets. The combined detector approach improves the reproducibility to better than ±1% (relative) for the U-234/238 at natural abundance, and yields a detection limit for U-236/U-238 of <0.2 ppm. We have quantified contribution of different factors to the uncertainties associated with these peak jumping measurement on a single detector, with an aim of further improvement. The uncertainties in the certified values for U-234 and U-236 in the uranium standard NBS U005, if used for mass bias correction, dominates the uncertainty in their isotopic ratio measurements. Software limitations in baseline measurement drives the detection limit for the U-236/U-238 ratio. This is a topic for discussion with the instrument manufacturers. Finally, deviation from linearity of the response of the electron multiplier with count rate limits the accuracy and reproducibility of these minor isotope measurements. References: (1) P. Steier et al(2008) Nuc Inst Meth(B), 266, 2246-2250. (2) E. Keegan et al (2008) Appl Geochem 23, 765-777. (3) K. Mayer et al (1998) IAEA-CN-98/11, in Advances in Destructive and Non-destructive Analysis for Environmental Monitoring and Nuclear Forensics. (4) S. Richter and S. Goldberg(2003) Int J Mass Spectrom, 229, 181-197.
E, Guangqi; Drujon, Thierry; Correia, Isabelle; Ploux, Olivier; Guianvarc'h, Dominique
2013-12-01
We have produced and purified an active site mutant of the Escherichia coli cyclopropane fatty acid synthase (CFAS) by replacing the strictly conserved G236 within cyclopropane synthases, by a glutamate residue, which corresponds to E146 of the homologous mycolic acid methyltransferase, Hma, producing hydroxymethyl mycolic acids. The G236E CFAS mutant had less than 1% of the in vitro activity of the wild type enzyme. We expressed the G236E CFAS mutant in an E. coli (DE3) strain in which the chromosomal cfa gene had been deleted. After extraction of phospholipids and conversion into the corresponding fatty acid methyl esters (FAMEs), we observed the formation of cyclopropanated FAMEs suggesting that the mutant retained some of the normal activity in vivo. However, we also observed the formation of new C17 methyl-branched unsaturated FAMEs whose structures were determined using GC/MS and NMR analyses. The double bond was located at different positions 8, 9 or 10, and the methyl group at position 10 or 9. Thus, this new FAMEs are likely arising from a 16:1 acyl chain of a phospholipid that had been transformed by the G236E CFAS mutant in vivo. The reaction catalyzed by this G236E CFAS mutant thus starts by the methylation of the unsaturated acyl chain at position 10 or 9 yielding a carbocation at position 9 or 10 respectively. It follows then two competing steps, a normal cyclopropanation or hydride shift/elimination events giving different combinations of alkenes. This study not only provides further evidence that cyclopropane synthases (CSs) form a carbocationic intermediate but also opens the way to CSs engineering for the synthesis of non-natural fatty acids. Copyright © 2013 Elsevier Masson SAS. All rights reserved.
Morici, Eleonora; Simoni, Serena; Brenciani, Andrea; Giovanetti, Eleonora; Varaldo, Pietro E; Mingoia, Marina
2017-01-01
To investigate the genetic basis of catQ-mediated chloramphenicol resistance in Streptococcus agalactiae. Two clinical strains of catQ-positive chloramphenicol-resistant S. agalactiae (Sag236 and Sag403) were recently isolated, typed (MLST, PFGE pulsotypes, capsular types) and their antibiotic resistances investigated by phenotypic and genotypic approaches. Several molecular methods (PCR mapping, restriction assays, Southern blotting, sequencing and sequence analysis, conjugal transfer assays) were used to determine the genetic context of catQ and characterize a genetic element detected in the isolates. Sag236 and Sag403 shared the same ST (ST19), but exhibited a different capsular type (III and V, respectively) and pulsotype. Both harboured the macrolide resistance genes mef(I) and erm(TR) and the tetracycline resistance gene tet(M). Accordingly, they were resistant to chloramphenicol, erythromycin and tetracycline. catQ and mef(I) were associated in an IQ module that was indistinguishable in Sag236 and Sag403. In mating assays, chloramphenicol and erythromycin resistance proved transferable, at low frequency, only from Sag236. Transconjugants carried not only catQ and mef(I), but also erm(TR), suggesting a linkage of the three resistance genes in a mobile element, which, though seemingly non-mobile, was also detected in Sag403. The new element (designated ICESag236, ∼110 kb) results from recombination of two integrative and conjugative elements (ICEs) originally described in different streptococcal species: S. agalactiae ICESagTR7, carrying erm(TR); and Streptococcus pneumoniae ICESpn529IQ, carrying the prototype IQ module. These findings strengthen the notion that widespread streptococcal ICEs may form mosaics that enhance their diversity and spread, broaden their host range and carry new cargo genes. © The Author 2016. Published by Oxford University Press on behalf of the British Society for Antimicrobial Chemotherapy. All rights reserved. For Permissions
Radiochemical studies of neutron deficient actinide isotopes
International Nuclear Information System (INIS)
Williams, K.E.
1978-04-01
The production of neutron deficient actinide isotopes in heavy ion reactions was studied using alpha, gamma, x-ray, and spontaneous fission detection systems. A new isotope of berkelium, 242 Bk, was produced with a cross-section of approximately 10 μb in reactions of boron on uranium and nitrogen on thorium. It decays by electron capture with a half-life of 7.0 +- 1.3 minutes. The alpha-branching ratio for this isotope is less than 1% and the spontaneous fission ratio is less than 0.03%. Studies of (Heavy Ion, pxn) and (Heavy Ion, αxn) transfer reactions in comparison with (Heavy ion, xn) compound nucleus reactions revealed transfer reaction cross-sections equal to or greater than the compound nucleus yields. The data show that in some cases the yield of an isotope produced via a (H.I.,pxn) or (H.I.,αxn) reaction may be higher than its production via an xn compound nucleus reaction. These results have dire consequences for proponents of the ''Z 1 + Z 2 = Z/sub 1+2/'' philosophy. It is no longer acceptable to assume that (H.I.,pxn) and (H.I.,αxn) product yields are of no consequence when studying compound nucleus reactions. No evidence for spontaneous fission decay of 228 Pu, 230 Pu, 232 Cm, or 238 Cf was observed indicating that strictly empirical extrapolations of spontaneous fission half-life data is inadequate for predictions of half-lives for unknown neutron deficient actinide isotopes
International Nuclear Information System (INIS)
Moeser, Christina
2010-01-01
The development of a disposal in deep geological formations for radioactive waste is a very important task for the future. The safety assessment for more than a hundred thousand years needs a full understanding of all processes of interaction between the radioactive waste and the surrounded formations. This work contributes to this understanding. The interaction between lanthanides (homologues of the actinides americium, curium and berkelium) / uranium and the host rock opalinus clay under influence of organic substances (NOM) have been analyzed and discussed. The complex system was split into 3 binary basic systems with the following interactions - Interactions between lanthanides / uranium and NOM - Interactions between lanthanides / uranium and the opalinus clay - Interactions between NOM and opalinus clay All binary systems can be influenced by geological parameters like pH, ion strength and competing cations. The sorption / desorption of the lanthanides onto the opalinus clay is analyzed via inductively coupled plasma mass spectrometry. For the investigation of the complexation behavior of metals with NOM we used capillary electrophoresis coupled with inductively coupled plasma mass spectrometry. Under these conditions the chosen model organic humic acid affected the sorption of the lanthanides onto opalinus clay favorably. The smaller organic compounds, which dominate in the composition of the clay organics, remobilized the metals after sorption onto clay and the sorption can be inhibited by NOM. Due to the reduced metal sorption onto Opalinus clay by NOM, a migration through the clay may be possible.
Energy Technology Data Exchange (ETDEWEB)
Mayer, Klaus; Wallenius, Maria; Luetzenkirchen, Klaus [European Comission, Joint Research Centre (JRC), Karlsruhe (Germany). Inst. for Transuranium Elements (ITU); and others
2015-11-02
In the 1940ies in Germany studies using uranium in different geometries were started. Using the isotope ration Th-230/U-234 it was possible to determine the materials used in 1949-1943.The geographic origin was determined from trace amounts of rare earths. The uranium used in German research projects came from Czech uranium mines. Traces of U-236 and Pu-236 were found corresponding to the normal occurrence. This fact indicates that no significant neutron irradiation has occurred.
Developmental testing of partially volatile neutron shields for high-performance shipping casks
International Nuclear Information System (INIS)
Pope, R.B.; Allen, G.C.; Rack, H.J.; Joseph, B.J.; Dupree, S.A.
1980-01-01
Results of the phase one tests have demonstrated that the neutron-shielding concept described in this paper is a viable design option for spent fuel shipping casks. The tests have shown that the Boro-silicone 236 shield is superior to the other shield materials considered. Repeated TGA, aging and fire tests demonstrated the reliability of the data. A second phase of the test program is now being pursued where the Boro-silicone 236 is injected into all-steel slab sections, and cured in place. 5 tables
ORF Alignment: NC_002620 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available = 58 ... Query: 236 FIERMVDYYLDWAPLPSPMEAEQVGAAAAFLVSPLANAITGETLYVDHGANIMGIGPE 293 ... FIERMVDYYLDWAPLPSPME...AEQVGAAAAFLVSPLANAITGETLYVDHGANIMGIGPE Sbjct: 1 ... FIERMVDYYLDWAPLPSPMEAEQVGAAAAFLVSPLANAITGETLYVDHGANIMGIGPE 58
Indian Academy of Sciences (India)
2. 2.92. 2.44. 1.25. 2.54. 3.66. C57B3. 2.97. 2.44. 1.25. 2.54. 3.49. C60. LiAlH4. 2.91. 2.60. 1.64. 2.36. 3.37. C59B. 2.76. 2.63. 1.63. 2.36. 3.47. C58B2. 2.80. 2.64. 1.65. 2.32. 3.49. C57B3. 2.72. 2.61. 1.64. 2.32. 3.47. C60. LiBH4. 2.20. 2.20. 1.26.
Preparation of proton rich radionuclides in support of radiochemical analysis
International Nuclear Information System (INIS)
Jerome, Simon; Larijani, Cyrus; Parker, David
2012-01-01
The production of proton rich radionuclides supports a wide range of radiochemical analyses via radioactive yield tracers ( 95m Tc and 236 Pu). In recent years, NPL and the University of Birmingham cyclotron have collaborated to produce these, and other, radionuclides. - Highlights: ► In this paper we options for the production of Tc and Pu tracers. ► The irradiation and measurement of targets producing Tc-95 m and Pu-236 are described. ► Options for production are discussed. ► The results of this study and future work needed are described.
Radiation-hard silicon gate bulk CMOS cell family
International Nuclear Information System (INIS)
Gibbon, C.F.; Habing, D.H.; Flores, R.S.
1980-01-01
A radiation-hardened bulk silicon gate CMOS technology and a topologically simple, high-performance dual-port cell family utilizing this process have been demonstrated. Additional circuits, including a random logic circuit containing 4800 transistors on a 236 x 236 mil die, are presently being designed and processed. Finally, a joint design-process effort is underway to redesign the cell family in reduced design rules; this results in a factor of 2.5 cell size reduction and a factor of 3 decrease in chip interconnect area. Cell performance is correspondingly improved
Measurement of isotope shift of recycled uranium by laser induced fluorescence spectroscopy
International Nuclear Information System (INIS)
Oba, Masaki; Wakaida, Ikuo; Akaoka, Katsuaki; Miyabe, Masabumi
1999-07-01
Isotope shift of the recycled uranium atoms including the 236 U was measured by laser induced fluorescence method. Eight even levels at 2 eV and three odd levels at 4 eV were measured with isotope shifts among 238 U, 236 U and 235 U obtained. As for the measurement of the 4 eV levels, the Doppler free two photon absorption method was used, and the hyperfine structure of the 235 U was analyzed simultaneously. The isotope shift of 234 U was also observed in the three transition. (J.P.N.)
International Nuclear Information System (INIS)
Aleshin, M.; Elantyev, I.; Stebelkov, Y.
2015-01-01
Traditional method of the analysis implies simultaneous measuring of secondary ion currents of isotopes 234U + , 235U + , 238U + , ions with mass 236 amu (236U + and 235UH + ) and hydride ions 238UH + by using mass-spectrometer Cameca IMS1280 in multicollection mode. Calculating of uranium isotopic composition is performed using the results of 40 successive measurements of those currents (cycles). Duration of each measurement is 8 s. Small amounts of uranium minor isotopes are limitation for precise determination of their concentrations. To prevent the damage of the secondary ions detector the intensity of ion current should be no more than 5 x 10 5 s -1 . This limitation does not allow setting a higher primary ion current for the increasing of minor uranium isotopes ions emission because of the signal of ions 238U + gets too high. New technique is developed to improve the accuracy of determination of uranium minor isotopes concentrations. Process of measurement is divided on two steps. First step is a measurement of ion currents during 20 cycles by five detectors. The second step implies the elimination of ions 238U + hitting to the detector and 10 times increasing of primary ion current. The ratio 235U/238U is calculated from the first step results, so uncertainty of determination of this value is 1.4 times bigger than with duration of 40 cycles of the measurement. The ratios 234U/235U and 236U/235U are calculated during the second step. This technique allows to determine content of 234U and 236U with 3 and 5 times less uncertainties respectively, but with different degree of the sputtering particles. Moreover the duration of each cycle was set less (1 second) to use data more efficient. The technique accordingly with every second counting provides uncertainty of determination 236U concentration 4 times less than traditional method at the same degree of sputtering particles. (author)
Hayat, Nasir; Ameen, Muhammad Tahir; Tariq, Muhammad Kashif; Shah, Syed Nadeem Abbas; Naveed, Ahmad
2017-08-01
Exploitation of low potential waste thermal energy for useful net power output can be done by manipulating organic Rankine cycle systems. In the current article dual-objectives (η_{th} and SIC) optimization of ORC systems [basic organic Rankine cycle (BORC) and recuperative organic Rankine cycle (RORC)] has been done using non-dominated sorting genetic algorithm (II). Seven organic compounds (R-123, R-1234ze, R-152a, R-21, R-236ea, R-245ca and R-601) have been employed in basic cycle and four dry compounds (R-123, R-236ea, R-245ca and R-601) have been employed in recuperative cycle to investigate the behaviour of two systems and compare their performance. Sensitivity analyses show that recuperation boosts the thermodynamic behaviour of systems but it also raises specific investment cost significantly. R-21, R-245ca and R-601 show attractive performance in BORC whereas R-601 and R-236ea in RORC. RORC, due to higher total investment cost and operation & maintenance costs, has longer payback periods as compared to BORC.
Directory of Open Access Journals (Sweden)
R. Léguillon
2016-10-01
Full Text Available It is shown that the multinucleon transfer reactions is a powerful tool to study fission of exotic neutron-rich actinide nuclei, which cannot be accessed by particle-capture or heavy-ion fusion reactions. In this work, multinucleon transfer channels of the 18O+232Th reaction are used to study fission of fourteen nuclei 231,232,233,234Th, 232,233,234,235,236Pa, and 234,235,236,237,238U. Identification of fissioning nuclei and of their excitation energy is performed on an event-by-event basis, through the measurement of outgoing ejectile particle in coincidence with fission fragments. Fission fragment mass distributions are measured for each transfer channel, in selected bins of excitation energy. In particular, the mass distributions of 231,234Th and 234,235,236Pa are measured for the first time. Predominantly asymmetric fission is observed at low excitation energies for all studied cases, with a gradual increase of the symmetric mode towards higher excitation energy. The experimental distributions are found to be in general agreement with predictions of the fluctuation–dissipation model.
ORF Alignment: NC_004193 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available PVHFIQGDATEDDTIKKA Sbjct: 1 ... HFIFVGWNERTRQLMKLVLEYYPGRRIVVIDKTVNKLTYKEYPVHFIQGDATEDDTIKKA 60 ... Query: 236 TIIRSN...DFMSNLFFHELD 253 ... TIIRSNDFMSNLFFHELD Sbjct: 121 TIIRSNDFMSNLFFHELD 138
Lifescience Database Archive (English)
Full Text Available *vikqrlpri tlinyqlyhlisqiqhpihqw*islinsfksilivilkrlpvfwlqrn*eqskkptikal krvknyqnffnln*YLSSRPIDTWRLMSVHYQNYQH...kqywqvqmkrmhgkefwrdqrlqihiifpdyi*wmnimi*vikqrlpri tlinyqlyhlisqiqhpihqw*islinsfksilivilkrlpvfwlqrn*eqskkptikal
Crossflow Filtration: EM-31, WP-2.3.6
International Nuclear Information System (INIS)
Duignan, M.; Nash, C.; Poirier, M.
2011-01-01
In the interest of accelerating waste treatment processing, the DOE has funded studies to better understand filtration with the goal of improving filter fluxes in existing crossflow equipment. The Savannah River National Laboratory (SRNL) performed some of those studies, with a focus on start-up techniques, filter cake development, the application of filter aids (cake forming solid precoats), and body feeds (flux enhancing polymers). This paper discusses the progress of those filter studies. Crossflow filtration is a key process step in many operating and planned waste treatment facilities to separate undissolved solids from supernate solutions. This separation technology generally has the advantage of self-cleaning through the action of wall shear stress created by the flow of waste slurry through the filter tubes. However, the ability of filter wall self-cleaning depends on the slurry being filtered. Many of the alkaline radioactive wastes are extremely challenging to filtration, e.g., those containing compounds of aluminum and iron, which have particles whose size and morphology reduce permeability. Unfortunately, low filter flux can be a bottleneck in waste processing facilities such as the Savannah River Integrated Salt Disposition Process and the Hanford Waste Treatment Plant. Any improvement to the filtration rate would lead directly to increased throughput of the entire process. To date increased rates are generally realized by either increasing the crossflow filter feed flow rate, limited by pump capacity, or by increasing filter surface area, limited by space and increasing the required pump load. SRNL set up both dead-end and crossflow filter tests to better understand filter performance based on filter media structure, flow conditions, filter cleaning, and several different types of filter aids and body feeds. Using non-radioactive simulated wastes, both chemically and physically similar to the actual radioactive wastes, the authors performed several tests to evaluate methods to improve filter performance. With the proper use of filter flow conditions and filter enhancers, filter flow rates can be increased over rates currently realized today. Experiments that use non-radioactive simulants for actual waste always carry the inherent risk of not eliciting prototypic results; however, they will assist in focusing the scope needed to minimize radioactive testing and thus maximize safety. To that end this investigation has determined: (1) Waste simulant SB6 was found to be more challenging to filtration than a SRS Tank 8F simulant; (2) Higher solids concentration presents a greater challenge to filtration; (3) Filter cake is something that should be properly developed in initial filter operation; (4) Backpulsing is not necessary to maintain a good filter flux with salt wastes; (5) Scouring a filter without cleaning will lead to improved filter performance; (6) The presence of a filter cake can improve the solids separation by an order of magnitude as determined by turbidity; (7) A well developed cake with periodic scouring may allow a good filter flux to be maintained for long periods of time; and (8) Filtrate flux decline is reversible when the concentration of the filtering slurry drops and the filter is scoured.
8 CFR 236.1 - Apprehension, custody, and detention.
2010-01-01
... safety of other persons or of property. If an alien meets this burden, the alien must further demonstrate... Kiribati Kuwait Kyrgyzstan Malaysia Malta Mauritius Moldova Mongolia Nigeria Philippines Poland 4 4...
48 CFR 852.236-88 - Contract changes-supplement.
2010-10-01
... small tools, incidental job burdens, and general home office expenses and no separate allowance will be... contractor shall submit proposals for changes in work to the resident engineer. Proposals, to be submitted as..., labor costs (separated into trades), construction equipment, etc. (Labor costs are to be identified with...
49 CFR 236.907 - Product Safety Plan (PSP).
2010-10-01
... addressed during the life cycle of the product, including maximum threshold limits for each hazard (for... accordance with other criteria if demonstrated to the satisfaction of the Associate Administrator for Safety... contractor employees and supervisors necessary to ensure the safe and proper installation, implementation...
18 CFR 367.2360 - Account 236, Taxes accrued.
2010-04-01
..., the basis for the accrual, the accounts to which charged, and the amount of tax paid. ... accrued. (a) This account must be credited with the amount of taxes accrued during the accounting period... date of the balance sheet, must be shown under account 165, Prepayments (§ 367.1650). (b) If accruals...
49 CFR 236.701 - Application, brake; full service.
2010-10-01
... a split reduction in brake pipe pressure at a service rate until maximum brake cylinder pressure is developed. As applied to an automatic or electro-pneumatic brake with speed governor control, an application other than emergency which develops the maximum brake cylinder pressure, as determined by the design of...
49 CFR 236.205 - Signal control circuits; requirements.
2010-10-01
..., INSPECTION, MAINTENANCE, AND REPAIR OF SIGNAL AND TRAIN CONTROL SYSTEMS, DEVICES, AND APPLIANCES Automatic... car, (b) When points of a switch are not closed in proper position, (c) When an independently operated...
48 CFR 52.236-7 - Permits and Responsibilities.
2010-10-01
... obtaining any necessary licenses and permits, and for complying with any Federal, State, and municipal laws... negligence. The Contractor shall also be responsible for all materials delivered and work performed until...
42 CFR 456.236 - Continued stay review process.
2010-10-01
... (CONTINUED) MEDICAL ASSISTANCE PROGRAMS UTILIZATION CONTROL Utilization Control: Mental Hospitals Ur Plan... each continued stay of a recipient in the mental hospital, the committee, subgroup or designee reviews... committee, subgroup or designee finds that a recipient's continued stay in the mental hospital is needed...
CROSSFLOW FILTRATION: EM-31, WP-2.3.6
Energy Technology Data Exchange (ETDEWEB)
Duignan, M.; Nash, C.; Poirier, M.
2011-02-01
In the interest of accelerating waste treatment processing, the DOE has funded studies to better understand filtration with the goal of improving filter fluxes in existing crossflow equipment. The Savannah River National Laboratory (SRNL) performed some of those studies, with a focus on start-up techniques, filter cake development, the application of filter aids (cake forming solid precoats), and body feeds (flux enhancing polymers). This paper discusses the progress of those filter studies. Crossflow filtration is a key process step in many operating and planned waste treatment facilities to separate undissolved solids from supernate solutions. This separation technology generally has the advantage of self-cleaning through the action of wall shear stress created by the flow of waste slurry through the filter tubes. However, the ability of filter wall self-cleaning depends on the slurry being filtered. Many of the alkaline radioactive wastes are extremely challenging to filtration, e.g., those containing compounds of aluminum and iron, which have particles whose size and morphology reduce permeability. Unfortunately, low filter flux can be a bottleneck in waste processing facilities such as the Savannah River Integrated Salt Disposition Process and the Hanford Waste Treatment Plant. Any improvement to the filtration rate would lead directly to increased throughput of the entire process. To date increased rates are generally realized by either increasing the crossflow filter feed flow rate, limited by pump capacity, or by increasing filter surface area, limited by space and increasing the required pump load. SRNL set up both dead-end and crossflow filter tests to better understand filter performance based on filter media structure, flow conditions, filter cleaning, and several different types of filter aids and body feeds. Using non-radioactive simulated wastes, both chemically and physically similar to the actual radioactive wastes, the authors performed several tests to evaluate methods to improve filter performance. With the proper use of filter flow conditions and filter enhancers, filter flow rates can be increased over rates currently realized today. Experiments that use non-radioactive simulants for actual waste always carry the inherent risk of not eliciting prototypic results; however, they will assist in focusing the scope needed to minimize radioactive testing and thus maximize safety. To that end this investigation has determined: (1) Waste simulant SB6 was found to be more challenging to filtration than a SRS Tank 8F simulant; (2) Higher solids concentration presents a greater challenge to filtration; (3) Filter cake is something that should be properly developed in initial filter operation; (4) Backpulsing is not necessary to maintain a good filter flux with salt wastes; (5) Scouring a filter without cleaning will lead to improved filter performance; (6) The presence of a filter cake can improve the solids separation by an order of magnitude as determined by turbidity; (7) A well developed cake with periodic scouring may allow a good filter flux to be maintained for long periods of time; and (8) Filtrate flux decline is reversible when the concentration of the filtering slurry drops and the filter is scoured.
48 CFR 52.236-5 - Material and Workmanship.
2010-10-01
... specifically provided in this contract. References in the specifications to equipment, material, articles, or... equipment, material, article, or process that, in the judgment of the Contracting Officer, is equal to that... 48 Federal Acquisition Regulations System 2 2010-10-01 2010-10-01 false Material and Workmanship...
Lifescience Database Archive (English)
Full Text Available EVHVMGRIKKRPESYNPKFSFILDPD TITFFAMAIEVCDASTIYVEDHLDEACGAFLPGCFWCPWSSKLTREIKV*tirvklnss* lnliklnt*ifnnkvy*tkvfikk Frame B: ---pmvtimil...fsn*qipkkfkwpeifclerkamkfm*wvelkrdlkaiiqsfplfltqi qshflp
Prompt neutrons from {sup 236}U fission fragments
Energy Technology Data Exchange (ETDEWEB)
Boldeman, J W; Musgrove, A.R. de L.; Walsch, R L
1971-03-01
Measurements were made of prompt neutron emission in the thermal neutron fission of {sup 235}U. The mean neutron emission per fragment was obtained for particular values of the fragment mass and total kinetic energy. A direct neutron counting method was employed and a comparison made with data from previous experiments of this type. (author)
Radiochemical studies of neutron deficient actinide isotopes
Energy Technology Data Exchange (ETDEWEB)
Williams, K.E.
1978-04-01
The production of neutron deficient actinide isotopes in heavy ion reactions was studied using alpha, gamma, x-ray, and spontaneous fission detection systems. A new isotope of berkelium, /sup 242/Bk, was produced with a cross-section of approximately 10 ..mu..b in reactions of boron on uranium and nitrogen on thorium. It decays by electron capture with a half-life of 7.0 +- 1.3 minutes. The alpha-branching ratio for this isotope is less than 1% and the spontaneous fission ratio is less than 0.03%. Studies of (Heavy Ion, pxn) and (Heavy Ion, ..cap alpha..xn) transfer reactions in comparison with (Heavy ion, xn) compound nucleus reactions revealed transfer reaction cross-sections equal to or greater than the compound nucleus yields. The data show that in some cases the yield of an isotope produced via a (H.I.,pxn) or (H.I.,..cap alpha..xn) reaction may be higher than its production via an xn compound nucleus reaction. These results have dire consequences for proponents of the ''Z/sub 1/ + Z/sub 2/ = Z/sub 1+2/'' philosophy. It is no longer acceptable to assume that (H.I.,pxn) and (H.I.,..cap alpha..xn) product yields are of no consequence when studying compound nucleus reactions. No evidence for spontaneous fission decay of /sup 228/Pu, /sup 230/Pu, /sup 232/Cm, or /sup 238/Cf was observed indicating that strictly empirical extrapolations of spontaneous fission half-life data is inadequate for predictions of half-lives for unknown neutron deficient actinide isotopes.
Paul Scherrer Institute Scientific Report 1999. Volume I: Particles and Matter
International Nuclear Information System (INIS)
Gobrecht, J.; Gaeggeler, H.; Herlach, D.; Junker, K.; Kettle, P.-R.; Kubik, P.; Zehnder, A.
2000-01-01
Although originally planned for fundamental research in nuclear physics, the particle beams of pions, muons, protons and neutrons are now used in a large variety of disciplines in both natural science and medicine. The beams at PSI have the world's highest intensities and therefore allow certain experiments to be performed, which would not be possible elsewhere. The highlight of research this year was the first-ever determination of the chemical properties of the superheavy element 107 Bohrium. This was undertaken, by an international team led by H. Gaeggeler of PSI's Laboratory for Radiochemistry. Bohrium was produced by bombarding a Berkelium target with Neon ions from the Injector I cyclotron and six atoms were detected after having passed through an online gas chromatography device. At the Laboratory for Particle Physics the focus has shifted from nuclear physics to elementary particle physics with about a fifty-fifty split between investigations of rare processes or particle decays using the high intensity muon, pion and recently also polarized neutron beams of PSI, and research at the highest energy frontier at CERN (Geneva) and DESY (Hamburg). Important space instrumentation has been contributed by the Laboratory for Astrophysics to the European Space Agency and NASA satellite programmes. The Laboratory for Micro and Nanotechnology continued to focus on research into molecular nanotechnology and SiGeC nanostructures, the latter with the aim of producing silicon based optoelectronics. Progress in 1999 in these topical areas is described in this report. A list of scientific publications in 1999 is also provided
Paul Scherrer Institute Scientific Report 1999. Volume I: Particles and Matter
Energy Technology Data Exchange (ETDEWEB)
Gobrecht, J.; Gaeggeler, H.; Herlach, D.; Junker, K.; Kettle, P.-R.; Kubik, P.; Zehnder, A. [eds.
2000-07-01
lthough originally planned for fundamental research in nuclear physics, the particle beams of pions, muons, protons and neutrons are now used in a large variety of disciplines in both natural science and medicine. The beams at PSI have the world's highest intensities and therefore allow certain experiments to be performed, which would not be possible elsewhere. The highlight of research this year was the first-ever determination of the chemical properties of the superheavy element {sup 107} Bohrium. This was undertaken, by an international team led by H. Gaeggeler of PSI's Laboratory for Radiochemistry. Bohrium was produced by bombarding a Berkelium target with Neon ions from the Injector I cyclotron and six atoms were detected after having passed through an online gas chromatography device. At the Laboratory for Particle Physics the focus has shifted from nuclear physics to elementary particle physics with about a fifty-fifty split between investigations of rare processes or particle decays using the high intensity muon, pion and recently also polarized neutron beams of PSI, and research at the highest energy frontier at CERN (Geneva) and DESY (Hamburg). Important space instrumentation has been contributed by the Laboratory for Astrophysics to the European Space Agency and NASA satellite programmes. The Laboratory for Micro and Nanotechnology continued to focus on research into molecular nanotechnology and SiGeC nanostructures, the latter with the aim of producing silicon based optoelectronics. Progress in 1999 in these topical areas is described in this report. A list of scientific publications in 1999 is also provided.
Paul Scherrer Institute Scientific Report 1999. Volume I: Particles and Matter
Energy Technology Data Exchange (ETDEWEB)
Gobrecht, J; Gaeggeler, H; Herlach, D; Junker, K; Kettle, P -R; Kubik, P; Zehnder, A [eds.
2000-07-01
lthough originally planned for fundamental research in nuclear physics, the particle beams of pions, muons, protons and neutrons are now used in a large variety of disciplines in both natural science and medicine. The beams at PSI have the world's highest intensities and therefore allow certain experiments to be performed, which would not be possible elsewhere. The highlight of research this year was the first-ever determination of the chemical properties of the superheavy element {sup 107} Bohrium. This was undertaken, by an international team led by H. Gaeggeler of PSI's Laboratory for Radiochemistry. Bohrium was produced by bombarding a Berkelium target with Neon ions from the Injector I cyclotron and six atoms were detected after having passed through an online gas chromatography device. At the Laboratory for Particle Physics the focus has shifted from nuclear physics to elementary particle physics with about a fifty-fifty split between investigations of rare processes or particle decays using the high intensity muon, pion and recently also polarized neutron beams of PSI, and research at the highest energy frontier at CERN (Geneva) and DESY (Hamburg). Important space instrumentation has been contributed by the Laboratory for Astrophysics to the European Space Agency and NASA satellite programmes. The Laboratory for Micro and Nanotechnology continued to focus on research into molecular nanotechnology and SiGeC nanostructures, the latter with the aim of producing silicon based optoelectronics. Progress in 1999 in these topical areas is described in this report. A list of scientific publications in 1999 is also provided.
ORF Alignment: NC_006510 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available illus ... kaustophilus HTA426] ... Length = 72 ... Query: 236 MVERLAKTDDERKMMVSSIAHDIRT...PLTVIQGQIDLIQDLRKLDHFDVTPHLEIIRKNCG 295 ... MVERLAKTDDERKMMVSSIAHDIRTPLTVIQGQIDLIQDL...RKLDHFDVTPHLEIIRKNCG Sbjct: 1 ... MVERLAKTDDERKMMVSSIAHDIRTPLTVIQGQIDLIQDLRKLDHFDVTPHLEIIRKNCG 60 ...
ORF Alignment: NC_000117 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available pe D, strain ... UW3/Cx) ... Length = 58 ... Query: 236 FIERMVDYYQDWAPLPSPMEAEQVGAAAAFLVSPLASAITG...ETLYVDHGANVMGIGPE 293 ... FIERMVDYYQDWAPLPSPMEAEQVGAAAAFLVSPLASAITGETLYVDHGANVMGIGPE Sbjct: 1 ... FIERMVDYYQDWAPLPSPMEAEQVGAAAAFLVSPLASAITGETLYVDHGANVMGIGPE 58
Preparation of pure TiO2 sorption material
International Nuclear Information System (INIS)
Špendlíková, Irena; Raindl, Jakub; Němec, Mojmír
2013-01-01
Among the natural or anthropogenic radionuclides of very low concentrations nowadays measured in environmental samples, the radionuclide of 236 U has been recently included. In these ultra-trace analyses, the purity of sorption materials is very important and the traditional preparation procedures have to be optimized to minimize possible contamination. In the case of the determination of natural concentration of 236 U ( 236 U/ 238 U ∼ 10 -10 - 10 -14 ), the sample treatment procedure has to be modified in order to eliminate possible contamination from anthropogenic 236 U that may result even in more than ten thousand times higher 236 U/ 238 U ratios. Many inorganic and organic materials have been proposed for the extraction of uranium. However, only several of them are suitable for the uranium sorption from the solutions of low uranium concentration, but relatively high salt content, such as fresh water, sea water etc. At the same time they have to meet other limiting parameters such as fast kinetics, chemical stability, and low costs. Among the inorganic sorption materials, titanium dioxide has been studied for years with promising results. Titanium dioxides can be prepared via the hydrolysis of titanium compounds, either inorganic salts or organic derivatives, but their properties strongly depend on the preparation conditions. In classical procedures, titanium dioxides are prepared from commercial inorganic salts, such as sulphates or chlorides, or even from industrial intermediates of the titanium white production. Typically, the resulting titanium dioxides are contaminated with uranium already from the origin. Assuming that most organic compounds do not contain uranium and that it is possible to find 'uranium free' water, titanium dioxide free of uranium contamination could be prepared by the hydrolysis of organic titanium derivatives. The aim of this study was to find a suitable way of pure titanium dioxide preparation and to optimize the preparation
Directory of Open Access Journals (Sweden)
Emily Spayde
2017-01-01
Full Text Available A model to evaluate the performance of a solar powered regenerative Organic Rankine Cycle (R-ORC using five dry organic fluids: RC318, R227ea, R236ea, R236fa, and R218, is presented in this paper. The system is evaluated in two locations in the U.S.: Jackson, MS and Tucson, AZ. The weather data for each location is used to determine the heat available from the solar collector that could be used by the R-ORC to generate power. Results from the R-ORC performance are compared with a basic ORC using first and second law criteria as well as primary energy consumption (PEC and carbon dioxide emission (CDE savings for both locations. An economic analysis to determine the maximum capital cost for a desired payback period is presented in this paper. A parametric analysis is also performed to study the effect of the turbine efficiency as well as the open feed organic fluid heater intermediate pressure on the system performance. Results indicate that the R-ORC is able to generate more power than the basic ORC for some of the selected working fluids. For the R-ORC, R236ea is the working fluid that show the best performance among the evaluated fluids under the modeled conditions. On the other hand, the basic ORC with R236ea as the working fluid outperformed three of the fluids in the R-ORC. Also, the R-ORC evaluated in Tucson, AZ is able to generate more power, to provide more PEC and CDE savings, and had a higher available capital cost than the R-ORC evaluated in in Jackson, MS.
Energy Technology Data Exchange (ETDEWEB)
Auclair, J M; Hubert, P; Joly, R; Vendryes, G; Jacrot, B; Netter, F [Commissariat a l' Energie Atomique, Saclay (France). Centre d' Etudes Nucleaires; Galula, M [Centre National de la Recherche Scientifique (CNRS), 91 - Gif-sur-Yvette (France)
1955-07-01
It presents the experimental measurements of cross section of fissile nuclei for slow neutrons to improve the understanding of some heavy nuclei of great importance in the study of nuclear reactors. The different experiments are divided in three categories. In the first part, it studied the variation with energy of the cross sections of natural uranium, {sup 233}U, {sup 235}U and {sup 239}Pu. Two measurement techniques are used: the time-of-flight spectrometer and the crystal spectrometer. In a second part, the fission cross sections of {sup 233}U and {sup 239}Pu for thermal neutrons are compared using a neutron flux from EL-2 going through a double fission chamber. The matter quantity contained in each source is measured by counting the {alpha} activity with a solid angle counter. Finally, the average cross section of {sup 236}U for a spectra of neutrons from the reactor is measured by studying the {beta} activity of {sup 237}U formed by the reaction {sup 236}U (n, {gamma}) {sup 237}U in a sample of {sup 236}U irradiated in the Saclay reactor (EL-2). (M.P.)
Directory of Open Access Journals (Sweden)
Elena Camisasca
2014-05-01
Full Text Available The purpose of this study was to explore the mediating and moderating effects of parenting alliance on the relationship between marital adjustment, as represented by the dimensions dyadic consensus, dyadic satisfaction, dyadic cohesion, and affectional expression, and maternal and paternal stress. Self-report data were gathered from 236 Italian families (236 mothers: M = 40.9; SD = 4.4 and 236 fathers: M = 42.9; SD = 4.8 of children aged 6–11 years (M = 8.6; SD = 1.7. A set of regression analyses were conducted to examine whether parenting alliance mediates or moderates the relationship between marital adjustment and parenting stress. Regression analyses were consistent with a model of coparenting as a mediator but not as a moderator of the relationship between marital adjustment and parenting stress. In the case of mothers, parenting alliance mediates the relationships between two dimensions of marital adjustment (dyadic consensus and dyadic cohesion on parenting stress; in the case of fathers, parenting alliance serves as a mediator of the relationship between the marital adjustment (in terms of dyadic satisfaction and parenting stress. Implications for future research and interventions are discussed.
DEFF Research Database (Denmark)
Knudsen, T.B.; Gustafson, P.; Kronborg, G.
2005-01-01
Pre-treatment serum levels of sCD163 were measured in a cohort of 236 suspected tuberculosis (TB) cases from Guinea-Bissau, with a median follow-up period of 3.3 years (range 0-6.4 years). In 113 cases, the diagnosis of TB was verified by positive sputum microscopy and/or culture. Among the verif......Pre-treatment serum levels of sCD163 were measured in a cohort of 236 suspected tuberculosis (TB) cases from Guinea-Bissau, with a median follow-up period of 3.3 years (range 0-6.4 years). In 113 cases, the diagnosis of TB was verified by positive sputum microscopy and/or culture. Among...
ORF Alignment: NC_004317 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available ... falciparum 3D7] ... Length = 244 ... Query: 116 NKFIGNWINDKRNGLGFNIDIYKNIYYGYYENNLKNGWGYYKWSRKGSTY...EGNWIDNKMN 175 ... NKFIGNWINDKRNGLGFNIDIYKNIYYGYYENNLKNGWGYYKWSRKGSTYEGNWI...DNKMN Sbjct: 1 ... NKFIGNWINDKRNGLGFNIDIYKNIYYGYYENNLKNGWGYYKWSRKGSTYEGNWIDNKMN 60 ... Query: 236 ILPFNFIKINFKNIA
Directory of Open Access Journals (Sweden)
Priscilla Chamelete Andrade
2004-10-01
Full Text Available OBJETIVO: avaliar os resultados perinatais em gestantes com mais de 35 anos e verificar diferenças nos grupos entre 35 e 39 anos e acima de 40 anos. MÉTODOS: entre janeiro de 2000 e julho de 2003, realizou-se estudo retrospectivo por análise de fichas obstétricas de 3093 gestantes, excluindo-se 933 gestantes. As pacientes foram divididas em 3 grupos: 18 a 29 anos (grupo controle, 30 a 39 anos e mais de 40 anos. A coleta de dados foi realizada por meio de formulário padronizado e os dados foram transferidos para uma planilha eletrônica (Excel - Microsoft Office 2000. Para a análise estatística, foram utilizados o teste do chi2 e o teste de Fisher, sendo considerado risco a (alfa menor ou igual a 5% e intervalo de confiança de 95%. RESULTADOS: a via de parto mais utilizada para essas pacientes foi a cesárea, tanto no grupo de 35 a 39 anos (438/792; 55,3%, quanto nas gestantes com mais de 40 anos (153/236; 64,8%. A taxa de prematuridade (39/236; 16,5%, o baixo peso ao nascer (37/236; 15,7% e a restrição de crescimento fetal (38/236; 16,1% foram mais altas entre as gestantes tardias, com mais de 40 anos, com diferença significante em relação aos demais grupos. Quanto à ocorrência de óbito fetal, foi constatado nas gestantes de 40 anos incidência cinco vezes maior quando comparado aos outros grupos (diferença estatisticamente significante. CONCLUSÃO: a comparação entre o grupo de gestantes de 35 a 39 anos com o grupo controle apenas diferiu significantemente quanto ao índice de cesáreas, o que nos permite sugerir acompanhamento pré-natal diferenciado para o grupo de gestantes acima de 40 anos.PURPOSE: to evaluate perinatal results in pregnant women over 35 years old and to check differences between two groups: 35 to 39-year-old women and women older than 40. METHODS: a retrospective survey was made during the period between January/2000 and July/2003, through the analysis of obstetric charts of 3,093 pregnant women who
LENUS (Irish Health Repository)
2012-02-01
BACKGROUND: Polymorphoneutrophils (PMNs) are activated by inflammatory mediators following splanchnic ischemia\\/reperfusion (I\\/R), potentially injuring organs such as the lung. As a result, some patients develop respiratory failure following abdominal aortic aneurysm repair. Pulmonary cyclooxygenase (COX)-2 protects against acid aspiration and bacterial instillation via lipoxins, a family of potent anti-inflammatory lipid mediators. We explored the role of COX-2 and lipoxin A(4) in experimental I\\/R-mediated lung injury. MATERIALS AND METHODS: Sprague-Dawley rats were assigned to one of the following five groups: (1) controls; (2) aortic cross-clamping for 45 min and reperfusion for 4 h (I\\/R group); (3) I\\/R and SC236, a selective COX-2 inhibitor; (4) I\\/R and aspirin; and (5) I\\/R and iloprost, a prostacyclin (PGI(2)) analogue. Lung injury was assessed by wet\\/dry ratio, myeloperoxidase (MPO) activity, and bronchoalveolar lavage (BAL) neutrophil counts. BAL levels of thromboxane, PGE(2), 6-keto-PGF(1)alpha (a hydrolysis product of prostacyclin), lipoxin A(4), and 15-epi-lipoxin A(4) were analyzed by enzyme immunoassay (EIA). Immunostaining for COX-2 was performed. RESULTS: I\\/R significantly increased tissue MPO, the wet\\/dry lung ratio, and neutrophil counts. These measures were significantly further aggravated by SC236 and improved by iloprost. I\\/R increased COX-2 immunostaining and both PGE(2) and 6-keto-PGF(1alpha) levels in BAL. SC236 markedly reduced these prostanoids and lipoxin A(4) compared with I\\/R alone. Iloprost markedly increased lipoxin A(4) levels. The deleterious effect of SC236 and the beneficial effect of iloprost was associated with a reduction and an increase, respectively, in lipoxin A(4) levels. CONCLUSIONS: Lipoxin A(4) warrants further evaluation as a mediator of COX-2 regulated lung protection.
Direct uranium isotope ratio analysis of single micrometer-sized glass particles
International Nuclear Information System (INIS)
Kappel, Stefanie; Boulyga, Sergei F.; Prohaska, Thomas
2012-01-01
We present the application of nanosecond laser ablation (LA) coupled to a ‘Nu Plasma HR’ multi collector inductively coupled plasma mass spectrometer (MC-ICP-MS) for the direct analysis of U isotope ratios in single, 10–20 μm-sized, U-doped glass particles. Method development included studies with respect to (1) external correction of the measured U isotope ratios in glass particles, (2) the applied laser ablation carrier gas (i.e. Ar versus He) and (3) the accurate determination of lower abundant 236 U/ 238 U isotope ratios (i.e. 10 −5 ). In addition, a data processing procedure was developed for evaluation of transient signals, which is of potential use for routine application of the developed method. We demonstrate that the developed method is reliable and well suited for determining U isotope ratios of individual particles. Analyses of twenty-eight S1 glass particles, measured under optimized conditions, yielded average biases of less than 0.6% from the certified values for 234 U/ 238 U and 235 U/ 238 U ratios. Experimental results obtained for 236 U/ 238 U isotope ratios deviated by less than −2.5% from the certified values. Expanded relative total combined standard uncertainties U c (k = 2) of 2.6%, 1.4% and 5.8% were calculated for 234 U/ 238 U, 235 U/ 238 U and 236 U/ 238 U, respectively. - Highlights: ► LA-MC-ICP-MS was fully validated for the direct analysis of individual particles. ► Traceability was established by using an IRMM glass particle reference material. ► Measured U isotope ratios were in agreement with the certified range. ► A comprehensive total combined uncertainty evaluation was performed. ► The analysis of 236 U/ 238 U isotope ratios was improved by using a deceleration filter.
Structural and physical properties of Mg3-xZnxSb2 (x=0-1.34)
International Nuclear Information System (INIS)
Ahmadpour, Faraz; Kolodiazhnyi, Taras; Mozharivskyj, Yurij
2007-01-01
The Mg 3-x Zn x Sb 2 phases with x=0-1.34 were prepared by direct reactions of the elements in tantalum tubes. According to the X-ray single crystal and powder diffraction, the Mg 3-x Zn x Sb 2 phases crystallize in the same P3-bar m1 space group as the parent Mg 3 Sb 2 phase. The Mg 3-x Zn x Sb 2 structure is different from the other substituted structures of Mg 3 Sb 2 , such as (Ca, Sr, Ba) Mg 2 Sb 2 or Mg 5.23 Sm 0.77 Sb 4 , in a way that in Mg 3-x Zn x Sb 2 the Mg atoms on the tetrahedral sites are replaced, while in the other structures Mg on the octahedral sites is replaced. Thermoelectric performance for the two members of the series, Mg 3 Sb 2 and Mg 2.36 Zn 0.64 Sb 2 , was evaluated from low to room temperatures through resistivity, Seebeck coefficient and thermal conductivity measurements. In contrast to Mg 3 Sb 2 which is a semiconductor, Mg 2.36 Zn 0.64 Sb 2 is metallic and exhibits an 18-times larger dimensionless figure-of-merit, ZT, at room temperature. However, thermoelectric performance of Mg 2.36 Zn 0.64 Sb 2 is still poor and it is mostly due to its large electrical resistivity. - Graphical abstract: The Mg atoms in Mg 3 Sb 2 were successfully substituted with Zn, with Zn going exclusively into the tetrahedral sites. Zn substitution increases the electrical conductivity in Mg 2.36 Zn 0.64 Sb 2 by closing the band gap. This change combined with a decrease in the thermal conductivity improves the ZT value
Energy Technology Data Exchange (ETDEWEB)
Bailey, Susan; Rapson, Trevor; Johnson-Winters, Kayunta; Astashkin, Andrei; Enemark, John; Kappler, Ulrike
2008-11-10
Sulfite dehydrogenases (SDHs) catalyze the oxidation and detoxification of sulfite to sulfate, a reaction critical to all forms of life. Sulfite-oxidizing enzymes contain three conserved active site amino acids (Arg-55, His-57, and Tyr-236) that are crucial for catalytic competency. Here we have studied the kinetic and structural effects of two novel and one previously reported substitution (R55M, H57A, Y236F) in these residues on SDH catalysis. Both Arg-55 and His-57 were found to have key roles in substrate binding. An R55M substitution increased Km(sulfite)(app) by 2-3 orders of magnitude, whereas His-57 was required for maintaining a high substrate affinity at low pH when the imidazole ring is fully protonated. This effect may be mediated by interactions of His-57 with Arg-55 that stabilize the position of the Arg-55 side chain or, alternatively, may reflect changes in the protonation state of sulfite. Unlike what is seen for SDHWT and SDHY236F, the catalytic turnover rates of SDHR55M and SDHH57A are relatively insensitive to pH (~;;60 and 200 s-1, respectively). On the structural level, striking kinetic effects appeared to correlate with disorder (in SDHH57A and SDHY236F) or absence of Arg-55 (SDHR55M), suggesting that Arg-55 and the hydrogen bonding interactions it engages in are crucial for substrate binding and catalysis. The structure of SDHR55M has sulfate bound at the active site, a fact that coincides with a significant increase in the inhibitory effect of sulfate in SDHR55M. Thus, Arg-55 also appears to be involved in enabling discrimination between the substrate and product in SDH.
2006-09-01
8 A ppendices ...................................................................................... 8 3 Mahoney...activation after acute injury to stratified epithelia. Biochem. Biophys. Res. Commun. 236, 231-238. Cowin, P. (1994). Unraveling the cytoplasmic
Directory of Open Access Journals (Sweden)
Dorin Rechiţean
2011-10-01
Full Text Available The researches carried out between the altitude levels of 236 and 1300 m, in 13 localities from Banat Mountains, proved the influence exerted by stationary natural conditions on the botanic diversity of the vegetal cover. From one vegetal association to another, the total number of botanic species ranged between 9 and 21; the biggest number of species was recorded between 236 – 630 m altitude, and the smallest one between 462 – 650 m. The mean coverage degree of these species was 42.69% in the species belonging to the Poaceae Family (with a variation of 30-70% and 12.85% in the species belonging to the Fabaceae Family (variation of 25-65%.
Fixational eye movement: a negligible source of dynamic aberration.
Mecê, Pedro; Jarosz, Jessica; Conan, Jean-Marc; Petit, Cyril; Grieve, Kate; Paques, Michel; Meimon, Serge
2018-02-01
To evaluate the contribution of fixational eye movements to dynamic aberration, 50 healthy eyes were examined with an original custom-built Shack-Hartmann aberrometer, running at a temporal frequency of 236Hz, with 22 lenslets across a 5mm pupil, synchronized with a 236Hz pupil tracker. A comparison of the dynamic behavior of the first 21 Zernike modes (starting from defocus) with and without digital pupil stabilization, on a 3.4s sequence between blinks, showed that the contribution of fixational eye movements to dynamic aberration is negligible. Therefore we highlighted the fact that a pupil tracker coupled to an Adaptive Optics Ophthalmoscope is not essential to achieve diffraction-limited resolution.
Lenik, Joanna
2014-12-01
This paper reports the preparation of diclofenac-selective membrane electrodes incorporating β-cyclodextrins: (2-hydroxypropyl)-β-cyclodextrin, heptakis(2,3,6-tri-O-methyl)-β-cyclodextrin, and heptakis(2,3,6-tri-O-benzoyl)-β-cyclodextrin. Several plasticized poly(vinyl chloride) membranes of different compositions were tested with the best electrode being the one incorporating heptakis(2,3,6-tri-O-benzoyl)-β-cyclodextrin with the membrane plasticized with 2-nitrophenyloctyl ether. The electrode is characterized by a near-Nernstian response slope of -60.0 mV decade(-1) over the linear range of 5.0×10(-5)-1.0×10(-2) mol L(-1) and a limit of detection of 1.4×10(-5) mol L(-1). The proposed electrode can easily discriminate diclofenac ions from several inorganic and organic interferents and some common drug excipients. The electrode has a response time of 10s and can be used within a pH range of 6.2-8.5 over 10 months without any considerable deterioration. The electrical properties of the membrane electrode were studied by impedance spectroscopy. The notable advantages of the diclofenac-selective electrode include its high sensitivity, selectivity, cost-effectiveness, and comfortable application in drug and urine analysis. Copyright © 2014 Elsevier B.V. All rights reserved.
Estimation of (n,f) Cross-Sections by Measuring Reaction Probability Ratios
Energy Technology Data Exchange (ETDEWEB)
Plettner, C; Ai, H; Beausang, C W; Bernstein, L A; Ahle, L; Amro, H; Babilon, M; Burke, J T; Caggiano, J A; Casten, R F; Church, J A; Cooper, J R; Crider, B; Gurdal, G; Heinz, A; McCutchan, E A; Moody, K; Punyon, J A; Qian, J; Ressler, J J; Schiller, A; Williams, E; Younes, W
2005-04-21
Neutron-induced reaction cross-sections on unstable nuclei are inherently difficult to measure due to target activity and the low intensity of neutron beams. In an alternative approach, named the 'surrogate' technique, one measures the decay probability of the same compound nucleus produced using a stable beam on a stable target to estimate the neutron-induced reaction cross-section. As an extension of the surrogate method, in this paper they introduce a new technique of measuring the fission probabilities of two different compound nuclei as a ratio, which has the advantage of removing most of the systematic uncertainties. This method was benchmarked in this report by measuring the probability of deuteron-induced fission events in coincidence with protons, and forming the ratio P({sup 236}U(d,pf))/P({sup 238}U(d,pf)), which serves as a surrogate for the known cross-section ratio of {sup 236}U(n,f)/{sup 238}U(n,f). IN addition, the P({sup 238}U(d,d{prime}f))/P({sup 236}U(d,d{prime}f)) ratio as a surrogate for the {sup 237}U(n,f)/{sup 235}U(n,f) cross-section ratio was measured for the first time in an unprecedented range of excitation energies.
Evaluation of a solar-powered organic Rankine cycle using dry organic working fluids
Directory of Open Access Journals (Sweden)
Emily Spayde
2015-12-01
Full Text Available This paper presents a model to evaluate the performance of a solar-powered organic Rankine cycle (ORC. The system was evaluated in Jackson, MS, using five dry organic working fluids, R218, R227ea, R236ea, R236fa, and RC318. The purpose of this study is to investigate how hourly temperature change affects the electricity production and exergy destruction rates of the solar ORC, and to determine the effect of the working fluid on the proposed system. The system was also evaluated in Tucson, AZ, to investigate the effect of average hourly outdoor temperatures on its performance. The potential of the system to reduce primary energy consumption and carbon dioxide emissions is also investigated. A parametric analysis to determine how temperature and pressure of the organic working fluid, the solar collector area, and the turbine efficiency affect the electricity production is performed. Results show that the ORC produces the most electricity during the middle of the day, when the temperatures are the highest and when the solar collectors have the highest efficiency. Also, R-236ea is the working fluid that shows the best performance of the evaluated fluids. An economic analysis was performed to determine the capital cost available for the proposed system.
International Nuclear Information System (INIS)
King, L.J.; Bigelow, J.E.; Collins, E.D.
1976-10-01
Between July 1, 1975, and December 31, 1975, maintenance was conducted at TRU for a period of three months, 295 g of curium oxide (enough for approximately 26 HFIR targets) were prepared, 100 mg of high-purity 248 Cm, were separated from 252 Cf that had been purified during earlier periods, 11 HFIR targets were fabricated, and 28 product shipments were made. No changes were made in the chemical processing flowsheets normally used at TRU during this report period. However, three equipment racks were replaced (with two new racks) during this time. In Cubicle 6, the equipment replaced was that used to decontaminate the transplutonium elements from rare earth fission products and to separate curium from the heavier elements by means of the LiCl-based anion-exchange process. In Cubicle 5, the equipment used to separate the transcurium elements by high-pressure ion exchange and to purify berkelium by batch solvent extraction was replaced. Two neutron sources were fabricated, bringing the total fabricated to 79. One source that had been used in a completed project was returned to the TRU inventory and is available for reissue. Three sources, for which no further use was foreseen, were processed to isolate and recover the ingrown 248 Cm and the residual 252 Cf. Eight pellets, each containing 100 μg of high-purity 248 Cm were prepared for irradiation in HFIR to study the production of 250 Cm. The values currently being used for transuranium element decay data and for cross-section data in planning irradiation-processing cycles, calculating production forecasts, and assaying products are tabulated
All projects related to | Page 236 | IDRC - International Development ...
International Development Research Centre (IDRC) Digital Library (Canada)
Revenue and Health Impacts of Restructuring Tobacco Excise Tax in the Philippines ... have implications for tobacco control and consumption, and public health, ... Region: North and Central America, South America, Argentina, Bolivia, Brazil ...
49 CFR 236.929 - Training specific to roadway workers.
2010-10-01
... themselves or roadway work groups. (b) What subject areas must roadway worker training include? (1... control equipment in establishing protection for roadway workers and their equipment. (2) Instruction for roadway workers must ensure recognition of processor-based signal and train control equipment on the...
49 CFR 236.1049 - Training specific to roadway workers.
2010-10-01
... who provide protection for themselves or roadway work groups. (b) Training subject areas. (1... control equipment in establishing protection for roadway workers and their equipment. (2) Instruction for... recognition of processor-based signal and train control equipment on the wayside and an understanding of how...
49 CFR 236.0 - Applicability, minimum requirements, and penalties.
2010-10-01
... persons, or has caused death or injury, a penalty not to exceed $100,000 per violation may be assessed... state law seeking damages for personal injury, death, or property damage alleging that a party has... 49 Transportation 4 2010-10-01 2010-10-01 false Applicability, minimum requirements, and penalties...
48 CFR 852.236-80 - Subcontracts and work coordination.
2010-10-01
... conflict in location or elevation of any of the utilities with themselves, with structural items or with other construction items, he/she shall bring this conflict to the attention of the contracting officer immediately. In doing so, the contractor shall explain the proposed method of solving the problem or shall...
40 CFR 180.236 - Triphenyltin hydroxide; tolerances for residues.
2010-07-01
....0 Cattle, fat 0.2 Cattle, kidney 2.0 Cattle, liver 4.0 Cattle, meat 0.5 Goat, fat 0.2 Goat, kidney 2.0 Goat, liver 4.0 Goat, meat 0.5 Hog, fat 0.3 Hog, meat 0.06 Hog, meat byproducts 0.3 Horse, fat 0.2 Horse, kidney 2.0 Horse, liver 4.0 Horse, meat 0.5 Milk 0.06 Pecan 0.05 Potato 0.05 Sheep, fat 0.2 Sheep...
49 CFR 236.913 - Filing and approval of PSPs.
2010-10-01
... Administrator for Safety considers the following applicable factors when evaluating the risk assessment: (i) The... product; (vi) The extent to which identified faults are effectively addressed; (vii) Whether the risk... concludes it is necessary based upon consideration of the following factors: (i) Those factors listed in...
8 CFR 236.3 - Detention and release of juveniles.
2010-01-01
... parent, close relative, a friend, or to an organization found on the free legal services list. A juvenile... must in fact communicate either with a parent, adult relative, friend, or with an organization found on... parent; (ii) Legal guardian; or (iii) An adult relative (brother, sister, aunt, uncle, grandparent) who...
Plutonium reclamation facility (PRF, building 236-Z) layup plan
International Nuclear Information System (INIS)
ANDERSON, R.N.
1999-01-01
This document reviews each system inside PRF to determine the operation and maintenance requirements necessary to maintain safe and predictable system performance for facility systems needed to remain operational while minimizing the maintenance and surveillance being performed. Also covered are the actions required to place PRF in a safe layup configuration while minimizing hazards and taking into account the need for reactivation of certain equipment when cleanup work commences in the future
Kinetic-energy distribution for symmetric fission of 236U
International Nuclear Information System (INIS)
Brissot, R.; Bocquet, J.P.; Ristori, C.; Crancon, J.; Guet, C.R.; Nifenecker, H.A.; Montoya, M.
1980-01-01
Fission fragment kinetic-energy distributions have been measured at the Grenoble high-flux reactor with the Lohengrin facility. Spurious events were eliminated in the symmetric region by a coherence test based on a time-of-flight measurement of fragment velocities. A Monte-Carlo calculation is then performed to correct the experimental data for neutron evaporation. The difference between the most probable kinetic energy in symmetric fission and the fission in which the heavy fragment is 'magic' (Zsub(H)=50) is found to be approximately =30 MeV. The results suggest that for the symmetric case the total excitation energy available at scission is shared equally among the fragments. (author)
236 Effective Social Work Practice in Lagos: An Emerging
African Journals Online (AJOL)
User
2010-10-17
Oct 17, 2010 ... social work profession; institutional perspective is the modern approach that is currently put in place, that ... Lagos had for long been in the fore-front of the development of social work in Nigeria .... organization has crises within or without or both; ... newly learnt ways of solving problems, so, learning effective.
Worldwide Report, Telecommunications Policy, Research and Development, No. 236
National Research Council Canada - National Science Library
1982-01-01
This report contains information concerning the telecommunications policy, research and development of the following countries: (1) Australia, (2) Argentina, (3) Madagascar, (4) South Africa, (5) Zaire, (6...
ORF Alignment: NC_003282 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available LKNVCGVAYPGELLAVMGSSGAGKTTLLNALAFRSPQGIQVSPSGMRLLNGQPVDAKEM 60 ... Query: 236 VGTMTE-KSLSRGERKRLAFACEILTDPPILFC...DEPTSGLDSFMSHQVIKALRQLTIEGK 294 ... +G ... K LS GERKRLAFA E LTDPP+L CDEPTSGLDSF +H V++ L++L+ +GK Sbjct: 121 IGVPGRVKGLSGGERKRLAFASEALTDPPLLICDEPTSGLDSFTAHSVVQVLKKLSQKGK 180 ...
Jak nepřesvědčit protivníka o víře. Setkání katolíka a nekatolíka jako téma dialogu
Czech Academy of Sciences Publication Activity Database
Kůrka, Pavel
2012-01-01
Roč. 27, č. 2 (2012), s. 225-236 ISSN 0231-7494 Institutional support: RVO:67985963 Keywords : Confessional polemics * Literary dialogue * Georg Scherer * Bartholomew Paprocki Subject RIV: AB - History
Directory of Open Access Journals (Sweden)
Paulo Antônio de S. Gonçalves
2000-07-01
Full Text Available O objetivo do trabalho foi avaliar a eficiência de diferentes volumes de calda e tipo de bico no controle químico de Thrips tabaci em cebola. Dois experimentos foram conduzidos na EPAGRI, Estação Experimental de Ituporanga, SC, no período de agosto a dezembro de 1996 e 1997. Os tratamentos com bico leque e respectivos níveis de vazão foram XR 110 015 VS® - 236 L/ha, XR 110 02 VS® - 316 L/ha, XR 110 03 VS® - 472 L/ha, XR 110 04 VS® - 632 L/ha, XR 110 05 VS® - 788 L/ha, TJ 60 110 02 VS® - 316 L/ha, TJ 60 110 04 VS® - 632 L/ha; com bico cone foram Conejet TSVS® - 236 L/ha, Conejet TXVK 18® - 472 L/ha, Conejet TXVK 26® - 632 L/ha, D6 Difusor V5® - 600 L/ha, além da testemunha, sem tratamento. O delineamento experimental utilizado foi blocos ao acaso com quatro repetições. O tamanho de parcela foi de 2,8 m x 3,0 m. O inseticida usado foi clorpirifós 0,72 g. i.a./ha. A amostragem de ninfas de T. tabaci foi realizada no campo em cinco plantas escolhidas ao acaso em cada parcela. A redução populacional de tripes foi semelhante entre os diferentes volumes de calda e tipos de bico utilizados. Portanto, os bicos cone e leque aplicando volumes de calda entre 236 a 788 L/ha, apresentaram a mesma eficiência no controle de T. tabaci em cebola.The objective of this work was to evaluate the efficiency of different nozzle types and volume of the insecticide solution in controlling thrips (Thrips tabaci in onions. The work was carried out from August to December, 1996 and 1997. The treatments consisted of different nozzle types (fan and cone and different flow rates. Fan nozzles were XR 110 015 VS® - 236 L/ha, XR 110 02 VS® - 316 L/ha, XR 110 03 VS® - 472 L/ha, XR 110 04 VS® - 632 L/ha, XR 110 05 VS® - 788 L/ha, TJ 60 110 02 VS® - 316 L/ha, TJ 60 110 04 VS - 632 L/ha; and cone nozzles were Conejet TSVS® - 236 L/ha, Conejet TXVK 18® - 472 L/ha, Conejet TXVK 26® - 632 L/ha, D6 Difusor V5® - 600 L/ha. Besides these treatments there
Influence of minor alloying additions on the glass-forming ability of Mg-Ni-La bulk metallic glasses
International Nuclear Information System (INIS)
Gonzalez, S.; Figueroa, I.A.; Todd, I.
2009-01-01
Bulk metallic glasses of Mg 60 Ni 23.6 Y x La (16.4-x) and Mg 65 Ni 20 Y x LaMM (15-x) with 0 ≤ x ≤ 1 at.% have been produced by injection casting. For the La-containing alloy a maximum amorphous diameter of 4 mm for x = 0.5 and 0.75 was obtained. The LaMM-containing alloy showed a maximum amorphous diameter of 2 mm for x = 0 and 0.25 but decreased to 1 mm with further Y additions. The glass-forming ability of the Mg 60 Ni 23.6 La 16.4 alloy decreased when La is partially substituted by small amounts of small atoms (Si or B) or by large atoms (Y and Si).
International Nuclear Information System (INIS)
Pimpel, M.; Schuettelkopf, H.
1984-01-01
A radiochemical method is described by which Np, Pu, Am and Cm in environmental samples can be determined. The transuranium elements are dissolved with acids out of the ashed material. Np/Pu is separated from Am/Cm by sequential extraction using TOPO/cyclohexane. The two fractions are radiochemically purified. Np-237, Pu-239+240, Pu-238 and Pu-236 as well as Am-243, Am-241, Cm-244 and Cm-242 are measured by alpha spectrometery. Pu-236, Am-243 and Np-239 are used to determine the respective yields. A fast method of Np-239 preparation is described. The chemical yields range from 60 to 90%. The detection limit attained per nuclide is 10 fCi/sample. 20 reference, 1 table
Kolm võimalust, kolm kontrasti / Tiiu Levald
Levald, Tiiu, 1940-
2009-01-01
Saaremaa ooperipäevadel Soome Kammerooperi ja Läti Rahvusooperi poolt esitatud kolmest ooperist - Ilkka Kuusisto "Vabaduse vang - Ryti, Risto, nr 236/46", R. Wagneri "Lendav Hollandlane" ja C. Puccini "Turandot"
Rückblick auf Jan Lehár (1949-2004)
Czech Academy of Sciences Publication Activity Database
Steiner, Martin
19/43/, - (2005), s. 299-302. ISBN 80-7007-236-9. ISSN 0231-5955 Institutional research plan: CEZ:AV0Z90090514 Keywords : Czech Comeniology * Comeniology, People Subject RIV: AA - Philosophy ; Religion
Czech Academy of Sciences Publication Activity Database
Hofmanová, Jiřina; Straková, Nicol; Vaculová, Alena; Tylichová, Zuzana; Šafaříková, Barbora; Skender, Belma; Kozubík, Alois
2014-01-01
Roč. 2014, April (2014) ISSN 0962-9351 Institutional support: RVO:68081707 Keywords : NF-KAPPA-B * TRAIL-INDUCED APOPTOSIS * RECEPTOR-MEDIATED APOPTOSIS Subject RIV: BO - Biophysics Impact factor: 3.236, year: 2014
2010-10-01
.../95 Foreign Relations Authorizations Act (Public Law 103-236) prohibits the Department of State from... to carry on diplomatic functions and is approved by the Secretary of State or his/her designee. ...
Czech Academy of Sciences Publication Activity Database
Jelínková, Dagmar
2002-01-01
Roč. 43, - (2002), s. 236-239 ISSN 1211-7250 Institutional research plan: CEZ:AV0Z8001916 Keywords : Late Roman Period * incineration graves * Roman-provincial products Subject RIV: AC - Archeology, Anthropology, Ethnology
Czech Academy of Sciences Publication Activity Database
Čechová, Martina
2014-01-01
Roč. 17, č. 1 (2014), s. 229-236. ISBN 978-2-87772-579-8. ISSN 2101-2849 Institutional support: RVO:68378017 Keywords : Tauric Chersonesos * fish products Subject RIV: AC - Archeology, Anthropology, Ethnology
The inherent purpose of ontology in ecology: The immutable use of Hans Jonas’s works
Directory of Open Access Journals (Sweden)
Raluca Deleanu
2014-12-01
Full Text Available Theresa Morris, Hans Jonas’s Ethic of Responsibility: From Ontology to Ecology, Albany, NY: State University of New York Press, SUNY Series in Environmental Philosophy and Ethics, 2013, 236 p.
The Power of the Word and the Mastery of Nature: Renaissance Magic and Francis Bacon
Czech Academy of Sciences Publication Activity Database
Špelda, Daniel
19/43/, - (2005), s. 7-36. ISBN 80-7007-236-9. ISSN 0231-5955 Institutional research plan: CEZ:AV0Z90090514 Keywords : magic * renaissance philosophy * Francis Bacon Subject RIV: AA - Philosophy ; Religion
Wendel, Cato Christian; Fifield, L Keith; Oughton, Deborah H; Lind, Ole Christian; Skipperud, Lindis; Bartnicki, Jerzy; Tims, Stephen G; Høibråten, Steinar; Salbu, Brit
2013-09-01
A combination of state-of-the-art isotopic fingerprinting techniques and atmospheric transport modelling using real-time historical meteorological data has been used to demonstrate direct tropospheric transport of radioactive debris from specific nuclear detonations at the Semipalatinsk test site in Kazakhstan to Norway via large areas of Europe. A selection of archived air filters collected at ground level at 9 stations in Norway during the most intensive atmospheric nuclear weapon testing periods (1957-1958 and 1961-1962) has been screened for radioactive particles and analysed with respect to the concentrations and atom ratios of plutonium (Pu) and uranium (U) using accelerator mass spectrometry (AMS). Digital autoradiography screening demonstrated the presence of radioactive particles in the filters. Concentrations of (236)U (0.17-23nBqm(-3)) and (239+240)Pu (1.3-782μBqm(-3)) as well as the atom ratios (240)Pu/(239)Pu (0.0517-0.237) and (236)U/(239)Pu (0.0188-0.7) varied widely indicating several different sources. Filter samples from autumn and winter tended to have lower atom ratios than those sampled in spring and summer, and this likely reflects a tropospheric influence in months with little stratospheric fallout. Very high (236)U, (239+240)Pu and gross beta activity concentrations as well as low (240)Pu/(239)Pu (0.0517-0.077), (241)Pu/(239)Pu (0.00025-0.00062) and (236)U/(239)Pu (0.0188-0.046) atom ratios, characteristic of close-in and tropospheric fallout, were observed in filters collected at all stations in Nov 1962, 7-12days after three low-yield detonations at Semipalatinsk (Kazakhstan). Atmospheric transport modelling (NOAA HYSPLIT_4) using real-time meteorological data confirmed that long range transport of radionuclides, and possibly radioactive particles, from Semipalatinsk to Norway during this period was plausible. The present work shows that direct tropospheric transport of fallout from atmospheric nuclear detonations periodically may have
Komisjoni kiuste avaldas Holland valimistulemuse / Arko Olesk
Olesk, Arko, 1981-
2004-01-01
Euroopa Komisjoni keelule ja karistusähvardusele vaatamata avaldasid Hollandi võimud europarlamendi valimiste tulemused, mille kohaselt said valitsevad kristlikud demokraadid 24,4 protsenti ja opositsioonilised sotsiaaldemokraadid 23,6 protsenti häältest
Czech Academy of Sciences Publication Activity Database
Vandeputte, M.; Kocour, Martin; Mauger, S.; Duppont Nivet, M.; De Guerry, D.; Rodina, Marek; Gela, David; Vallod, D.; Chevassus, B.; Linhart, Otomar
2004-01-01
Roč. 235, - (2004), s. 223-236 ISSN 0044-8486 Institutional research plan: CEZ:AV0Z5045916 Keywords : common carp * Cyprinus carpio * heritability Subject RIV: ED - Physiology Impact factor: 1.627, year: 2004
Book review: Femi Abodunrin, Black African Literature in English ...
African Journals Online (AJOL)
Book review: Femi Abodunrin, Black African Literature in English 1991-2001: Critical Appreciation and Reception; Mkuki na Nyota Publishers, Dar es Salaam, 2007, 236 pp. ISBN 9987449182/ISBN 13:978-9987-449-18-7.
Research Article Special Issue
African Journals Online (AJOL)
pc
Published online: 24 November 2017. ABSTRACT. Introduction ... and this is a task for both the local university administration and the national legislative body. ..... Newbury Park: Sage, 207-236. Berry, J. (2005). ... Amsterdam University Press.
Development of a “Fission-proxy” Method for the Measurement of 14-MeV Neutron Fission Yields at CAMS
Energy Technology Data Exchange (ETDEWEB)
Gharibyan, Narek [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States)
2016-10-25
Relative fission yield measurements were made for 50 fission products from 25.6±0.5 MeV alpha-induced fission of Th-232. Quantitative comparison of these experimentally measured fission yields with the evaluated fission yields from 14-MeV neutron-induced fission of U-235 demonstrates the feasibility of the proposed fission-proxy method. This new technique, based on the Bohr-independence hypothesis, permits the measurement of fission yields from an alternate reaction pathway (Th-232 + 25.6 MeV α → U-236* vs. U-235 + 14-MeV n → U-236*) given that the fission process associated with the same compound nucleus is independent of its formation. Other suitable systems that can potentially be investigated in this manner include (but are not limited to) Pu-239 and U-237.
International Nuclear Information System (INIS)
Jallu, F.; Lyoussi, A.; Passard, C.; Payan, E.; Recroix, H.; Nurdin, G.; Buisson, A.; Allano, J.
2000-01-01
Measuring α-emitters such as ( 234,235,236,238 U, 238,239,240,242,244 Pu, 237 Np, 241,243 Am, ...), in solid radioactive waste allows us to quantify the α-activity in a drum and then to classify it. The simultaneous photon and neutron interrogation experiment (SIMPHONIE) method dealt with in this paper, combines both active neutron interrogation and induced photofission interrogation techniques simultaneously. Its purpose is to quantify fissile ( 235 U, 239,241 Pu, ...) and non-fissile ( 236,238 U, 238,240 Pu, ...) elements separately in only one measurement. This paper presents the principle of the method, the experimental setup, and the first experimental results obtained using the DGA/ETCA Linac and MiniLinatron pulsed linear electron accelerators located at Arcueil, France. First studies were carried out with U and Pu bare samples
ORF Alignment: NC_003155 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_003155 gi|29832733 >1chkA 1 236 48 283 9e-87 ... dbj|BAC73902.1| putative chitosan...ase [Streptomyces avermitilis MA-4680] ... ref|NP_827367.1| putative chitosanase [Streptomyces ...
ORF Alignment: NC_003155 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_003155 gi|29828557 >1chkA 1 236 35 270 4e-95 ... dbj|BAC69726.1| putative chitosan...ase [Streptomyces avermitilis MA-4680] ... ref|NP_823191.1| putative chitosanase [Streptomyces ...
2010-01-01
... that he or she is waiving the requirement in section 236 of the Act that the inquiry shall be kept... free legal services programs qualified under 8 CFR part 1003 and organizations recognized pursuant to...
Tzv. karantánské náušnice ve středním Podunají
Czech Academy of Sciences Publication Activity Database
Ungerman, Šimon
2016-01-01
Roč. 107, prosinec (2016), s. 181-236 ISSN 0031-0506 Institutional support: RVO:68081758 Keywords : Early Middle Ages * jewellery * earrings * chronology * Middle Danube region * Eastern Alps region * Balkans Subject RIV: AC - Archeology, Anthropology, Ethnology
Factors influencing cassava - pulp fermentation period for gari ...
African Journals Online (AJOL)
Factors influencing cassava - pulp fermentation period for gari processing among ... Result of probit model analysis at 5% significance level shows an R value ... Marital status (2.236**) and respondents' cultural influences (1.960**) were ...
Czech Academy of Sciences Publication Activity Database
Bakešová, Alena
2006-01-01
Roč. 54, č. 2 (2006), s. 235-236 ISSN 0015-1831 Institutional research plan: CEZ:AV0Z90090514 Keywords : hermeneutics * situated subject * normativity in the modernism and postmodernism Subject RIV: AA - Philosophy ; Religion
Gclust Server: 123078 [Gclust Server
Lifescience Database Archive (English)
Full Text Available 123078 HSA_70995422 Cluster Sequences Related Sequences(16) 236 NP_001020605.1 NAD(P)H menadione...tation NP_001020605.1 NAD(P)H menadione oxidoreductase 1, dioxin-inducible isoform c ; no annotation Number
What do we learn on the dynamics of fission from α-accompanied fission data
International Nuclear Information System (INIS)
Guet, C.; Asghar, M.; Nifenecker, H.; Perrin, P.
1978-01-01
Measurements of the angular distribution of α-particles emitted by thermal fission of 236 U are presented. Also the dependence of the angular distribution on the kinetic energy of the fission products is studied. (WL) [de
Advances in the material science of concrete
National Research Council Canada - National Science Library
Ideker, Jason H; Radlinska, Aleksandra
2010-01-01
... Committee 236, Material Science of Concrete. The session focused on material science aspects of concrete with an emphasis placed on advances in understanding the fundamental scientific topics of cement-based materials, as well as the crucial...
Over-the-counter pain relievers
... Waltham, MA: Elsevier; 2016:236-272. Dinakar P. Principles of pain management. In: Daroff RB, Jankovic J, Mazziotta JC, Pomeroy SL, eds. Bradley's Neurology in Clinical Practice . 7th ed. Philadelphia, PA: Elsevier; 2016:chap 54.
76 FR 59180 - Agency Information Collection Activities: Proposed Request and Comment Request
2011-09-23
... criteria. Respondents complete Form SSA-1026-REDE under the following circumstances: (1) When individuals...,420 SSA-1026-OCR-SM-REDE 225,000 1 18 67,500 Total 236,400 70,920 II. SSA submitted the information...
ORF Alignment: NC_003888 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_003888 gi|21219207 >1chkA 2 236 45 279 3e-87 ... ref|NP_624986.1| secreted chitosan...ase [Streptomyces coelicolor A3(2)] ... emb|CAB61194.1| secreted chitosanase [Streptomyces ...
Czech Academy of Sciences Publication Activity Database
Ulčová-Gallová, Z.; Gruberová, J.; Vrzalová, J.; Bibková, K.; Pěknicová, Jana; Mičanová, Z.; Topolčan, O.
2009-01-01
Roč. 61, č. 3 (2009), s. 236-245 ISSN 1046-7408 Institutional research plan: CEZ:AV0Z50520701 Keywords : intra-acrosomal protein * cytokines * infertility Subject RIV: EC - Immunology Impact factor: 2.172, year: 2009
Czech Academy of Sciences Publication Activity Database
Ruan, Z.; Giordano, Mario
2017-01-01
Roč. 40, č. 2 (2017), s. 227-236 ISSN 0140-7791 Institutional support: RVO:61388971 Keywords : carbon allocation * cyanobacteria * elemental stoichiometry Subject RIV: EE - Microbiology, Virology OBOR OECD: Microbiology Impact factor: 6.173, year: 2016
Actinide production in the reaction of heavy ions with curium-248
International Nuclear Information System (INIS)
Moody, K.J.
1983-07-01
Chemical experiments were performed to examine the usefulness of heavy ion transfer reactions in producing new, neutron-rich actinide nuclides. A general quasi-elastic to deep-inelastic mechanism is proposed, and the utility of this method as opposed to other methods (e.g. complete fusion) is discussed. The relative merits of various techniques of actinide target synthesis are discussed. A description is given of a target system designed to remove the large amounts of heat generated by the passage of a heavy ion beam through matter, thereby maximizing the beam intensity which can be safely used in an experiment. Also described is a general separation scheme for the actinide elements from protactinium (Z=91) to mendelevium (Z=101), and fast specific procedures for plutonium, americium and berkelium. The cross sections for the production of several nuclides from the bombardment of 248 Cm with 18 O, 86 Kr and 136 Xe projectiles at several energies near and below the Coulomb barrier were determined. The results are compared with yields from 48 Ca and 238 U bombardments of 248 Cm. Simple extrapolation of the product yields into unknown regions of charge and mass indicates that the use of heavy ion transfer reactions to produce new, neutron-rich above-target species is limited. The substantial production of neutron-rich below-target species, however, indicates that with very heavy ions like 136 Xe and 238 U the new species 248 Am, 249 Am and 247 Pu should be produced with large cross sections from a 248 Cm target. A preliminary, unsuccessful attempt to isolate 247 Pu is outlined. The failure is probably due to the half life of the decay, which is calculated to be less than 3 minutes. The absolute gamma ray intensities from 251 Bk decay, necessary for calculating the 251 Bk cross section, are also determined
Minor Actinides Recycling in PWRs
International Nuclear Information System (INIS)
Delpech, M.; Golfier, H.; Vasile, A.; Varaine, F.; Boucher, L.; Greneche, D.
2006-01-01
Recycling of minor actinides in current and near future PWR is considered as one of the options of the general waste management strategy. This paper presents the analysis of this option both from the core physics and fuel cycle point of view. A first indicator of the efficiency of different neutron spectra for transmutation purposes is the capture to fission cross sections ratio which is less favourable by a factor between 5 to 10 in PWRs compared to fast reactors. Another indicator presented is the production of high ranking isotopes like Curium, Berkelium or Californium in the thermal or epithermal spectrum conditions of PWR cores by successive neutron captures. The impact of the accumulation of this elements on the fabrication process of such PWR fuels strongly penalizes this option. The main constraint on minor actinides loadings in PWR (or fast reactors) fuels are related to their direct impact (or the impact of their transmutation products) on the reactivity coefficients, the reactivity control means and the core kinetics parameters. The main fuel cycle physical parameters like the neutron source, the alpha decay power, the gamma and neutrons dose rate and the criticality aspects are also affected. Recent neutronic calculations based on a reference core of the Evolutionary Pressurized Reactor (EPR), indicates typical maximum values of 1 % loadings. Different fuel design options for minor actinides transmutation purposes in PWRs are presented: UOX and MOX, homogeneous and heterogeneous assemblies. In this later case, Americium loading is concentrated in specific pins of a standard UOX assembly. Recycling of Neptunium in UOX and MOX fuels was also studied to improve the proliferation resistance of the fuel. The impact on the core physics and penalties on Uranium enrichment were underlined in this case. (authors)
Ion-selective electrodes in organic elemental and functional group analysis: a review
Energy Technology Data Exchange (ETDEWEB)
Selig, W.
1977-11-08
The literature on the use of ion-selective electrodes in organic elemental and functional group analysis is surveyed in some detail. The survey is complete through Chemical Abstracts, Vol. 83 (1975). 40 figures, 52 tables, 236 references.
Ion-selective electrodes in organic elemental and functional group analysis: a review
International Nuclear Information System (INIS)
Selig, W.
1977-01-01
The literature on the use of ion-selective electrodes in organic elemental and functional group analysis is surveyed in some detail. The survey is complete through Chemical Abstracts, Vol. 83 (1975). 40 figures, 52 tables, 236 references
Charged-particle multiplicities in proton–proton collisions at $\\sqrt{s} = 0.9$ to 8 TeV
Adam, Jaroslav; Adamova, Dagmar; Akindinov, Alexander; Bjelogrlic, Sandro; Blair, Justin Thomas; Blau, Dmitry; Blume, Christoph; Bock, Friederike; Bogdanov, Alexey; Boggild, Hans; Boldizsar, Laszlo; Bombara, Marek; Book, Julian Heinz; Alam, Sk Noor; Borel, Herve
2017-01-01
A detailed study of pseudorapidity densities and multiplicity distributions of primary charged particles produced in proton–proton collisions, at $\\sqrt{s} =$ 0.9, 2.36, 2.76, 7 and 8 TeV, in the pseudorapidity range $|\\eta |
Gold-catalyzed oxidation of substituted phenols by hydrogen peroxide
Cheneviere, Yohan; Caps, Valerie; Tuel, Alain
2010-01-01
Gold nanoparticles deposited on inorganic supports are efficient catalysts for the oxidation of various substituted phenols (2,6-di-tert-butyl phenol and 2,3,6-trimethyl phenol) with aqueous hydrogen peroxide. By contrast to more conventional
Czech Academy of Sciences Publication Activity Database
Lecocq, T.; Brasero, N.; De Meulemeester, T.; Michez, D.; Dellicour, S.; Lhomme, P.; de Jonghe, R.; Valterová, Irena; Urbanová, Klára; Rasmont, P.
2015-01-01
Roč. 18, č. 3 (2015), s. 236-248 ISSN 1367-9430 Institutional support: RVO:61388963 Keywords : Bayesian * bumblebees * endemic * evolutionarily significant unit * genetic marker * insular Subject RIV: CC - Organic Chemistry Impact factor: 2.788, year: 2015
Conflict, displacement, and post-war recovery: the case of ...
International Development Research Centre (IDRC) Digital Library (Canada)
2015-11-20
Nov 20, 2015 ... ... challenges communities face in a post-conflict environment. ... Read the working paper (PDF, 2.36 MB ). ... Discover how IDRC supports research to make cities safer through our partnership – Safe and Inclusive Cities ...
African Journal of Biotechnology - Vol 15, No 8 (2016)
African Journals Online (AJOL)
Codon usage bias analysis for the coding sequences of Camellia sinensis and Brassica campestris · EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT · DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. Prosenjit Paul, Supriyo Chakraborty, 236-251 ...
Assessment of undiscovered oil and gas resources in the Cuyo Basin Province, Argentina, 2017
Schenk, Christopher J.; Brownfield, Michael E.; Tennyson, Marilyn E.; Le, Phuong A.; Mercier, Tracey J.; Finn, Thomas M.; Hawkins, Sarah J.; Gaswirth, Stephanie B.; Marra, Kristen R.; Klett, Timothy R.; Leathers-Miller, Heidi M.; Woodall, Cheryl A.
2017-07-18
Using a geology-based assessment methodology, the U.S. Geological Survey estimated mean undiscovered, technically recoverable resources of 236 million barrels of oil and 112 billion cubic feet of associated gas in the Cuyo Basin Province, Argentina.
analytical overview of agricultural conditions in nigeria
African Journals Online (AJOL)
PC USER
Enugu National Fadama Development Project III only one, monitoring and Evaluation System (t= -. 3.08*) was perceived differently by both men and women facilitators. From the ..... Not sure of career prospect. 3.00 ... Language barrier. 2.36.
Risk preferences under acute stress
Czech Academy of Sciences Publication Activity Database
Cahlíková, Jana; Cingl, L.
2017-01-01
Roč. 20, č. 1 (2017), s. 209-236 ISSN 1386-4157 Institutional support: RVO:67985998 Keywords : risk preferences * risk aversion * stress Subject RIV: AH - Economics OBOR OECD: Applied Economics, Econometrics Impact factor: 2.391, year: 2016
The relationship between landscape planting patterns and ...
African Journals Online (AJOL)
ahmad
43600 UKM Bangi, Selangor, Malaysia. .... gested not only vegetation type, size, and location are .... Business. 30. 10.1. Others. 70. 23.6. RESULTS. Demographic profile of the ... wed by “offenders can easily vanish among dense plan-.
The Logic and Semantics of Modal Propositions in Juan Caramuel
Czech Academy of Sciences Publication Activity Database
Dvořák, Petr
19/43/, - (2005), s. 105-115. ISBN 80-7007-236-9. ISSN 0231-5955 Institutional research plan: CEZ:AV0Z90090514 Keywords : Juan Caramuel y Lobkowicz * modal logic * modalities * late scholasticism Subject RIV: AA - Philosophy ; Religion
Permitting plan for project W-236B, initial pretreatment module
International Nuclear Information System (INIS)
Tollefson, K.S.
1995-01-01
The Tank Waste Remediation System pretreatment process mission is to separate high-level and low-level waste fractions. A comprehensive review of environmental regulations has indicated that several environmental reviews, permits, and approvals are required before construction and operation of the facility. This revised document provides a summary of permit application data requirements, alternative strategies for permit completion and approval, as well as the probability of success for each alternative for the Initial Pretreatment Module resulting from recent revisions to the Tri-Party Agreement
49 CFR Appendix B to Part 236 - Risk Assessment Criteria
2010-10-01
... designated life-cycle of the product. Each risk metric for the proposed product must be expressed with an... as applicable; (2) Train movement density for freight, work, and passenger trains where applicable..., transient, and intermittent faults accounting for the fault coverage of the integrated hardware/software...
236 basis of osteological characters. Tandy & Keith (1972) place this ...
African Journals Online (AJOL)
pocket of warm water, but is nevertheless within the range of the living species in the Mediter- ranean and West Africa (KcnsIey 1974: 211). D. Cram (in litt.) suggests that larvae overdue for metamorphosis might have found a warm-water patch, settled, but might be unable to reproduce due to the generally low temperatures.
49 CFR 236.1005 - Requirements for Positive Train Control systems.
2010-10-01
.... (4) The control circuit or electronic equivalent for all movement authorities over any switches... device operated directly by the switch points, derail, or by switch locking mechanism, or through relay or electronic device controlled by such circuit controller or functionally equivalent device, for...
48 CFR 52.236-21 - Specifications and Drawings for Construction.
2010-10-01
... ACQUISITION REGULATION (CONTINUED) CLAUSES AND FORMS SOLICITATION PROVISIONS AND CONTRACT CLAUSES Text of... shown on the drawings and not mentioned in the specifications, shall be of like effect as if shown or..., diagrams, layouts, schematics, descriptive literature, illustrations, schedules, performance and test data...
49 CFR 236.1006 - Equipping locomotives operating in PTC territory.
2010-10-01
... 31, 2015, a train controlled by a locomotive with an onboard PTC apparatus that has failed en route... III railroad, including a tourist or excursion railroad, and controlled by a locomotive not equipped...
RP1 is a phosphorylation target of CK2 and is involved in cell adhesion.
Stenner, Frank; Liewen, Heike; Göttig, Stephan; Henschler, Reinhard; Markuly, Norbert; Kleber, Sascha; Faust, Michael; Mischo, Axel; Bauer, Stefan; Zweifel, Martin; Knuth, Alexander; Renner, Christoph; Wadle, Andreas
2013-01-01
RP1 (synonym: MAPRE2, EB2) is a member of the microtubule binding EB1 protein family, which interacts with APC, a key regulatory molecule in the Wnt signalling pathway. While the other EB1 proteins are well characterized the cellular function and regulation of RP1 remain speculative to date. However, recently RP1 has been implicated in pancreatic cancerogenesis. CK2 is a pleiotropic kinase involved in adhesion, proliferation and anti-apoptosis. Overexpression of protein kinase CK2 is a hallmark of many cancers and supports the malignant phenotype of tumor cells. In this study we investigate the interaction of protein kinase CK2 with RP1 and demonstrate that CK2 phosphorylates RP1 at Ser(236) in vitro. Stable RP1 expression in cell lines leads to a significant cleavage and down-regulation of N-cadherin and impaired adhesion. Cells expressing a Phospho-mimicking point mutant RP1-ASP(236) show a marked decrease of adhesion to endothelial cells under shear stress. Inversely, we found that the cells under shear stress downregulate endogenous RP1, most likely to improve cellular adhesion. Accordingly, when RP1 expression is suppressed by shRNA, cells lacking RP1 display significantly increased cell adherence to surfaces. In summary, RP1 phosphorylation at Ser(236) by CK2 seems to play a significant role in cell adhesion and might initiate new insights in the CK2 and EB1 family protein association.
RP1 is a phosphorylation target of CK2 and is involved in cell adhesion.
Directory of Open Access Journals (Sweden)
Frank Stenner
Full Text Available RP1 (synonym: MAPRE2, EB2 is a member of the microtubule binding EB1 protein family, which interacts with APC, a key regulatory molecule in the Wnt signalling pathway. While the other EB1 proteins are well characterized the cellular function and regulation of RP1 remain speculative to date. However, recently RP1 has been implicated in pancreatic cancerogenesis. CK2 is a pleiotropic kinase involved in adhesion, proliferation and anti-apoptosis. Overexpression of protein kinase CK2 is a hallmark of many cancers and supports the malignant phenotype of tumor cells. In this study we investigate the interaction of protein kinase CK2 with RP1 and demonstrate that CK2 phosphorylates RP1 at Ser(236 in vitro. Stable RP1 expression in cell lines leads to a significant cleavage and down-regulation of N-cadherin and impaired adhesion. Cells expressing a Phospho-mimicking point mutant RP1-ASP(236 show a marked decrease of adhesion to endothelial cells under shear stress. Inversely, we found that the cells under shear stress downregulate endogenous RP1, most likely to improve cellular adhesion. Accordingly, when RP1 expression is suppressed by shRNA, cells lacking RP1 display significantly increased cell adherence to surfaces. In summary, RP1 phosphorylation at Ser(236 by CK2 seems to play a significant role in cell adhesion and might initiate new insights in the CK2 and EB1 family protein association.
Direct uranium isotope ratio analysis of single micrometer-sized glass particles.
Kappel, Stefanie; Boulyga, Sergei F; Prohaska, Thomas
2012-11-01
We present the application of nanosecond laser ablation (LA) coupled to a 'Nu Plasma HR' multi collector inductively coupled plasma mass spectrometer (MC-ICP-MS) for the direct analysis of U isotope ratios in single, 10-20 μm-sized, U-doped glass particles. Method development included studies with respect to (1) external correction of the measured U isotope ratios in glass particles, (2) the applied laser ablation carrier gas (i.e. Ar versus He) and (3) the accurate determination of lower abundant (236)U/(238)U isotope ratios (i.e. 10(-5)). In addition, a data processing procedure was developed for evaluation of transient signals, which is of potential use for routine application of the developed method. We demonstrate that the developed method is reliable and well suited for determining U isotope ratios of individual particles. Analyses of twenty-eight S1 glass particles, measured under optimized conditions, yielded average biases of less than 0.6% from the certified values for (234)U/(238)U and (235)U/(238)U ratios. Experimental results obtained for (236)U/(238)U isotope ratios deviated by less than -2.5% from the certified values. Expanded relative total combined standard uncertainties U(c) (k = 2) of 2.6%, 1.4% and 5.8% were calculated for (234)U/(238)U, (235)U/(238)U and (236)U/(238)U, respectively. Copyright © 2012 Elsevier Ltd. All rights reserved.
Molecular markers associated with aluminium tolerance in Sorghum bicolor.
Too, Emily Jepkosgei; Onkware, Augustino Osoro; Were, Beatrice Ang'iyo; Gudu, Samuel; Carlsson, Anders; Geleta, Mulatu
2018-01-01
Sorghum ( Sorghum bicolor , L. Moench) production in many agro-ecologies is constrained by a variety of stresses, including high levels of aluminium (Al) commonly found in acid soils. Therefore, for such soils, growing Al tolerant cultivars is imperative for high productivity. In this study, molecular markers associated with Al tolerance were identified using a mapping population developed by crossing two contrasting genotypes for this trait. Four SSR ( Xtxp34 , Sb5_236 , Sb6_34 , and Sb6_342 ), one STS ( CTG29_3b ) and three ISSR ( 811_1400 , 835_200 and 884_200 ) markers produced alleles that showed significant association with Al tolerance. CTG29_3b, 811_1400 , Xtxp34 and Sb5_ 236 are located on chromosome 3 with the first two markers located close to Alt SB , a locus that underlie the Al tolerance gene ( SbMATE ) implying that their association with Al tolerance is due to their linkage to this gene. Although CTG29_3b and 811_ 1400 are located closer to Alt SB , Xtxp34 and Sb5_236 explained higher phenotypic variance of Al tolerance indices. Markers 835_200 , 884_200 , Sb6_34 and Sb6_342 are located on different chromosomes, which implies the presence of several genes involved in Al tolerance in addition to S bMATE in sorghum. These molecular markers have a high potential for use in breeding for Al tolerance in sorghum.
International Nuclear Information System (INIS)
Long, Yu-Yang; Feng, Yi-Jian; Cai, Si-Shi; Hu, Li-Fang; Shen, Dong-Sheng
2014-01-01
Highlights: • The highest metal reduction occurs at a 2.36 mm sieving size. • Washing promotes heavy metal recycling without secondary pollution. • Sieving and washing are environmentally friendly pretreatments for WEEE wastes. - Abstract: Residues disposal from the dismantling of waste electrical and electronic equipment are challenging because of the large waste volumes, degradation-resistance, low density and high heavy metal content. Incineration is advantageous for treating these residues but high heavy metal contents may exist in incinerator input and output streams. We have developed and studied a specialized heavy metal reduction process, which includes sieving and washing for treating residues before incineration. The preferable screen aperture for sieving was found to be 2.36 mm (8 meshes) in this study; using this screen aperture resulted in the removal of approximately 47.2% Cu, 65.9% Zn, 26.5% Pb, 55.4% Ni and 58.8% Cd from the residues. Subsequent washing further reduces the heavy metal content in the residues larger than 2.36 mm, with preferable conditions being 400 rpm rotation speed, 5 min washing duration and liquid-to-solid ratio of 25:1. The highest cumulative removal efficiencies of Cu, Zn, Pb, Ni and Cd after sieving and washing reached 81.1%, 61.4%, 75.8%, 97.2% and 72.7%, respectively. The combined sieving and washing process is environmentally friendly, can be used for the removal of heavy metals from the residues and has benefits in terms of heavy metal recycling
Uranium beam characterization at CIRCE for background and contamination determinations.
De Cesare, M; De Cesare, N; D'Onofrio, A; Fifield, L K; Gialanella, L; Terrasi, F
2015-09-01
The Accelerator Mass Spectrometry (AMS) is the most sensitive technique, compared either to the Inductively Coupled Plasma (ICP-MS) or Thermal Ionization (TI-MS) mass spectrometer, for the actinide (e.g. (236)U, (x)Pu isotopes) measurements. They are present in environmental samples at the ultra trace level since atmospheric tests of Nuclear Weapons (NWs) performed in the past, deliberate dumping of nuclear waste, nuclear fuel reprocessing, on a large scale, and operation of Nuclear Power Plants (NPPs), on a small scale, have led to the release of a wide range of radioactive nuclides in the environment. At the Center for Isotopic Research on Cultural and Environmental heritage (CIRCE) in Caserta, Italy, an upgraded actinide AMS system, based on a 3-MV pelletron tandem accelerator, has been developed and routinely operated. At CIRCE a charge state distribution as a function of terminal voltage, the beam emittance, measured in the 20° actinides dedicated beam line, as well as the energy and position validation of the U ions were performed in order to determine the best measurement conditions. A (236)U/(238)U isotopic ratio background level of about 5×10(-12) or 3×10(-13), depending on the Time of Flight-Energy (TOF-E) configurations, as well as the spatial distribution of the (235)U, (238)U interferences ions and a (236)U contamination mass of about 0.5 fg have been determined. Copyright © 2015 Elsevier Ltd. All rights reserved.
Energy Technology Data Exchange (ETDEWEB)
Long, Yu-Yang; Feng, Yi-Jian; Cai, Si-Shi [Zhejiang Provincial Key Laboratory of Solid Waste Treatment and Recycling, School of Environmental Science and Engineering, Zhejiang Gongshang University, Hangzhou 310012 (China); Hu, Li-Fang [College of Quality and Safety Engineering, China Jiliang University, Hangzhou 310018 (China); Shen, Dong-Sheng, E-mail: shends@zju.edu.cn [Zhejiang Provincial Key Laboratory of Solid Waste Treatment and Recycling, School of Environmental Science and Engineering, Zhejiang Gongshang University, Hangzhou 310012 (China)
2014-05-01
Highlights: • The highest metal reduction occurs at a 2.36 mm sieving size. • Washing promotes heavy metal recycling without secondary pollution. • Sieving and washing are environmentally friendly pretreatments for WEEE wastes. - Abstract: Residues disposal from the dismantling of waste electrical and electronic equipment are challenging because of the large waste volumes, degradation-resistance, low density and high heavy metal content. Incineration is advantageous for treating these residues but high heavy metal contents may exist in incinerator input and output streams. We have developed and studied a specialized heavy metal reduction process, which includes sieving and washing for treating residues before incineration. The preferable screen aperture for sieving was found to be 2.36 mm (8 meshes) in this study; using this screen aperture resulted in the removal of approximately 47.2% Cu, 65.9% Zn, 26.5% Pb, 55.4% Ni and 58.8% Cd from the residues. Subsequent washing further reduces the heavy metal content in the residues larger than 2.36 mm, with preferable conditions being 400 rpm rotation speed, 5 min washing duration and liquid-to-solid ratio of 25:1. The highest cumulative removal efficiencies of Cu, Zn, Pb, Ni and Cd after sieving and washing reached 81.1%, 61.4%, 75.8%, 97.2% and 72.7%, respectively. The combined sieving and washing process is environmentally friendly, can be used for the removal of heavy metals from the residues and has benefits in terms of heavy metal recycling.
International Nuclear Information System (INIS)
He, Sinian; Chang, Huawei; Zhang, Xiaoqing; Shu, Shuiming; Duan, Chen
2015-01-01
This study proposed a combined Organic Rankine Cycle (ORC) system utilizing exhaust waste as its heat source and liquid natural gas (LNG) as its heat sink to provide alternative power for an LNG-fired vehicle. This system, consisting of a regenerator and a dual heat source composite heat exchanger, was designed to efficiently recover the engine waste heat (EWH) and to guarantee vaporizing LNG steadily. Five potential applicable organic working fluids are analyzed: C4F10, CF3I, R236EA, R236FA and RC318. Each fluid was analyzed at various evaporation temperatures and condensation temperatures using a thermodynamic model, and a self-made MATLAB program based on the physical properties on REFPROP data was applied to run the simulation. Analytical results showed that fluid R236FA has the highest thermal efficiency η_t_h of 21.6%, and that of the others are also around 21%. Based on a twelve-cylinder four stroke stationary natural gas engine, the simulated calculations show that the selected five working fluids can improve the fuel economy by more than 14.7% compared to that without ORC. - Highlights: • We design an ORC utilizing LNG cold energy and engine waste heat. • Five working fluids are examined at various working conditions. • The maximum thermal efficient of our proposed cycle can reach 20.3%–21.6%. • This system can decrease the brake specific fuel consumption by more than 14.7%.
High-frequency ultrasonographic imaging of avian cardiovascular development.
Czech Academy of Sciences Publication Activity Database
McQuinn, T. C.; Bratoeva, M.; Dealmeida, A.; Remond, M.; Thompson, R.P.; Sedmera, David
2007-01-01
Roč. 236, - (2007), s. 3503-3513 ISSN 1058-8388 Institutional research plan: CEZ:AV0Z50450515 Keywords : chick embryo * echocardiography * heart development Subject RIV: FA - Cardiovascular Diseases incl. Cardiotharic Surgery Impact factor: 3.084, year: 2007
rice-husk ash-carbide-waste stabilization of reclaimed asphalt
African Journals Online (AJOL)
user
2016-07-03
Jul 3, 2016 ... passing sieve 2.36 mm aperture, of the composite ... is the indication of the amount of unburned carbon in ..... protective coating on the surface of unhydrated grains .... Materials”, Journal of the European Ceramic Society,. Vol.
Religion and modernity in a secular city: A public theology of ...
African Journals Online (AJOL)
2011-07-20
Jul 20, 2011 ... The theme of the conference,1 'Religion and Modernity in a Secular City', brings together old enemies who ...... and Habermas seek it, but a language of pure mathematics, .... 236–252, Harvard University Press, Cambridge.
Directory of Open Access Journals (Sweden)
Ahmad Mansur
2009-06-01
Full Text Available Book Review:Book title:Nahdlatul Ulama and the Struggle for Power within Islam and Politics in IndonesiaAuthor:Robin BushNo. of Pages:xx + 236Year:2009Publisher:The Institute of Southeast Asian Studies, Singapore
African Journals Online (AJOL)
GB
2015-10-04
Oct 4, 2015 ... KEYWORDS: breast cancer, suboptimal treatment, untreated, chemotherapy ... present early; there is evidence that optimal .... failure. All were females. Stages recorded at presentation were II(2,3.6%), III(24,42.9%) and. IV(30 ...
Czech Academy of Sciences Publication Activity Database
Feczkó, T.; Trif, L.; Németh, B.; Horák, Daniel
2016-01-01
Roč. 641, 10 October (2016), s. 24-28 ISSN 0040-6031 Institutional support: RVO:61389013 Keywords : porous poly(glycidyl methacrylate-ethylene dimethacrylate) beads * paraffin * cetyl alcohol Subject RIV: CD - Macromolecular Chemistry Impact factor: 2.236, year: 2016
Transcriptome analyzis of germinatiing maize kernels exposed to smoke-water and active compound KAR1
Czech Academy of Sciences Publication Activity Database
Soós, V.; Sebestyén, E.; Juhász, A.; Light, M. E.; Kohout, Ladislav; Szalai, G.; Tandori, J.; van Staden, J.; Balázs, E.
2010-01-01
Roč. 10, č. 236 (2010), s. 1-15 ISSN 1471-2229 Institutional research plan: CEZ:AV0Z40550506 Keywords : smoke compound * transcriptome * KAR1 * butenolide Subject RIV: CC - Organic Chemistry Impact factor: 4.085, year: 2010
Genetic and phylogenetic characterization of novel bocaparvovirus infecting chimpanzee
Czech Academy of Sciences Publication Activity Database
Brožová, K.; Hrazdilová, K.; Slaninková, E.; Modrý, David; Černý, Jiří; Celer, V.
2016-01-01
Roč. 37, JAN (2016), s. 231-236 ISSN 1567-1348 Institutional support: RVO:60077344 Keywords : Bocavirus * phylogeny * primate * recombination * Bocaparvovirus * chimpanzee * Pan troglodytes Subject RIV: FN - Epidemiology, Contagious Diseases ; Clinical Immunology Impact factor: 2.885, year: 2016
Oskar Lutsu fantastilis-müütilised näidendid / Felix Oinas
Oinas, Felix, 1911-2004
1999-01-01
Varem ilmunud: Tulimuld, 1978, nr. 2, 1988, nr. 3. Bibl. lk. 59. Kokkuvõte inglise k. "The phantastic-mythic plays of Oskar Luts", lk. 234-236. "Ülemiste vanake" (1916), "Siniallik" (1916), "Viimne pidu" (1916) ja "Sootuluke" (1919)
Czech Academy of Sciences Publication Activity Database
Zachariáš, J.; span class="emphasis">Adamovič, Jiříspan>; Doležalová, L.
2006-01-01
Roč. 37, 29 (2006), s. 235-236 ISSN 0032-6267 R&D Projects: GA AV ČR IAA3013302 Institutional research plan: CEZ:AV0Z30130516 Keywords : quartzite * Eger Graben * sulphides Subject RIV: DB - Geology ; Mineralogy
ORF Alignment: NC_006348 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_006348 gi|53726032 >1iwlA 3 178 47 236 2e-42 ... ref|YP_109199.1| probable outer-membrane lipoproteins... ATCC 23344] ... emb|CAH36611.1| probable outer-membrane lipoproteins ... carrier protein [Bur
ORF Alignment: NC_006350 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_006350 gi|53720213 >1iwlA 3 178 47 236 2e-42 ... ref|YP_109199.1| probable outer-membrane lipoproteins... ATCC 23344] ... emb|CAH36611.1| probable outer-membrane lipoproteins ... carrier protein [Bur
Efficient Solving of Large Non-linear Arithmetic Constraint Systems with Complex Boolean Structure
Czech Academy of Sciences Publication Activity Database
Fränzle, M.; Herde, C.; Teige, T.; Ratschan, Stefan; Schubert, T.
2007-01-01
Roč. 1, - (2007), s. 209-236 ISSN 1574-0617 Grant - others:AVACS(DE) SFB/TR 14 Institutional research plan: CEZ:AV0Z10300504 Keywords : interval-based arithmetic constraint solving * SAT modulo theories Subject RIV: BA - General Mathematics
Anna Groundwater, The Scottish Middle March 1573-1625: Power, Kinship, Allegiance
Janine van Vliet
2011-01-01
Anna Groundwater. The Scottish Middle March 1573-1625: Power, Kinship, Allegiance. Royal Historical Society Studies in History, New Series. Woodbridge, UK: The Boydell Press, 2010. Pp. 236. ISBN 978-0-86193-307-5. £50.00; US$90.00.
On a construction of fast direct solvers
Czech Academy of Sciences Publication Activity Database
Práger, Milan
2003-01-01
Roč. 48, č. 3 (2003), s. 225-236 ISSN 0862-7940 Institutional research plan: CEZ:AV0Z1019905; CEZ:AV0Z1019905 Keywords : Poisson equation * boundary value problem * fast direct solver Subject RIV: BA - General Mathematics
2013-04-24
... March 2012 by the National Agricultural Statistics Service, the total 2011 farm-gate value of all pears...: 7 U.S.C. 601-674. 0 2. In Sec. 927.236, the introductory text and paragraphs (a) and (b) are revised...
78 FR 34 - Pears Grown in Oregon and Washington; Modification of the Assessment Rate for Fresh Pears
2013-01-02
... Agricultural Statistics Service, the total 2011 farm-gate value of all pears grown in Oregon and Washington is... follows: Authority: 7 U.S.C. 601-674. 0 2. In Sec. 927.236, the introductory text and paragraphs (a) and...
African Journals Online (AJOL)
USER
2016-06-09
Jun 9, 2016 ... simple random sampling technique and Central Bank of Nigeria (CBN) Statistical Bulletin. ... This is evidenced by the interest rate possessing a t-value of. 1.020, 1.236 ... It was recommended that financial institutions needs to.
2012-08-28
... Racial and Ethnic Minority-PA10-236. Date: October 9, 2012. Time: 2 p.m. to 3 p.m. Agenda: To review and... Diabetes and Digestive and Kidney Diseases Special Emphasis Panel; DDK-C Conflicts. Date: October 18, 2012...
D:\\African Health Sciences\\Augu
African Journals Online (AJOL)
user
system lesions and pleuropulmonary infiltrates 2,4. .... Other drugs that may be used are ... and intra-articular steroid injection. 2,3,6. Long term ... delivery. She gave birth to a female baby whose. Apgar score 8 and weighed 2800grammes. The.
Phytochemical and Antibacterial Properties of Leaf Extracts of ...
African Journals Online (AJOL)
Nigerian Journal of Basic and Applied Science (2011), 19 (2): 236-240. ISSN 0794- ... old tradition in Africa Asia and Latin America. (Bibitha et. al. ..... Journal of. Contemporary Dental Practice; 6(3):86-94. Sibanda, T. and Okoh, A.I. (2007).
Czech Academy of Sciences Publication Activity Database
Dreslerová, Dagmar
2012-01-01
Roč. 64, č. 2 (2012), s. 199-236 ISSN 0323-1267 R&D Projects: GA AV ČR IAAX00020701 Institutional research plan: CEZ:AV0Z80020508 Keywords : forest * woodland management * prehistory * Holocene Subject RIV: AC - Archeology, Anthropology, Ethnology
Czech Academy of Sciences Publication Activity Database
Horák, J.; Kout, J.; Vodka, Štěpán; Donato, D. C.
2016-01-01
Roč. 363, MAR 1 (2016), s. 229-236 ISSN 0378-1127 Institutional support: RVO:60077344 Keywords : biodiversity * gaps * microenvironment variation Subject RIV: EH - Ecology, Behaviour Impact factor: 3.064, year: 2016 http://www.sciencedirect.com/science/article/pii/S0378112715007744
Bohlmann-Rahtz Cyclodehydration of Aminodienones to Pyridines Using N-Iodosuccinimide
Directory of Open Access Journals (Sweden)
Mark C. Bagley
2010-04-01
Full Text Available Cyclodehydration of Bohlmann-Rahtz aminodienone intermediates using N-iodosuccinimide as a Lewis acid proceeds at low temperature under very mild conditions to give the corresponding 2,3,6-trisubstituted pyridines in high yield and with total regiocontrol.
2011-06-01
solutions that operate reliable under adverse conditions including a bandwidth-limited environment, and provide them with customised information...236 Klein, G. (1998) Sources of Power: How people make decisions, MIT Press, Cambridge, Mass ., USA, 1998 NATO (2007) NATO Architecture Framework
Directory of Open Access Journals (Sweden)
Jacqueline Irene Cannata
2012-10-01
Full Text Available Richard J. Hill, Picturing Scotland through the Waverley Novels: Walter Scott and the Origins of the Victorian Illustrated Novel . Farnham, Surrey, and Burlington, VT: Ashgate, 2010. Pp. 236. ISBN 978-0-7546-6806-0. US$99.99.
Competition policy spurs economy-wide gains
International Development Research Centre (IDRC) Digital Library (Canada)
tive markets is more likely to empower the poor, a thesis the UNCTAD .... PHONE: 613-236-6163. FAX: 613-567-7748. EMAIL: ggp@idrc.ca. WEB: www.idrc.ca/ ... leading institutions in the generation and application of new knowledge to meet.
Czech Academy of Sciences Publication Activity Database
Parajdi-Losonczi, P.L.; Benyei, A.C.; Kovats, E.; Timari, I.; Muchová, T.; Novohradský, Vojtěch; Kašpárková, Jana; Buglyo, P.
2016-01-01
Roč. 160, JUL2016 (2016), s. 236-245 ISSN 0162-0134 R&D Projects: GA MŠk(CZ) LH14317 Institutional support: RVO:68081707 Keywords : Ruthenium complexes * Aminohydroxamates * Anticancer Subject RIV: BO - Biophysics Impact factor: 3.348, year: 2016
Directory of Open Access Journals (Sweden)
Katarina Görts Öberg, PhD
2017-12-01
Öberg KG, Hallberg J, Kaldo V, et al. Hypersexual Disorder According to the Hypersexual Disorder Screening Inventory in Help-Seeking Swedish Men and Women With Self-Identified Hypersexual Behavior. Sex Med 2017;5:e229–e236.
Savannah River Laboratory isotopic power and heat sources. Monthly report, June 1966
International Nuclear Information System (INIS)
1966-06-01
Progress in research and development is described for the following: preparation of Tm 2 O 3 ; properties of thulium-171; reduction of Pu-236 in Pu-238; 238 Pu oxide with low neutron emission; and encapsulation of cobalt-60 heat sources
Czech Academy of Sciences Publication Activity Database
René, Miloš; Finger, F.
2016-01-01
Roč. 110, č. 4 (2016), 503-514 ISSN 0930-0708 R&D Projects: GA MŠk ME 555 Institutional support: RVO:67985891 Keywords : leucogranite * turmaline * petrology * geochemistry * Bohemian Massif Subject RIV: DB - Geology ; Mineralogy Impact factor: 1.236, year: 2016
kenya : tous les projets | Page 5 | CRDI - Centre de recherches pour ...
International Development Research Centre (IDRC) Digital Library (Canada)
Sujet: DISEASE TRANSMISSION, TRAINING PROGRAMMES, RESEARCH PROJECTS, IMMUNOLOGY, HIV, SEXUALLY TRANSMITTED DISEASES, Capacity building, Gender. Région: Kenya, North of Sahara, South of Sahara. Programme: Santé des mères et des enfants. Financement total : CA$ 41,236.00.
Epidemiological aspects of recruitment of male volunteers for non-invasive urodynamics
V. Avagyan (Vardan); R. van Mastrigt (Ron); J.W.N.C. Huang Foen Chung (John); A.M. Bohnen (Arthur); P.G.H. Mulder (Paul); J.L.H.R. Bosch (Ruud)
2006-01-01
textabstractWe studied epidemiological aspects of recruitment of volunteers for a non-invasive urodynamic study. MATERIALS AND METHODS: 9,236 volunteers were invited by 20 general practitioners (GPs), using two different recruitment methods, i.e. by mail only, or during a
Postoperative Pain Management: Clinicians' Knowledge and ...
African Journals Online (AJOL)
Postoperative Pain Management: Clinicians' Knowledge and Practices on Assessment and Measurement at Moi Teaching and Referral Hospital. ... A standardized questionnaire was administered to 236 hospital – based clinicians including medical doctors, nurses and clinical officers. The questionnaire consisted of ...
Newberry, Ryan; Redman, Ted; Ross, Elliot; Ely, Rachel; Saidler, Clayton; Arana, Allyson; Wampler, David; Miramontes, David
2018-01-01
Out-of-hospital cardiac arrest (OHCA) is a major cause of death and morbidity in the United States. Quality cardiopulmonary resuscitation (CPR) has proven to be a key factor in improving survival. The aim of our study was to investigate the outcomes of OHCA when mechanical CPR (LUCAS 2 Chest Compression System™) was utilized compared to conventional CPR. Although controlled trials have not demonstrated a survival benefit to the routine use of mechanical CPR devices, there continues to be an interest for their use in OHCA. We conducted a retrospective observational study of OHCA comparing the outcomes of mechanical and manual chest compressions in a fire department based EMS system serving a population of 1.4 million residents. Mechanical CPR devices were geographically distributed on 11 of 33 paramedic ambulances. Data were collected over a 36-month period and outcomes were dichotomized based on utilization of mechanical CPR. The primary outcome measure was survival to hospital discharge with a cerebral performance category (CPC) score of 1 or 2. This series had 3,469 OHCA reports, of which 2,999 had outcome data and met the inclusion criteria. Of these 2,236 received only manual CPR and 763 utilized a mechanical CPR device during the resuscitation. Return of spontaneous circulation (ROSC) was attained in 44% (334/763) of the mechanical CPR resuscitations and in 46% (1,020/2,236) of the standard manual CPR resuscitations (p = 0.32). Survival to hospital discharge was observed in 7% (52/763) of the mechanical CPR resuscitations and 9% (191/2,236) of the manual CPR group (p = 0.13). Discharge with a CPC score of 1 or 2 was observed in 4% (29/763) of the mechanical CPR resuscitation group and 6% (129/2,236) of the manual CPR group (p = 0.036). In our study, use of the mechanical CPR device was associated with a poor neurologic outcome at hospital discharge. However, this difference was no longer evident after logistic regression adjusting for confounding variables
Energy Technology Data Exchange (ETDEWEB)
Schneider, Stephanie
2017-02-01
In March 2011, the nuclear power plant Fukushima Dai-ichi was seriously damaged by a tsunami caused by an earthquake. During the accident large quantities of radionuclides, mainly of the volatile elements cesium and iodine, were released to the environment. In small amounts refractory elements such as plutonium and uranium have also been released. Plutonium and the uraniumisotope {sup 236}U have primarily been delivered by human activities in the environment. Large amounts were released during the atmospheric nuclear weapons tests. Additional sources are accidents in nuclear facilities, like Chernobyl. Every source has its own characteristic isotopic composition. It is therefore possible to determine the origin of the contamination by measuring the isotopic ratios of {sup 240}Pu/{sup 239}Pu and {sup 236}U/{sup 238}U. These ratios can be determined by using accelerator mass spectrometry. Due to its high sensitivity, it is possible to measure even small amounts of plutonium and especially of {sup 236}U. These measurements were performed using the compact 500 kV facility ''TANDY'' of ETH Zurich. In 2013 and 2015 vegetation, litter and soil drill core samples were taken in the contaminated area in Fukushima prefecture. In 2015 samples were taken as close to the sampling locations of the 2013 campaign as possible. After isolation of plutonium and uranium by chemical extraction, separate targets were prepared for the measurement. The {sup 240}Pu/{sup 239}Pu ratios indicate global fallout as the plutonium source for most samples. The plutonium of the reactors of Fukushima Dai-ichi is located in the upper layers like in vegetation or litter. From the uranium ratios alone the reactors could not unambigously be identified as the source of {sup 236}U. However, this is plausible in the cases were reactor plutonium was detected. None of the samples contained higher plutonium activity concentrations than in the rest of Japan, caused by global fallout. This
Morales Hernandez, Maria B.
The review of municipal solid waste (MSW) management scheme has indicated that the amount of MSW sent to incineration plants will increase in the UK in coming years. Therefore, the amount of municipal solid waste incineration (MSWI) residues generated will increase significantly. MSWI residues are divided into MSWI fly ash (MSWI-FA) and MSWI bottom ash (MSWI-BA). MSWI-FA is classified as hazardous residue thereby requires special treatment before disposal. MSWI-BA is mostly disposed in landfill sites. MSWI-BA fraction with particle size diameter below approximately 2mm has low engineering properties and may have an adverse effect on the environment due to its high porosity, solubility and leachability of possible toxic compounds. This research programme has investigated new potential uses and leaching behaviour of mortar containing MSWI-BA with particle size diameters below 2.36mm. Fraction of MSWI-BA with particle size diameters (φ) below 2.36 mm (φ <2.36) was divided into different sub-fractions to evaluate their influence on compressive strength of concrete when used as partial replacement of cement or sand. MSWI-BA fraction with φ <212mum (fine fraction) and 212mum < φ2.36mm (coarse fraction) used as partial replacement of cement and sand respectively, showed higher compressive strength compared with the other fractions examined. In addition, replacing sand with the coarse fraction of MSWI-BA exhibited similar or higher strength than the reference mix. Examination of physical and chemical properties of the fine and coarse fractions of MSWI-BA unbound indicated that both fractions had potential to be used as replacement of cement or sand. However, the evaluation of their leaching behaviour suggested that they should be bound in cement-based systems to avoid leaching of potential toxic elements. Evaluation of physical, mechanical and sulfate resistance properties of mortars containing 15% of the fine fraction of MSWI-BA as a partial replacement of cement and
Directory of Open Access Journals (Sweden)
Bárbara Carolina Teixeira Amado
2009-01-01
Full Text Available OBJETIVO: identificar os indicadores de risco para perda auditiva em recém-nascidos de um hospital da rede pública de Campinas - São Paulo, no período de julho de 2007 a janeiro de 2008. MÉTODOS: a amostra foi composta por 589 protocolos de neonatos avaliados no Programa de Triagem Auditiva Neonatal Universal, no período. RESULTADOS: do total de protocolos estudados, 152 (25,8% evidenciaram presença de indicadores de risco para surdez em neonatos. Dentre eles, os mais prevalentes, em ordem decrescente, foram: antecedentes familiares (26,3%, boletim Apgar de 0 a 4 no primeiro minuto (23,6%, uso de medicamentos ototóxicos (23,6%, permanência em incubadora (22,3%, hiperbilirrubinemia (21,7% e permanência em Unidade de Terapia Intensiva Neonatal (18,4%. CONCLUSÃO: o número de indicadores de risco encontrados por neonato variou de um a seis. Dentre os neonatos com indicadores de risco, apenas um bebê falhou nas três avaliações realizadas na triagem auditiva, sendo que, de acordo com seu protocolo, ele apresentava três indicadores de risco para surdez.PURPOSE: to identify the hearing loss risk indicators in newborns at a public hospital facility in Campinas - São Paulo, in the period from July 2007 to January 2008. METHODS: sample composed of 589 protocols of newborns evaluated in the Program of Universal Hearing Screening during the considered period. RESULTS: 152 protocols (25.8% showed hearing loss risk indicators. Among them, the most prevalent were, in decreasing order: family antecedents (26.3 %; Apgar index from 0 to 4 in the first minute (23.6%; ototoxic drug use (23.6 %, incubator permanence (22.3%, hyperbilirubinemia of the newborn (21.7% and permanence in Neonatal Intensive Care Unit (18.4%. CONCLUSION: the number of risk indicators found per newborn ranged from 1 to 6. Among the newborns with hearing loss risk indicators, just one baby failed in the three evaluations conducted in the hearing screening program. This baby
Nóbrega, Clévio; Khadem, Mahnaz; Aguadé, Montserrat; Segarra, Carmen
2008-08-01
Chromosomal inversion polymorphism affects nucleotide variation at loci associated with inversions. In Drosophila subobscura, a species with a rich chromosomal inversion polymorphism and the largest recombinational map so far reported in the Drosophila genus, extensive genetic structure of nucleotide variation was detected in the segment affected by the O(3) inversion, a moderately sized inversion at Muller's element E. Indeed, a strong genetic differentiation all over O(3) and no evidence of a higher genetic exchange in the center of the inversion than at breakpoints were detected. In order to ascertain, whether other polymorphic and differently sized inversions of D. subobscura also exhibited a strong genetic structure, nucleotide variation in 5 gene regions (P236, P275, P150, Sxl, and P125) located along the A(2) inversion was analyzed in A(st) and A(2) chromosomes of D. subobscura. A(2) is a medium-sized inversion at Muller's element A and forms a single inversion loop in heterokaryotypes. The lower level of variation in A(2) relative to A(st) and the significant excess of low-frequency variants at polymorphic sites indicate that nucleotide variation at A(2) is not at mutation-drift equilibrium. The closest region to an inversion breakpoint, P236, exhibits the highest level of genetic differentiation (F(ST)) and of linkage disequilibrium (LD) between arrangements and variants at nucleotide polymorphic sites. The remaining 4 regions show a higher level of genetic exchange between A(2) and A(st) chromosomes than P236, as revealed by F(ST) and LD estimates. However, significant genetic differentiation between the A(st) and A(2) arrangements was detected not only at P236 but also in the other 4 regions separated from the nearest breakpoint by 1.2-2.9 Mb. Therefore, the extent of genetic exchange between arrangements has not been high enough to homogenize nucleotide variation in the center of the A(2) inversion. A(2) can be considered a typical successful inversion
Journal of Earth System Science | Indian Academy of Sciences
Indian Academy of Sciences (India)
pp 223-236. 1420 Ma diabasic intrusives from the Mesoproterozoic Singhora Group, Chhattisgarh Supergroup, India: Implications towards non-plume intrusive activity · Priyabrata Das Kaushik Das Partha Pratim Chakraborty S Balakrishnan · More Details Abstract Fulltext PDF. Besides offering significant clues towards ...
Czech Academy of Sciences Publication Activity Database
Kic, P.; Zajíček, Milan
2010-01-01
Roč. 19, č. 5 (2010), s. 234-236 ISSN 1210-1389 Institutional research plan: CEZ:AV0Z10750506 Keywords : Broiler house * ventilation * CFD Subject RIV: GB - Machines ; Buildings for Agriculture http://library.utia.cas.cz/separaty/2013/VS/zajicek-0394117.pdf
Anna Groundwater, The Scottish Middle March 1573-1625: Power, Kinship, Allegiance
Directory of Open Access Journals (Sweden)
Janine van Vliet
2011-09-01
Full Text Available Anna Groundwater. The Scottish Middle March 1573-1625: Power, Kinship, Allegiance. Royal Historical Society Studies in History, New Series. Woodbridge, UK: The Boydell Press, 2010. Pp. 236. ISBN 978-0-86193-307-5. £50.00; US$90.00.
Czech Academy of Sciences Publication Activity Database
Chrz, Vladimír; Čermák, Ivo
2015-01-01
Roč. 59, č. 1 (2015), s. 1-16 ISSN 0009-062X R&D Projects: GA ČR(CZ) GAP407/12/2432 Institutional support: RVO:68081740 Keywords : narrative complexity * differentiation * integration Subject RIV: AN - Psychology Impact factor: 0.236, year: 2015
Indian Academy of Sciences (India)
Srimath
236 The Central Dogma of Molecular Biology. A Retrospective after Fifty Years. Michel Morange. 248 Chemistry is Evergreen... 2008 Nobel Prize in Chemistry. Swagata Dasgupta. 248. 226. Page 2. 215. RESONANCE | March 2009. DEPARTMENTS. Editorial. Biman Nath. Hubble Space Telescope, launched in 1991.
Plasma modification of polycarbonates
Czech Academy of Sciences Publication Activity Database
Zajíčková, L.; Bursíková, V.; Peřina, Vratislav; Macková, Anna; Subedi, D.; Janča, J.
2001-01-01
Roč. 142, - (2001), s. 449-454 ISSN 0257-8972 R&D Projects: GA ČR GV202/97/K038; GA AV ČR KSK1010104 Subject RIV: BG - Nuclear, Atomic and Molecular Physics, Colliders Impact factor: 1.236, year: 2001
Czech Academy of Sciences Publication Activity Database
Lacey, M. J.; Sémon, E.; Krasulová, Jana; Sillam-Dusses, David; Robert, A.; Cornette, R.; Hoskovec, Michal; Žáček, Petr; Valterová, Irena; Bordereau, Ch.
2011-01-01
Roč. 57, č. 12 (2011), s. 1585-1591 ISSN 0022-1910 Institutional research plan: CEZ:AV0Z40550506 Keywords : sex-specific pheromone s * basal termites * classification * phylogenetic relationships * zootermopsis Subject RIV: CC - Organic Chemistry Impact factor: 2.236, year: 2011
Estimating the burden of disease attributable to diabetes South ...
African Journals Online (AJOL)
... World Health Organization comparative risk assessment (CRA) methodology was ... Monte Carlo simulation-modelling techniques were used for uncertainty analysis. ... uncertainty interval 236 856 - 290 849) in South Africa in 2000, accounting ... of the disease through multi-level interventions and improved management ...
D. Erran Seaman
1997-01-01
We monitored the threatened Northern Spotted Owl (Strix occidentalis caurina) in Olympic National Park from 1992 through 1996. We used a stratified random sampling scheme to survey 35 plots totaling 236 km?, approximately 10 percent of the forested area of the park.