WorldWideScience

Sample records for bericht ii untersuchung

  1. Student und Wissenschaft: soziale Faktoren des wissenschaftlichen Engagements der Studenten ; spezieller Bericht "Student 79"

    OpenAIRE

    Lange, Günter

    1982-01-01

    Die Ausgangsfragestellung, wie soziale Beziehungen im Studienprozeß das wissenschaftliche Engagement der Studenten beeinflussen, wird aufgrund vorliegenden empirischen Materials (der Autor stützt sich primär auf die Ergebnisse der Untersuchung STUDENT 79) auf die Analyse des Verhältnisses der Studenten zu den Lehrkräften eingegrenzt. Der Verfasser äußert sich zur Gültigkeit seiner Aussagen: "Der Bericht trägt den Charakter einer Zusammenfassung vorläufiger Ergebnisse zum Problem und bedarf ti...

  2. Optical investigations and control of spindynamics in Mn doped II-VI quantum dots; Optische Untersuchung und Kontrolle der Spindynamik in Mn dotierten II-VI Quantenpunkten

    Energy Technology Data Exchange (ETDEWEB)

    Schmidt, Thomas

    2009-05-13

    The present thesis deals with the spin of charge carriers confined in CdSe/ZnSe quantum dots (QDs) closely linked to the polarization of emitted photons. II-VI material systems can be adequately mixed with the B-group element manganese. Such semimagnetic nanostructures offer a number of characteristic optical and electronic features. This is caused by an exchange interaction between the spin of optically excited carriers and the 3d electrons of the Mn ions. Within the framework of this thesis addressing of well defined spin states was realized by optical excitation of charge carriers. The occupation of different spin states was detected by the degree of polarization of the emitted photoluminescence (PL) light. For that purpose different optical methods of time-resolved and time-integrated spectroscopy as well as investigations in magnetic fields were applied. (orig.)

  3. Analyses and results of the OECD/NEA WPNCS EGUNF benchmark phase II. Technical report; Analysen und Ergebnisse zum OECD/NEA WPNCS EGUNF Benchmark Phase II. Technischer Bericht

    Energy Technology Data Exchange (ETDEWEB)

    Hannstein, Volker; Sommer, Fabian

    2017-05-15

    The report summarizes the performed studies and results in the frame of the phase II benchmarks of the expert group of used nuclear fuel (EGUNF) of the working party of nuclear criticality safety (WPNCS) of the nuclear energy agency (NEA) of the organization for economic co-operation and development (OECD). The studies specified within the benchmarks have been realized to the full extent. The scope of the benchmarks was the comparison of a generic BWR fuel element with gadolinium containing fuel rods with several computer codes and cross section libraries of different international working groups and institutions. The used computational model allows the evaluation of the accuracy of fuel rod and their influence of the inventory calculations and the respective influence on BWR burnout credit calculations.

  4. Berichte zu Pflanzenschutzmitteln 2010 Jahresbericht Pflanzenschutz-Kontrollprogramm

    CERN Document Server

    Dombrowski, Saskia

    2012-01-01

    In der Bundesrepublik Deutschland überwachen die Länderbehörden die Einhaltung der Vorschriften für das Inverkehrbringen und die Anwendung von Pflanzenschutzmitteln. 2010 wurden bundesweit 2558 Handelsbetriebe sowie 4909 land- und forstwirtschaftliche sowie Gartenbau-Betriebe kontrolliert. Darüber hinaus haben Kontrollstellen fast 100 Tausend Pflanzenschutzgeräte überprüft und die physikalischen, chemischen und technischen Eigenschaften von 157 Pflanzenschutzmitteln untersucht. Der vorliegende Bericht fasst die Ergebnisse dieser Kontrollen zusammen.

  5. Further development of the methodology for the realization of safety analyses concerning the controllability of operational malfunctions and accidents. Report on the working package 1. Review and development of safety-related assessment for final repositories for wastes with negligible heat generation and the provision of the necessary set of tools using the example of the final repository Konrad; Weiterentwicklung der Methodik fuer die Durchfuehrung von Sicherheitsanalysen zur Beherrschung von Betriebsstoerungen und Stoerfaellen. Bericht zum Arbeitspaket 1. Untersuchung und Entwicklung von sicherheitstechnischen Bewertungen fuer Endlager fuer Abfaelle mit vernachlaessigbarer Waermeentwicklung und Bereitstellung des notwendigen Instrumentariums am Beispiel des Endlagers Konrad

    Energy Technology Data Exchange (ETDEWEB)

    Hartwig-Thurat, Eva; Uhlmann, Stephan

    2015-09-15

    In the research project on the ''Review and development of safety-related assessments of disposal facilities with negligible heat generation; development and provision of the necessary set of tools, using the example of the Konrad disposal facility'' (Untersuchung und Entwicklung von sicherheitstechnischen Bewertungen fuer Endlager fuer Abfaelle mit vernachlaessigbarer Waermeentwicklung; Entwicklung und Bereitstellung des notwendigen Instrumentariums am Beispiel des Endlagers Konrad - Forschungsvorhaben 3612R03410), the state of the art in science and technology of the safety-related assessments and sets of tools for building a safety case was examined. The reports pertaining to the two work packages described the further development of the methodology for accident analyses (WP 1) and of building a safety case (WP 2); also, comparisons were drawn on a national and international scale with the methods applied in the licensing procedure of the Konrad disposal facility. As part of the project, the report of Work Package 1 depicts the methodology of the operating safety analysis in order to control malfunctions and incidents (accident analysis) using the example of the Konrad mine accident analysis. Set of criteria in this connection is the state-of-the-art international and national comprehensive body of legislation identifying the incident requirements. In extracts complementary safety analysis procedures of other countries are presented where applicable. It becomes apparent, that the majority of the investigated countries use a deterministic accident analyses to identify incidents. Here, common international practice is to com-plement the deterministic accident analysis by a probabilistic analysis. This procedure acts on the IAEA (International Atomic Energy Agency) terms of reference using both deterministic and probabilistic methods for the determination of facility hazard potentials. Based on the Konrad mine method, aspects of incident

  6. Leitung und Kooperation in wissenschaftlichen Bibliotheken Berlins - eine empirische Untersuchung

    OpenAIRE

    Paul, Gerhard

    1998-01-01

    Die vorliegende Arbeit greift ein im bibliotheks- und IuK-wissenschaftlichen sowie im fachprofessionellen Diskurs bisher weitgehend vernachlässigtes, aber immer bedeutsameres Thema auf: das vertikale soziale Geschehen in der Arbeitsorganisation ?wissenschaftliche Bibliothek". Die Absicht der Untersuchung lag darin, einen Zusammenhang zwischen dem Interaktionsverhalten der Leitungspersonen einerseits und der Mobilisierung von Leistungs- und Innovationspotentialen bei den Mitarbeiterinnen und M...

  7. Qualifizierungsbedarfe, -ansätze und -strategien im Secondhand Sektor. Ein Europäischer Good-Practice-Bericht

    OpenAIRE

    Arold, Heike; Koring, Claudia; Windelband, Lars

    2008-01-01

    Vor dem Hintergrund eines sich ändernden Konsumverhaltens sowie des Wandels in der Umweltpolitik ist zukünftig mit einem Wachstum des Secondhand Sektors zu rechnen. Um die Qualität sowie die Professionalisierung innerhalb der im Sektor operierenden Unternehmen zu stärken, bedarf es der Entwicklung einer europaweit einheitlichen und sektorspezifischen Qualifizierung, die an den realen Arbeitsprozessen und Anforderungen ausgerichtet ist. Der vorliegende Good-Practice-Bericht zeigt neben einer a...

  8. Technical description of the test section SUCOT to investigate a water/steam two-phase flow; Technische Beschreibung der Testanlage SUCOT zur Untersuchung Wasser/Wasserdampf Zweiphasenstroemung

    Energy Technology Data Exchange (ETDEWEB)

    Daubner, M.; Janssens-Maenhout, G.; Knebel, J.U.

    2002-02-01

    Within the POOLTHY Project of the European Union (Euratom Fourth Framework Programme contract FJ4J-CT95-0003) an active/passive concept (SUCO-Programme) was investigated which controls the heat removal after a potential core melt-down accident in an evolutionary light water reactor by spreading and stabilising the core melt in the reactor sump and flooding the melt with sump water from above. The experiments were performed in the test facility SUCOT which was designed and erected at the Institute for Nuclear and Energy Technologies (IKET). The report gives an overview on the SUCO-Programme and the scaling analysis, which was applied to design the test facility SUCOT. A detailed technical description of the test facility SUCOT is given, in which the natural circulation driven two-phase flow within the reactor sump and relevant phenomena such as flow boiling, disperse bubbly flow with and without mass transfer, and geysering are investigated. The major components of the test facility, the three-loop system and the instrumentation are described. Finally, a perspective for future application of the gained knowledge is given. (orig.) [German] Im Rahmen des POOLTHY Projekts der Europaeischen Union (Euratom Fourth Framework Programme Kennzeichen FJ4J-CT95-0003) wurde ein aktiv/passives Konzept (SUCO-Programm) zur Beherrschung der Nachwaermeabfuhr nach einem potenziellen Kernschmelzunfall in einem evolutionaeren Leichtwasserreaktor untersucht. Das Konzept sieht eine stabile Ausbreitung der Kernschmelze im Reaktorsumpf und deren Kuehlung von oben mit Sumpfwasser vor. Die experimentellen Arbeiten wurden in der dafuer entwickelten und am Institut fuer Kern- und Energietechnik (IKET) gebauten Testanlage SUCOT durchgefuehrt. Der Bericht gibt einen Ueberblick ueber das SUCO-Programm und die Aehnlichkeitsskalierung, die zur Auslegung der Testanlage SUCOT verwendet wurde. Es wird eine detaillierte technische Beschreibung der Testanlage SUCOT gegeben, die zur Untersuchung der durch

  9. Examination of the e{sup +} and e{sup +}e{sup -} pair emission from heavy ion collisions at the EPoS II spectrometer; Untersuchung der e{sup +}- und e{sup +}e{sup -}-Paaremission aus Schwerionenkollisionen mit dem EPoS II Spektrometer

    Energy Technology Data Exchange (ETDEWEB)

    Baumann, J.

    1996-12-01

    In the course of examination of the positron and positron-electron pair emission from heavy ion collisions at the Coulomb barrier, the research groups EPOS I and ORANGE have found a number of line structures in the measured positron energy and cumulative pair energy spectra which up to present could not be fully explained, as theoretical interpretations so far remain inconsistent in some respects. For clarification, further measurements have been made at the completely new designed EPoS II spectrometer. Reproducibility of the lines is possible at a high level of statistical significance. (orig./CB) [Deutsch] Bei Untersuchungen der Positron- und Positron- Elektron- Paaremissionaus Schwerionenkollisionen an der Coulombbarriere wurde von den Gruppen EPOS I und ORANGE eine Reihe von Linienstrukturen in den gemessenen Positronenenergie- und Paarsummenenergiespektren beobachtet, fuer die bislang keine in allen Punkten konsistente, theoretische Erklaerunggefunden werden konnte. Um ihre Ursachen zu klaeren, wurden mit dem voellig neu aufgebauten EPoS II Spektrometer weitere Messreihen durgefuehrt. Die Reproduzierbarkeit der Linien ist auf einem hohen statistischen Signifikanzniveau moeglich.

  10. [Anja Wilhelmi. Lebensweltlen von Frauen der deutschen Oberschicht im Baltikum (1800-1939). Eine Untersuchung anhand von Autobiographien] / Alexander Ewig

    Index Scriptorium Estoniae

    Ewig, Alexander, 1980-

    2011-01-01

    Arvustus: Wilhelmi, Anja. Lebenswelten von Frauen der deutschen Oberschicht im Baltikum (1800-1939). Eine Untersuchung anhand von Autobiographien. (Veröffentlichungen des Nordost-Instituts, 10.) (Wiesbaden : HArrassowitz 2008)

  11. Zur Konstruktion von ''Männlichkeit'' bei ''Ultras'' : eine empirische Untersuchung zur Fanszene in Bremen

    OpenAIRE

    Guth, Oliver

    2014-01-01

    ''Männliche'' Herrschaftsstrukturen sind innerhalb der gesamten Gesellschaft stark verbreitet. Dies spiegelt sich dementsprechend auch in Fußballfanszenen wider. Diese Arbeit untersucht daher die Konstruktion von Männlichkeit bei ''Ultras'', da diese mit ihrer starken Präsens und ihren aufwendigen Choreographien in Stadien großen Einfluss vor allem auf Jugendliche haben. Ziel der Untersuchung ist es, Mechanismen innerhalb der Fanszene aufzuzeigen um somit pädagogisch zu intervenieren, damit g...

  12. Ergebnisse einer empirischen Untersuchung zur Klangfarbenwahmehmung von Vorschulkindern mit einem Klangmemory

    OpenAIRE

    Schellberg, Gabriele

    1998-01-01

    Im Unterschied zu anderen Bereichen der musikalischen Wahrnehmung gibt es zur Klangfarbenwahmehmung nur wenige Untersuchungen. Ein Grund dafür dürfte in den methodischen Schwierigkeiten liegen, die insbesondere bei der Untersuchung kleiner Kinder auftreten. Ein Klangfarbentest für Vorschulkinder existiert bislang nicht. Daher wurde nach mehreren Voruntersuchungen ein „Klangfarben-Memory“ als Methode entwickelt und bei Vorschulkindern eingesetzt. Die Ergebnisse dieser empirischen Studie werden...

  13. Potentiale und Barrieren der Nutzung des Mobile Payment aus Kundensicht: eine empirische Untersuchung

    OpenAIRE

    Haarstick, Felix

    2016-01-01

    Während sich das Zahlungsverfahren Mobile Payment seit einigen Jahren international mehr und mehr etabliert, fristet es entgegen jährlich wiederkehrender Erfolgsprognosen in Deutschland immer noch ein Nischendasein. Die vorliegende Untersuchung entstand im Rahmen einer Bachelorarbeit des Studiengangs der Betriebswirtschaftslehre an der Hochschule Hannover und beschäftigt sich mit den Potentialen und Barrieren der Nutzung des Mobile Payment aus Kundensicht, mit dem Ziel, die wesentlichen Fakto...

  14. Flood defence in the catchment of the Hessian Lahn river. Manual pt. 1: Summarized report; Vorbeugender Hochwasserschutz im Einzugsgebiet der hessischen Lahn. Handbuch. T. 1: Zusammenfassender Bericht

    Energy Technology Data Exchange (ETDEWEB)

    Lang, T.; Toensmann, F.

    2002-06-01

    meadows. Middle course sections (3-10 permille), upper course sections (10-100 permille), and steep sections (>100 permille), which are predominantly in notched valleys, can also be found, as typical for low mountain ranges. These areas are less compatible for water retention in meadows. The construction of flood retention basins is recommended. (orig.) [German] In den Jahren 2000 und 2001 wurde von einer Projektgruppe unter Leitung des Fachgebietes Wasserbau und Wasserwirtschaft der Universitaet Kassel im Rahmen der Gemeinschaftsinitiative INTERREG IIC und des Aktionsprogramms IRMA der Europaeischen Union, das Projekt 'Vorbeugender Hochwasserschutz im hessischen Einzugsgebiet der Lahn' (Einzugsgebietsgroesse rd. 4500 km{sup 2}) bearbeitet. Ziel des Projektes war es, in einem wissenschaftlichen Teil ein Hochwasserschutzkonzept des natuerlichen Wasserrueckhaltes ohne grosse Hochwasserrueckhaltebecken zu entwickeln und parallel dazu in 9 Teilprojekten Erfahrung mit der Umsetzung zu sammeln. Die hydrologische und hydraulische Effektivitaet, die Raumwirksamkeit und die Umweltvertraeglichkeit sollten geprueft und eine monetaere Bewertung durchgefuehrt werden. Die Ergebnisse werden in diesem zusammenfassenden Bericht dargestellt. Dazu wurden systematisch die Handlungsvorgaben der drei Strategien 'Natuerlicher Wasserrueckhalt', 'Technischer Hochwasseschutz' und 'Weitergehende Hochwasservorsorge' optimiert. Durch eine integrative Bearbeitung war es moeglich, insbesondere das Retentionspotential in der Gewaesserrenaturierung und in der Talauennutzung, aber auch in Siedlungsgebieten, quantitativ und teilweise monetaer zu erfassen. Breiten Raum nahm auch die Untersuchung der Umweltvertraeglichkeit ein. Als Ergebnis laesst sich feststellen, dass als ueberoertliche Massnahmen der Wasserrueckhalt in Gewaesser und Aue, die Flaechennutzungsaenderung ausserhalb von Ortslagen und der Hochwasserrueckhalt in den Nebentaelern bevorzugt verwirlicht

  15. Bildung für eine nachhaltige Entwicklung. Bericht der BLK an die Regierungschefs von Bund und Ländern zur Umsetzung des Orientierungsrahmens

    OpenAIRE

    2001-01-01

    Der Orientierungsrahmen "Bildung für eine nachhaltige Entwicklung" wurde 1998 durch die Bund-Länder-Kommission für Bildungsplanung und Forschungsförderung (BLK) beschlossen. In dem vorliegenden Dokument wird auf der Grundlage einer Umfrage der BLK-Geschäftsstelle bei den Kultus- und Wissenschaftsministerien über seine Umsetzung berichtet. Der Bericht gliedert sich wie folgt: 1. Rechtliche und politische Grundlagen sowie landesspezifische Initiativen/Programme einer Bildung für nachhaltige Ent...

  16. Physikochemische Untersuchung der Analyt – HKUST-1 Wechselwirkung unter Verwendung der inversen Gaschromatographie

    OpenAIRE

    Münch, Alexander

    2013-01-01

    Die vorliegende Arbeit hat neben der Untersuchung der Synthese über den Controlled SBU-Approach von HKUST-1, ein poröses Kupfertrimesat, die Abscheidung dieses Metal-Organic Frameworks in dünnen Quarzglaskapillaren mit einer Länge von 10 bis 30 m und Innendurchmessern zwischen 0,53 und 0,25 mm zum Thema. Diese Säulen werden zur gaschromatographischen Trennung wie auch zur Bestimmung physikochemischer Kenngrößen, die den Adsorptionsvorgang verschiedener Analyten auf der HKUST-1 Oberfläche besc...

  17. Untersuchung der Produktion charmhaltiger Mesonen in der Photon-Photon-Streuung mit dem OPAL-Experiment

    CERN Document Server

    Patt, Jochen

    2001-01-01

    Die Produktion von Charm-Quarks in der Photon-Photon-Streuung wird ueber den Nachweis charmhaltiger Mesonen untersucht. Die Arbeit basiert auf den Daten, die mit dem OPAL-Detektor am Elektron-Positron-Speicherring LEP am CERN in Genf in den Jahren von 1989 bis 1998 aufgenommen worden sind. Anhand des Charmonium-Zustandes Chi(c2) wird die Resonanzproduktion von Charm-Quarks untersucht und die Zwei-Photon-Breite des Chi(c2)-Mesons wird gemessen. Geladene D*-Mesonen werden zur Untersuchung der offenen Produktion von Charm-Quarks benutzt. Der Anteil des direkten und des einfach-aufgeloesten Produktionsmechanismus, differentielle D*-Wirkungsquerschnitte, der totale Charm-Wirkungsquerschnitt sowie die Charm-Strukturfunktion des Photons werden bestimmt.

  18. Schreiben hat auch eine Stimme. Eine explorative Untersuchung über die Beziehung zwischen lautem Sprechen und Schreiben.

    OpenAIRE

    Lohmeier-Weidner, Yvonne (B. A.)

    2017-01-01

    Die Aufgabe in dieser Arbeit ist die Untersuchung der Beziehung zwischen lautem Sprechen und Schreiben im Schreibprozess. Grundlage ist die Annahme, dass beides zusammengehört und das Verbalisieren von Gedanken zum Schreiben, ob im Dialog oder im Selbstgespräch, selbiges positiv unterstützt. Dazu werden drei Studentinnen der Universität Paderborn, die an einem Abschlussarbeitenworkshop des Kompetenzzentrums Schreiben teilnahmen, durch ein fokussiertes Interview befragt. Diese Interviews werde...

  19. Die Wirkung von Work-Life Balance Initiativen auf das Mitarbeitercommitment: Eine empirische Untersuchung in der Unternehmensberatungsbranche

    OpenAIRE

    Kaiser, Stephan; Ringlstetter, Max; Reindl, Cornelia U.; Stolz, Martin Lothar

    2010-01-01

    Der vorliegende Beitrag untersucht die Wirkung von unternehmerischen Work-Life Balance Initiativen für die emotionale Bindung der Mitarbeiter zum Unternehmen, d. h. das organisationale Commitment von Mitarbeitern im Kontext der Unternehmensberatung. Dazu wurde eine Untersuchung mit insgesamt 275 Unternehmensberaterinnen und -beratern durchgeführt. Die Datenanalyse erfolgte anhand eines PLSStrukturgleichungsmodells (Partial-Least-Squares-Ansatz). Die Ergebnisse weisen darauf hin, dass auch in ...

  20. Delphi report 1995 on developments in science and technology. Mini Delphi; Delphi-Bericht 1995 zur Entwicklung von Wissenschaft und Technik. Mini-Delphi

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1996-03-01

    In August 1993 the first German `Delphi Report on Developments in Science and Technology` was published. It was elaborated by the Fraunhofer Institute for System Engineering and Innovation Research (FhG-ISI) in cooperation with the Japanese National Institute of Science and Technology Policy (NISTEP). The `MINI-DELPHI` now completed by FhG-ISI, again in cooperation with NISTEP, is a further development of the Delphi approach in that it is more differentiated in its questions and assessment criteria than its predecessors. `MINI-DELPHI` is not intended as a comprehensive forecast on technology in general but rather focusses on key topics. Its emphasis is on technology demand and the relevance of technologies to social issues. Although the Mini-Delphi study was primarily aimed at further refining the methodology employed, it nevertheless contains a wealth of information and details on circumscript questions. The requisite database is provided by tables on the results of two inquiry rounds among Japanese and German experts. (orig./RHM) [Deutsch] Im August 1993 wurde der erste deutsche `Delphi-Bericht zur Entwicklung von Wissenschaft und Technik` veroeffentlicht. Er war vom Fraunhofer-Institut fuer Systemtechnik und Innovationsforschung (FhG-ISI) in Zusammenarbeit mit dem japanischen National Institute of Science and Technology Policy (NISTEP) erarbeitet worden. Mit dem jetzt vorliegenden `MINI-DELPHI` hat das FhG-ISI - wieder in Zusammenarbeit mit dem NISTEP - den Delphi-Ansatz fortentwickelt und sowohl hinsichtlich der Fragen als auch der Beurteilungskriterien weiter ausdifferenziert. `MINI-DELPHI` bezweckt keine umfassende Technologievorausschau, sondern konzentriert sich auf Schluesselthemen. Im Vordergrund steht der Gedanke des Technikbedarfs und die Relevanz fuer gesellschaftliche Fragestellungen. Obwohl die Mini-Delphi-Studie vorrangig der Weiterentwicklung der Methodik dient, enthaelt sich eine Fuelle von Informationen und Details zu Einzelfragen. Die im Bericht

  1. Investigation of a matrix converter for contactless power transmission systems; Untersuchung eines Matrixumrichters fuer kontaktlose Energieuebertragungssysteme

    Energy Technology Data Exchange (ETDEWEB)

    Ecklebe, Andreas

    2009-05-22

    Arbeit beschaeftigt sich mit einem drei- zu zweiphasigen Matrixumrichter zur Speisung von kontaktlosen Energieuebertragungssystemen. Aufbauend auf einer Darlegung relevanter Untersuchungen zur Thematik werden zunaechst moegliche Resonanzanordnungen fuer kontaktlose Energieuebertragungssysteme untersucht. Die Betrachtung wichtiger elektrischer Parameter zeigt neben den Unterschieden der einzelnen Anordnungen auch, dass fuer eine auf den speisenden Umrichter fokussierte Untersuchung eine einfache Modellierung der drei untersuchten Resonanzanordnungen mit Hilfe eines Reihenschwingkreises moeglich ist. Als Konsequenz ergibt sich die Schlussfolgerung, dass sich die erzielten Ergebnisse auch fuer den Matrixumrichter mit anderen serienresonanten Lasten anwenden lassen. Der zweite Teil der Arbeit ist der Untersuchung des Matrixumrichters gewidmet. Basierend auf einer theoretischen Beschreibung wird die Kombination von hochfrequenten Steuerverfahren - wie z.B. der Blocktaktung - und niederfrequenten Pulsmustern zur Stellung des Oberschwingungsgehalts der Netzstroeme vorgestellt. Die Aehnlichkeit des Umrichters zu einem konventionellen Wechselrichter in H-Brueckenschaltung ermoeglicht anschliessend eine Betrachtung der Kommutierung und die Ableitung notwendiger Schaltzustaende. Diese sind dadurch gekennzeichnet, dass zu jedem Zeitpunkt genau eine bidirektionale Verbindung vom Eingangssystem zu jeder Ausgangsphase besteht. Die Funktionsweise der Kommutierung wie auch des gesamten Umrichters wird in einem ersten Schritt simulativ belegt. Dabei wird auch das dynamische Schaltverhalten der Leistungshalbleiter beruecksichtigt. Anschliessend werden an einem Laboraufbau aufgenommene Messergebnisse vorgestellt und mit den theoretischen Ergebnissen verglichen. Der Laboraufbau besteht aus dem Leistungsteil des Matrixumrichters mit Eingangsfiltern und modularen Gate-Treibern, einem DSP/FPGA-Steuerungssystem und einem kontaktlosen Energieuebertragungssystem mit sekundaerseitigem Gleichrichter

  2. Testing and modification of a simple flow turbine; Messtechnische Untersuchung und Modifikation einer einfachen Durchstroemturbine

    Energy Technology Data Exchange (ETDEWEB)

    Gentner, C. [Stuttgart Univ. (Germany). Inst. fuer Stroemungsmechanik und Hydraulische Stroemungsmaschinen; Fischer, G. [SKAT, St. Gallen (Switzerland)

    1997-12-31

    A study conducted at the IHS had the aim to obtain basic information on whether it is possible to build flow turbines following the free jet principle that are on a par with, or superior to, the conventional design, especially in terms of performance and the efficiency curve. Several inflow contours with a ventilated free jet and a conventional flow turbine were studied. The direct comparison of these variants revealed a slightly enhanced peak load efficiency and a very distinct superiority of the free jet contour during partial load. But the efficiency of all variants failed to attain the values claimed by commercial manufacturers. As compared to the initial contour, peak load efficiency was enhanced by 5 per cent. During partial load, the variants studied showed a distinct superiority of the free jet concept over the contour of conventional flow turbines. (orig.) [Deutsch] Am IHS wurde eine Untersuchung mit dem Ziel durchgefuehrt, grundlegende Aussagen zu gewinnen, ob Durchstroemturbinen mit dem Freistrahlprinzip gebaut werden koennen, die dem konventionellen Design, vor allem in bezug auf Leistungsausbeute und Wirkungsgradverlauf, gleichwertig oder ueberlegen sind. Es wurden mehrere Anstroemkonturen mit belueftetem Freistrahl und einer konventionellen Durchstroemturbine untersucht. Der direkte Vergleich der am Institut untersuchten Varianten ergab bei etwas hoeherem Spitzenwirkungsgrad sehr deutliche Vorteile der Freistrahlkontur im Teillastbereich. Das Wirkungsgradniveau aller Varianten lag jedoch unter den Werten, die von kommerziellen Herstellern veroeffentlicht werden. Gegenueber der Ausgangskontur wurde im Spitzenwirkungsgrad eine Verbesserung von 5% erreicht. Im Teillastbereich ergibt sich fuer die hier untersuchten Varianten eine deutliche Ueberlegenheit der Freistrahlkonzeption ueber die Kontur konventioneller Durchstroemturbinen. (orig.)

  3. Investigation of mass transfer phenomena in biofilm systems; Untersuchung von Stoffuebergangsphaenomenen in Biofilmsystemen

    Energy Technology Data Exchange (ETDEWEB)

    Waesche, S.; Hempel, D.C. [Technische Univ. Braunschweig (Germany). Inst. fuer Bioverfahrenstechnik; Horn, H. [Fachhochschule Magdeburg (Germany). Hydro- und Abfallchemie

    1999-07-01

    Substance transfer in the boundary layer bulk/biofilm can be only inadequately described by conventional model concepts. In such cases where the surface structure of a biofilm adapts to given hydraulic conditions, the substance transfer phenomena need to be studied in depth. In addition, the entire biofilm structure is much influenced both by substrate conditions and by hydrodynamic conditions during growth. With a view to quantifying these factors, biofilms were cultured under various substrate and hydrodynamic conditions in tube reactors with a diameter of 2.6 cm. For characterizing the cultured biofilms, biofilm density and substrate turnover measured as maximum mass transfer density were determined in each test series. Biofilm density (dry biomass/biofilm volume) was determined by gravimetry. Maximum mass transfer densities in biofilm were established in batch experiments with excess substrate. By means of oxygen microelectrodes, oxygen profiles in the biofilm were measured directly in the reactor. These measurements concerned biofilms of thicknesses ranging from 400 to 2000 {mu}m, where the biofilms did not yet exhibit erosion. (orig.) [German] Der Stoffuebergang in der Grenzschicht Bulk/Biofilm ist mit herkoemmlichen Modellvorstellungen nur ungenuegend beschreibbar. Eine sich an die aktuellen hydraulischen Bedingungen anpassende Oberflaechenstruktur des Biofilms erfordert eine intensive Untersuchung der Stoffuebergangsphaenomene in derartigen Systemen. Darueber hinaus wird die gesamte Biofilmstruktur sowohl von den Substratbedingungen als auch von den hydrodynamischen Bedingungen waehrend des Wachstums stark beeinflusst. Um diese Faktoren quantifizieren zu koennen, wurden Biofilme bei verschiedenen Substrat- und hydrodynamischen Bedingungen in Rohrreaktoren mit einem Durchmesser von 2,6 cm kultiviert. Zur Charakterisierung der kultivierten Biofilme wurde die Biofilmdichte und der Substratumsatz, gemessen als maximale Massestromdichte, bei jeder Versuchsreihe

  4. Differential diagnostics of the musculoskeletal system in sports medicine; Differenzialdiagnostische Untersuchung in der Sportmedizin des Bewegungsapparats

    Energy Technology Data Exchange (ETDEWEB)

    Nehrer, S. [Donau-Universitaet Krems, Department fuer Klinische Medizin und Biotechnologie, Zentrum fuer Regenerative Medizin, Krems (Austria)

    2010-05-15

    sowie die Untersuchung unter Einschluss funktioneller Tests stehen wie immer am Anfang der diagnostischen Strategie; wobei der Verletzungsmechanismus und das sportspezifische Belastungsmuster beruecksichtigt werden muessen. Regionale Inspektions-, Palpations- und Testbefunde der verletzten Struktur weisen auf eine Verdachtsdiagnose hin, die durch bildgebende Verfahren bestaetigt oder auch widerlegt werden kann. Durch den effizienten Einsatz bildgebender Methoden kann dann rasch die entsprechende Therapie eingeleitet werden. Die Sonographie gibt hier, aufgrund ihrer raschen Verfuegbarkeit, vor allem im Bereich von Muskeln, Sehnen und Baendern u. U. wertvolle Hinweise. Die nativradiologische Abklaerung im Bereich des Knochens muss oft durch Zielaufnahmen ergaenzt werden. Die MRT stellt im Bereich der Gelenkverletzungen den Goldstandard dar, wobei eine exakte differenzialdiagnostische Fragestellung hilfreich ist, das Untersuchungsprotokoll entsprechend durchzufuehren, um die fraglich pathologischen Strukturen moeglichst klar darzustellen. (orig.)

  5. Einfluss des Alltagskontextes auf den Prozess einer Ernährungsverhaltensmodifikation : eine qualitative Untersuchung von Personen mit erhöhten Cholesterinwerten

    OpenAIRE

    Hildebrandt, Karen

    2012-01-01

    Das erkenntnisleitende Forschungsinteresse gilt einer umfassenden Betrachtung ernährungsbezogenen Handelns in den drei Alltagsbereichen „Haushalt/Familie“, „Arbeitsplatz/Kollegen“ und „Freizeit/Freunde“ mit dem Ziel, individuell erlebte Bedingungen und Faktoren einer Ernährungsverhaltensmodifikation herauszuarbeiten. In die Untersuchung sind Personen mit einer Fettstoffwechselstörung eingeschlossen worden, die sich in verschiedenen Stadien einer Gesundheitsverhaltensmodifikation befinden. ...

  6. Untersuchung des Funktionsumfangs und der fachlichen Grundlagen des LAMBDA Tools (Examination of the functional scope and the technical basics of the LAMBDA- Tools)

    Science.gov (United States)

    2017-01-01

    Untersuchung des Funktionsumfangs und der fachlichen Grundlagen des LAMBDA -Tools (Examination of the functional scope and the technical basics of the... LAMBDA -Tools) 6. AUTHOR(S) Jan-Malte Lef3mann 7. PERFORMING ORGANIZATION NAME(S) AND ADDRESS(ES) 8. PERFORMING ORGANIZATION REPORT .NUMBER UNIBW 9...planning, health care and environmental protection. Machine assi sted translation. 14. SUBJECT TERMS UNIBW, German, LAMBDA -Tools, functional scope 17

  7. Research tool for the investigation of the driver/brake pedal interface; Forschungswerkzeug zur Untersuchung der Schnittstelle Fahrer/Bremspedal

    Energy Technology Data Exchange (ETDEWEB)

    Bill, K.H.; Breuer, B. [Technische Hochschule Darmstadt (Germany). Fachgebiet Fahrzeugtechnik; Leber, M. [DaimlerChrysler AG, Stuttgart (Germany); Becker, H. [Ford-Werke AG, Koeln (Germany)

    1999-02-01

    The driver/brake pedal interface gains increasing importance when one considers the increasing demands for driver safety and comfort in the vehicle, as well as Brake-by-Wire and braking assistance systems. The decoupling of the brake pedal from the rest of the brake system in the Brake-by-Wire power control braking system makes it necessary to give the brake pedal a specific characteristic. While this can only be slightly influenced in conventional brake systems due to the energetic coupling with the brake hydraulics, in future concepts this interface must be completely re-designed. At the Department of Automotive Engineering at the Technical University of Darmstadt (fzd), supported by the automobile producer Ford, Inc., new methods for the investigation of brake pedal feel under actual conditions with a specially designed test vehicle have been the subject of research. (orig.) [Deutsch] Mit der absehbaren Einfuehrung von Brake-by-Wire und Bremsassistenzsystemen gewinnt die Schnittstelle Fahrer / Bremspedal zunehmend an Bedeutung. Die Entkopplung des Bremspedals vom restlichen Bremssystem macht bei Brake-by-Wire-Anlagen eine gezielte Auslegung der Bremspedalcharakteristik notwendig. Waehrend diese bei konventionellen Bremssystemen infolge der energetischen Kopplung mit der Bremsenhydraulik nur in engen Grenzen beeinflusst werden kann, muss bei zukuenftigen Konzepten diese Schnittstelle vollstaendig neu ueberdacht werden. Am Fachgebiet Fahrzeugtechnik der Technischen Universitaet Darmstadt (fzd) wird, unterstuetzt durch die Ford-Werke AG, an neuen Ansaetzen zur Untersuchung des Bremspedalgefuehls unter realen Bedingungen mit einem speziell hierfuer aufgebauten Versuchstraeger geforscht. (orig.)

  8. 3 tesla magnetic resonance imaging in children and adults with congenital heart disease; 3-Tesla-Magnetresonanztomographie zur Untersuchung von Kindern und Erwachsenen mit angeborenen Herzfehlern

    Energy Technology Data Exchange (ETDEWEB)

    Voges, I.; Hart, C.; Kramer, H.H.; Rickers, C. [Universitaetsklinikum Schleswig-Holstein, Klinik fuer angeborene Herzfehler und Kinderkardiologie, Kiel (Germany); Jerosch-Herold, M. [Harvard Medical School, Department of Radiology, Brigham and Women' s Hospital, Boston (United States); Helle, M. [Universitaetsklinikum Schleswig-Holstein, Institut fuer Neuroradiologie, Kiel (Germany)

    2010-09-15

    Cardiovascular magnetic resonance imaging (CMR) has become a routinely used imaging modality for congenital heart disease. A CMR examination allows the assessment of thoracic anatomy, global and regional cardiac function, blood flow in the great vessels and myocardial viability and perfusion. In the clinical routine cardiovascular MRI is mostly performed at field strengths of 1.5 Tesla (T). Recently, magnetic resonance systems operating at a field strengths of 3 T became clinically available and can also be used for cardiovascular MRI. The main advantage of CMR at 3 T is the gain in the signal-to-noise ratio resulting in improved image quality and/or allowing higher acquisition speed. Several further differences compared to MRI systems with lower field strengths have to be considered for practical applications. This article describes the impact of CMR at 3 T in patients with congenital heart disease by meanings of methodical considerations and case studies. (orig.) [German] Die kardiovaskulaere Magnetresonanztomographie (MRT) hat sich zu einer etablierten bildgebenden Methode zur Untersuchung von Patienten mit angeborenen Herzfehlern entwickelt. Sie erlaubt in einer einzigen Untersuchung die exakte Beurteilung von Anatomie, globaler und regionaler Funktion, Blutfluessen sowie der myokardialen Perfusion und Vitalitaet. In der klinischen Routine erfolgen die Untersuchungen zumeist bei einer Feldstaerke von 1,5 Tesla (T), mittlerweile gibt es jedoch Geraete und Bildgebungstechniken, die die kardiovaskulaere MRT auch bei 3 T ermoeglichen. Der wesentliche Vorteil der MRT bei 3 T ist das hoehere Signal-zu-Rausch-Verhaeltnis, das sowohl zu einer Verbesserung der Bildqualitaet als auch zu einer Verkuerzung der Untersuchungszeit genutzt werden kann. Darueber hinaus bestehen verschiedene andere Unterschiede gegenueber Systemen mit niedriger Feldstaerke, die im praktischen Einsatz beachtet werden muessen. Dieser Artikel beschreibt die Erfahrungen der 3-T-MRT fuer die

  9. Studierbereitschaft und Wahl von ingenieurwissenschaftlichen Studienfächern: Eine empirische Untersuchung sächsischer Abiturienten der Abschlussjahrgänge 1996, 1998 und 2000

    OpenAIRE

    Becker, Rolf

    2000-01-01

    Ausgangspunkt der vorliegenden empirischen Untersuchung ist zum einen die Frage, warum nach einem rückläufigen Trend bis 1998 die Studierneigung sächsischer Abiturienten wieder angestiegen ist und zum anderen die Frage, warum sich seit 1996 wieder mehr sächsische Abiturienten für das Ingenieurstudium interessieren. Diese Entwicklung wird anhand der Humankapital- und Werterwartungstheorie zu erklären versucht. Im Vordergrund stehen dabei die Mechanismen, die letztlich zur Entscheidung für oder...

  10. Investigation of the feasibility of the solar-/geothermally-assisted heat supply system Gesotherm S; Untersuchung der Durchfuehrbarkeit des solar-/ geothermisch gestuetzten Waermeversorgungssystems Gesotherm S

    Energy Technology Data Exchange (ETDEWEB)

    Liebisch, H. [EKT Energie und Kommunal-Technologie GmbH, Berlin (Germany)

    1998-12-31

    The project has been running since 1st March 1998 and is supposed to investigate the technical feasibility and economic efficiency of the Gesotherm S heat supply system in the residential area Berlin-Biesdorf/Habichtshorst (1,000 flats). Main points of investigation are: proof of feasibility and geothermal analysis of the deep pit; analysis of storage possibilities and technical synergies of combined solar-geothermal operation; determination of the regenerative supply ratio; calculation of economic efficiency; estimation of cost-saving potentials. The whole system is simulated for these studies. A new simulation model was developed for the pit. Simulations are based on the SMILE-simulation environment developed by the Technical University of Berlin. First estimates indicate costs of DM 200 per MWh without subsidies. (orig.) [Deutsch] Mit dem seit 1. Maerz 1998 laufenden Vorhaben soll die technische Realisierbarkeit und wirtschaftliche Attraktivitaet des Waermeversorgungssystems Gesotherm S am Beispiel der Nahwaermeversorgung eines Wohngebietes (ca. 1.000 WE) in Berlin-Biesdorf/Habichtshorst umfassend untersucht werden. Schwerpunkte der Untersuchung: - Machbarkeitsnachweis und geothermische Analyse der Tiefensonde - Analyse der Speichermoeglichkeiten und der technischen Synergieeffekte des solar-/geothermischen Kombinationsbetriebes - Ermittlung der regenerativen Deckungsrate - Berechnung der Wirtschaftlichkeit - Abschaetzung der Kostensenkungspotentiale. Fuer die Untersuchung wird das Gesamtsystem simuliert. Speziell fuer die Tiefensonde wird ein neues Simulationsmodell entwickelt. Basis ist die, an der TU-Berlin entwickelte, Simulationsumgebung SMILE. Erste Abschaetzungen ergaben Waermekosten ohne Subventionen von unter 200 DM/MWh. (orig.)

  11. Fourth report by the Federal German Government to the Bundestag on measures for the protection of the ozone layer; 4. Bericht der Bundesregierung an den Deutschen Bundestag ueber Massnahmen zum Schutz der Ozonschicht

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1997-07-01

    This report, which relates the situation as of July 1997, again confirms the internationally leading role of the Federal German Republic in the phase-out of CFCs. No country has realised a more comprehensive concept for the phase-out of substances that deplete the ozone layer. Combining statutory and voluntary measures has proved a path-breaking approach. One of the most important driving forces in the CFC phase-out were the restrictions of use imposed by the Ordinance on the Prohibition of CFCs and Halon. (orig./SR) [Deutsch] Dieser Bericht - mit Stand vom Juli 1997 - bestaetigt erneut die internationale Fuehrungsrolle der Bundesrepublik Deutschland beim FCKW-Ausstieg. In keinem anderen Staaat wurde ein umfassenderes Konzept zum Ausstieg aus den ozonabbauenden Stoffen realisiert. Als wegweisend hat sich dabei die Verknuepfung ordnungsrechtlicher und freiwilliger Massnahem erwiesen. Insbesondere von den Verwendungsbeschraenkungen der FCKW-Halon-Verbots-Verordnung gingen wichtige Impulse beim FCKW-Ausstieg aus. (orig./SR)

  12. Hemorrhagic transformation in ischemic posterior infarction by magnetic resonance imaging (MRI); Kernspintomographische Untersuchung der haemmorrhagischen Transformation ischaemischer Posteriorinfarkte

    Energy Technology Data Exchange (ETDEWEB)

    Reimann, M.; Niehaus, L.; Lehmann, R. [Humboldt-Universitaet, Berlin (Germany). Medizinische Fakultaet Charite

    2000-08-01

    Purpose: To describe the incidence, time course, and clinical correlates of hemorrhagic transformation (HT) of ischemic stroke in the posterior cerebral artery territory. Methods: Within 42 months 48 patients with 52 occipital lobe infarctions were examined by T{sub 1}- and T{sub 2}-weighted MR imaging. The extent and distribution of secondary hemorrhage were analysed at different intervals after stroke. Volume of ischemic and hemorrhagic infarction was measured planimetrically. Results: HT was observed in 71% of the infarcts between the 5{sup th} day and up to 1 year after stroke. HT was most frequently (88%) observed in the 2{sup nd} and 3{sup rd} month. HT was present in 55% of small infarcts (<10 cm{sup 3}), in 88% of medium size (10-50 cm{sup 3}), and in all large (>50 cm{sup 3}) infarcts. In 92% HT presented with petechial bleedings within the cortex (64%) or less frequently (28%) in subcortical structures. The latter types of HT showed no progression and did not increase the clinical deficits. Space-occupying bleedings occurred in only two large defects. Conclusions: In ischemic posterior infarction, HT can frequently be detected within the first three months after stroke and is predominantly of the petechial type and seems not to be relevant with regard to clinical deficits. (orig.) [German] Ziel: MR-tomographische Untersuchung ischaemischer Posteriorinfarkte zur Erfassung der Haeufigkeit, des zeitlichen Verlaufs und der klinischen Bedeutung einer haemorrhagischen Transformation (HT). Methodik: Ueber einen Zeitraum von 42 Monaten wurden 48 Patienten mit 52 Territorialinfarkten im Versorgungsgebiet der Arteria cerebri posterior im MRT (T{sub 1}/T{sub 2}-gewichtete Spinecho-Sequenzen) untersucht. 77 MRT-Untersuchungen aus 5 verschiedenen Untersuchungszeitraeumen wurden hinsichtlich Lokalisation und Ausdehnung einer sekundaeren HT und etwaiger Veraenderungen im Verlauf analysiert. Die Infarkt- und Haemorrhagievolumina wurden planimetrisch gemessen. Ergebnisse

  13. Medienkompetenz - Anmerkungen anlässlich einer Untersuchung der Medienkompetenz von und durch SchülerInnen an Neuen Mittelschulen in Wien.

    Directory of Open Access Journals (Sweden)

    Christian Swertz

    2016-06-01

    Full Text Available Im Beitrag wird vorgeschlagen, Medienkompetenz auch als Ordnungsbegriff zu verstehen. Dazu wird eine präskriptive, eine empirische und eine selektive Ordnung unterschieden. Mit einer induktiv-empirischen Untersuchung wird demonstriert, dass so ein Beitrag zum Verständnis des Medienkompetenzbegriffs geleistet werden kann, mit dem zugleich eine Kritik deduktiv-empirischer Ordnungen erreicht wird. Dabei wird gezeigt, dass ein Bezug auf aktuelle materielle Zeichenträger zugleich problematisch und notwendig ist. It is suggested to understand media literacy as an ordering term. A prescriptive, an empirical and a selective order are distinguished. In an inductive-empirical study it is shown, that this perspective can contribute to an understanding of media literacy and to a critical reflection of deductive-empirical orders. While doing so it is shown, that relating media literacy to contemporary material sign vehicles is problematic and necessary at the same time.

  14. Experimental and numerical examination of the unsteady flow in an axial turbine; Experimentelle und numerische Untersuchung der instationaeren Stroemung in einer Axialturbine

    Energy Technology Data Exchange (ETDEWEB)

    Gentner, C.

    2000-07-01

    The periodic instationary flow in guidevanes and runner of an axial hydraulic turbine is examined experimentally and numerically. The study is carried out at three different points of operation. The experimental study comprises the measurement of the velocity of the flow at midspan using a single channel Laser Doppler Velocimeter and the acquisition of the ozillating pressure at several locations in the casing. The unsteady numerical examination is carried out in a two dimensional plane at midspan of the runnerblades. The interaction between guidevanes and runner is taken into account by exchanging the flow properties at the adjoining edges of the two calculation grids. Further the influence of the tip clearance flow on the characteristics of the turbine is studied numerically by means of a three dimensional steady state calculation. The comparison of the results of measurement and calculation shows the abilities and the limitations of the applied numerical method. Moreover the results are helpful for the optimisation of the turbine with regard to higher efficiency and reduced cavitation. (orig.) [German] Die periodisch instationaere Stroemung in Leit- und Laufrad einer hydraulischen Axialturbine zur Druckentspannung in Rohrleitungssystemen wird fuer drei Betriebspunkte experimentell und rechnerisch untersucht. Die experimentelle Untersuchung umfasst die zeitaufgeloeste Messung der Stroemungsgeschwindigkeiten mit einem Laser-Doppler-Velozimeter im Mittelschnitt und die Erfassung des periodisch schwankenden Drucks an mehreren Punkten an der Gehaeusewand. Die instationaere numerische Untersuchung erfolgt in einem zweidimensionalen Zylinderschnitt im mittleren Durchmesser der Laufschaufeln. Die Wechselwirkung zwischen Leit- und Laufrad wird druch den Austausch der Stroemungsgroessen mittels eines Kopplungsalgorithmus an der Stossflaeche zwischen den zwei gegeneinander bewegten Berechnungsgittern erfasst. Darueber hinaus wird in einer dreidimensionalen stationaeren

  15. cobalt (ii), nickel (ii)

    African Journals Online (AJOL)

    DR. AMINU

    Department of Chemistry Bayero University, P. M. B. 3011, Kano, Nigeria. E-mail: hnuhu2000@yahoo.com. ABSTRACT. The manganese (II), cobalt (II), nickel (II) and .... water and common organic solvents, but are readily soluble in acetone. The molar conductance measurement [Table 3] of the complex compounds in.

  16. Environmental policy. Resolution of the German Federal Government concerning the Air Pollution Abatement Programme of the Federal Republic of Germany based on the fourth report of the Interdepartmental Working Group on Carbon Dioxide Reduction (IMA `CO{sub 2} Reduction`); Umweltpolitik. Beschluss der Bundesregierung zum Klimaschutzprogramm der Bundesrepublik Deutschland auf der Basis des Vierten Berichts der Interministeriellen Arbeitsgruppe ``CO{sub 2}-Reduktion`` (IMA ``CO{sub 2}-Reduktion``)

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1997-11-01

    Air pollution abatement is a key issue in German environmental policy. This was stressed again in the 4th report of the Interdepartmental Working Group on Carbon Dioxide Reduction (IMA `CO{sub 2}-Reduktion`), in which the Federal Government confirmed its goal of a 25% reduction of carbon dioxide emissions by 2005 as referred to 1990. This report contains the government decision, the formulatio of the task assigned to the IMA, and the 4th report of the IMA. (orig./SR) [Deutsch] Klimavorsorge ist ein Schwerpunkt der deutschen Umweltpolitik. Dies hat das Bundeskabinett mit der Verabschiedung des 4. Berichts der Interministeriellen Arbeitsgruppe (IMA) ``CO{sub 2}-Reduktion`` nachdruecklich unterstrichen. Mit diesem Beschluss bekraeftigt die Bundesregierung erneut ihr Ziel, die CO{sub 2} Emissionen bis 2005 um 25 % gegenueber 1990 zu senken. Der vorliegende Bericht enthaelt den Beschluss, der Bundesregierung, den Auftrag der Bundesregierung an die Interministerielle Arbeitsgruppe (IMA) und den 4. Bericht der IMA ``CO{sub 2}-Reduktion``. (orig./SR)

  17. 57th report of the Arbeitsgemeinschaft Rhein-Wasserwerke e.V. (ARW). Annual report 2000; 57. Bericht der Arbeitsgemeinschaft Rhein-Wasserwerke e.V. (ARW). Jahresbericht 2000

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    2001-08-01

    This is the 57th annual report of the Arbeitsgemeinschaft Rhein-Wasserwerke e.V. (ARW) on Rhine water quality from the view of drinking water supply. The positive trends continued in some fields, especially in the case of chloride concentrations and freights. On the other hand, there was a significant increase of some organic pollutants like DTPA, glyphosate and AMPA. The microbiological specifications of the new Drinking Water Ordinance and the concentrations of tensides and their metabolites are gone into. The ARW is worried about new or newly identified organic substances in Rhine water, especially as there is a lack of toxicological data on these substances and of data concerning their behaviour during freshwater preparation for drinking. [German] Die Arbeitsgemeinschaft Rhein-Wasserwerke e.V. (ARW) legt hiermit ihren nunmehr 57. Jahresbericht vor, in dem ueber ihre Aktivitaeten und wichtige Ergebnisse aus dem Untersuchungsprogramm der Rhein-Wasserwerke berichtet wird. Wie in den Vorjahren steht im Mittelpunkt der fachlichen Arbeiten der ARW die Bewertung der Rheinwasserbeschaffenheit aus Sicht der Trinkwasserversorgung. Im ersten Teil dieses Jahresberichtes sind die wichtigsten Ergebnisse zusammengefasst, die insgesamt erkennen lassen, dass sich die positiven Tendenzen bei vielen Wassergueteparametern auch im Berichtsjahr 2000 fortgesetzt haben. Dies gilt vor allem fuer die Chlorid-Konzentrationen und -Frachten im Rhein, die im Vergleich zum Vorjahr deutlich zurueckgegangen sind. Im Gegensatz dazu haben die Konzentrationen einiger organischer Einzelstoffe, wie z. B. DTPA sowie Glyphosat und AMPA, im Jahr 2000 z. T. deutlich zugenommen. Weiterhin sind in diesem Jahresbericht eine ausfuehrliche Zusammenstellung ueber die mikrobiologischen Anforderungen, die sich aus der neuen Trinkwasserverordnung ergeben sowie ein Bericht ueber das Vorkommen von Tensiden und deren Metaboliten in Oberflaechengewaessern, wie z. B. im Rhein, enthalten. Insbesondere das Auftreten

  18. E-business solutions for utilities, - current state of implementation on the Internet; E-Business-Branchenloesungen - Untersuchung zum Implementierunsstand im Internet. Der Online-Weg zu den Privatkunden

    Energy Technology Data Exchange (ETDEWEB)

    Koch, M.; Baier, D. [Brandenburgische Technische Univ. Cottbus (Germany). Lehrstuhl fuer Marketing und Innovationsmanagement

    2003-04-22

    In the first part of the contribution the benefit of an e-business system in connection with internet was illustrated by an example. The current state of implementation is the subject of this second part. In an empirical study the websites of 600 utilities were analyzed in detail. The results of this analysis are described in the following. (orig.) [German] In [1] wird der Nutzen eines E-Business-Systems in Verbindung mit dem Internet an einem praktischen Beispiel veranschaulicht. Im Folgenden wird ein Ueberblick zum aktuellen Implementierungsstand in den Enegieversorgungsunternehmen gegeben. In einer empirischen Untersuchung wurden die Webseiten von 600 EVU analysiert, die Ergebnisse der Auswertung werden vorgestellt. (orig.)

  19. Private is Public?! Der Umgang von 14- bis 18-Jährigen mit Sozialen Medien. - Eine explorativ-empirische Untersuchung im gymnasialen Kontext

    Directory of Open Access Journals (Sweden)

    Christian Filk

    2011-12-01

    Full Text Available Die explorative Studie „Private is Public?!“ fokussiert sich auf das Mediennutzungsverhalten von 14- bis 18-jährigen Schülerinnen und Schülern mit Schwerpunkt soziale Medien. Das Forscherteam führte seine empirische Untersuchung am Mons-Tabor-Gymnasium im ländlich gelegenen Montabaur, Rheinland-Pfalz (Deutschland durch. Gestützt auf Forschungshypothesen erhoben Christian Filk, Hanno Schauer und Amina Ovcina Cajacob mit Hilfe des Instruments der schriftlichen Befragung aktuelle Trends zu Frequenz und Intensität der Nutzung sozialer Medien, zur zweckbezogenen Nutzung sozialer Medien, zu Informationsverhaltensschemata in sozialen Medien sowie zu Erfahrungen mit Cyber-Mobbing. Die gewonnenen Daten werden mittels deskriptiv-statistischer Analysen ausgewertet. Schliesslich diskutieren Verfasser und Verfasserin den innovativen Einsatz privater sozialer Medien für den Unterricht in öffentlichen Schulen. The explorative study “Private is Public?!” focuses on the use of media of 14- to 18-years-old students with a special focus on social media. The research team conducted its empirical investigation at Mons Tabor High School in the rural area of Montabaur, Rhineland-Palatinate (Germany. Based on research hypothesis Christian Filk, Hanno Schauer and Amina Ovcina Cajacob are using written surveys in order to identify current trends in frequency and intensity of performing social media, purpose-oriented use of social media, information-seeking behavior patterns in social media, and last but not least experiences with cyber-bullying. The collected data are evaluated by using descriptive statistical analysis. Finally, the authors discuss the innovative use of private social media for teaching in public schools.

  20. 64. report of Arbeitsgemeinschaft Rhein-Wasserwerke e.V. (ARW). Annual report 2007; 64. Bericht der Arbeitsgemeinschaft Rhein-Wasserwerke e.V. (ARW). Jahresbericht 2007

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    2007-07-01

    The 64th annual report of the Arbeitsgemeinschaft Rhein-Wasserwerke e.V. (ARW, Cologne, Federal Republic of Germany) presents its technical and scientific activities in the field of freshwater supply on the Rhine river. This annual report consists of the following contributions: (a) Main results from the exploration program 2007 of the ARW (H.-J. Brauch, M. Fleig, W. Kuehn); (b) About the importance of NDMA, other nitrosamines and N,N-dimethyl sulfamide (DMS) in the supply of drinking water (C.K. Schmidt, H.-J. Brauch); (c) Development of the chloride burden in the river Rhine (M. Fleig, H.-J. Brauch, W. Kuehn); (d) Hydrochemical developments in areas of freshwater production at Lower Rhine; Part II: Observation of trends in groundwater (E. Denecke, T. Oertel); (e) On the problem of PFT at the Lower Ruhr and its consequences for the processing of drinking water in the waterworks Muehlheim-Styrum/East (M. Schoepel).

  1. Modified double contrast-enhanced examination of the stomach of adipose patients after vertical gastroplasty; Modifizierte Doppelkontrast-Untersuchung des Magens bei adipoesen Patienten nach vertikaler Gastroplastie

    Energy Technology Data Exchange (ETDEWEB)

    Raissaki, M.T. [Institut fuer Bildgebende Diagnostik, Universitaetsklinik Heraklion (Greece); Prassopoulos, P. [Institut fuer Bildgebende Diagnostik, Universitaetsklinik Heraklion (Greece); Hatjidakis, A.A. [Institut fuer Bildgebende Diagnostik, Universitaetsklinik Heraklion (Greece); Christodoulakis, M. [Klinik fuer Chirurgische Onkologie der Universitaetsklinik Heraklion (Greece); Melissas, J. [Klinik fuer Chirurgische Onkologie der Universitaetsklinik Heraklion (Greece); Gourtsoyiannis, N.C. [Institut fuer Bildgebende Diagnostik, Universitaetsklinik Heraklion (Greece)

    1995-11-01

    The study reported covers 28 patients who were examined once by radiology before surgery, and twice after surgery. The first post-surgery examination was done on days 5-7, the second during the 4th until 6th month after surgery. For the first examination, water-soluble contrast agent was initially applied, then barium containing contrast agent. The second examination was done by modified double contrast technique. The most frequent, pre-surgery findings revealed gastro-esophageal reflux in 13 patients. The first post-surgery control detected a somastenosis in 2 patients, while the second control examination detected complications of various nature in 11 patients and gastro-esophageal reflux in 5 patients. In 6 patients, discrepancy between clinical and radiological findings was stated. The pouch size did not correlate with the frequency of complications, or with the body-to-mass index decrease. The examination method proposed in this article yields pre-surgery information on the anatomy of the stomach, more accurate dewscription of post-surgery complications, and better evaluation of the antireflux effect of the vertical gastroplasty. (orig.) [Deutsch] In der Studie wurden 28 Patienten einmal praeoperativ und zweimal postoperativ roentgenologisch kontrolliert. Die erste postoperative Kontrolle fand am 5.-7. Tag und die zweite im 4.-6. Monat nach dem Eingriff statt. Bei der ersten Kontrolle wurde zuerst wasserloesliches und anschliessend bariumhaltiges Kontrastmittel benutzt, waehrend bei der zweiten Kontrolle eine modifizierte Doppelkontrast-Untersuchung durchgefuehrt wurde. Der haeufigste praeoperative Befund war der gastrooesophageale Reflux bei 13 Patienten. Bei der ersten praeoperativen Kontrolle fand sich bei 2 Patienten eine Stomastenose, waehrend bei der zweiten verschiedene Komplikationen bei 11 sowie gastrooesophagealer Reflux bei 5 Patienten vorlagen. Eine Diskrepanz zwischen radiologischen und klinischen Befunden fanden wir bei 6 Patienten. Die

  2. Deregulation of the electric power market and chances of ecopolicy-based regulatory action. Report on the symposium organised by Forschungsstelle Umweltrecht at Hamburg University on June 2, 1994; Liberalisierung des Strommarktes und die Chancen fuer umweltpolitische Steuerungen. Bericht ueber das Symposium der Forschungsstelle Umweltrecht an der Universitaet Hamburg am 2. Juni 1994

    Energy Technology Data Exchange (ETDEWEB)

    Krebs, A [Freiherr-vom-Stein-Institut, Muenster (Germany)

    1994-08-01

    The report briefly discusses each paper presented at the symposium. Eleven experts from academia, administration and the power industry have been ventilating the various models of reform for deregulation of the electric power market currently under debate at national and international level, and the possibilities available under these models for ecopolicy-based regulatory activities for avoiding adverse effects on the environment. Other topics discussed addressed framework conditions to be defined for the reform models on the basis of constitutional laws, and rules of competition. (orig.) [Deutsch] Elf Experten aus Wissenschaft, Verwaltung und Energiewirtschaft eroertern die zur Zeit auf nationaler und internationaler Ebene diskutierten Reformmodelle fuer eine Liberalisierung des Strommarktes sowie die mit diesen jeweils verbundenen Moeglichkeiten der umweltpolitischen Steuerung von oekologischen Folgewirkungen. Weitere Themen des Symposions waren die wettbewerbs- und verfassungsrechtlichen Rahmenbedingungen einer Deregulierung des Strommarktes. Der Bericht behandelt in kurzer Form alle beim Symposion gehaltenen Referate. (orig.)

  3. Copper (II)

    African Journals Online (AJOL)

    CLEMENT O BEWAJI

    Valine (2 - amino - 3 – methylbutanoic acid), is a chemical compound containing .... Stability constant (Kf). Gibb's free energy. ) (. 1. −. ∆. Mol. JG. [CuL2(H2O)2] ... synthesis and characterization of Co(ii), Ni(ii), Cu (II), and Zn(ii) complexes with ...

  4. Mediastinal fibrosis with pulmonary artery obstruction; diagnosis and investigation with helical CT imaging including 3-dimensional reconstructions; Pulomonalarterienstenose bei aggresiver Mediastinalfibrose; Diagnostik und 3D-Darstellung mittels helikaler CT-Untersuchung

    Energy Technology Data Exchange (ETDEWEB)

    Kolbe, M. [Inst. fuer Diagnostische Radiologie, Kantonsspital Basel (Switzerland); Helwig, A. [Inst. fuer Diagnostische Radiologie, Kantonsspital Basel (Switzerland); Habicht, J.M. [Klinik fuer Herz-Torax-Chirurgie, Universitaetskliniken Basel (Switzerland); Steinbruch, W. [Inst. fuer Diagnostische Radiologie, Kantonsspital Basel (Switzerland)

    1997-07-01

    An aggressive mediastinal fibrosis was found in a 42-year-old female, suffering from dysphagia, stabbing pain in the chest, and an unclear weight loss. In this case, the rare combination of esophageal involvement, bronchial narrowing, and pulmonary artery obstruction could easily be demonstrated with a barium study and a helical CT examination including three-dimensional reconstructions. (orig.) [Deutsch] Wir stellen den Fall einer 42jaehrigen Patientin vor, welche zur Abklaerung einer zunehmenden Dysphagie, stechender Thoraxschmerzen und eines Gewichtsverlustes hospitalisiert wurde. Mittels klinischer und radiologischer Abklaerung konnte eine aggressive Mediastinalfibrose diagnostiziert werden. Die seltene Kombination einer Oesophaguseinengung mit Pulmonalarterienstenosen sowie einer Bronchuskompression konnte nichtinvasiv mittels Oesophagogramm und helikaler CT-Untersuchung zuverlaessig und schnell dargestellt werden. (orig.)

  5. Long term results of surgery in Perthes disease: Comparison of X-ray and MR-studies; Spaetergebnisse nach operativer Behandlung des Morbus Perthes: Vergleich der roentgenologischen und kernspintomographischen Untersuchung

    Energy Technology Data Exchange (ETDEWEB)

    Tosch, U. [Strahlenklinik und Poliklinik, Universitaetsklinikum Rudolf Virchow, Berlin (Germany); Sparmann, M. [Orthopaedische Klinik im Oskar-Helene-Heim, Berlin (Germany); Stelling, E. [Orthopaedische Klinik im Oskar-Helene-Heim, Berlin (Germany); Tomala, D. [Strahlenklinik und Poliklinik, Universitaetsklinikum Rudolf Virchow, Berlin (Germany)

    1995-05-01

    Twenty patients treated by surgery for Perthes` disease were studied between 4 and 9 years postoperatively. In the clinical investigation eight patients complained of persistent stress-induced pain. In nine patients flexion, extension, ab- and adduction of the hip joint was limited. In the MRI-Study of ten hip joints a reduction of fatty marrow was seen in the femoral head. In 11 hip joints of patients complaining of persistent pain, a deformation of the femoral head (n = 2), a dysplasia of the femoral metaphysis (n = 2), and diaphysis (n = 4) or both (n = 2) were seen. In another five patients an additional dysplasia of the acetabulum was visualized. All these findings were diagnosed by X-ray studies as well. However, only by MRI were the extents of the postoperative defects of femoral spongiosa diagnosed in fifteen hip joints. (orig.) [Deutsch] 20 wegen eines Morbus Perthes operierte Patienten wurden 4-9 Jahre nach einer Umstellungsosteotomie klinisch, radiologisch und kernspintomographisch untersucht. Bei der klinischen Nachuntersuchung gaben 8 Patienten persistierende Beschwerden bei Belastung an. Bei der koerperlichen Untersuchung war die Flexion und Extension bei 9 sowie die Abduktion und Adduktion bei einem Patienten eingeschraenkt. Bei der kernspintomographischen Untersuchung liessen sich bei 10 Hueftgelenken Residuen des M. Perthes im Fettmark des Femurkopfs nachweisen. An 11 Hueftkoepfen wurden pathologische Veraenderungen wie eine Femurkopfentrundung (n = 2), eine Deformierung der Femurmeta- (n = 3) und -diaphyse (n = 4) bis hin zur hirtenstabfoermigen Konfiguration (n = 2) nachgewiesen. Bei 5 Patienten wurde eine Pfannendysplasie gefunden. Diese Befunde waren auch roentgenologisch darzustellen. Als postoperative Defekte waren im Schaftmark des Femurs eine langstreckige Hoehlenbildung mit Zysten oder durch Fettmark aufgefuellte Spongiosadefekte bei 15 Hueftgelenken nur kernspintomographisch nachweisbar. (orig.)

  6. Dosisabhängiger Anstieg von Knochenformatinsmarkern in Serum und Knochen unter Zink-Supplementation - eine Untersuchung an der erwachsenen weiblichen Maus

    Directory of Open Access Journals (Sweden)

    Dimai H-P

    1998-01-01

    Full Text Available Zink (Zn ist eine essentielles Spurenelement. Es spielt eine wichtige Rolle in zahlreichen metabolischen Prozessen und wird auch für das normale Knochenwachstum benötigt. Ziel der vorliegenden Untersuchung war es, den Effekt von Zn auf a die Aktivität der alkalischen Phosphatase (ALP in Serum und Knochen, b das Serum-Osteocalcin, c die Tartrat-resistente saure Phosphatase (TRAP im Knochen, sowie d den Protein-Gehalt des Knochens darzustellen. Erwachsene weibliche Swiss-Webster-Mäuse erhielten entweder eine Zn-freie Diät, oder eine Diät, welche einen normalen, oder einen 2-, 3-, 4-, oder 5-fach höheren Zn-Gehalt als die Normal-Diät hatte. Die Diät wurde für 2, 4, oder 6 Wochen verabreicht. Es zeigte sich eine positive Korrelation zwischen der Menge des mit der Nahrung aufgenommenen Zn und der Serum-ALP (4 und 6 Wochen, p 0,001, der tibialen ALP (2, 4 und 6 Wochen, p  0,03, sowie dem tibialen Protein (2,4 und 6 Wochen p 0.001; weiters zeigte sich eine negative Korrelation zwischen Zn und tibialer TRAP (2, 4 und 6 Wochen, p 0,001. Kovarianzanalysen zeigten überdies, daß die Aktivität der Serum-ALP, der tibialen ALP und der tibialen TRAP, sowie die Menge des tibialen Proteins sowohl durch die Zn-Dosis (p 0,005, als auch die Dauer der Therapie (p 0,03 beeinflußbar sind. Zn zeigte auch einen signifikanten Einfluß auf den Serum-Osteocalcin-Spiegel (p 0,03 bei 3 x höher Zn-Menge als in der Normaldiät. In einer ergänzenden Studie zeigte sich auch, daß Zn zu einem dosisabhängigen Anstieg der ALP und des Proteins, und zu einem signifikanten Abfall der TRAP in murinen osteoblastenähnlichen MC3T3-E1 Zellen führt. Insgesamt kann aus den Ergebnissen der vorliegenden Studie geschlossen werden, daß eine schrittweise Erhöhung des Zn-Gehaltes der Nahrung zu einem entsprechenden Anstieg der ALP-Aktivität von Serum und Knochen führt. Da in dieser Studie klar gezeigt werden konnte, daß Zn auch zu einem Abfall der TRAP-Aktivität in

  7. Bιβλιοκρισία του: V. SYROS, Die Rezeption der aristotelischen politischen Philosophie bei Marsilius von Padua. Eine Untersuchung zur ersten Diktion des Defensor pacis [Studies in Medieval and Reformation Traditions, ed. by A. C. Gow, v. 134], Leiden, 2007

    Directory of Open Access Journals (Sweden)

    Στυλιανός ΛΑΜΠΑΚΗΣ

    2012-01-01

    Full Text Available   Βιβλιοκρισία του : V. SYROS, Die Rezeption der aristotelischen politischen Philosophie bei Marsilius von Padua. Eine Untersuchung zur ersten Diktion des Defensor pacis. [Studies in Medieval and Reformation Traditions, edited by Andrew Colin Gow, volume 134], Brill, Leiden-Boston 2007, σελ. X+364, ISSN 1573-4188

  8. (II) complexes

    African Journals Online (AJOL)

    activities of Schiff base tin (II) complexes. Neelofar1 ... Conclusion: All synthesized Schiff bases and their Tin (II) complexes showed high antimicrobial and ...... Singh HL. Synthesis and characterization of tin (II) complexes of fluorinated Schiff bases derived from amino acids. Spectrochim Acta Part A: Molec Biomolec.

  9. Mechanistic investigation and modelling of anode reaction in the molten carbonate fuel cell; Mechanistische Untersuchung und Modellierung der Anodenreaktion in der Karbonat-Brennstoffzelle

    Energy Technology Data Exchange (ETDEWEB)

    Schuster, Markus Roman

    2011-04-27

    detaillierte Kenntnisse der an den Elektroden ablaufenden Reaktionsmechanismen. In der vorliegenden Arbeit wird der komplexe anodenseitige Reaktionsmechanismus in der Karbonat-Brennstoffzelle detailliert untersucht, mit dem Ziel, ein grundlegendes Verstaendnis ueber die an der Anode stattfindenden physikalischen und elektrochemischen Prozesse zu entwickeln und Einflussgroessen auf die Leistung der Brennstoffzellen-Stapel zu identifizieren. Dazu zaehlen die eingehende Untersuchung der parallel stattfindenden Oxidationsreaktionen von Wasserstoff und Kohlenmonoxid und ihrer reaktionstechnischen Parameter, die detaillierte Analyse von Stofftransport, Adsorption und Ladungstransport und die Betrachtung von Degradationsphaenomenen, welche sich degressiv auf Zellleistung und Lebensdauer auswirken. Fuer die experimentellen Untersuchungen stehen verschiedene Versuchsanlagen zur Verfuegung. Dazu zaehlen vorrangig Anoden-Halbzellen und Einzelzellen. Werkzeug zur Analyse der physikalischen und elektrochemischen Phaenomene ist die elektrochemische Impedanzspektroskopie (EIS), deren Ergebnisse in die Entwicklung eines Ersatzschaltbilds einfliessen. Die Verknuepfung der Elemente des Ersatzschaltbilds mit physikalischen Prozessgroessen erfolgt im Rahmen eines numerischen Modells fuer die MCFC-Anode. Die Impedanzspektren der MCFC-Anoden ergeben vier charakteristische Widerstaende: ohmscher Widerstand, hochfrequenter Widerstand, niederfrequenter Widerstand und Gesamtwiderstand. Der stark temperaturabhaengige hochfrequente Widerstand wird von der Elektrodenkinetik beeinflusst, waehrend der Stofftransport durch den niederfrequenten Widerstand ausgedrueckt wird. Es zeigt sich, dass die in der Literatur postulierten Mechanismen fuer die anodenseitige Oxidation von Wasserstoff unvollstaendig sind. Die Oxidation des Wasserstoffs folgt einer Reaktionsgeschwindigkeit (pseudo) negativer Ordnung. Voraussetzung hierfuer sind zwei adsorbierende, miteinander reagierende Spezies. Mithilfe der numerischen

  10. Bromide as a tracer for studying water movement and nitrate displacement in soils: comparison with stable isotope tracers; Bromid als Tracer zur Untersuchung der Wasserbewegung und der Nitratverlagerung in Boeden: Vergleich mit stabilisotopen Tracern

    Energy Technology Data Exchange (ETDEWEB)

    Russow, R.; Knappe, S. [UFZ - Umweltforschungszentrum Leipzig-Halle GmbH, Bad Lauchstaedt (Germany). Sektion Bodenforschung

    1999-02-01

    Tracers are an ideal means of studying water movement and associated nitrate displacement. Often bromide is preferred as a tracer because it is considered a representative tracer for water and because, being a conservative tracer (i.e. not involved in chemical and biological soil processes), it can be used for studying anion transport in soils. Moreover, it is less expensive and easier to measure than the stable isotopes deuterium and {sup 15}N. Its great advantage over radioactive tracers (e.g. tritium), which outweighs their extreme sensitivity and ease of measurement and which it has in common with stable isotopes, is that it does not require radiation protection measures. However, there are also constraints on the use of bromide as a tracer in soil/water/plant systems. Our own studies on different soils using D{sub 2}O, bromide and [{sup 15}N]-nitrate in lysimeters suggest that the above assumptions on bromide tracers need not always be valid under conditions as they prevail in biologically active soils. As the present paper shows, these studies permit a good assessment of the possibilities and limits to these tracers. [Deutsch] Fuer die Untersuchung der Wasserbewegung sowie der daran gekoppelten Nitrat-Verlagerung ist der Einsatz von Tracern das Mittel der Wahl. Dabei wird Bromid als Tracer haeufig bevorzugt, da es allgemein als ein repraesentativer Tracer fuer Wasser und als konservativer Tracer (nicht involviert in chemische und biologische Bodenprozesse) zur Untersuchung des Anionentransportes in Boeden angesehen wird und es gegenueber den stabilen Isotopen Deuterium und {sup 15}N billiger und einfacher zu bestimmen ist. Gegenueber den radioaktiven Tracern (z.B. Tritium), die zwar sehr empfindlich und einfach messbar sind, besteht der grosse Vorteil, dass, wie bei den stabilen Isotopen, keine Strahlenschutzmassnahmen ergriffen werden muessen. Es gibt jedoch auch einschraenkende Hinweise fuer die Verwendung von Bromid als Tracer im System Boden

  11. Dynamik, Schadstoffbelastung und Ökotoxizität der Sedimente in der Rummelsburger Bucht – Berliner Spree

    OpenAIRE

    Bölscher, Jens; Dumm, Michaela; Suthfeldt, René; Vogt, Benjamin; Bölscher, Judith; Terytze, Konstantin; Schulte, Achim

    2017-01-01

    Der vorliegende Bericht behandelt die Ergebnisse des Forschungsprojektes RUBUS, welches im Zeitraum November 2013 bis November 2015 von der Freien Universität Berlin durchgeführt wurde. Gegenstand des Projektes ist die Untersuchung der aktuellen Belastungssituation und der Dynamik der Sedimente in der Rummelsburger Bucht als Teil der urbanen Spree in Berlin. Das Projekt hat die Klärung der räumlichen Verteilung, Quantifizierung und Bewertung der Schadstoffbelastung in den Sedimenten der Ru...

  12. Technology assessment with regard to the environment. Assessment of the consequences of legislation for environment protection shown for the example of the Law on Chemicals. Final report; Technikfolgenabschaetzung - Umwelt. Gesetzesfolgenabschaetzung im Umweltschutz. Untersuchung am Beispiel des Chemikaliengesetzes. Endbericht

    Energy Technology Data Exchange (ETDEWEB)

    Schulte-Hostede, S.

    1993-12-31

    The present report contains the result of a research project on `Technology assessment with regard to the environment` which was commissioned by the Federal Ministry for Research and Technology (BMFT) and carried out jointly by the GSF Research Centre for Environment and Health (GSF) and the Institute for Applied Innovation Research (IAI). In this project the Law on Protection from Harzardous Substances (Law on Chemicals) was used to exemplify the procedure of assessing the consequences of legislation in the area of environmental law. The project proposal distinguished three project phases. In the first an exemplary ex post analysis was to be carried out on a significant legal regulation (the Law on Chemicals) concerning a specific branch of industry generally considered innovative (the chemical industry). In this way it was intended to collect empirical knowledge on how regulations affect innovation processes in the individual company. In the second phase the planned amendment of the Law on Chemicals was to serve as a case example for an assessment of the consequences of legislation. In the third project phase the methodology employed in the former was to be extended for the purpose of developing an instrumentarium for the ex ante assessment of legislation. Such an instrument could permit both the corporate innovator and the innovation promoter to assess the effets of environmental legislation at the corporate level and thus develop an anticipatory conflict management. (orig./SR) [Deutsch] Der vorgelegte Bericht beinhaltet die Ergebnisse des vom GSF-Forschungszentrum fuer Umwelt und Gesundheit (GSF) und dem Institut fuer Angewandte Innovationsforschung (IAI) gemeinsam bearbeiteten BMFT-Forschungsvorhabens `Technikfolgenabschaetzung - Umwelt`. Thema war die Gesetzesfolgenabschaetzung im Bereich der Umweltschutzgesetzgebung am Beispiel des `Gesetzes zum Schutz vor gefaehrlichen Stoffen (Chemikaliengesetz)`. Der Projektvorschlag sah dabei vor, zunaechst in einer

  13. TBscore II

    DEFF Research Database (Denmark)

    Rudolf, Frauke; Lemvik, Grethe; Abate, Ebba

    2013-01-01

    Abstract Background: The TBscore, based on simple signs and symptoms, was introduced to predict unsuccessful outcome in tuberculosis patients on treatment. A recent inter-observer variation study showed profound variation in some variables. Further, some variables depend on a physician assessing...... them, making the score less applicable. The aim of the present study was to simplify the TBscore. Methods: Inter-observer variation assessment and exploratory factor analysis were combined to develop a simplified score, the TBscore II. To validate TBscore II we assessed the association between start...

  14. Examination of imaging detectors for combined radiography procedures in the ACCIS joint project. Automatic cargo container inspection system. Final report; Untersuchung von bildgebenden Detektoren fuer kombinierte Radiographieverfahren im Verbundprojekt ACCIS. Automatisches Cargo-Container Inspektionssystem. Abschlussbericht

    Energy Technology Data Exchange (ETDEWEB)

    Dangendorf, Volker

    2014-06-09

    erfordert im Verdachtsfalle aufwendige Nachuntersuchungen. Auf der anderen Seite ist auch der Bildkontrast bei schweren Elementen mit Roentgenmethoden nur gering was z.B. die Identifikation durch von nukleares Schmuggelgut (SNM) wie Pu und.U, die ggf auch noch in einem Behaelter aus Blei zur Tarnung und gemischt mit Waren aus anderen schweren Metallen transportiert werden, sehr schwierig macht. Im Rahmen des ACCIS Verbundprojektes wurde ein neuartiges Inspektionssystem fuer Luftfracht auf der Basis von Neutronen- und Gammastrahlung erforscht. Das Teilprojekt der PTB umfasste innerhalb dieses Rahmens folgende Aufgabenbereiche: 1. Erforschung und Aufbau von Labormustern der bildgebenden Strahlungsdetektoren; 2. Aufbau eines Messplatzes zur Evaluation der Durchleuchtungsmethode an der Beschleunigeranlage der PTB, 3. Mitarbeit bei der Entwicklung eines Konzeptes fuer eine gepulste Strahlungsquelle, insbesondere Aufbau- und Untersuchung des strahlerzeugenden Targets, 4. Ermittlung der strahlenschutzrechtlich relevanten physikalischen und dosimetrischen Kenngroessen, 5. Untersuchung der Bedingungen fuer die Anwendung, Anforderung an einsatzfaehige Anlage, Endnutzerkontakte; 6. Koordination der deutschen Partner, insbesondere Organisation der Projektmeetings der deutschen und der israelischen Partner.

  15. Pb II

    African Journals Online (AJOL)

    Windows User

    This investigation describes the use of non-living biomass of Aspergillus caespitosus for removal of ... Pb(II) production has exceeded 3.5 million tons per year. It has been used in the ... This biomass was selected after screening a wide range of microbes. .... prolonged, which proved better biopolymer in metal uptake (Gadd ...

  16. Individual coping as a link between traffic noise and its effects? A study on railway noise; Individuelle Bewaeltigungsversuche als Vermittler zwischen Verkehrslaerm und seinen Wirkungen? Eine Untersuchung am Beispiel des Schienenverkehrslaerms

    Energy Technology Data Exchange (ETDEWEB)

    Meyer-Paron, M.

    2000-07-01

    Does a person's strategy of coping with traffic noise influence the extent to which he or she feels stressed by it? Ever sSince the seventies, noise research has been attempting to identify factors apart from the noise level that contribute to extraaural noise effects. This investigation discusses new results in the light of transactional stress theory and also investigates the influence of individual coping. Studies on 116 persons showed that it is not the concrete attempt to cope which is the decisive factor but a person's assumptions about his or her potential influence on the experienced noise and its effects, i.e. control. The degree of control experienced was found to be an intermediate step in the development of stress effects. [German] Hat die Art, wie Personen mit taeglich erlebtem Verkehrslaerm umgehen, Einfluss darauf, wie stark sie sich beeintraechtigt fuehlen? Seit den 70er Jahren bemueht sich die Laermforschung, Faktoren zu benennen, die neben dem Schallpegel an der Entstehung (extraauraler) Laermwirkungen beteiligt sind. Die vorliegenden Erkenntnisse erhalten hier durch ihre Einordnung in den Rahmen der transaktionalen Stresstheorien eine theoretische Fundierung. Gleichzeitig wird die Frage aufgeworfen, ob auch das Theorieelement Coping (individuelle Bewaeltigungsversuche) als Einflussfaktor fuer die Staerke von Laermwirkungen zu betrachten ist. Empirisch wurde geprueft, ob sich Gestoertheitsurteile und Schlafqualitaetsindikatoren bei schienenverkehrslaermbelasteten Personen in Abhaengigkeit vom individuellen Coping unterscheiden. Die Untersuchung an 116 Personen zeigte, dass nicht konkrete Bewaeltigungsversuche die Groesse von Laermwirkungen mitbestimmen, sondern die Einschaetzung, Einfluss auf den Laerm oder seine Wirkungen nehmen zu koennen (Kontrolle). Belegt wurde, dass die wahrgenommene Kontrolle einen Zwischenschritt bei der Entstehung von Gestoertheitsurteilen darstellt. (orig.)

  17. Progress report within the series of GRS-F progress reports on reactor safety, sponsored by the Federal Ministry of Economics and Labour. Period: 1 July - 31 December 2003; Berichte ueber vom Bundesministerium fuer Wirtschaft und Arbeit gefoerderte Forschungsvorhaben auf dem Gebiet der Reaktorsicherheit. Berichtszeitraum: 01. Juli - 31. Dezember 2003

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    2004-07-01

    (Joint Safety Research Index) der KEG. Die Anordnung der einzelnen Berichte erfolgt nach aufsteigenden Foerderkennzeichen. (orig.)

  18. Evaluation of the water hazard potential of solid wastes. Pt. 1. Experimental results; Untersuchung von Abfaellen mit biologischen Testverfahren zur Bewertung der Wassergefaehrdung. T. 1. Experimentelle Ergebnisse

    Energy Technology Data Exchange (ETDEWEB)

    Brackemann, H.; Hahn, J.; Vogel, U. [Umweltbundesamt, Berlin (Germany); Hagendorf, U. [Umweltbundesamt, Langen (Germany)

    2000-07-01

    Wastes from three different types of waste treatment facilities (slag from a municipal waste incineration plant, slag granules from a pilot plant combining carbonization and incineration, mechanical and biological treated wastes) were examined to determine their hazard potential to different waters sites. The process temperature is seen to be the main difference between the three treatment processes. The wastes were extracted with water according to the German standard DIN 38414 S 4 and additionally at a constant pH value of 4. The leachates were investigated in a battery of aquatic bioassays and characterised physically and chemically. Every leachate revealed in a toxic effect at least in one test. The toxicity of the leachates prepared at a pH of 4 was significantly higher than the toxicity of the leachates prepared by extraction with water without pH adjustment. The leachates of the slag granules showed the lowest toxicity. On the basis of these experimental results, a scheme to derive Water Hazard Classes of wastes, which is presented in part II of this publication, was developed. (orig.) [German] Zur Bestimmung der wassergefaehrdenden Eigenschaften wurden die Eluate von Abfaellen/Rueckstaenden aus drei verschiedenen Abfallbehandlungsanlagen untersucht (Schlacke aus einer Abfallverbrennungsanlage (Rostfeuerung), Schmelzgranulat aus einer Versuchsanlage mit kombinierter Verschwelung und Hochtemperaturverbrennung sowie biologisch-mechanisch behandelter Abfall). Ein wesentlicher Unterschied dieser drei Verfahren liegt in der Behandlungstemperatur. Die Rueckstaende wurden nach DIN 38414, Teil 4 sowie bei einem konstant eingestellten pH-Wert von 4 eluiert. Die Eluate wurden mit verschiedenen aquatischen Biotests untersucht sowie physikalisch-chemisch charakterisiert. Dabei zeigte sich, dass jedes untersuchte Eluat in mindestens einem Test eine toxische Wirkung aufwies; die Toxizitaet der bei saurem pH-Wert durchgefuehrten Elutionen war deutlich erhoeht. Die Eluate

  19. Small Diameter Bomb Increment II (SDB II)

    Science.gov (United States)

    2015-12-01

    Selected Acquisition Report (SAR) RCS: DD-A&T(Q&A)823-439 Small Diameter Bomb Increment II (SDB II) As of FY 2017 President’s Budget Defense... Bomb Increment II (SDB II) DoD Component Air Force Joint Participants Department of the Navy Responsible Office References SAR Baseline (Production...Mission and Description Small Diameter Bomb Increment II (SDB II) is a joint interest United States Air Force (USAF) and Department of the Navy

  20. Tomo II

    OpenAIRE

    Llano Zapata, José Eusebio

    2015-01-01

    Memorias, histórico, físicas, crítico, apologéticas de la América Meridional con unas breves advertencias y noticias útiles, a los que de orden de Su Majestad hubiesen de viajar y describir aquellas vastas regiones. Reino Vegetal, Tomo II. Por un anónimo americano en Cádiz por los años de 1757. Muy Señor mío, juzgo que los 20 artículos del libro que remití a Vuestra Merced le habrán hecho formar el concepto que merece la fecundidad de aquellos países en las producciones minerales. Y siendo es...

  1. Biliary fascioliasis – an uncommon cause of recurrent biliary colics: Report of a case and brief review [Biliäre Fasciolose – eine ungewöhnliche Ursache für wiederholte Gallenkoliken: Bericht eines Falles mit einer kurzen Übersicht

    Directory of Open Access Journals (Sweden)

    All, Gamal Nasr Ahmed Abdel

    2012-05-01

    Cholangiopankreatikographie (ERCP wurde die biliäre Fasciolose als Ursache für die wiederholten Gallenkoliken entdeckt. Nach Entfernen der lebenden Fasciola hepatica aus dem Gallengang wurde der Patient, nunmehr seit 11 Monaten, symptomfrei. Das klinische Spektrum der biliären Fasciolose wird in diesem Bericht diskutiert.

  2. Cd(II), Cu(II)

    African Journals Online (AJOL)

    user

    Depending on the way goethite was pretreated with oxalic acid, affinity for Cd(II) varied ...... Effects and mechanisms of oxalate on Cd(II) adsorption on goethite at different ... precipitation, surfactant mediation, hydrothermal and micro-emulsion.

  3. Cu(II) AND Zn(II)

    African Journals Online (AJOL)

    Preferred Customer

    SYNTHESIS OF 2,2-DIMETHYL-4-PHENYL-[1,3]-DIOXOLANE USING ZEOLITE. ENCAPSULATED Co(II), Cu(II) AND Zn(II) COMPLEXES. B.P. Nethravathi1, K. Rama Krishna Reddy2 and K.N. Mahendra1*. 1Department of Chemistry, Bangalore University, Bangalore-560001, India. 2Department of Chemistry, Government ...

  4. Elizabeth II uus kunstigalerii

    Index Scriptorium Estoniae

    1999-01-01

    Tähistamaks oma troonile asumise 50. aastapäeva, avab Elizabeth II 6. II 2002 Buckinghami palees uue kunstigalerii, mis ehitatakse palee tiibhoonena. Arhitekt John Simpson. Elizabeth II kunstikogust

  5. Fractures of the atlantoaxial complex in the elderly: assessment of radiological spectrum of fractures and factors influencing imaging diagnosis; Frakturen des Atlas und Axis bei aelteren Patienten: Untersuchung des Radiologischen Spektrums der Frakturen und bedeutsamer Faktoren fuer die Bildgebende Diagnostik

    Energy Technology Data Exchange (ETDEWEB)

    Lomoschitz, F.M. [Universitaetsklinik fuer Radiodiagnostik, AKH Wien, Wien (Germany); Dept. of Radiology, Harborview Medical Center, Univ. of Washington, Seattle, WA (United States); Blackmore, C.C.; Linnau, K.F.; Mann, F.A. [Dept. of Radiology, Harborview Medical Center, Univ. of Washington, Seattle, WA (United States); Stadler, A. [Universitaetsklinik fuer Radiodiagnostik, AKH Wien, Wien (Germany)

    2004-02-01

    Objective: to describe patterns of atlantoaxial fractures in a population of consecutive elderly patients, including assessment of type, distribution and associated clinical and radiological findings, and to analyze any influence of the causative trauma mechanism on the individual fracture pattern. Materials and methods: the distribution and type of 123 atlantoaxial fractures in 95 subjects older than 65 years (range: 65-102; mean age: 79 years) were retrospectively assessed. For each subject, trauma mechanism and clinical and neurological status were recorded at admission. Initial imaging studies of the cervical spine were reviewed. Preexistent degenerative changes were assessed and the atlantoaxial fractures classified. Data were evaluated for the frequency of different types of fractures of C1 and C2 and for accompanying fractures of cervical vertebrae or the occipital condyles, respectively. Results: the majority of patients with injuries of the atlantoaxial complex had fractures of C2 (90 of 95, 95%). A large proportion of these patients (67 of 90, 74%) had odontoid fractures. An isolated fracture of C1 was present in only 5 (5%) patients. Associated fractures of the occipital condyles or other cervical vertebrae were rare (10 of 95, 11%). The main trauma mechanism for atlantoaxial injuries was a fall (56 of 95, 59%). Elderly patients injured in motor vehicle accidents were more likely to have isolated fractures of C2 and Type III fractures of the odontoid (p < 0.02). Conclusion: in elderly patients, fractures of the atlantoaxial complex are mainly caused by falls and almost always involve C2. The trauma mechanism influences the fracture pattern (orig.) [German] Untersuchung von Frakturen des Atlas (C1) und Axis (C2) in einer konsekutiven Population aelterer Patienten ({>=} 65 Jahre) hinsichtlich Fraktur-Typus, -Haeufigkeit, und -Kombinationen, und Analyse von assoziierter Klinik sowie Einfluss von unfall-ursaechlichen Faktoren auf Frakturen des atlanto

  6. Synthesis and characterisation of Cu(II), Ni(II), Mn(II), Zn(II) and VO(II ...

    Indian Academy of Sciences (India)

    Unknown

    Synthesis and characterisation of Cu(II), Ni(II), Mn(II), Zn(II) and VO(II) Schiff base complexes derived from o-phenylenediamine and acetoacetanilide. N RAMAN*, Y PITCHAIKANI RAJA and A KULANDAISAMY. Department of Chemistry, VHNSN College, Virudhunagar 626 001, India e-mail: ra_man@123india.com.

  7. Wie nutzen deutsche Tiermedizinerinnen und Tiermediziner soziale Netzwerke? Eine Untersuchung am Beispiel des tiermedizinischen Netzwerks „NOVICE“ [How do German veterinarians use social networks? A study, using the example of the 'NOVICE' veterinary medicine network

    Directory of Open Access Journals (Sweden)

    Schaper, Elisabeth

    2013-02-01

    figures developed very positively during the assessed time period. Until now, the focus of the content of contributions in NOVICE (Network of Veterinary ICT in Education has been on veterinary medicine teaching supported by e-Learning. An increase in the number of members would, however, be beneficial in order to further develop the network so that valuable exchange of information and informal learning can also take place in other specialist areas of veterinary medicine. [german] Zielsetzung: NOVICE (Network Of Veterinary ICt in Education, ist ein soziales professionelles online-Netzwerk für Tiermediziner, Dozierende und Studierende der Tiermedizin sowie für E-Learning-Berater bzw. Didaktiker der veterinärmedizinischen Bildungsstätten. In dieser Arbeit sollte untersucht werden, wie die Akzeptanz bei deutschen Tierärzten, Dozierenden und Studierenden der Veterinärmedizin sowie E-Learning-Beauftragten für ein fachspezifisches Netzwerk ist, welche Anforderungen durch die Nutzer an soziale online-Netzwerke gestellt werden, wie der Umgang mit Web 2.0-Werkzeugen , erfolgt und welches Potential ein berufsspezifisches Netzwerk bieten könnte. Methodik: Die Untersuchung erfolgte mittels Datenanalyse durch die Datenbank der Elgg-Plattform sowie zusätzlich mit google analytics. Jährliche Fokusgruppenbefragungen und Einzelinterviews wurden durchgeführt, um eine Akzeptanzanalyse der Netzwerk-Nutzer vorzunehmen.Ergebnisse: In NOVICE haben sich zwischen dem 01. September 2010 und 21. März 2012 1961 Mitglieder aus 73 Ländern registriert, dabei hat Deutschland mit 565 Nutzern (28,81% den größten Anteil. In diesem Zeitraum kamen auch die meisten Einzelbesuche der Webseite aus Deutschland. Insgesamt sind im Netzwerk 24,83% aller Mitglieder und 19,22% der deutschen Mitglieder aktiv. In Bezug auf das Geschlecht befinden sich sowohl in Hinblick auf alle Mitglieder als auch auf die deutschen Mitglieder deutlich mehr Frauen als Männer in NOVICE. Die am häufigsten verwendeten Web

  8. (II) COMPLEX COMPOUND

    African Journals Online (AJOL)

    user

    electrochemical sensors, as well as in various chromatographic ... were carried out using Jenway pH meter Model 3320 and a conductivity ... Figure 1: the proposed molecular structure of the copper (II) Schiff base complex. M = Cu (II) or Mn (II).

  9. and copper(II)

    Indian Academy of Sciences (India)

    Unknown

    (II) and copper(II)–zinc(II) complexes. SUBODH KUMAR1, R N PATEL1*, P V KHADIKAR1 and. K B PANDEYA2. 1 Department of Chemistry, APS University, Rewa 486 003, India. 2 CSJM University, Kanpur 208 016, India e-mail: (R N Patel) ...

  10. Pius II. a utrakvismus

    OpenAIRE

    Šimek, Milan

    2009-01-01

    Milan Šimek Pius II. a utrakvismus Pius II. and utraquism Based on sources work - out, the thesis aims the description and analysis of the attitude alternation of Enea Sylvio Piccolomini - Pius II to the utraquism. The conclusions stress the postulate that Pius II. did not change that attitude, but just did not succed in quelling the utraquist movement. In the sense of political background that finally led to fatal dissention among both leaders, king Jiří of Poděbrady and pope Pius II.

  11. Bericht über die Pilotphase Handschriftendigitalisierung der deutschen Handschriftenzentren

    Directory of Open Access Journals (Sweden)

    Carolin Schreiber

    2014-12-01

    Full Text Available Im Juni 2013 genehmigte die DFG die Durchführung einer zweijährigen Pilotphase zur Digitalisierung mittelalterlicher Handschriften an den deutschen Handschriftenzentren. Diese wird im DFG-Programm „Erschließung und Digitalisierung handschriftlicher und gedruckter Überlieferung“ im Bereich der Wissenschaftlichen Literaturversorgungs- und Informationssysteme (LIS gefördert.Das Vorhaben besteht aus sieben Digitalisierungsprojekten, die seit Herbst 2013 an fünf deutschen Bibliotheken durchgeführt werden. Die projektübergreifenden Organisations- und Koordinationsarbeiten sind an der Bayerischen Staatsbibliothek angesiedelt. Auf Basis der praktischen Erfahrungen der sieben einzelnen Projekte soll ein sog. Masterplan erarbeitet werden, der bei positiver Begutachtung zur Grundlage einer zukünftigen DFG-Förderlinie werden soll. Ziel der Initiative ist die Gesamtdigitalisierung des mittelalterlichen Handschriftenerbes in Deutschland. In June 2013, a proposal for a two-year pilot phase for the development of a concerted national programme for the digitization of medieval manuscripts in Germany, proposed by five German cataloguing centres, was accepted by the DFG, the largest research funding organization in Germany, in the context of its Scientific Library Services and Information Systems (LIS programme [1]. The pilot phase consists of seven coordinated digitization projects carried out by five German libraries. Project coordination and organization is taken over by the Bayerische Staatsbibliothek (BSB. Based on the practical experience gained in the different digitization projects, a master plan will be developed, which will be the basis for the establishment of a new DFG funding programme. The initiative aims at the digitization of all surviving medieval manuscripts preserved in German cultural heritage institutions.

  12. Aufbau von regionalen Schülerforschungszentren Berichte und Praxisempfehlungen

    CERN Document Server

    Bayatloo, Annabel

    2013-01-01

    Angesichts des sich verschärfenden Fachkräftemangels ist es wichtig, die vorhandenen Begabungspotenziale noch wirkungsvoller zu identifizieren und auszuschöpfen. Vor allem im Bereich von Mathematik, Informatik, Naturwissenschaft und Technik (MINT) erweist es sich als zielführend, künftig stärker auf forschendes Lernen zu setzen. Dieser pädagogische Ansatz wird auf vorbildliche Weise an Schülerforschungszentren verwirklicht. Aufgrund der Chancen für die Nachwuchsförderung, die mit diesen außerschulischen MINT-Bildungszentren verbunden sind, haben der Deutsche Industrie- und Handelskammertag (DIHK), die IHK Darmstadt, LernortLabor - Bundesverband der Schülerlabore e. V. und die Stiftung Jugend forscht e. V. gemeinsam einen Leitfaden für den „Aufbau regionaler Schülerforschungszentren“ erarbeitet. Die neue Publikation ist als Best Practice-Handreichung konzipiert und soll vor allem regionale Entscheidungsträger in die Lage versetzen, auf diesem Feld selbst aktiv zu werden und den begonnenen Pr...

  13. BeForE - 2016: Bericht Foresight in Higher Education

    OpenAIRE

    Lübcke, Maren

    2016-01-01

    BeForE hat zum Ziel, für den Hochschulbereich relevante technologische Trends zu identifizieren, diese in einer realistischen Zeiteinschätzung zu verorten und eine robuste und skalierbare Methode für die Erstellung von zukünftigen BeForE Ausgaben zu entwickeln. Dazu wurde mit Hilfe computerlinguistischer Verfahren aus dem Big-Data-Bereich eine Metaanalyse über verschiedene Diskursräume durchgeführt. Insgesamt wurden die Ergebnisse von acht verschiedenen Trendreports, 1‘416 wissenschaftlichen ...

  14. Complexes of cobalt(II), nickel(II), copper(II), zinc(II), cadmium(II) and dioxouranium(II) with thiophene-2-aldehydethiosemicarbazone

    International Nuclear Information System (INIS)

    Singh, Balwan; Misra, Harihar

    1986-01-01

    Metal complexes of thiosemicarbazides have been known for their pharmacological applications. Significant antitubercular, fungicidal and antiviral activities have been reported for thiosemicarbazides and their derivatives. The present study describes the systhesis and characterisation of complexes of Co II , Cu II , Zn II ,Cd II and UO II with thiosemicarbazone obtained by condensing thiophene-2-aldehyde with thiosemicarbazide. 17 refs., 2 tables. (author)

  15. Report about the agricultural situation in Austria 2000; Gruener Bericht 2000. Bericht ueber die Lage der oesterreichischen Landwirtschaft 2000

    Energy Technology Data Exchange (ETDEWEB)

    Poschacher, G; Panholzer, L; Hofer, O; Moravec, K; Fehrer, R; Brier, K [eds.

    2001-07-01

    In 2000 economic growth in Austria amounted to 3.2 %. The inflation rate rose from 0.6 % in 1999 to 2.3 % in 2000. Apart from the increase in crude oil price the rise in indirect taxes contributed as well to the upward trend of prices. According to Eurostat the unemployed rate went down to 3.7 %. According to the agricultural accounts agricultural incomes were rising again in 2000 for the first time since 1995 (+1.6 %). The final production of agriculture and forestry amounted to ATS 62.9 billion (+0.4 %, of which agriculture ATS 50.3 billion, and forestry ATS 12.6 billion). Whereas the yields in plant production decreased in particular due to the drought (-6.1 %), the gross yield from animal husbandry increased by 8.1 %. this rise is in particular due to the recovery of the pig market. According to the Austrian Institute of Economic Research (Wirtschafts-forschungsinstitut WIFO) direct payments rose compared to the year before by ATS 0.5 billion to ATS 17.8 billion. The share of agriculture and forestry in the GDP decreased to 1.3 %. According to WIFO the number of persons working full-time in the agricultural sector totalled 140,000 in 2000. The agricultural quota amounted to 4.0 %. In agricultural trade a rise was recorded again in exports (15.6 %) as well as in imports (14.7 %) in 2000 compared to the year 1999. Exports of agricultural goods totalled almost ATS 47 billion, of which two thirds were exports to EU member countries. Agricultural imports amounted to almost ATS 61 billion, of which three quarters came from EU member countries. The agricultural trade balance decreased to - ATS 14 billion. In 2000 the food industry was severely hi in particular by the current meat crises. European consumers organizations and associations call for the rethinking in the subsidisation policy and a promotion of organic farming. The core elements of the European foodstuffs model should be in particular security and safety, quality, origin, and diversity. In 2000 Austrian tourism recorded a slight increase in overnight stays of 0.8 % (in 1999: +1.4 %). The number of overnight stays amounted to 113.7 million. As far as overnight stays on farms are concerned there was in particular an increase in the category 'holiday apartments' (+7.4 %) compared to the year before. The number of overnight stays in the category private farm holidays (up to 10 beds, without holiday apartments) decreased by 3.8 %. (author)

  16. Quininium tetrachloridozinc(II

    Directory of Open Access Journals (Sweden)

    Li-Zhuang Chen

    2009-10-01

    Full Text Available The asymmetric unit of the title compound {systematic name: 2-[hydroxy(6-methoxyquinolin-1-ium-4-ylmethyl]-8-vinylquinuclidin-1-ium tetrachloridozinc(II}, (C20H26N2O2[ZnCl4], consists of a double protonated quininium cation and a tetrachloridozinc(II anion. The ZnII ion is in a slightly distorted tetrahedral coordination environment. The crystal structure is stabilized by intermolecular N—H...Cl and O—H...Cl hydrogen bonds.

  17. Burkina Faso - BRIGHT II

    Data.gov (United States)

    Millennium Challenge Corporation — Millennium Challenge Corporation hired Mathematica Policy Research to conduct an independent evaluation of the BRIGHT II program. The three main research questions...

  18. cobalt(II), nickel(II)

    Indian Academy of Sciences (India)

    Unknown

    procedures. The supporting electrolyte, NaClO4 used in the voltammetric experiment was purchased from. Sigma. IR spectra were recorded in KBr medium on .... (13⋅6). L = Schiff base ligand form of one broad band envelope. The electronic spectra of Co(II) complex showed two spin-allowed transitions at 17856 and ...

  19. Nuclear physics II

    International Nuclear Information System (INIS)

    Elze, T.

    1988-01-01

    This script consisting of two parts contains the matter of the courses Nuclear Pyhsics I and II, as they were presented in the winter term 1987/88 and summer term 1988 for students of physics at Frankfurt University. In the present part II the matter of the summer term is summarized. (orig.) [de

  20. World War II Homefront.

    Science.gov (United States)

    Garcia, Rachel

    2002-01-01

    Presents an annotated bibliography that provides Web sites focusing on the U.S. homefront during World War II. Covers various topics such as the homefront, Japanese Americans, women during World War II, posters, and African Americans. Includes lesson plan sources and a list of additional resources. (CMK)

  1. Biologically active new Fe(II, Co(II, Ni(II, Cu(II, Zn(II and Cd(II complexes of N-(2-thienylmethylenemethanamine

    Directory of Open Access Journals (Sweden)

    C. SPÎNU

    2008-04-01

    Full Text Available Iron(II, cobalt(II, nickel (II, copper (II, zinc(II and cadmium(II complexes of the type ML2Cl2, where M is a metal and L is the Schiff base N-(2-thienylmethylenemethanamine (TNAM formed by the condensation of 2-thiophenecarboxaldehyde and methylamine, were prepared and characterized by elemental analysis as well as magnetic and spectroscopic measurements. The elemental analyses suggest the stoichiometry to be 1:2 (metal:ligand. Magnetic susceptibility data coupled with electronic, ESR and Mössbauer spectra suggest a distorted octahedral structure for the Fe(II, Co(II and Ni(II complexes, a square-planar geometry for the Cu(II compound and a tetrahedral geometry for the Zn(II and Cd(II complexes. The infrared and NMR spectra of the complexes agree with co-ordination to the central metal atom through nitrogen and sulphur atoms. Conductance measurements suggest the non-electrolytic nature of the complexes, except for the Cu(II, Zn(II and Cd(II complexes, which are 1:2 electrolytes. The Schiff base and its metal chelates were screened for their biological activity against Escherichia coli, Staphylococcus aureus and Pseudomonas aeruginosa and the metal chelates were found to possess better antibacterial activity than that of the uncomplexed Schiff base.

  2. Evolved H II regions

    International Nuclear Information System (INIS)

    Churchwell, E.

    1975-01-01

    A probable evolutionary sequence of H II regions based on six distinct types of observed objects is suggested. Two examples which may deviate from this idealized sequence, are discussed. Even though a size-mean density relation of H II regions can be used as a rough indication of whether a nebula is very young or evolved, it is argued that such a relation is not likely to be useful for the quantitative assignment of ages to H II regions. Evolved H II regions appear to fit into one of four structural types: rings, core-halos, smooth structures, and irregular or filamentary structures. Examples of each type are given with their derived physical parameters. The energy balance in these nebulae is considered. The mass of ionized gas in evolved H II regions is in general too large to trace the nebula back to single compact H II regions. Finally, the morphological type of the Galaxy is considered from its H II region content. 2 tables, 2 figs., 29 refs

  3. Preliminary PBFA II design

    International Nuclear Information System (INIS)

    Johnson, D.L.; VanDevender, J.P.; Martin, T.H.

    1980-01-01

    The upgrade of Sandia National Laboratories particle beam fusion accelerator, PBFA I, to PBFA II presents several interesting and challenging pulsed power design problems. PBFA II requires increasing the PBFA I output parameters from 2 MV, 30 TW, 1 MJ to 4 MV, 100 TW, 3.5 MJ with the constraint of using much of the same PBFA I hardware. The increased PBFA II output will be obtained by doubling the number of modules (from 36 to 72), increasing the primary energy storage (from 4 MJ to 15 MJ), lowering the pulse forming line (PFL) output impedance, and adding a voltage doubling network

  4. Mn(II), Zn(II) and VO(II) Schiff

    Indian Academy of Sciences (India)

    Home; Journals; Journal of Chemical Sciences; Volume 113; Issue 3. Synthesis and characterisation of Cu(II), Ni(II), Mn(II), Zn(II) and VO(II) Schiff base complexes derived from o-phenylenediamine and acetoacetanilide. N Raman Y Pitchaikani Raja A Kulandaisamy. Inorganic Volume 113 Issue 3 June 2001 pp 183-189 ...

  5. Planning, budgeting and performance management at Swiss hospitals – Are Swiss hospitals at a crossroads – Will these medical specialist organisations in future develop into institutions with a business orientation? [Die Krankenhäuser der Schweiz am Wendepunkt von der medizinischen Expertenorganisation hin zu betriebswirtschaftlich geführten Institutionen? – Untersuchung zu deren Performance-Management-System

    Directory of Open Access Journals (Sweden)

    Walser, Konrad

    2013-11-01

    die Schweizer Krankenhäuser ein kohärentes und langfristig ausgerichtetes Performance Management aufbauen können. Mit der Einführung von Wettbewerbsmechanismen (DRG-System im neuen Krankenversicherungsgesetz wird die betriebswirtschaftliche Ausrichtung der Krankenhausführung zum Schlüsselfaktor für ein Bestehen am Markt. Die Basis der vorliegenden Untersuchung bildet eine schriftliche Befragung aller Deutschschweizer Krankenhäuser. Diese wurden auf der Grundlage eines Reifegrade-Modells zum Ist- sowie dem Soll-Zustand von deren Performance-Management-Systemen befragt. Das Reifegradmodell wurde für Krankenhäuser angepasst.Die deskriptive Auswertung der Daten zeigt, dass die meisten Krankenhäuser auf dem richtigen Weg sind. Planung und Controlling haben mehrheitlich einen hohen Reifegrad, indes wird die strategische Wichtigkeit eines wirksamen Performance Managements (Reporting, IT-Integration vielerorts noch unterschätzt. So verfügen die meisten Krankenhäuser bereits heute über ausgebaute Planungsmechanismen, beurteilen aber die dazu gehörige Informatikunterstützung als nicht prioritär.Dabei zeigen die bivariaten Auswertungen (Korrelationsmatrizen der Umfrage, dass gerade der IT als Träger oder Plattform des Performance-Managements eine zentrale Rolle zukommt. Gleichzeitig weisen diese weiterführenden Analysen darauf hin, dass die betriebswirtschaftliche Krankenhausplanung der eigentliche Treiber zum Auf- und Ausbau von leistungsfähigen Performance-Management-Systemen ist. Erst eine gut entwickelte und integrierte IT und klare Planwerte, so zeigt sich ausgehend von der Untersuchung, lassen ein umfassendes Performance Management zu.Ein gut funktionierendes Performance Management beinhaltet überdies auch eine organisatorische Komponente. Erst wenn die Aufgaben, Kompetenzen und Verantwortlichkeiten im Hinblick auf die Krankenhaussteuerung bezüglich Betriebswirtschaft, Medizin und Pflege aufeinander abgestimmt sind, können Krankenh

  6. The Belle II Experiment

    CERN Document Server

    Kahn, J

    2017-01-01

    Set to begin data taking at the end of 2018, the Belle II experiment is the next-generation B-factory experiment hosted at KEK in Tsukuba, Japan. The experiment represents the cumulative effort from the collaboration of experimental and detector physics, computing, and software development. Taking everything learned from the previous Belle experiment, which ran from 1998 to 2010, Belle II aims to probe deeper than ever before into the field of heavy quark physics. By achieving an integrated luminosity of 50 ab−1 and accumulating 50 times more data than the previous experiment across its lifetime, along with a rewritten analysis framework, the Belle II experiment will push the high precision frontier of high energy physics. This paper will give an overview of the key components and development activities that make the Belle II experiment possible.

  7. Factor II assay

    Science.gov (United States)

    ... this page: //medlineplus.gov/ency/article/003674.htm Factor II assay To use the sharing features on ... M. is also a founding member of Hi-Ethics and subscribes to the principles of the Health ...

  8. Factor II deficiency

    Science.gov (United States)

    ... this page: //medlineplus.gov/ency/article/000549.htm Factor II deficiency To use the sharing features on ... M. is also a founding member of Hi-Ethics and subscribes to the principles of the Health ...

  9. Ni(II

    African Journals Online (AJOL)

    Preferred Customer

    analytical chemistry, catalysis, electrochemistry, ring-opening metathesis ... Ethanol was dried over anhydrous copper(II) sulfate and distilled over metallic sodium. ... All bacteria were inoculated into Nutrient Broth (Difco) and incubated for 24 h ...

  10. NNDSS - Table II. Vibriosis

    Data.gov (United States)

    U.S. Department of Health & Human Services — NNDSS - Table II. Vibriosis - 2017. In this Table, provisional cases of selected notifiable diseases (≥1,000 cases reported during the preceding year), and selected...

  11. Disruption Rose Tinted II

    OpenAIRE

    Livingstone, Andrew

    2009-01-01

    'Disruption - Rose Tinted II' continues to engage narratives of historical English china as previously explored in the work 'Rose Tinted'. This work engages the sleepy rural idyll which is overlaid with visual contemporary social commentary.

  12. NNDSS - Table II. Vibriosis

    Data.gov (United States)

    U.S. Department of Health & Human Services — NNDSS - Table II. Vibriosis - 2018. In this Table, provisional cases of selected notifiable diseases (≥1,000 cases reported during the preceding year), and selected...

  13. Gamble II Facility

    Data.gov (United States)

    Federal Laboratory Consortium — FUNCTION: Gamble II produces a high-voltage (2 MV), high-current (1 MA), short (100 ns) pulse of energy of either positive or negative polarity. This terawatt power...

  14. Leo II PC

    Data.gov (United States)

    Kansas Data Access and Support Center — LEO II is a second-generation software system developed for use on the PC, which is designed to convert location references accurately between legal descriptions and...

  15. Tokapole II device

    International Nuclear Information System (INIS)

    Sprott, J.G.

    1978-05-01

    A discussion is given of the design and operation of the Tokapole II device. The following topics are considered: physics considerations, vacuum vessel, poloidal field, ring and support design, toroidal field, vacuum system, initial results, and future plans

  16. copper(II)

    Indian Academy of Sciences (India)

    Unknown

    bis(2,2,6,6-tetramethyl-3,5-heptadionato)copper(II) ... Abstract. Equilibrium concentrations of various condensed and gaseous phases have been thermodyna- ... phere, over a wide range of substrate temperatures and total reactor pressures.

  17. Digital optical computer II

    Science.gov (United States)

    Guilfoyle, Peter S.; Stone, Richard V.

    1991-12-01

    OptiComp is currently completing a 32-bit, fully programmable digital optical computer (DOC II) that is designed to operate in a UNIX environment running RISC microcode. OptiComp's DOC II architecture is focused toward parallel microcode implementation where data is input in a dual rail format. By exploiting the physical principals inherent to optics (speed and low power consumption), an architectural balance of optical interconnects and software code efficiency can be achieved including high fan-in and fan-out. OptiComp's DOC II program is jointly sponsored by the Office of Naval Research (ONR), the Strategic Defense Initiative Office (SDIO), NASA space station group and Rome Laboratory (USAF). This paper not only describes the motivational basis behind DOC II but also provides an optical overview and architectural summary of the device that allows the emulation of any digital instruction set.

  18. Chemical behaviour of trivalent and pentavalent americium in saline NaCl-solutions. Studies of transferability of laboratory data to natural conditions. Interim report. Reported period: 1.2.1993-31.12.1993; Chemisches Verhalten von drei- und fuenfwertigem Americium in Salinen NaCl-Loesungen. Untersuchung der Uebertragbarkeit von Labordaten auf natuerliche Verhaeltnisse. Zwischenbericht. Berichtszeitraum 1.2.1993-31.12.1993

    Energy Technology Data Exchange (ETDEWEB)

    Runde, W; Kim, J I

    1994-09-15

    In order to clarify the chemical behaviour of Americium in saline aqueous systems relevant for final storage this study deals with the chemical reactions of trivalent and pentavalent Americium in NaCl-solutions under the influence of radiolysis from its own alpha radiation. The focus of the study was on investigating the geologically relevant reactions, such as hydrolysis or carbonate- and chloride complexing in solid-liquid equilibriums. Comprehensive measurements on solubility and spectroscopic studies in NaCl-solutions were carried out in a CO{sub 2}-free atmosphere and 10{sup -2} atm CO{sub 2} partial pressure. Identification and characterisation of the AM (III) and AM(V) solid phases were supplemented by structural research with the chemically analogue EU (III) and Np(V) compounds. The alpha-radiation induced radiolysis in saline NaCl solutions and the redox behaviour of Americium which was influenced thereby were spectroscopically quantified. (orig.) [Deutsch] Zur Klaerung des chemischen Verhaltens von Americium in endlagerrelevanten salinen aquatischen Systemen befasst sich die vorliegende Arbeit mit den chemischen Reaktionen des drei- und fuenfwertigen Americiums in NaCl-Loesungen unter dem Einfluss der Radiolyse durch die eigene {alpha}-Strahlung. Der Schwerpunkt dieser Arbeit lag auf der Untersuchung der geologisch relevanten Reaktionen, wie Hydrolyse sowie Carbonat- und Chloridkomplexierung in fest-fluessig Gleichgewichtssystemen. Hierzu wurden umfassende Loeslichkeitsmessungen und spektroskopische Untersuchungen in NaCl-Loesungen, sowohl unter CO{sub 2}-freier Atmosphaere als auch unter 10{sup -2} atm CO{sub 2}-Partialdruck, durchgefuehrt. Die Identifizierung und Charakterisierung der Am(III)- und Am(V)-Festphasen wurde ergaenzt durch strukturelle Untersuchungen mit den chemisch analogen Eu(III)- und Np(V)-Verbindungen. Die von der {alpha}-Strahlung induzierte Radiolyse in salinen NaCl-Loesungen und das dadurch beeinflusste Redoxverhalten von Americium

  19. SPEAR II performance

    International Nuclear Information System (INIS)

    Paterson, J.M.

    1975-01-01

    The single beam and colliding beam performance of the SLAC electron-positron storage ring SPEAR II is described. The sevenfold increase in harmonic number in SPEAR II in comparison to SPEAR I has made significant changes in single beam behavior. Strong synchrobetatron resonances and a new transverse instability are observed, and our first studies of these phenomena are described. Measurements on current dependent bunch lengthening are presented. (auth)

  20. Computing at Belle II

    International Nuclear Information System (INIS)

    Kuhr, Thomas

    2012-01-01

    Belle II, a next-generation B-factory experiment, will search for new physics effects in a data sample about 50 times larger than the one collected by its predecessor, the Belle experiment. To match the advances in accelerator and detector technology, the computing system and the software have to be upgraded as well. The Belle II computing model is presented and an overview of the distributed computing system and the offline software framework is given.

  1. Nsls-II Boster

    Science.gov (United States)

    Gurov, S. M.; Akimov, A. V.; Akimov, V. E.; Anashin, V. V.; Anchugov, O. V.; Baranov, G. N.; Batrakov, A. M.; Belikov, O. V.; Bekhtenev, E. A.; Blum, E.; Bulatov, A. V.; Burenkov, D. B.; Cheblakov, P. B.; Chernyakin, A. D.; Cheskidov, V. G.; Churkin, I. N.; Davidsavier, M.; Derbenev, A. A.; Erokhin, A. I.; Fliller, R. P.; Fulkerson, M.; Gorchakov, K. M.; Ganetis, G.; Gao, F.; Gurov, D. S.; Hseuh, H.; Hu, Y.; Johanson, M.; Kadyrov, R. A.; Karnaev, S. E.; Karpov, G. V.; Kiselev, V. A.; Kobets, V. V.; Konstantinov, V. M.; Kolmogorov, V. V.; Korepanov, A. A.; Kramer, S.; Krasnov, A. A.; Kremnev, A. A.; Kuper, E. A.; Kuzminykh, V. S.; Levichev, E. B.; Li, Y.; Long, J. De; Makeev, A. V.; Mamkin, V. R.; Medvedko, A. S.; Meshkov, O. I.; Nefedov, N. B.; Neyfeld, V. V.; Okunev, I. N.; Ozaki, S.; Padrazo, D.; Petrov, V. V.; Petrichenkov, M. V.; Philipchenko, A. V.; Polyansky, A. V.; Pureskin, D. N.; Rakhimov, A. R.; Rose, J.; Ruvinskiy, S. I.; Rybitskaya, T. V.; Sazonov, N. V.; Schegolev, L. M.; Semenov, A. M.; Semenov, E. P.; Senkov, D. V.; Serdakov, L. E.; Serednyakov, S. S.; Shaftan, T. V.; Sharma, S.; Shichkov, D. S.; Shiyankov, S. V.; Shvedov, D. A.; Simonov, E. A.; Singh, O.; Sinyatkin, S. V.; Smaluk, V. V.; Sukhanov, A. V.; Tian, Y.; Tsukanova, L. A.; Vakhrushev, R. V.; Vobly, P. D.; Utkin, A. V.; Wang, G.; Wahl, W.; Willeke, F.; Yaminov, K. R.; Yong, H.; Zhuravlev, A.; Zuhoski, P.

    The National Synchrotron Light Source II is a third generation light source, which was constructed at Brookhaven National Laboratory. This project includes a highly-optimized 3 GeV electron storage ring, linac preinjector, and full-energy synchrotron injector. Budker Institute of Nuclear Physics built and delivered the booster for NSLS-II. The commissioning of the booster was successfully completed. This paper reviews fulfilled work by participants.

  2. II-VI semiconductor compounds

    CERN Document Server

    1993-01-01

    For condensed matter physicists and electronic engineers, this volume deals with aspects of II-VI semiconductor compounds. Areas covered include devices and applications of II-VI compounds; Co-based II-IV semi-magnetic semiconductors; and electronic structure of strained II-VI superlattices.

  3. About APPLE II Operation

    International Nuclear Information System (INIS)

    Schmidt, T.; Zimoch, D.

    2007-01-01

    The operation of an APPLE II based undulator beamline with all its polarization states (linear horizontal and vertical, circular and elliptical, and continous variation of the linear vector) requires an effective description allowing an automated calculation of gap and shift parameter as function of energy and operation mode. The extension of the linear polarization range from 0 to 180 deg. requires 4 shiftable magnet arrrays, permitting use of the APU (adjustable phase undulator) concept. Studies for a pure fixed gap APPLE II for the SLS revealed surprising symmetries between circular and linear polarization modes allowing for simplified operation. A semi-analytical model covering all types of APPLE II and its implementation will be presented

  4. VATICANO II CONCILIO DOCTRINAL?

    Directory of Open Access Journals (Sweden)

    Horacio Bojorge

    1970-01-01

    Full Text Available It is a century since the army of Victor Manuel invaded Rome and put an end to Vatican I. In this article we try to understand Vatican II linking it to the previous circumtances and binding it to its doctrinal and pastoral character. Vatican II omitted many subjects that seemed important, e. g. not giving any dogmatic definitions. Contrasting with the Tridentine and Vatican I, that were mostly doctrinal, Vatican II was pastoral. But it was also doctrinal as were the two previous also pastoral. The Constitution "Dei Verbum" brings forth the intentions that led John XXIII to summon the Council in 5-8-1962. The world looked confused and agitated. What could the Church do?

  5. Datalogger usando nios ii

    OpenAIRE

    Campoverde Rugel, Luis Enrique; Velásquez Vargas, Washington Adrián; Ponguillo, Ronald

    2013-01-01

    El presente proyecto consiste en la implementación de un Datalogger utilizando el microprocesador NIOS II el cual fue embebido en el FPGA CYCLONE II que se encuentra integrada en la tarjeta de desarrollo ALTERA DE2, el cual obtiene datos de distintos sensores y los almacena en una tarjeta SD Card. Para la realización del proyecto se aplican cuatro etapas. La primera etapa está basada en obtener los datos mediante el uso de sensores y la transmisión usando un PIC, la siguiente etapa se basa...

  6. Results from SAGE II

    International Nuclear Information System (INIS)

    Nico, J.S.

    1994-01-01

    The Russian-American Gallium solar neutrino Experiment (SAGE) began the second phase of operation (SAGE II) in September of 1992. Monthly measurements of the integral flux of solar neutrinos have been made with 55 tonnes of gallium. The K-peak results of the first nine runs of SAGE II give a capture rate of 66 -13 +18 (stat) -7 +5 (sys) SNU. Combined with the SAGE I result of 73 -16 +18 (stat) -7 5 (sys) SNU, the capture rate is 69 -11 +11 (stat) -7 +5 (sys) SNU. This represents only 52%--56% of the capture rate predicted by different Standard Solar Models

  7. Information on Asse II

    International Nuclear Information System (INIS)

    2014-01-01

    The brochure published by BfS describes the actual situation of Asse II with respect to the debate on an interim storage and the status of the realization of a final repository search law. During the visit of the new environment minister Hendricks in the underground facility repository Asse II the issue interim storage site and the retrieval of the corroded casks with radioactive waste were discussed. The challenges for BFS include the acceleration of the retrieval process and the safety of the procedure.

  8. TJ-II project

    International Nuclear Information System (INIS)

    Alejaldre, C.; Gozalo, J.J.A.; Perez, J.B.; Magaria, F.C.; Diaz, J.R.C.; Perez, J.G.; Lopez-Fraguas, A.; Garcia, L.; Krivenski, V.I.; Martin, R.; Navarro, A.P.; Perea, A.; Rodriguez-Yunta, A.; Ayza, M.S.; Varias, A.

    1990-01-01

    The TJ-II device is a medium-size helical-axis stellarator to be built in Madrid. Its main characteristics are potential for high-beta operation; flexibility, i.e., its rotational transform can be varied over a wide range and its shear to some extent; and bean-shaped plasma cross section. The latest understanding of TJ-II physics in the fields of electron cyclotron resonance heating, transport, and magneto-hydrodynamics, and the engineering solutions introduced in its final design are discussed

  9. ECLESIOLOGIA DO VATICANO II

    Directory of Open Access Journals (Sweden)

    Víctor Codina

    2013-01-01

    Full Text Available Não se pode compreender a eclesiologia do Vaticano II sem conhecer a vida, o estilo pastoral e o carisma de João XXIII, que convocou o Concílio e abriu o caminho em direção a uma nova configuração eclesial que acabava com séculos de uma Igreja de Cristandade. O Vaticano II implica uma transição de uma Igreja clerical a uma Igreja Povo de Deus, povo de batizados. A passagem de uma Igreja juridicista e legalista a uma Igreja Mistério de comunhão em Cristo. Mudar de uma Igreja triunfalista e ligada ao poder mundano a uma Igreja vivificada pela força renovadora do Espírito. A Igreja está a caminho rumo ao Reino de Deus juntamente com todos os cristãos e com toda a humanidade. A recepção do Vaticano II supõe uma conversão pastoral: voltar ao Evangelho e abrir-se aos novos sinais dos tempos seguindo o Espírito que inspirou João XXIII. ABSTRACT: You cannot understand the Ecclesiology of Vatican II without knowing the life, the pastoral style and the charisma of John XXIII, who convened the Council and opened the way toward a new ecclesial setting that ended centuries of a church of Christendom. The Vatican II involves a transition from a clerical Church to a “People (baptized people of God” Church. The Vatican II implies the passage from a juridical and legalistic Church to a Church as the Mystery of the communion in Christ. The Vatican II implies the change from a triumphalistic Church and connected to worldly power to a Church vivified by the renewing force of the Spirit. The Church is on its way toward the Kingdom of God together with all Christians and all mankind. The reception of the Vatican II supposes a pastoral conversion: a return to the Gospel and openness to new signs of the times following the Spirit that inspired John XXIII.

  10. Galaxy S II

    CERN Document Server

    Gralla, Preston

    2011-01-01

    Unlock the potential of Samsung's outstanding smartphone with this jargon-free guide from technology guru Preston Gralla. You'll quickly learn how to shoot high-res photos and HD video, keep your schedule, stay in touch, and enjoy your favorite media. Every page is packed with illustrations and valuable advice to help you get the most from the smartest phone in town. The important stuff you need to know: Get dialed in. Learn your way around the Galaxy S II's calling and texting features.Go online. Browse the Web, manage email, and download apps with Galaxy S II's 3G/4G network (or create you

  11. Calculus II For Dummies

    CERN Document Server

    Zegarelli, Mark

    2012-01-01

    An easy-to-understand primer on advanced calculus topics Calculus II is a prerequisite for many popular college majors, including pre-med, engineering, and physics. Calculus II For Dummies offers expert instruction, advice, and tips to help second semester calculus students get a handle on the subject and ace their exams. It covers intermediate calculus topics in plain English, featuring in-depth coverage of integration, including substitution, integration techniques and when to use them, approximate integration, and improper integrals. This hands-on guide also covers sequences and series, wit

  12. Development of the status of W and T for the realization of a long-term safety demonstration for the final repository using the examples VSG and Konrad. Report on the Working package 2. Review and development of safety-related assessments of disposal facilities of wastes with negligible heat generation; development and provision of the necessary set of tools using the example of the final repository Konrad; Entwicklung des Standes von W and T bei der Fuehrung eines Langzeitsicherheitsnachweises fuer Endlager an den Beispielen VSG und Konrad. Bericht zum Arbeitspaket 2. Untersuchung und Entwicklung von sicherheitstechnischen Bewertungen fuer Endlager fuer Abfaelle mit vernachlaessigbarer Waermeentwicklung und Bereitstellung des notwendigen Instrumentariums am Beispiel des Endlagers Konrad

    Energy Technology Data Exchange (ETDEWEB)

    Larue, Juergen; Fischer-Appelt, Klaus; Hartwig-Thurat, Eva

    2015-09-15

    In the research project on the ''Review and development of safety-related assessments of disposal facilities with negligible heat generation; development and provision of the necessary set of tools, using the example of the Konrad disposal facility'' (3612R03410), the state of the art in science and technology of the safety-related assessments and sets of tools for building a safety case was examined. The reports pertaining to the two work packages described the further development of the methodology for accident analyses (WP 1) and of building a safety case (WP 2); also, comparisons were drawn on a national and international scale with the methods applied in the licensing procedure of the Konrad disposal facility. A safety case as well as its underlying analyses and methods always has to be brought up to date with the development of the state of the art in science and technology. In Germany, two safety cases regarding the long-term safety of disposal facilities have been prepared. These are the licensing documentation for the Konrad disposal facility in the year 1990 and the research project regarding the preliminary safety case for the Gorleben site (Vorlaeufige Sicherheitsanalyse Gorleben - VSG) in the year 2013, both reflecting the state of development of building a safety case at the respective time. Comparing the two above-mentioned examples of safety cases and taking recent international recommendations and national regulations into account, this report on Work Package 2 presents the development of the international state of the art in science and technology. This has been done by summarising the essential differences and similarities of each element of the safety case for the Konrad disposal facility on the one hand and the VSG and the international status on the other hand.

  13. Periodontics II: Course Proposal.

    Science.gov (United States)

    Dordick, Bruce

    A proposal is presented for Periodontics II, a course offered at the Community College of Philadelphia to give the dental hygiene/assisting student an understanding of the disease states of the periodontium and their treatment. A standardized course proposal cover form is given, followed by a statement of purpose for the course, a list of major…

  14. Workshop 96. Part II

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1996-12-31

    Part II of the seminar proceedings contains contributions in various areas of science and technology, among them materials science in mechanical engineering, materials science in electrical, chemical and civil engineering, and electronics, measuring and communication engineering. In those areas, 6 contributions have been selected for INIS. (P.A.).

  15. Experiment CATETO II

    International Nuclear Information System (INIS)

    Hendriks, J.A.; Freudenreich, W.E.

    1994-03-01

    In the irradiation experiment CATETO II different reduced activation (RA) steels will be irradiated up to 2.5 dpa at a temperature of 300 C. The results of the calculation of the nuclear constants, the reactivity effect, and the activity of the steel samples are presented. (orig.)

  16. Amorphous iron (II) carbonate

    DEFF Research Database (Denmark)

    Sel, Ozlem; Radha, A.V.; Dideriksen, Knud

    2012-01-01

    Abstract The synthesis, characterization and crystallization energetics of amorphous iron (II) carbonate (AFC) are reported. AFC may form as a precursor for siderite (FeCO3). The enthalpy of crystallization (DHcrys) of AFC is similar to that of amorphous magnesium carbonate (AMC) and more...

  17. Workshop 96. Part II

    International Nuclear Information System (INIS)

    1995-12-01

    Part II of the seminar proceedings contains contributions in various areas of science and technology, among them materials science in mechanical engineering, materials science in electrical, chemical and civil engineering, and electronics, measuring and communication engineering. In those areas, 6 contributions have been selected for INIS. (P.A.)

  18. UNISIST II: Special Report.

    Science.gov (United States)

    Hattery, Lowell H., Ed.

    1979-01-01

    The major part of this report of the Intergovernmental Conference on Scientific and Technical Information (UNISIST II), held in Paris May 28-June 1, 1979, focuses on three sets of recommendations which were unanimously approved after combining the recommendations proposed by various groups and blocs: (1) recommendations to the United Nations…

  19. Photosystem II and photoinhibition

    NARCIS (Netherlands)

    Feikema, Willem Onno

    2006-01-01

    Plants harvest light energy and convert it into chemical energy. Light absorption by photosystems I and II (PSI and PSII) results in charge separations in their reaction centers (RCs), initiating a chain of redox reactions with PSI generating the reducing power for CO2 assimilation into sugars, and

  20. European Telecommunications Satellite II (EUTELSAT II)

    Science.gov (United States)

    Laemmel, G.; Brittinger, P.

    1991-01-01

    EUTELSAT II is a regional public telecommunications system for Europe. The services which will be provided are telephone and television. The satellites will be placed at a geostationary orbit within the arcs of 6 degrees east to 19 degrees east or 26 degrees to 36 degrees east. The designed lifetime is 7 years. After separation of the satellites from the launch vehicles, telemetry, telecommand, and ranging will be performed within the S-band frequencies. After positioning of the satellite at its final geostationary orbit, the Ku-band telecommunication equipment will be activated. From this time on, all satellite control operations will be performed in Ku-band. The Deep Space Network (DSN) will support the transfer and drift orbit mission phases. The coverage will consist of the 26-m antennas at Goldstone and Canberra as prime support for the transfer and drift orbits. Maximum support will consist of a 7-day period, plus 14 days of contingency support. Information is given in tabular form for DSN support, frequency assignments, telemetry, command, and tracking support responsibility.

  1. Ni (II) and Cu(II) complexes of

    African Journals Online (AJOL)

    ADOWIE PERE

    ABSTRACT: The objective of this study is to investigate the antimicrobial activity of novel. Schiff base metal complexes. The resistance of micro-organisms to classical antimicrobial compounds poses a challenge to effective management and treatment of some diseases. In line with this, copper (II), nickel (II) and cobalt (II) ...

  2. X-radiographic study of rare-earth compounds with special regardment of modulated structures. The response of the crystal structure to stoichiometry deviations; Roentgengraphische Untersuchung von Seltenerdverbindungen mit besonderer Beruecksichtigung modulierter Strukturen. Die Antwort der Kristallstruktur auf Stoechiometrieabweichungen

    Energy Technology Data Exchange (ETDEWEB)

    Leisegang, Tilmann

    2010-04-09

    Even shortly after World War II, as large amounts of ultrapure rare earths (RE) became available for scientific research, a large reservoir of peculiar phenomena was uncovered. These had not been investigated before or were completely unknown. Examples of these phenomena are, magnetic ordering, the KONDO effect, quantum critical points, heavy fermion behaviour, as well as superconductivity. A strong influence of small variations of the chemical composition on the physical properties had been observed. The main focus of the present thesis is the detailed elucidation of the crystal structure of fundamental representatives of this class of substances, as well as the influence of dedicated variations of the chemical composition on their structure and properties. In particular, the characterisation of modulated crystals is an important facet. A large spectrum of physical methods, especially X-ray diffraction, is employed in the investigations. Results on oriented intergrowth in the Y-Ni-B-C system, incommensurately ordered vacancies in the Ce-Si system, incorporation of stacking faults as well as commensurately ordered transition metal atoms (TM) in the RE-TM-Si system and site specific occupancy in the Y-Mn-Fe-O system are presented. Their elucidation is reported for the first time. It is shown which consequences the structural peculiarities will have on the physical properties. An objective of this thesis is to give an overview of the possible ''answers'' that can be obtained with regard to the influence of the crystal structure of rare earth transition metal compounds on deviations of the chemical composition. (orig.)

  3. Transport phenomena II essentials

    CERN Document Server

    REA, The Editors of

    2012-01-01

    REA's Essentials provide quick and easy access to critical information in a variety of different fields, ranging from the most basic to the most advanced. As its name implies, these concise, comprehensive study guides summarize the essentials of the field covered. Essentials are helpful when preparing for exams, doing homework and will remain a lasting reference source for students, teachers, and professionals. Transport Phenomena II covers forced convention, temperature distribution, free convection, diffusitivity and the mechanism of mass transfer, convective mass transfer, concentration

  4. Information on Asse II

    International Nuclear Information System (INIS)

    2015-01-01

    The information brochure on Asse II describes the situation in the repository for radioactive wastes that was closed by law due to the violations of safety standards. The discussed topics include the necessity of waste retrieval, the problems with public anxiety and public information, the hazard of an uncontrolled water ingress (worst case scenario), the work sites in the cavern, man-machine interactions and the cost of the project.

  5. Information on Asse II

    International Nuclear Information System (INIS)

    2014-01-01

    The information on Asse II include the following topics: The image and what is behind - the barrier building Dammjoch built 1914; Fact finding - underground explorations; concept for a site comparison; Learning from experiences - the final repository projects Asse, Gorleben and Morsleben show what should not be done; At first drilling - thereafter building - progress of the recovery duct; The retrieval can only go on in dialogue with the public.

  6. Heat transfer II essentials

    CERN Document Server

    REA, The Editors of

    1988-01-01

    REA's Essentials provide quick and easy access to critical information in a variety of different fields, ranging from the most basic to the most advanced. As its name implies, these concise, comprehensive study guides summarize the essentials of the field covered. Essentials are helpful when preparing for exams, doing homework and will remain a lasting reference source for students, teachers, and professionals. Heat Transfer II reviews correlations for forced convection, free convection, heat exchangers, radiation heat transfer, and boiling and condensation.

  7. Numerical analysis II essentials

    CERN Document Server

    REA, The Editors of; Staff of Research Education Association

    1989-01-01

    REA's Essentials provide quick and easy access to critical information in a variety of different fields, ranging from the most basic to the most advanced. As its name implies, these concise, comprehensive study guides summarize the essentials of the field covered. Essentials are helpful when preparing for exams, doing homework and will remain a lasting reference source for students, teachers, and professionals. Numerical Analysis II covers simultaneous linear systems and matrix methods, differential equations, Fourier transformations, partial differential equations, and Monte Carlo methods.

  8. Review on technology II

    International Nuclear Information System (INIS)

    Mroziewicz, B.

    1986-01-01

    The most important requirements for the spectral properties of photodetectors are reviewed with particular attention to the fiber optics applications. Data on a number of materials are collected and presented. Pros and cons are pointed out for each type of photodetector-photoconductor, p-i-n photodiode and APD. A review is given of the relevant papers presented in the poster session 'Technology II' of the Symposium

  9. Algebra & trigonometry II essentials

    CERN Document Server

    REA, Editors of

    2012-01-01

    REA's Essentials provide quick and easy access to critical information in a variety of different fields, ranging from the most basic to the most advanced. As its name implies, these concise, comprehensive study guides summarize the essentials of the field covered. Essentials are helpful when preparing for exams, doing homework and will remain a lasting reference source for students, teachers, and professionals. Algebra & Trigonometry II includes logarithms, sequences and series, permutations, combinations and probability, vectors, matrices, determinants and systems of equations, mathematica

  10. EASI graphics - Version II

    International Nuclear Information System (INIS)

    Allensworth, J.A.

    1984-04-01

    EASI (Estimate of Adversary Sequence Interruption) is an analytical technique for measuring the effectiveness of physical protection systems. EASI Graphics is a computer graphics extension of EASI which provides a capability for performing sensitivity and trade-off analyses of the parameters of a physical protection system. This document reports on the implementation of the Version II of EASI Graphics and illustrates its application with some examples. 5 references, 15 figures, 6 tables

  11. BeII** revisited

    International Nuclear Information System (INIS)

    Fischer, C.F.

    1982-01-01

    Doubly excited 1s2snl and 1s2pnl quartet states of BeII** are readily populated in beam-foil experiments and line-rich spectra have been obtained covering 600 to 5500 A wavelength range. In spite of several theoretical calculations a substantial number of observed lines have not been identified. The quartet system in BeII is an intersting one from a theoretical point of view. Three electron systems are simple enough that a fairly high level of accuracy is attainable without the calculations becoming horrendous. The important correlation effects are between the outer two electrons and, to a good approximation, the three-electrons system may be treated as a two-electron system outside a 1s-core. The multi-configuration Hartree-Fock (MCHF) method has been used successfully in a number of studies. Programs are under development that take into account the non-orthogonality of orbitals in the initial and final state, and allow for some non-orthogonal orbitals in a wavefunction expansion. LS dependent relativistic effects are also included. A study of BeII** was undertaken to evaluate the MCHF techniques being developed and to assit in the identification of observed lines. Most of the earlier calculations concentrated on the lower-lying levels. In this work particular attention was given to the more highly-excited states, though calculations for lower-lying states had to be repeated in order to predict life-times

  12. What is LAMPF II

    International Nuclear Information System (INIS)

    Thiessen, H.A.

    1982-08-01

    The present conception of LAMPF II is a high-intensity 16-GeV synchrotron injected by the LAMPF 800-MeV H - beam. The proton beam will be used to make secondary beams of neutrinos, muons, pions, kaons, antiprotons, and hyperons more intense than those of any existing or proposed accelerator. For example, by taking maximum advantage of a thick target, modern beam optics, and the LAMPF II proton beam, it will be possible to make a negative muon beam with nearly 100% duty factor and nearly 100 times the flux of the existing Stopped Muon Channel (SMC). Because the unique features of the proposed machine are most applicable to beams of the same momentum as LAMPF (that is, < 2 GeV/c), it may be possible to use most of the experimental areas and some of the auxiliary equipment, including spectrometers, with the new accelerator. The complete facility will provide improved technology for many areas of physics already available at LAMPF and will allow expansion of medium-energy physics to include kaons, antiprotons, and hyperons. When LAMPF II comes on line in 1990 LAMPF will have been operational for 18 years and a major upgrade such as this proposal will be reasonable and prudent

  13. What is LAMPF II

    Energy Technology Data Exchange (ETDEWEB)

    Thiessen, H.A.

    1982-08-01

    The present conception of LAMPF II is a high-intensity 16-GeV synchrotron injected by the LAMPF 800-MeV H/sup -/ beam. The proton beam will be used to make secondary beams of neutrinos, muons, pions, kaons, antiprotons, and hyperons more intense than those of any existing or proposed accelerator. For example, by taking maximum advantage of a thick target, modern beam optics, and the LAMPF II proton beam, it will be possible to make a negative muon beam with nearly 100% duty factor and nearly 100 times the flux of the existing Stopped Muon Channel (SMC). Because the unique features of the proposed machine are most applicable to beams of the same momentum as LAMPF (that is, < 2 GeV/c), it may be possible to use most of the experimental areas and some of the auxiliary equipment, including spectrometers, with the new accelerator. The complete facility will provide improved technology for many areas of physics already available at LAMPF and will allow expansion of medium-energy physics to include kaons, antiprotons, and hyperons. When LAMPF II comes on line in 1990 LAMPF will have been operational for 18 years and a major upgrade such as this proposal will be reasonable and prudent.

  14. Average [O II] nebular emission associated with Mg II absorbers: dependence on Fe II absorption

    Science.gov (United States)

    Joshi, Ravi; Srianand, Raghunathan; Petitjean, Patrick; Noterdaeme, Pasquier

    2018-05-01

    We investigate the effect of Fe II equivalent width (W2600) and fibre size on the average luminosity of [O II] λλ3727, 3729 nebular emission associated with Mg II absorbers (at 0.55 ≤ z ≤ 1.3) in the composite spectra of quasars obtained with 3 and 2 arcsec fibres in the Sloan Digital Sky Survey. We confirm the presence of strong correlations between [O II] luminosity (L_{[O II]}) and equivalent width (W2796) and redshift of Mg II absorbers. However, we show L_{[O II]} and average luminosity surface density suffer from fibre size effects. More importantly, for a given fibre size, the average L_{[O II]} strongly depends on the equivalent width of Fe II absorption lines and found to be higher for Mg II absorbers with R ≡W2600/W2796 ≥ 0.5. In fact, we show the observed strong correlations of L_{[O II]} with W2796 and z of Mg II absorbers are mainly driven by such systems. Direct [O II] detections also confirm the link between L_{[O II]} and R. Therefore, one has to pay attention to the fibre losses and dependence of redshift evolution of Mg II absorbers on W2600 before using them as a luminosity unbiased probe of global star formation rate density. We show that the [O II] nebular emission detected in the stacked spectrum is not dominated by few direct detections (i.e. detections ≥3σ significant level). On an average, the systems with R ≥ 0.5 and W2796 ≥ 2 Å are more reddened, showing colour excess E(B - V) ˜ 0.02, with respect to the systems with R < 0.5 and most likely trace the high H I column density systems.

  15. Algebra II workbook for dummies

    CERN Document Server

    Sterling, Mary Jane

    2014-01-01

    To succeed in Algebra II, start practicing now Algebra II builds on your Algebra I skills to prepare you for trigonometry, calculus, and a of myriad STEM topics. Working through practice problems helps students better ingest and retain lesson content, creating a solid foundation to build on for future success. Algebra II Workbook For Dummies, 2nd Edition helps you learn Algebra II by doing Algebra II. Author and math professor Mary Jane Sterling walks you through the entire course, showing you how to approach and solve the problems you encounter in class. You'll begin by refreshing your Algebr

  16. Synthesis and spectroscopic studies of biologically active tetraazamacrocyclic complexes of Mn(II, Co(II, Ni(II, Pd(II and Pt(II

    Directory of Open Access Journals (Sweden)

    Monika Tyagi

    2014-01-01

    Full Text Available Complexes of Mn(II, Co(II, Ni(II, Pd(II and Pt(II were synthesized with the macrocyclic ligand, i.e., 2,3,9,10-tetraketo-1,4,8,11-tetraazacycoletradecane. The ligand was prepared by the [2 + 2] condensation of diethyloxalate and 1,3-diamino propane and characterized by elemental analysis, mass, IR and 1H NMR spectral studies. All the complexes were characterized by elemental analysis, molar conductance, magnetic susceptibility measurements, IR, electronic and electron paramagnetic resonance spectral studies. The molar conductance measurements of Mn(II, Co(II and Ni(II complexes in DMF correspond to non electrolyte nature, whereas Pd(II and Pt(II complexes are 1:2 electrolyte. On the basis of spectral studies an octahedral geometry has been assigned for Mn(II, Co(II and Ni(II complexes, whereas square planar geometry assigned for Pd(II and Pt(II. In vitro the ligand and its metal complexes were evaluated against plant pathogenic fungi (Fusarium odum, Aspergillus niger and Rhizoctonia bataticola and some compounds found to be more active as commercially available fungicide like Chlorothalonil.

  17. Removal of Ni (II), Co (II) and Pb (II) ions from aqueous media using ...

    African Journals Online (AJOL)

    Removal of Ni (II), Co (II) and Pb (II) ions from aqueous media using Starch ... The results showed that 0.025 % loaded SSMNPs gave the optimal sorption ... constants (Lagergren and Pseudo-2nd-order) for Ni2+ and Co2+ adsorption were ... Langmuir correlation coefficients showed a better fit for the adsorption isotherms.

  18. Electronics II essentials

    CERN Document Server

    REA, The Editors of

    2012-01-01

    REA's Essentials provide quick and easy access to critical information in a variety of different fields, ranging from the most basic to the most advanced. As its name implies, these concise, comprehensive study guides summarize the essentials of the field covered. Essentials are helpful when preparing for exams, doing homework and will remain a lasting reference source for students, teachers, and professionals. Electronics II covers operational amplifiers, feedback and frequency compensation of OP amps, multivibrators, logic gates and families, Boolean algebra, registers, counters, arithmet

  19. Engineering mathematics-II

    CERN Document Server

    Ganesh, A

    2009-01-01

    About the Book: This book Engineering Mathematics-II is designed as a self-contained, comprehensive classroom text for the second semester B.E. Classes of Visveswaraiah Technological University as per the Revised new Syllabus. The topics included are Differential Calculus, Integral Calculus and Vector Integration, Differential Equations and Laplace Transforms. The book is written in a simple way and is accompanied with explanatory figures. All this make the students enjoy the subject while they learn. Inclusion of selected exercises and problems make the book educational in nature. It shou

  20. Thermodynamics II essentials

    CERN Document Server

    REA, The Editors of

    2013-01-01

    REA's Essentials provide quick and easy access to critical information in a variety of different fields, ranging from the most basic to the most advanced. As its name implies, these concise, comprehensive study guides summarize the essentials of the field covered. Essentials are helpful when preparing for exams, doing homework and will remain a lasting reference source for students, teachers, and professionals. Thermodynamics II includes review of thermodynamic relations, power and refrigeration cycles, mixtures and solutions, chemical reactions, chemical equilibrium, and flow through nozzl

  1. Physics II for dummies

    CERN Document Server

    Holzner, Steven

    2010-01-01

    A plain-English guide to advanced physics. Does just thinking about the laws of motion make your head spin? Does studying electricity short your circuits? Physics II For Dummies walks you through the essentials and gives you easy-to-understand and digestible guidance on this often intimidating course. Thanks to this book, you don?t have to be Einstein to understand physics. As you learn about mechanical waves and sound, forces and fields, electric potential and electric energy, and much more, you?ll appreciate the For Dummies law: The easier we make it, the faster you'll understand it!

  2. Physical chemistry II essentials

    CERN Document Server

    REA, The Editors of

    1992-01-01

    REA's Essentials provide quick and easy access to critical information in a variety of different fields, ranging from the most basic to the most advanced. As its name implies, these concise, comprehensive study guides summarize the essentials of the field covered. Essentials are helpful when preparing for exams, doing homework and will remain a lasting reference source for students, teachers, and professionals. Physical Chemistry II includes reaction mechanisms, theoretical approaches to chemical kinetics, gravitational work, electrical and magnetic work, surface work, kinetic theory, collisional and transport properties of gases, statistical mechanics, matter and waves, quantum mechanics, and rotations and vibrations of atoms and molecules.

  3. Graphics gems II

    CERN Document Server

    Arvo, James

    1991-01-01

    Graphics Gems II is a collection of articles shared by a diverse group of people that reflect ideas and approaches in graphics programming which can benefit other computer graphics programmers.This volume presents techniques for doing well-known graphics operations faster or easier. The book contains chapters devoted to topics on two-dimensional and three-dimensional geometry and algorithms, image processing, frame buffer techniques, and ray tracing techniques. The radiosity approach, matrix techniques, and numerical and programming techniques are likewise discussed.Graphics artists and comput

  4. Thin film processes II

    CERN Document Server

    Kern, Werner

    1991-01-01

    This sequel to the 1978 classic, Thin Film Processes, gives a clear, practical exposition of important thin film deposition and etching processes that have not yet been adequately reviewed. It discusses selected processes in tutorial overviews with implementation guide lines and an introduction to the literature. Though edited to stand alone, when taken together, Thin Film Processes II and its predecessor present a thorough grounding in modern thin film techniques.Key Features* Provides an all-new sequel to the 1978 classic, Thin Film Processes* Introduces new topics, and sever

  5. Statistics II essentials

    CERN Document Server

    Milewski, Emil G

    2012-01-01

    REA's Essentials provide quick and easy access to critical information in a variety of different fields, ranging from the most basic to the most advanced. As its name implies, these concise, comprehensive study guides summarize the essentials of the field covered. Essentials are helpful when preparing for exams, doing homework and will remain a lasting reference source for students, teachers, and professionals. Statistics II discusses sampling theory, statistical inference, independent and dependent variables, correlation theory, experimental design, count data, chi-square test, and time se

  6. Data structures II essentials

    CERN Document Server

    Smolarski, Dennis C

    2012-01-01

    REA's Essentials provide quick and easy access to critical information in a variety of different fields, ranging from the most basic to the most advanced. As its name implies, these concise, comprehensive study guides summarize the essentials of the field covered. Essentials are helpful when preparing for exams, doing homework and will remain a lasting reference source for students, teachers, and professionals. Data Structures II includes sets, trees, advanced sorting, elementary graph theory, hashing, memory management and garbage collection, and appendices on recursion vs. iteration, alge

  7. Computer science II essentials

    CERN Document Server

    Raus, Randall

    2012-01-01

    REA's Essentials provide quick and easy access to critical information in a variety of different fields, ranging from the most basic to the most advanced. As its name implies, these concise, comprehensive study guides summarize the essentials of the field covered. Essentials are helpful when preparing for exams, doing homework and will remain a lasting reference source for students, teachers, and professionals. Computer Science II includes organization of a computer, memory and input/output, coding, data structures, and program development. Also included is an overview of the most commonly

  8. Synthesis and spectral studies of manganese(II), cobalt(II), nickel(II), copper(II), zinc(II), cadmium(II) and mercury(II) complexes of 4-oxo-4H-1-benzopyran-3-carboxaldehyde hydrazone derivatives

    International Nuclear Information System (INIS)

    Nawar, N.; Khattab, M.A.; Bekheit, M.M.; El-Kaddah, A.H.

    1996-01-01

    A few complexes of Mn(II), Co(II), Ni(II), Cu(II), Zn(II), Cd(II) and Hg(II) with 4-oxo-4H-1-benzopyran-3-(carboxaldehyde-4-chlorobenzylhydrazone) (BCBH) and 4-oxo-4H-1-benzopyran-3-(carboxaldehyde-4-methylbenzylhydrazone) (BMBH) have been synthesised and characterized by elemental analysis, molar conductivities, magnetic measurements and infrared (IR) and visible spectral studies. The IR spectra show that BCBH and BMBH behave as bidentate ligands either in the keto or enol form. (author). 24 refs., 2 tabs

  9. Evaluation of the computerized procedures Manual II (COPMA II)

    International Nuclear Information System (INIS)

    Converse, S.A.

    1995-11-01

    The purpose of this study was to evaluate the effects of a computerized procedure system, the Computerized Procedure Manual II (COPMA-II), on the performance and mental workload of licensed reactor operators. To evaluate COPMA-II, eight teams of two operators were trained to operate a scaled pressurized water reactor facility (SPWRF) with traditional paper procedures and with COPMA-II. Following training, each team operated the SPWRF under normal operating conditions with both paper procedures and COPMA-II. The teams then performed one of two accident scenarios with paper procedures, but performed the remaining accident scenario with COPMA-II. Performance measures and subjective estimates of mental workload were recorded for each performance trial. The most important finding of the study was that the operators committed only half as many errors during the accident scenarios with COPMA-II as they committed with paper procedures. However, time to initiate a procedure was fastest for paper procedures for accident scenario trials. For performance under normal operating conditions, there was no difference in time to initiate or to complete a procedure, or in the number of errors committed with paper procedures and with COPMA-II. There were no consistent differences in the mental workload ratings operators recorded for trials with paper procedures and COPMA-II

  10. RTNS-II utilization

    International Nuclear Information System (INIS)

    Doran, D.G.; Panayotou, N.F.; Powell, R.W.

    1979-12-01

    The objective of the several RTNS-II irradation programs is to maximize information gained from the small test volume available in this unique irradiation facility for application in the fusion materials program. While this facility provides the highest 14 MeV neutron flux available, the flux is generally too low and the irradiation volume too small for testing of engineering materials. Emphasis, therefore, is on identifying damage mechanisms of high energy neutrons and correlating them quantitatively with effects produced by fission neutrons. The information gained will be used to evaluate and calibrate damage and correlation models under development. The scope of the program includes in-situ experiments, postirradiation experiments, irradiation temperatures ranging from 4 0 K to 1,000 0 K, and fluences ranging from 3 x 10 16 to about 3 x 10 19 n/cm 2

  11. Belle II Software

    International Nuclear Information System (INIS)

    Kuhr, T; Ritter, M

    2016-01-01

    Belle II is a next generation B factory experiment that will collect 50 times more data than its predecessor, Belle. The higher luminosity at the SuperKEKB accelerator leads to higher background levels and requires a major upgrade of the detector. As a consequence, the simulation, reconstruction, and analysis software must also be upgraded substantially. Most of the software has been redesigned from scratch, taking into account the experience from Belle and other experiments and utilizing new technologies. The large amount of experimental and simulated data requires a high level of reliability and reproducibility, even in parallel environments. Several technologies, tools, and organizational measures are employed to evaluate and monitor the performance of the software during development. (paper)

  12. Inside ISIS II

    CERN Multimedia

    1981-01-01

    ISIS stands for Identification of Secondaries by Ionization Sampling. It was a drift chamber with an active volume of about 40 m3 built by Oxford University as a particle identifier for the European Hybrid Spectrometer (EHS). The photo shows the electrostatic grading structure and the central anode-wire plane, with Roger Giles standing just under it (Annual Report 1981 p. 57, Fig. 4). ISIS-II differed from the prototype ISIS-I only in the depth of the track (4 m instead of 1 m) thus extending the momentum range for particle identification to 50 GeV/c. See Nucl. Instr. and Meth. 224 (1984) 396, and Nucl. Instr. and Meth. 258 (1987) 26.

  13. Water radiological surveillance (II)

    International Nuclear Information System (INIS)

    Pablo San Martin de, M.

    2008-01-01

    This paper summarizes the characteristics of the Environmental Surveillance Radiological Networks (ESRN) currently operating in CEDEX. In the first part, the Spanish Continental Waters ESRN has been presented. This second one describes Spanish Costal Waters ESRN and the High Sensitivity Networks in Continental and Marine Waters. It also presents the Radiological Surveillance of Drinking Waters that CEDEX carries out in waters of public consumption management by the Canal de Isabel II (CYII) and by the Mancomunity of Canals Taibilla (M.C.T.). The legislation applicable in each case is reviewed as well. Due to its extension the article has been divided into two parts. As Spanish Continental Waters ESRN has been reviewed in the first part, the others ESRN are discussed in this second one. (Author) 10 refs

  14. PEP-II Alignment

    CERN Document Server

    Gaydosh, M

    2003-01-01

    The PEP-II Asymmetric B-factory consists of two independent storage rings, one located atop the other in the 2200m-circumference PEP tunnel. The high-energy ring, which stores a 9-GeV electron beam, is an upgrade of the existing PEP collider. It re-utilizes all of the PEP magnets and incorporates a state-of-the-art copper vacuum chamber and a new RF system capable of supporting a one-amp stored beam. The low-energy ring, which stores 3.1-GeV positrons, is new construction. Injection is achieved by extracting electrons and positrons at collision energies from the SLC and transporting them each in a dedicated bypass line. The low-emittance SLC beams will be used for the injection process.

  15. Stage II Seminoma

    International Nuclear Information System (INIS)

    Sagerman, R.H.; Kotlove, D.J.; Regine, W.; Chung, C.T.; King, G.A.; Dalai, P.S.

    1988-01-01

    Between 1966 and 1985, 32 patients with stage II (21 A,11 B) testicular seminoma were treated with postorchiectomy irradiation to the retroperitoneal and ipsilateral iliac nodes; 28 received elective mediastinal-supraclavicular irradiation. The median follow-up was 8 1/2 years; 29 patients were followed up for over 3 years and 24 for over 5 years. Twenty-eight patients remain alive and well and four have die, two of a second primary cancer. Two patients developed recurrent seminoma in the mediastinum; these patients showed a variant lymphangiographic pattern. Both remain well after further irradiation or irradiation plus chemotherapy. A third patient developed nonseminomatous ''recurrence'' in the radiation field and is well after chemotherapy

  16. Phase II Final Report

    Energy Technology Data Exchange (ETDEWEB)

    Schuknecht, Nate [Project Manager; White, David [Principle Investigator; Hoste, Graeme [Research Engineer

    2014-09-11

    The SkyTrough DSP will advance the state-of-the-art in parabolic troughs for utility applications, with a larger aperture, higher operating temperature, and lower cost. The goal of this project was to develop a parabolic trough collector that enables solar electricity generation in the 2020 marketplace for a 216MWe nameplate baseload power plant. This plant requires an LCOE of 9¢/kWhe, given a capacity factor of 75%, a fossil fuel limit of 15%, a fossil fuel cost of $6.75/MMBtu, $25.00/kWht thermal storage cost, and a domestic installation corresponding to Daggett, CA. The result of our optimization was a trough design of larger aperture and operating temperature than has been fielded in large, utility scale parabolic trough applications: 7.6m width x 150m SCA length (1,118m2 aperture), with four 90mm diameter × 4.7m receivers per mirror module and an operating temperature of 500°C. The results from physical modeling in the System Advisory Model indicate that, for a capacity factor of 75%: The LCOE will be 8.87¢/kWhe. SkyFuel examined the design of almost every parabolic trough component from a perspective of load and performance at aperture areas from 500 to 2,900m2. Aperture-dependent design was combined with fixed quotations for similar parts from the commercialized SkyTrough product, and established an installed cost of $130/m2 in 2020. This project was conducted in two phases. Phase I was a preliminary design, culminating in an optimum trough size and further improvement of an advanced polymeric reflective material. This phase was completed in October of 2011. Phase II has been the detailed engineering design and component testing, which culminated in the fabrication and testing of a single mirror module. Phase II is complete, and this document presents a summary of the comprehensive work.

  17. Effect of Cu(II), Cd(II) and Zn(II) on Pb(II) biosorption by algae Gelidium-derived materials.

    Science.gov (United States)

    Vilar, Vítor J P; Botelho, Cidália M S; Boaventura, Rui A R

    2008-06-15

    Biosorption of Pb(II), Cu(II), Cd(II) and Zn(II) from binary metal solutions onto the algae Gelidium sesquipedale, an algal industrial waste and a waste-based composite material was investigated at pH 5.3, in a batch system. Binary Pb(II)/Cu(II), Pb(II)/Cd(II) and Pb(II)/Zn(II) solutions have been tested. For the same equilibrium concentrations of both metal ions (1 mmol l(-1)), approximately 66, 85 and 86% of the total uptake capacity of the biosorbents is taken by lead ions in the systems Pb(II)/Cu(II), Pb(II)/Cd(II) and Pb(II)/Zn(II), respectively. Two-metal results were fitted to a discrete and a continuous model, showing the inhibition of the primary metal biosorption by the co-cation. The model parameters suggest that Cd(II) and Zn(II) have the same decreasing effect on the Pb(II) uptake capacity. The uptake of Pb(II) was highly sensitive to the presence of Cu(II). From the discrete model it was possible to obtain the Langmuir affinity constant for Pb(II) biosorption. The presence of the co-cations decreases the apparent affinity of Pb(II). The experimental results were successfully fitted by the continuous model, at different pH values, for each biosorbent. The following sequence for the equilibrium affinity constants was found: Pb>Cu>Cd approximately Zn.

  18. Aerospace Systems Monitor, Phase II

    Data.gov (United States)

    National Aeronautics and Space Administration — Proposal Title: Aerospace Systems Monitor PHASE 1 Technical Abstract: This Phase II STTR project will continue development and commercialization of the Aerospace...

  19. Acute toxicity of postoperative radiochemotherapy with amifostine vs radiochemotherapy alone in head and neck cancer patients. Preliminary results of a randomized trial; Nebenwirkungen einer postoperativen Radiochemotherapie mit Amifostin versus alleiniger Radiochemotherapie bei Kopf-Hals-Tumoren. Vorlaeufige Ergebnisse einer prospektiv randomisierten Untersuchung

    Energy Technology Data Exchange (ETDEWEB)

    Vacha, P; Marx, M; Engel, A; Richter, E; Feyerabend, T [Medizinische Univ. Luebeck (Germany). Klinik fuer Strahlentherapie und Nuklearmedizin

    1999-11-01

    Purpose: Experimental and clinical data suggest a reduction of radiation-induced acute toxicity by amifostine. We investigated this issue in a randomized trial comparing radiochemotherapy (RCT) versus radiochemotherapy and amifostine (RCT+A) in patients with head and neck cancer. Patients and methods: Forty-seven patients with pharyngeal or laryngeal cancer (T{sub 1-2}N{sub 1-2}G{sub 3},T{sub 3-4}N{sub 0-2}G{sub 1-3}) were randomized to receive RCT alone (21 patients) or RCT+A (21 patients). Patients were irradiated up to 60 Gy (R{sub 0}) or 70 Gy (R{sub 1/2}). Chemotherapy consisted of 70 mg/m{sup 2} carboplatin and was administered over 5 days in the 1st and 5th week of the radiotherapy course. 250 mg amifostine were applied daily just before each radiotherapy session. Acute toxicity was evaluated according to the Common Toxicity Criteria (CTC). As for xerostomia no patients with laryngeal cancer were assessed because in these cases only small volumes of the salivary glands were within the treatment volume. To evaluate the overall toxicity a summarized CTC score of all observed side effects was calculated. Results: Forty-two patients were evaluable. Clinical characteristics (age, sex, Karnofsky index, tumor-staging) were well balanced in both treatment groups. Amifostine provided reduction in xerostomia and mucositis. Conclusions: According to our preliminary results amifostine has a radioprotective effect on salivary glands. Mucositis can be reduced during radiochemotherapy. At this point of patient accrual the difference between both groups are statistically not significant. To improve the radioprotective effects of amifostine in clinical practice the application of a higher dose (>250 mg) seems to be necessary. (orig.) [German] Ziel: Diese Untersuchung soll die Frage beantworten, ob bei der postoperativen Radiochemotherapie von Patienten mit HNO-Tumoren eine zusaetzliche Amifostin-Medikation Ausmass und Haeufigkeit akuter Strahlenreaktionen vermindert

  20. Lead (II) and nickel (II) adsorption kinetics from aqueous metal ...

    African Journals Online (AJOL)

    This paper discusses the kinetics of lead (II) and Nickel (II) ions adsorption from aqueous solutions using chemically modified and unmodified agricultural adsorbents at 28°C, pH 6.2 and 0.01M NaCl ionic strength. The removal of the two metals were found to increase with increase in chemical modification, the sequence ...

  1. Solar Type II Radio Bursts and IP Type II Events

    Science.gov (United States)

    Cane, H. V.; Erickson, W. C.

    2005-01-01

    We have examined radio data from the WAVES experiment on the Wind spacecraft in conjunction with ground-based data in order to investigate the relationship between the shocks responsible for metric type II radio bursts and the shocks in front of coronal mass ejections (CMEs). The bow shocks of fast, large CMEs are strong interplanetary (IP) shocks, and the associated radio emissions often consist of single broad bands starting below approx. 4 MHz; such emissions were previously called IP type II events. In contrast, metric type II bursts are usually narrowbanded and display two harmonically related bands. In addition to displaying complete dynamic spectra for a number of events, we also analyze the 135 WAVES 1 - 14 MHz slow-drift time periods in 2001-2003. We find that most of the periods contain multiple phenomena, which we divide into three groups: metric type II extensions, IP type II events, and blobs and bands. About half of the WAVES listings include probable extensions of metric type II radio bursts, but in more than half of these events, there were also other slow-drift features. In the 3 yr study period, there were 31 IP type II events; these were associated with the very fastest CMEs. The most common form of activity in the WAVES events, blobs and bands in the frequency range between 1 and 8 MHz, fall below an envelope consistent with the early signatures of an IP type II event. However, most of this activity lasts only a few tens of minutes, whereas IP type II events last for many hours. In this study we find many examples in the radio data of two shock-like phenomena with different characteristics that occur simultaneously in the metric and decametric/hectometric bands, and no clear example of a metric type II burst that extends continuously down in frequency to become an IP type II event. The simplest interpretation is that metric type II bursts, unlike IP type II events, are not caused by shocks driven in front of CMEs.

  2. Recent results from AMANDA II

    International Nuclear Information System (INIS)

    Hanson, K.; Ahrens, J.; Bai, X.; Barwick, S.W.; Becka, T.; Becker, K.-H.; Bernardini, E.; Bertrand, D.; Binon, F.; Biron, A.; Boeser, S.; Botner, O.; Bouhali, O.; Burgess, T.; Carius, S.; Castermans, T.; Chen, A.; Chirkin, D.; Conrad, J.; Cooley, J.; Cowen, D.F.; Davour, A.; De Clercq, C.; De Young, T.; Desiati, P.; Dewulf, J.-P.; Doksus, P.; Ekstroem, P.; Feser, T.; Gaisser, T.K.; Gaug, M.; Gerhardt, L.; Goldschmidt, A.; Hallgren, A.; Halzen, F.; Hanson, K.; Hardtke, R.; Hauschildt, T.; Hellwig, M.; Herque, P.; Hill, G.C.; Hulth, P.O.; Hundertmark, S.; Jacobsen, J.; Karle, A.; Koci, B.; Koepke, L.; Kuehn, K.; Kowalski, M.; Lamoureux, J.I.; Leich, H.; Leuthold, M.; Lindahl, P.; Liubarsky, I.; Madsen, J.; Marciniewski, P.; Matis, H.S.; McParland, C.P.; Minaeva, Y.; Miocinovic, P.; Morse, R.; Nahnhauer, R.; Neunhoeffer, T.; Niessen, P.; Nygren, D.R.; Ogelman, H.; Olbrechts, Ph.; Perez de los Heros, C.; Pohl, A.C.; Price, P.B.; Przybylski, G.T.; Rawlins, K.; Resconi, E.; Rhode, W.; Ribordy, M.; Richter, S.; Rodriguez Martino, J.; Ross, D.; Sander, H.-G.; Schmidt, T.; Schneider, D.; Schwarz, R.; Silvestri, A.; Solarz, M.; Spiczak, G.M.; Spiering, C.; Steele, D.; Steffen, P.; Stokstad, R.G.; Sudhoff, P.; Sulanke, K.-H.; Taboada, I.; Thollander, L.; Tilav, S.; Walck, C.; Weinheimer, C.; Wiebusch, C.H.; Wiedemann, C.; Wischnewski, R.; Wissing, H.; Woschnagg, K.; Yodh, G.; Young, S.

    2003-01-01

    We present new data taken with the AMANDA-II neutrino telescope array. The AMANDA-II upgrade was completed at the beginning of 2000. It significantly extends the sensitivity of the 10-string AMANDA-B10 detector to high- and ultrahigh-energy neutrino fluxes into regions of interest for probing current astrophysical models which remain unexplored by other experiments

  3. Synthesis, characterization and thermal studies of nickel (II), copper (II), zinc (II) and cadmium (II) complexes with some mixed ligands

    International Nuclear Information System (INIS)

    Mitra, Samiran; Kundu, Parimal; Singh, Rajkumar Bhubon

    1998-01-01

    Dichloro-(DCA) and trichloroacetate(TCA) -cyclic ligand morpholine (Morph)/thiomorpholine (Tmorph)/methylmorpholine (Mmorph)/dimethyl-piperazine (DMP) complexes of nickel (II), copper (II), zinc (II) and cadmium (II) with the compositions [Ni(tmorph) 2 (DCA) 2 ], [Ni(tmorph) 2 (TCA) 2 ].2H 2 O, [Cu(DMP) 2 (TCA) 2 ],[ML 2 X 2 ].nH 2 O where M=Zn II or Cd II , L=Morph, DMP or tmorph and X=DCA or TCA and n=O except in case of [Cd (Morph) 2 (TCA) 2 ] where n=1 have been synthesised. Some intermediate complexes have been isolated by temperature arrest technique (pyrolysis) and characterised. Configurational and conformational changes have been studied by elemental analyses, IR and electronic spectra, magnetic moment data (in the case of Ni(II) and Cu(II) complexes) and thermal analysis. E a * , ΔH, and ΔS for the decomposition reaction of these complexes are evaluated and the stability of the complexes with respect to activation energy has also been compared. The linear correlation has been found between E a * and ΔS for the decomposition of the complexes. (author)

  4. Dust in H II regions

    International Nuclear Information System (INIS)

    Isobe, S.

    1977-01-01

    Several pieces of evidence indicate that H II regions may contain dust: 1) the continuum light scattered by dust grains (O'Dell and Hubbard, 1965), 2) thermal radiation from dust grains at infrared wavelengths (Ney and Allen, 1969), 3) the abnormal helium abundance in some H II regions (Peimbert and Costero, 1969), etc. Although observations of the scattered continuum suggest that the H II region cores may be dust-free, dust grains and gas must be well mixed in view of the infrared observations. This difficulty may be solved by introducing globules with sizes approximately 0.001 pc. These globules and the molecular clouds adjacent to H II regions are the main sources supplying dust to H II regions. (Auth.)

  5. RTNS-II operations guidebook

    International Nuclear Information System (INIS)

    Heikkinen, D.W.

    1985-01-01

    This guidebook is intended to provide training criteria, procedures and guidelines for operation of the RTNS-II neutron sources and ancilliary equipment. Use of this document requires full knowledge of the RTNS-II Facility Safety Procedure (FSP) and any Operational Safety Procedures (OSP) in effect. The RTNS-II FSP defines the hazards which may be encountered at RTNS-II and defines the procedures which must be followed in performing any task including operations. The purpose of this document is to provide a central source of detailed information concerning systems and equipment used in operating the RTNS-II neutron sources on a day-to-day basis. All members of the Operations Group are expected to be familiar with its contents. It is also intended to be used in training new members of the Operations Group

  6. BEPC II positron source

    International Nuclear Information System (INIS)

    Pei Guoxi; Sun Yaolin; Liu Jintong; Chi Yunlong; Liu Yucheng; Liu Nianzong

    2006-01-01

    BEPC II-an upgrade project of the Beijing Electron Positron Collider (BEPC) is a factory type of e + e - collider. The fundamental requirements for its injector linac are the beam energy of 1.89 GeV for on-energy injection and a 40 mA positron beam current at the linac end with a low beam emittance of 1.6 μm and a low energy spread of ±0.5% so as to guarantee a higher injection rate (≥50 mA/min) to the storage ring. Since the positron flux is proportional to the primary electron beam power on the target, the authors will increase the electron gun current from 4A to 10A by using a new electron gun system and increase the primary electron energy from 120 MeV to 240 MeV. The positron source itself is an extremely important system for producing more positrons, including a positron converter target chamber, a 12kA flux modulator, the 7m focusing module with DC power supplies and the support. The new positron production linac from the electron gun to the positron source has been installed into the tunnel. In what follows, the authors will emphasize the positron source design, manufacture and tests. (authors)

  7. Dark matter detection - II

    International Nuclear Information System (INIS)

    Zacek, Viktor

    2015-01-01

    The quest for the mysterious missing mass of the universe has become one of the big challenges of today's particle physics and cosmology. Astronomical observations show that only 1% of the matter of the universe is luminous. Moreover there is now convincing evidence that 85% of all gravitationally observable matter in the universe is of a new exotic kind, different from the 'ordinary' matter surrounding us. In a series of three lectures we discuss past, recent and future efforts made world-wide to detect and/or decipher the nature of Dark Matter. In Lecture I we review our present knowledge of the Dark Matter content of the Universe and how experimenters search for it's candidates; In Lecture II we discuss so-called 'direct detection' techniques which allow to search for scattering of galactic dark matter particles with detectors in deep-underground laboratories; we discuss the interpretation of experimental results and the challenges posed by different backgrounds; In Lecture III we take a look at the 'indirect detection' of the annihilation of dark matter candidates in astrophysical objects, such as our sun or the center of the Milky Way; In addition we will have a look at efforts to produce Dark Matter particles directly at accelerators and we shall close with a look at alternative nonparticle searches and future prospects. (author)

  8. Textos sobre Sostenibilidad II

    Directory of Open Access Journals (Sweden)

    Ciudades para un futuro más sostenible http://habitat.aq.upm.es

    2004-12-01

    This issue assembles a selection of articles publicly available on the website Ciudades para un Futuro más Sostenible (CF+S: http://habitat.aq.upm.es. This selection was originally used as a printed companion guide to the public lecture series on ‘‘Sustainability in the Architecture and Urban Project’’, held on March 2004 and organized by the Madrid School of Architecture within the Initiative for a more Sustainable Architecture and Urbanism (IAU+S. The compilation an overall vision on sustainability presents to average audience. The basic criterion to select these articles was therefore a pedagogical one, including those simpler and clearer papers dealing with all main topics in CF+S. However, due to space limitations, many excellent articles available on the website are unfortunately not included within this selection. CF+S was created in 1996 as a partnership between the Spanish Ministry of Works and Madrid School of Architecture. The objective was to translate into Spanish and publish the experiences selected at the International Award for Best Practices in Improving the Living Environment, organized by United Nations after the Istanbul Conference on Human Settlements (Habitat II. CF+S aims to gather documents concerning any kind of actions and experiences both on the territory and the city actually improving people’s living conditions according to the sustainability concept in its strongest sense. It also offers papers, reports and theoretical reflections on the state of and the possible alternatives to urban development nowadays.

  9. Crystal Structure of Rat Carnitine Palmitoyltransferase II (CPT-II)

    Energy Technology Data Exchange (ETDEWEB)

    Hsiao,Y.; Jogl, G.; Esser, V.; Tong, L.

    2006-01-01

    Carnitine palmitoyltransferase II (CPT-II) has a crucial role in the {beta}-oxidation of long-chain fatty acids in mitochondria. We report here the crystal structure of rat CPT-II at 1.9 Angstroms resolution. The overall structure shares strong similarity to those of short- and medium-chain carnitine acyltransferases, although detailed structural differences in the active site region have a significant impact on the substrate selectivity of CPT-II. Three aliphatic chains, possibly from a detergent that is used for the crystallization, were found in the structure. Two of them are located in the carnitine and CoA binding sites, respectively. The third aliphatic chain may mimic the long-chain acyl group in the substrate of CPT-II. The binding site for this aliphatic chain does not exist in the short- and medium-chain carnitine acyltransferases, due to conformational differences among the enzymes. A unique insert in CPT-II is positioned on the surface of the enzyme, with a highly hydrophobic surface. It is likely that this surface patch mediates the association of CPT-II with the inner membrane of the mitochondria.

  10. 371 Exhumierungen : eine Untersuchung aus morphologischer, versicherungsmedizinischer und rechtsmedizinischer Sicht

    OpenAIRE

    Ulm, Kristin

    2008-01-01

    In der vorliegenden Arbeit wurden die Ergebnisse von 371 Exhumierungen aus den Jahren 1967 bis 1998 ausgewertet unter der Fragestellung, ob aussagekräftige morphologische Befunde auch noch nach einer längeren Leichenliegezeit erhoben werden und versicherungsmedizinische Fragen hierdurch beantwortet werden können. Die erhobenen morphologischen Befunde sowohl auf mikroskopischer als auch auf makroskopischer Ebene wurden zu einem Erwartungskatalog zusammengefasst und mit den Ergebnissen der...

  11. Herstellung und Untersuchung metallischer Einzel-Elektronen-Transistoren

    OpenAIRE

    Hofmann, Karl

    2001-01-01

    Single-electron transistors (SETs) are quantum devices and are based on the controlling of the Coulomb blockade. They are the ultimate development of low-power devices with an extreme high potential of integration. Their dominant purpose is seen in future memory devices. Usually the key element of all metallic SETs is a tunnel junction consisting of a metal-insulator-metal transition. In this current thesis the microscopic and electrical investigations of e-gun evaporated titanium thin films ...

  12. Nina Otto, Enargeia. Untersuchung zur Charakteristik alexandrinischer Dichtung

    Directory of Open Access Journals (Sweden)

    Christophe Cusset

    2011-07-01

    Full Text Available L’étude part dans l’introduction d’une présentation circonstanciée et précise des thèses différentes de Bernd Effe et de Graham Zanker sur le traitement du réalisme, qui permet néanmoins de mettre en évidence le même phénomène caractéristique de la poésie hellénistique, à savoir que celle-ci est parcourue par la représentation jusque-là inégalée de la réalité quotidienne et triviale et par la volonté de mettre la poésie le plus étroitement possible en rapport avec une expérience intellectuell...

  13. Options Study - Phase II

    Energy Technology Data Exchange (ETDEWEB)

    R. Wigeland; T. Taiwo; M. Todosow; W. Halsey; J. Gehin

    2010-09-01

    The Options Study has been conducted for the purpose of evaluating the potential of alternative integrated nuclear fuel cycle options to favorably address the issues associated with a continuing or expanding use of nuclear power in the United States. The study produced information that can be used to inform decisions identifying potential directions for research and development on such fuel cycle options. An integrated nuclear fuel cycle option is defined in this study as including all aspects of the entire nuclear fuel cycle, from obtaining natural resources for fuel to the ultimate disposal of used nuclear fuel (UNF) or radioactive wastes. Issues such as nuclear waste management, especially the increasing inventory of used nuclear fuel, the current uncertainty about used fuel disposal, and the risk of nuclear weapons proliferation have contributed to the reluctance to expand the use of nuclear power, even though it is recognized that nuclear power is a safe and reliable method of producing electricity. In this Options Study, current, evolutionary, and revolutionary nuclear energy options were all considered, including the use of uranium and thorium, and both once-through and recycle approaches. Available information has been collected and reviewed in order to evaluate the ability of an option to clearly address the challenges associated with the current implementation and potential expansion of commercial nuclear power in the United States. This Options Study is a comprehensive consideration and review of fuel cycle and technology options, including those for disposal, and is not constrained by any limitations that may be imposed by economics, technical maturity, past policy, or speculated future conditions. This Phase II report is intended to be used in conjunction with the Phase I report, and much information in that report is not repeated here, although some information has been updated to reflect recent developments. The focus in this Options Study was to

  14. National Energy Plan II

    Energy Technology Data Exchange (ETDEWEB)

    None

    1979-01-01

    This volume contains the Administration's second National Energy Plan, as required by section 801 of the Department of Energy Organization Act (Public Law 95-91). A second volume will contain an assessment of the environmental trends associated with the energy futures reported here. Detailed appendices to the Plan will be published separately. The eight chapters and their subtitles are: Crisis and Uncertainty in the World Energy Future (The Immediate Crisis and the Continuing Problem, The Emergence of the Energy Problem, The Uncertainties of the World Energy Future, World Oil Prices, Consequences for the U.S.); The U.S. Energy Future: The Implications for Policy (The Near-, Mid-, and Long-Term, The Strategy in Perspective); Conservation (Historical Changes in Energy Use, Post-Embargo Changes - In Detail, Conservation Policies and Programs, The Role of Conservation); Oil and Gas (Oil, Natural Gas); Coal and Nuclear (Coal, Nuclear, Policy for Coal and Nuclear Power); Solar and Other Inexhaustible Energy Sources (Solar Energy, Geothermal, Fusion, A Strategy for Inexhaustible Resources); Making Decisions Promptly and Fairly (Managing Future Energy Crises: Emergency Planning, Managing the Current Shortfall: The Iranian Response Plan, Managing the Long-Term Energy Problem: The Institutional Framework, Fairness in Energy Policy, Public Participation in the Development of Energy Policy); and NEP-II and the Future (The Second National Energy Plan and the Nation's Energy Future, The Second National Energy Plan and the Economy, Employment and Energy Policy, The Second National Energy Plan and Individuals, The Second National Energy Plan and Capital Markets, and The Second National Energy Plan and the Environment). (ERA citation 04:041097)

  15. Stiffnites. Part II

    Directory of Open Access Journals (Sweden)

    Maria Teresa Pareschi

    2011-06-01

    Full Text Available

    The dynamics of a stiffnite are here inferred. A stiffnite is a sheet-shaped, gravity-driven submarine sediment flow, with a fabric made up of marine ooze. To infer stiffnite dynamics, order of magnitude estimations are used. Field deposits and experiments on materials taken from the literature are also used. Stiffnites can be tens or hundreds of kilometers wide, and a few centimeters/ meters thick. They move on the sea slopes over hundreds of kilometers, reaching submarine velocities as high as 100 m/s. Hard grain friction favors grain fragmentation and formation of triboelectrically electrified particles and triboplasma (i.e., ions + electrons. Marine lipids favor isolation of electrical charges. At first, two basic assumptions are introduced, and checked a posteriori: (a in a flowing stiffnite, magnetic dipole moments develop, with the magnetization proportional to the shear rate. I have named those dipoles as Ambigua. (b Ambigua are ‘vertically frozen’ along stiffnite streamlines. From (a and (b, it follows that: (i Ambigua create a magnetic field (at peak, >1 T. (ii Lorentz forces sort stiffnite particles into two superimposed sheets. The lower sheet, L+, has a sandy granulometry and a net positive electrical charge density. The upper sheet, L–, has a silty muddy granulometry and a net negative electrical charge density; the grains of sheet L– become finer upwards. (iii Faraday forces push ferromagnetic grains towards the base of a stiffnite, so that a peak of magnetic susceptibility characterizes a stiffnite deposit. (iv Stiffnites harden considerably during their motion, due to magnetic confinement. Stiffnite deposits and inferred stiffnite characteristics are compatible with a stable flow behavior against bending, pinch, or other macro instabilities. In the present report, a consistent hypothesis about the nature of Ambigua is provided.

  16. Kursk Operation Simulation and Validation Exercise - Phase II (KOSAVE II)

    National Research Council Canada - National Science Library

    Bauman, Walter

    1998-01-01

    ... (KOSAVE) Study (KOSAVE II) documents, in this report a statistical record of the Kursk battle, as represented in the KDB, for use as both a standalone descriptive record for historians, and as a baseline for a subsequent Phase...

  17. RTNS-II [Rotating Target Neutron Source II] operational summary

    International Nuclear Information System (INIS)

    Heikkinen, D.W.

    1988-09-01

    The Rotating Target Neutron Source II facility (RTNS-II) operated for over nine years. Its purpose was to provide high intensities of 14 MeV neutrons for materials studies in the fusion energy program. For the period from 1982-1987, the facility was supported by both the US (Department of Energy) and Japan (Ministry of Education, Culture, and Science). RTNS-II contains two accelerator-based neutron sources which use the T(d,n) 4 He reaction. In this paper, we will summarize the operational history of RTNS-II. Typical operating parameters are given. In addition, a brief description of the experimental program is presented. The current status and future options for the facility are discussed. 7 refs., 5 tabs

  18. Chemical speciation of Pb(II, Cd(II, Hg(II, Co(II, Ni(II, Cu(II and Zn(II binary complexes of l-methionine in 1,2-propanediol-water mixtures

    Directory of Open Access Journals (Sweden)

    M. Padma Latha

    2007-04-01

    Full Text Available Chemical speciation of Pb(II, Cd(II, Hg(II, Co(II, Ni(II, Cu(II and Zn(II complexes of L-methionine in 0.0-60 % v/v 1,2-propanediol-water mixtures maintaining an ionic strength of 0.16 M at 303 K has been studied pH metrically. The active forms of ligand are LH2+, LH and L-. The predominant species detected are ML, MLH, ML2, ML2H, ML2H2 and MLOH. Models containing different numbers of species were refined by using the computer program MINIQUAD 75. The best-fit chemical models were arrived at based on statistical parameters. The trend in variation of complex stability constants with change in the dielectric constant of the medium is explained on the basis of electrostatic and non-electrostatic forces.

  19. New instruments at IPNS: POSY II and SAD II

    International Nuclear Information System (INIS)

    Crawford, R.K.; Felcher, G.P.; Kleb, R.; Epperson, J.E.; Thiyagarajan, P.

    1988-01-01

    Three new instruments are currently in varying degrees of development/construction at IPNS. One of these, the Glass, Liquid, and Amorphous Materials Diffractometer (GLAD) is the subject of a separate paper in these Proceedings, and so will not be discussed further here. The other two, a second neutron reflectometer (POSY II) and a second small-angle diffractometer (SAD II) are described briefly below. 5 refs., 1 fig., 1 tab

  20. Integrated Procurement Management System, Version II

    Science.gov (United States)

    Collier, L. J.

    1985-01-01

    Integrated Procurement Management System, Version II (IPMS II) is online/ batch system for collecting developing, managing and disseminating procurementrelated data at NASA Johnson Space Center. Portions of IPMS II adaptable to other procurement situations.

  1. Bose Condensate in He II

    International Nuclear Information System (INIS)

    Svensson, E.C.

    1984-01-01

    The Condensate Saga, now halfway through its fifth decade, is reviewed. The recent neutron-scattering work which has at last convincingly established that there is indeed a Bose Condensate in He II is described

  2. Tier II Chemical Storage Facilities

    Data.gov (United States)

    Iowa State University GIS Support and Research Facility — Facilities that store hazardous chemicals above certain quantities must submit an annual emergency and hazardous chemical inventory on a Tier II form. This is a...

  3. Penetrating Internet Information Services (IIS).

    African Journals Online (AJOL)

    PROF. O. E. OSUAGWU

    2013-12-01

    Dec 1, 2013 ... Information Services (IIS) packages have been presented. Note that while some of ... encompasses a variety of services including FTP, SMTP ..... for Web-based Distributed Authoring ... denial-of-service vulnerabilities we have.

  4. Coordination compounds of cobalt(II), nickel(II), copper(II), and zinc(II) with pantothenic acid

    Energy Technology Data Exchange (ETDEWEB)

    Shabilalov, A.A.; Yunuskhodzhaev, A.N.; Khodzhaev, O.F.; Azizov, M.A.

    1986-11-01

    The compounds Ni(PANA - H)/sub 2/ x 4H/sub 2/O (PANA stands for pantothenic acid, and - H indicates a deprotonated ligand), Cu(PANA - H)/sub 2/ x 2H/sub 2/O, Zn(PANA - H)/sub 2/ x H/sub 2/O, Co(PANA - H)Cl x H/sub 2/O, and Ni(PANA - H)Cl x 3H/sub 2/O have been synthesized on the basis of pantothenic acid and Co(II), Ni(II), Cu(II), and Zn(II) salts in aqueous media. The compounds have been identified by elemental and x-ray diffraction analysis. Some physicochemical properties (solubility, melting point, molar conductivity) of the compounds obtained have been studied. The structure of the compounds isolated has been established on the basis of an analysis of their IR, ESR, and electronic spectra, as well as derivatograms.

  5. Lunar Health Monitor, Phase II

    Data.gov (United States)

    National Aeronautics and Space Administration — During the Phase II Lunar Health Monitor program, Orbital Research will develop a second generation wearable sensor suite for astronaut physiologic monitoring. The...

  6. Australia; Basel II Implementation Assessment

    OpenAIRE

    International Monetary Fund

    2010-01-01

    The key findings of Australia’s BASEL II implementation assessment are presented. The Australian Prudential Regulation Authority (APRA) allocated sufficient resources, including highly skilled staff, prior to the Basel II start date, and the outcome has been a robust and high-quality implementation that has built upon and substantially strengthened the risk-management capabilities of major banks. The quality of leadership and commitment by all involved has been instrumental in the success of ...

  7. Pb(II), Cd(II) and Zn(II) adsorption on low grade manganese ore ...

    African Journals Online (AJOL)

    Low grade manganese ore (LMO) of Orissa containing 58.37% SiO2, 25.05% MnO2, 8.8% Al2O3, and 5.03% Fe2O3 as the main constituents was taken to study its adsorption behaviour for Pb(II), Cd(II) and Zn(II) from aqueous solutions. The XRD studies showed the crystalline phases to be quartz, ß-MnO2, d-MnO2 and ...

  8. Cr(III,Mn(II,Fe(III,Co(II,Ni(II,Cu(II and Zn(II Complexes with Diisobutyldithiocarbamato Ligand

    Directory of Open Access Journals (Sweden)

    Mohammad Tarique

    2011-01-01

    Full Text Available The synthesis of sulphur and nitrogen containing dithiocarbamato ligand derived from diisobutylamine as well as its coordination compounds with 3d series transition metals is presented. These synthesized compounds were characterized on the basis of elemental analysis, conductometric measurements and IR spectral studies. The analytical data showed the stoichiometry 1:2 and 1:3 for the compounds of the types ML2 {M=Mn(II, Co(II, Ni(II, Cu(II and Zn(II} and M'L3{M'=Cr(III and Fe(III} respectively. The conductometric measurements proved the non-electrolytic behaviour of all the compounds. The bidentate nature of dithiocarbamato moiety was confirmed on the basis of IR spectral data.

  9. Mu2e-II Injection from PIP-II

    Energy Technology Data Exchange (ETDEWEB)

    Neuffer, David [Fermilab

    2018-04-26

    We discuss injection of 800 MeV proton beam from PIP-II into the production target for Mu2e-II, assuming a targeting and μ production scenario similar to mu2e. The incoming beam trajectory must be modified from the mu2e parameters to match the focusing fields. Adding a vertical deflection at injection enables the injected beam to reach the target. Other differences from the mu2e system must be considered, including changes in the target structure, the radiation shielding and beam dump/absorber. H- beam should be stripped to p+. Other variations are discussed.

  10. The CDF SVX II upgrade for the Tevatron Run II

    International Nuclear Information System (INIS)

    Bortoletto, Daniela

    1997-01-01

    A microstrip silicon detector SVX II has been proposed for the upgrade of CDF to be installed in 1999 for Run II of the Tevatron. Three barrels of five layers of double-sided silicon microstrip detectors will cover the interaction region. A description of the project status will be presented. Emphasis will be given to the R and D program for silicon sensors which includes capacitance minimization, the study of coupling capacitor integrity, the operation of the detectors in conjunction with the SVXH and SVX2 readout chips in two beam tests and the determination of the detectors performance deterioration due to radiation damage

  11. EBR-II Data Digitization

    Energy Technology Data Exchange (ETDEWEB)

    Yoon, Su-Jong [Idaho National Lab. (INL), Idaho Falls, ID (United States); Rabiti, Cristian [Idaho National Lab. (INL), Idaho Falls, ID (United States); Sackett, John [Idaho National Lab. (INL), Idaho Falls, ID (United States)

    2014-08-01

    1. Objectives To produce a validation database out of those recorded signals it will be necessary also to identify the documents need to reconstruct the status of reactor at the time of the beginning of the recordings. This should comprehends the core loading specification (assemblies type and location and burn-up) along with this data the assemblies drawings and the core drawings will be identified. The first task of the project will be identify the location of the sensors, with respect the reactor plant layout, and the physical quantities recorded by the Experimental Breeder Reactor-II (EBR-II) data acquisition system. This first task will allow guiding and prioritizing the selection of drawings needed to numerically reproduce those signals. 1.1 Scopes and Deliverables The deliverables of this project are the list of sensors in EBR-II system, the identification of storing location of those sensors, identification of a core isotopic composition at the moment of the start of system recording. Information of the sensors in EBR-II reactor system was summarized from the EBR-II system design descriptions listed in Section 1.2.

  12. RTNS-II: present status

    International Nuclear Information System (INIS)

    Heikkinen, D.W.; Logan, C.M.

    1980-10-01

    The present status of the RTNS-II facility is described and typical operating parameters are given. A brief discussion is given of the methods used in production of the TiT 2 targets as well as their performance and tritium handling at RTNS-II. The various types of non-interactive beam diagnostics presently in use at the neutron sources are outlined. The on-line computer system which provides a time history of an irradiation and records target performance is described. Examples are listed of several representative experimental programs which have been carried out thus far at RTNS-II. These include both active and passive experiments. Finally, several of the major improvements to the facility made since the beginning of the experimental program are given

  13. STARFIRE-II studies. Summary

    International Nuclear Information System (INIS)

    Baker, C.C.; Brooks, J.N.; Ehst, D.A.; Smith, D.L.; Sze, D.K.

    1985-01-01

    The US Department of Energy's Office of Fusion Energy has initiated several studies during FY-1985 called Tokamak Power System Studies (TPSS). The TPSS is being carried out by several laboratories, universities and industry with the general objective of developing innovative physics and technology concepts to improve the commercial attractiveness of tokamak power reactors. The effort of Argonne National Laboratory, entitled STARFIRE-II, is an effort to update and improve STARFIRE, which was the last comprehensive conceptual design study in the US of a commercial tokamak power plant. The STARFIRE-II effort has developed a number of goals in order to improve fusion commercial power plants based in part on several recent studies. The primary goals for STARFIRE-II are listed

  14. First results from SAGE II

    International Nuclear Information System (INIS)

    Abdurashitov, J.N.; Faizov, E.L.; Gavrin, V.N.

    1994-01-01

    The Russian-American Gallium solar neutrino Experiment (SAGE) began the second phase of operation (SAGE II) in September of 1992. Monthly measurements of the integral flux of solar neutrinos have been made with 55 tonnes of gallium. The K-peak results of the first five runs of SAGE II give a capture rate of 76 -18 +21 (stat) -7 +5 (sys) SNU. combined with the SAGE I result, the capture rate is 74 -12 +13 (stat) -7 +5 (sys) SNU. This represents only 56%--60% of the capture rate predicted by different Standard Solar Models

  15. Facilities design for TIBER II

    International Nuclear Information System (INIS)

    Thomson, S.L.; Blevins, J.D.

    1987-01-01

    This paper describes the conceptual design of the reactor building and reactor maintenance building for the TIBER II tokamak. These buildings are strongly influenced by the reactor configuration, and their characterization allows a better understanding of the economic and technical implications of the reactor design. Key features of TIBER II that affect the facilities design are the small size and compact arrangement, the use of an external vacuum vessel, and the complete reliance on remote maintenance. The building design incorporates requirements for equipment layout, maintenance operations and equipment, safety, and contamination control. 4 figs

  16. First results from SAGE II

    International Nuclear Information System (INIS)

    Aburashitov, J.N.; Faizov, E.L.; Gavrin, V.N.; Gusev, A.O.; Kalikhov, A.V.; Knodel, T.V.; Knyshenko, I.I.; Kornoukhov, V.N.; Mirmov, I.N.; Pshukov, A.M.; Shalagin, A.M.; Shikhin, A.A.; Timofeyev, P.V.; Veretenkin, E.P.; Vermul, V.M.; Zatsepin, G.T.; Bowles, T.J.; Nico, J.S.; Teasdale, W.A.; Wark, D.L.; Wilkerson, J.F.; Cleveland, B.T.; Daily, T.; Davis, R. Jr.; Lande, K.; Lee, C.K.; Wildenhain, P.W.; Elliott, S.R.; Cherry, M.L.

    1995-01-01

    The Russian-American Gallium solar neutrino Experiment (SAGE) began the second phase of operation (SAGE II) in September of 1992. Monthly measurements of the integral flux of solar neutrinos have been made with 55 tonnes of gallium. The K-peak results of the first five runs of SAGE II give a capture rate of 76 +21 -18 (stat) +5 -7 (sys) SNU. Combined with the SAGE I result, the capture rate is 74 +13 -12 (stat) +5 -7 (sys) SNU. This represents only 56%--60% of the capture rate predicted by different Standard Solar Models. copyright 1995 American Institute of Physics

  17. Extinction of H II regions

    International Nuclear Information System (INIS)

    Israel, F.P.; Kennicutt, R.C.

    1980-01-01

    Visual extinction of H II regions in nine nearby galaxies as derived from the ratio of the radio continuum emission to H-alpha emission is systematically larger than visual extinction deduced from the Balmer lines alone, if one assumes a value Av/E(B-V) 3. An optically-limited sample of about 30 extragalactic H II regions has a mean extinction of 1.7 m in the visual while about 1.2 m is not seen in the reddening of the Balmer lines. Both reddening and extinction decreases with increasing galactic radius, at least for M33 and M101

  18. Synthesis and structural characterization of nickel(II), cobalt(II), Zinc(II), manganese(II), cadmium(II) and uranium(VI) complexes of α-oximinoacetoacet-o/p-anisidide thiosemicarbazone

    International Nuclear Information System (INIS)

    Patel, P.S.; Patel, M.M.; Ray, R.M.

    1993-01-01

    A few metal complexes of α-oximinoacetoacet-o/p-anisidide thiosemicarbazones (OAOATS)/(OAPATS) with Ni(II), Co(II), Zn(II), Mn(II), Hg(II), Cd(II) and UO 2 (II) have been prepared and characterized by elemental analyses, conductivity, differential scanning calorimetry study, thermogravimetric analyses and infrared and electronic spectral measurements in conjunction with magnetic susceptibility measurements at room temperature. They have also been tested for their antimicrobial activities. (author). 24 refs., 2 tabs

  19. Irradiations at RTNS-II

    International Nuclear Information System (INIS)

    Heikkinen, D.W.; Logan, C.M.

    1982-01-01

    The RTNS-II 14-MeV neutron source facility at Lawrence Livermore National Laboratory is described. Average neutron source parameters are outlined. A brief general description of the irradiation program to the present time is given. A short discussion of guidelines for prospective users is also given

  20. DUMAND-II progress report

    International Nuclear Information System (INIS)

    Wilkes, R.J.; Alexander, C.M.; Aoki, T.; Berson, U.; Bosetti, P.; Bolesta, J.; Boynton, P.E.; Bradner, H.; Camerini, U.; Dye, S.T.; Gergin, E.; Gorham, P.W.; Grieder, P.K.F.; Grogan, W.; Hanada, H.; Harris, D.; Hayashino, T.; Hazen, E.; Ito, M.; Jaworski, M.; Jenko, M.; Kawamoto, H.; Kitamura, T.; Kobayakawa, K.; Kondo, S.; Koske, P.; Learned, J.G.; Ley, C.; Lord, J.J.; Lord, R.; Lozic, T.; March, R.; Matsumoto, T.; Matsuno, S.; Mavretic, A.; McCourry, L.; Mignard, M.; Miller, K.; Minkowski, P.; Mitiguy, R.; Mitsui, K.; Narita, S.; Nicklaus, D.

    1993-01-01

    The design, scientific goals, and capabilities of the DUMAND II detector system are described. Construction was authorized by DOE in 1990, and construction of various detector subsystems is under way. Current plans include deployment of the shore cable, junction box and three strings of optical detector modules in 1993, with expansion to the full 9-string configuration about one year later

  1. Tech Area II: A history

    Energy Technology Data Exchange (ETDEWEB)

    Ullrich, R. [Ktech Corp., Albuquerque, NM (United States)

    1998-07-01

    This report documents the history of the major buildings in Sandia National Laboratories` Technical Area II. It was prepared in support of the Department of Energy`s compliance with Section 106 of the National Historic Preservation Act. Technical Area II was designed and constructed in 1948 specifically for the final assembly of the non-nuclear components of nuclear weapons, and was the primary site conducting such assembly until 1952. Both the architecture and location of the oldest buildings in the area reflect their original purpose. Assembly activities continued in Area II from 1952 to 1957, but the major responsibility for this work shifted to other sites in the Atomic Energy Commission`s integrated contractor complex. Gradually, additional buildings were constructed and the original buildings were modified. After 1960, the Area`s primary purpose was the research and testing of high-explosive components for nuclear weapons. In 1994, Sandia constructed new facilities for work on high-explosive components outside of the original Area II diamond-shaped parcel. Most of the buildings in the area are vacant and Sandia has no plans to use them. They are proposed for decontamination and demolition as funding becomes available.

  2. Light harvesting in photosystem II

    NARCIS (Netherlands)

    van Amerongen, H.; Croce, R.

    2013-01-01

    Water oxidation in photosynthesis takes place in photosystem II (PSII). This photosystem is built around a reaction center (RC) where sunlight-induced charge separation occurs. This RC consists of various polypeptides that bind only a few chromophores or pigments, next to several other cofactors. It

  3. TJ-II Library Manual

    International Nuclear Information System (INIS)

    Tribaldos, V.; Milligen, B.Ph., van; Lopez-Fraguas, A.

    1996-01-01

    This report contains a detailed description of the TJ-II library and its routines. The library is written in FORTRAN 77 language and is available in the CRAY J916 and DEC Alpha 8400 computers at CIEMAT. This document also contains some examples of its use. (Author)

  4. Case 22:Type II diabetes

    Science.gov (United States)

    Diabetes mellitus is characterized by elevated blood glucose levels. It is composed of two types depending on the pathogenesis. Type I diabetes is characterized by insulin deficiency and usually has its onset during childhood or teenage years. This is also called ketosis-prone diabetes. Type II diab...

  5. Rahvusvaheline "Scripta manent II" Tallinnas

    Index Scriptorium Estoniae

    2000-01-01

    Eduard Taska 110. sünniaastapäevale pühendatud rahvusvaheline köitekunsti- ja kalligraafianäitus "Scripta manent II" Tallinna Kunstihoones. Köitekunsti osas pälvis "kuldraamatu" Marielle Liivat, ergutusauhinnad: Marje Kask, Kadi Kiipus, Urve Kolde

  6. Recent results from DORIS II

    International Nuclear Information System (INIS)

    Bloom, E.D.

    1985-01-01

    This report contains a brief review of recent results from the ARGUS and Crystal Ball experiments at DORIS II, concentrating on UPSILON(1S) and UPSILON(2S) spectroscopy with a short foray into γγ physics. 18 refs., 10 figs

  7. Paiton II financing locked up

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1996-04-01

    The 2 x 610 MW Paiton II coal-fired independent power project in Indonesia became a reality last week with the completion of a 1.36 billion dollars commercial financing for the 1.65 billion dollar undertaking. Details of the financing are given. A table lists Indonesia`s independent power projects and their current status.

  8. Elizabeth II / Fagira D. Morti

    Index Scriptorium Estoniae

    Fagira D. Morti, pseud., 1974-

    2006-01-01

    Järjejutt Elizabeth II elust. Järgneb nr. 80, lk. 30-33, nr. 81, lk. 30-32, nr. 82, lk. 34-36, nr. 83, lk. 34-37, nr. 84, lk. 42-45, nr. 85, lk. 36-38, 86, lk. 44-47, nr. 87, lk. 32-35. Nr. 86 ja 87 autor: Helene Wait

  9. Application Programming in AWIPS II

    Science.gov (United States)

    Smit, Matt; McGrath, Kevin; Burks, Jason; Carcione, Brian

    2012-01-01

    Since its inception almost 8 years ago, NASA's Short-term Prediction Research and Transition (SPoRT) Center has integrated NASA data into the National Weather Service's decision support system (DSS) the Advanced Weather Interactive Processing System (AWIPS). SPoRT has, in some instances, had to shape and transform data sets into various formats and manipulate configurations to visualize them in AWIPS. With the advent of the next generation of DSS, AWIPS II, developers will be able to develop their own plugins to handle any type of data. Raytheon is developing AWIPS II to be a more extensible package written mainly in Java, and built around a Service Oriented Architecture. A plugin architecture will allow users to install their own code modules, and (if all the rules have been properly followed) they will work hand-in-hand with AWIPS II as if it were originally built in. Users can bring in new datasets with existing plugins, tweak plugins to handle a nuance or desired new functionality, or create an entirely new visualization layout for a new dataset. SPoRT is developing plugins to ensure its existing NASA data will be ready for AWIPS II when it is delivered, and to prepare for the future of new instruments on upcoming satellites.

  10. Type-II Weyl semimetals.

    Science.gov (United States)

    Soluyanov, Alexey A; Gresch, Dominik; Wang, Zhijun; Wu, QuanSheng; Troyer, Matthias; Dai, Xi; Bernevig, B Andrei

    2015-11-26

    Fermions--elementary particles such as electrons--are classified as Dirac, Majorana or Weyl. Majorana and Weyl fermions had not been observed experimentally until the recent discovery of condensed matter systems such as topological superconductors and semimetals, in which they arise as low-energy excitations. Here we propose the existence of a previously overlooked type of Weyl fermion that emerges at the boundary between electron and hole pockets in a new phase of matter. This particle was missed by Weyl because it breaks the stringent Lorentz symmetry in high-energy physics. Lorentz invariance, however, is not present in condensed matter physics, and by generalizing the Dirac equation, we find the new type of Weyl fermion. In particular, whereas Weyl semimetals--materials hosting Weyl fermions--were previously thought to have standard Weyl points with a point-like Fermi surface (which we refer to as type-I), we discover a type-II Weyl point, which is still a protected crossing, but appears at the contact of electron and hole pockets in type-II Weyl semimetals. We predict that WTe2 is an example of a topological semimetal hosting the new particle as a low-energy excitation around such a type-II Weyl point. The existence of type-II Weyl points in WTe2 means that many of its physical properties are very different to those of standard Weyl semimetals with point-like Fermi surfaces.

  11. Sequestration of Cu(II), Ni(II), and Co(II) by ethyleneimine immobilized on silica

    International Nuclear Information System (INIS)

    Arakaki, Luiza N.H.; Alves, Ana Paula M.; Silva Filho, Edson C. da; Fonseca, Maria G.; Oliveira, Severino F.; Espinola, Jose Geraldo P.; Airoldi, Claudio

    2007-01-01

    Thermodynamic data on interaction of Cu(II), Ni(II), and Co(II) with silica modified with ethyleneimine are obtained by calorimetric titration. The amount of ethyleneimine anchored on silica surface was estimated to be 0.70 mmol g -1 . The enthalpies of binding Ni(II), Cu(II) and Co(II), are -3.59 ± 0.001, -4.88 ± 0.001, and -7.75 ± 0.003 kJ mol -1 , respectively

  12. Solar photocatalytic removal of Cu(II), Ni(II), Zn(II) and Pb(II): Speciation modeling of metal-citric acid complexes

    International Nuclear Information System (INIS)

    Kabra, Kavita; Chaudhary, Rubina; Sawhney, R.L.

    2008-01-01

    The present study is targeted on solar photocatalytic removal of metal ions from wastewater. Photoreductive deposition and dark adsorption of metal ions Cu(II), Ni(II), Pb(II) and Zn(II), using solar energy irradiated TiO 2 , has been investigated. Citric acid has been used as a hole scavenger. Modeling of metal species has been performed and speciation is used as a tool for discussing the photodeposition trends. Ninety-seven percent reductive deposition was obtained for copper. The deposition values of other metals were significantly low [nickel (36.4%), zinc (22.2%) and lead (41.4%)], indicating that the photocatalytic treatment process, using solar energy, was more suitable for wastewater containing Cu(II) ions. In absence of citric acid, the decreasing order deposition was Cu(II) > Ni(II) > Pb(II) > Zn(II), which proves the theoretical thermodynamic predictions about the metals

  13. Radioimmunologic determination of plasmapepsinogen II

    International Nuclear Information System (INIS)

    Patzschke, C.; Berg, U.

    1979-01-01

    Within the frame of this study the pepsinogen II concentration could be determined for the first time with a radioimmunoassay in the plasma. In our normal study group the mean value was 13.91 ng/ml with a variation between 4.08 and 36.19 ng/ml. With increasing patient age a continuous increase of this concentration could be observed. The mean value of 14.99 ng/ml for male patients was by 4.75 ng/ml higher than the mean value of 10.24 ng/ml for female patients. The 24 hour profiles represented for the pepsinogen plasma concentration daily physiologic fluctuations and a stabilisation at night. The effects of meals could not be defined unambiguously. In stimulation tests Pentagastrin provoked in 4 of 9 test persons an increase of the concentration of up to 70% of the basic value. In short-term stress-tests the Pg II concentrations found in the test subjects presented an increase or a decrease. In investigations before or after the same patient underwent an operative procedure, an expressive Pg II decrease (up to 33.74 ng/ml) could be detected. Patients with a total resection of the stomach had only a very low Pg II concentration (less than 3.1 ng/ml). In patients with gastric pathologies a significant difference of the confidence limits was found for the Pg II concentration between superficial gastritis (m = 16.04 ng/ml) and atrophic gastritis (m = 27.38 ng/ml). Compared with various gastric diseases the normal patient group presents a significant difference with reference to the atrophic gastritis or the cancerous stomach. The mean values found in atrophic gastritis or the cancerous stomach. The mean values found in atrophic gastritis and in gastric carcinoma are close to each other and are increased, compared to those measured in the normal patient group. (orig./MG) [de

  14. Synthesis, Characterization, and Biological Activity of Mn(II, Fe(II, Co(II, Ni(II, Cu(II, Zn(II, and Cd(II Complexes of N-Thiophenoyl-N′-Phenylthiocarbohydrazide

    Directory of Open Access Journals (Sweden)

    M. Yadav

    2013-01-01

    Full Text Available Mn(II, Fe(II, Co(II, Ni(II, Cu(II, Zn(II, and Cd(II complex of N-thiophenoyl -N′-phenylthiocarbohydrazide (H2 TPTH have been synthesized and characterized by elemental analysis, magnetic susceptibility measurements, infrared, NMR, electronic, and ESR spectral studies. The complexes were found to have compositions [Mn(H TPTH2], [Co(TPTH (H2O2], [Ni(TPTH (H2O2], [Cu(TPTH], [Zn(H TPTH], [Cd(H TPTH2], and [Fe(H TPTH2(EtOH]. The magnetic and electronic spectral studies suggest square planar geometry for [Cu(TPTH], tetrahedral geometry for [Zn(TPTH] and [Cd(H TPTH2], and octahedral geometry for rest of the complexes. The infrared spectral studies of the 1 : 1 deprotonated complexes suggest bonding through enolic oxygen, thiolato sulfur, and both the hydrazinic nitrogens. Thus, H2TPTH acts as a binegative tetradentate ligand. H2 TPTH and its metal complexes have been screened against several bacteria and fungi.

  15. Digital logic circuit design with ALTERA Quartus II

    International Nuclear Information System (INIS)

    Lee, Seung Ho

    2009-09-01

    This book consists 31 chapters about digital logic circuit with ALTERA Quartus II. It includes the introduction of ALTERA Quartus II, ALTERA Quartus II schematic editor, ALTERA Quartus II compiler, ALTERA Quartus II simulator, ALTERA Quartus II timing analyzer, how to use HBE-COMBO II training and HBE-COMBO II training kit with schematic editor, VHDL grammar and practice of ALTERA Quartus II and HBE-COMBO II training kit with VHDL.

  16. Adsorption of Pb(II), Cu(II), Cd(II), Zn(II), Ni(II), Fe(II), and As(V) on bacterially produced metal sulfides.

    Science.gov (United States)

    Jong, Tony; Parry, David L

    2004-07-01

    The adsorption of Pb(II), Cu(II), Cd(II), Zn(II), Ni(II), Fe(II) and As(V) onto bacterially produced metal sulfide (BPMS) material was investigated using a batch equilibrium method. It was found that the sulfide material had adsorptive properties comparable with those of other adsorbents with respect to the specific uptake of a range of metals and, the levels to which dissolved metal concentrations in solution can be reduced. The percentage of adsorption increased with increasing pH and adsorbent dose, but decreased with increasing initial dissolved metal concentration. The pH of the solution was the most important parameter controlling adsorption of Cd(II), Cu(II), Fe(II), Ni(II), Pb(II), Zn(II), and As(V) by BPMS. The adsorption data were successfully modeled using the Langmuir adsorption isotherm. Desorption experiments showed that the reversibility of adsorption was low, suggesting high-affinity adsorption governed by chemisorption. The mechanism of adsorption for the divalent metals was thought to be the formation of strong, inner-sphere complexes involving surface hydroxyl groups. However, the mechanism for the adsorption of As(V) by BPMS appears to be distinct from that of surface hydroxyl exchange. These results have important implications to the management of metal sulfide sludge produced by bacterial sulfate reduction.

  17. Information on Asse II; Informationen ueber die Schachtanlage Asse II

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    2014-07-15

    The information on Asse II include the following topics: The image and what is behind - the barrier building Dammjoch built 1914; Fact finding - underground explorations; concept for a site comparison; Learning from experiences - the final repository projects Asse, Gorleben and Morsleben show what should not be done; At first drilling - thereafter building - progress of the recovery duct; The retrieval can only go on in dialogue with the public.

  18. Type II Supernova Spectral Diversity. II. Spectroscopic and Photometric Correlations

    Science.gov (United States)

    Gutiérrez, Claudia P.; Anderson, Joseph P.; Hamuy, Mario; González-Gaitan, Santiago; Galbany, Lluis; Dessart, Luc; Stritzinger, Maximilian D.; Phillips, Mark M.; Morrell, Nidia; Folatelli, Gastón

    2017-11-01

    We present an analysis of observed trends and correlations between a large range of spectral and photometric parameters of more than 100 type II supernovae (SNe II), during the photospheric phase. We define a common epoch for all SNe of 50 days post-explosion, where the majority of the sample is likely to be under similar physical conditions. Several correlation matrices are produced to search for interesting trends between more than 30 distinct light-curve and spectral properties that characterize the diversity of SNe II. Overall, SNe with higher expansion velocities are brighter, have more rapidly declining light curves, shorter plateau durations, and higher 56Ni masses. Using a larger sample than previous studies, we argue that “Pd”—the plateau duration from the transition of the initial to “plateau” decline rates to the end of the “plateau”—is a better indicator of the hydrogen envelope mass than the traditionally used optically thick phase duration (OPTd: explosion epoch to end of plateau). This argument is supported by the fact that Pd also correlates with s 3, the light-curve decline rate at late times: lower Pd values correlate with larger s 3 decline rates. Large s 3 decline rates are likely related to lower envelope masses, which enables gamma-ray escape. We also find a significant anticorrelation between Pd and s 2 (the plateau decline rate), confirming the long standing hypothesis that faster declining SNe II (SNe IIL) are the result of explosions with lower hydrogen envelope masses and therefore have shorter Pd values. This paper includes data gathered with the 6.5 m Magellan Telescopes located at Las Campanas Observatory, Chile; and the Gemini Observatory, Cerro Pachon, Chile (Gemini Program GS- 2008B-Q-56). Based on observations collected at the European Organisation for Astronomical Research in the Southern Hemisphere, Chile (ESO Programs 076.A-0156, 078.D-0048, 080.A-0516, and 082.A-0526).

  19. Information on Asse II; Informationen ueber die Schachtanlage Asse II

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    2015-02-15

    The information brochure on Asse II describes the situation in the repository for radioactive wastes that was closed by law due to the violations of safety standards. The discussed topics include the necessity of waste retrieval, the problems with public anxiety and public information, the hazard of an uncontrolled water ingress (worst case scenario), the work sites in the cavern, man-machine interactions and the cost of the project.

  20. Physicochemical properties of 3,4,5-trimethoxybenzoates of Mn(II, Co(II, Ni(II and Zn(II

    Directory of Open Access Journals (Sweden)

    W. FERENC

    2005-09-01

    Full Text Available The complexes of Mn(II, Co(II, Ni(II, Cu(II and Zn(II with 3,4,5-trimethoxybenzoic acid anion of the formula: M(C10H11O52·nH2O, where n = 6 for Ni(II, n = 1 for Mn(II, Co(II, Cu(II, and n = 0 for Zn, have been synthesized and characterized by elemental analysis, IR spectroscopy, X–ray diffraction measurements, thermogravimetry and magnetic studies. They are crystalline compounds characterized by various symmetry. They decompose in various ways when heated in air to 1273 K. At first, they dehydrate in one step and form anhydrous salts. The final products of decomposition are oxides of the respective metals (Mn2O3, Co3O4, NiO, CuO, ZnO. The solubilities of the analysed complexes in water at 293 K are in the orders of 10-2 – 10-4 mol dm-3. The magnetic susceptibilities of the Mn(II, Co(II, Ni(II and Cu(II complexes were measured over the range of 76–303 K and the magnetic moments were calculated. The results show that the 3,4,5-trimethoxybenzoates of Mn(II, Co(II and Ni(II are high-spin complexes but that of Cu(II forms a dimer [Cu2(C10H11O54(H2O2]. The carboxylate groups bind as monodentate or bidentate chelating or bridging ligands.

  1. TAF(II)250: a transcription toolbox.

    Science.gov (United States)

    Wassarman, D A; Sauer, F

    2001-08-01

    Activation of RNA-polymerase-II-dependent transcription involves conversion of signals provided by gene-specific activator proteins into the synthesis of messenger RNA. This conversion requires dynamic structural changes in chromatin and assembly of general transcription factors (GTFs) and RNA polymerase II at core promoter sequence elements surrounding the transcription start site of genes. One hallmark of transcriptional activation is the interaction of DNA-bound activators with coactivators such as the TATA-box binding protein (TBP)-associated factors (TAF(II)s) within the GTF TFIID. TAF(II)250 possesses a variety of activities that are likely to contribute to the initial steps of RNA polymerase II transcription. TAF(II)250 is a scaffold for assembly of other TAF(II)s and TBP into TFIID, TAF(II)250 binds activators to recruit TFIID to particular promoters, TAF(II)250 regulates binding of TBP to DNA, TAF(II)250 binds core promoter initiator elements, TAF(II)250 binds acetylated lysine residues in core histones, and TAF(II)250 possesses protein kinase, ubiquitin-activating/conjugating and acetylase activities that modify histones and GTFs. We speculate that these activities achieve two goals--(1) they aid in positioning and stabilizing TFIID at particular promoters, and (2) they alter chromatin structure at the promoter to allow assembly of GTFs--and we propose a model for how TAF(II)250 converts activation signals into active transcription.

  2. Roget's II the new thesaurus

    CERN Document Server

    2003-01-01

    Roget’s II: The New Thesaurus, Third Edition, allows the user to find the right synonym with a minimum of effort. Unlike many thesauruses, this easy-to-use reference lists main entry words alphabetically, as in a dictionary, for quick lookup. Each entry is divided into senses, with brief definitions and a full list of synonyms for each sense, to ensure that the selected usage is the most appropriate one. All special usages, such as slang terms, are labeled and grouped together at the end of each synonym list. Following each list is a cross-reference to a related entry in the thesaurus’s unique Category Index. This index leads the reader from the starting word to dozens of others that have related or opposite meanings. All these features make Roget’s II the best resource for finding the right word every time.

  3. Belle II silicon vertex detector

    Energy Technology Data Exchange (ETDEWEB)

    Adamczyk, K. [H. Niewodniczanski Institute of Nuclear Physics, Krakow 31-342 (Poland); Aihara, H. [Department of Physics, University of Tokyo, Tokyo 113-0033 (Japan); Angelini, C. [Dipartimento di Fisica, Università di Pisa, I-56127 Pisa (Italy); INFN Sezione di Pisa, I-56127 Pisa (Italy); Aziz, T.; Babu, V. [Tata Institute of Fundamental Research, Mumbai 400005 (India); Bacher, S. [H. Niewodniczanski Institute of Nuclear Physics, Krakow 31-342 (Poland); Bahinipati, S. [Indian Institute of Technology Bhubaneswar, Satya Nagar (India); Barberio, E.; Baroncelli, Ti.; Baroncelli, To. [School of Physics, University of Melbourne, Melbourne, Victoria 3010 (Australia); Basith, A.K. [Indian Institute of Technology Madras, Chennai 600036 (India); Batignani, G. [Dipartimento di Fisica, Università di Pisa, I-56127 Pisa (Italy); INFN Sezione di Pisa, I-56127 Pisa (Italy); Bauer, A. [Institute of High Energy Physics, Austrian Academy of Sciences, 1050 Vienna (Austria); Behera, P.K. [Indian Institute of Technology Madras, Chennai 600036 (India); Bergauer, T. [Institute of High Energy Physics, Austrian Academy of Sciences, 1050 Vienna (Austria); Bettarini, S. [Dipartimento di Fisica, Università di Pisa, I-56127 Pisa (Italy); INFN Sezione di Pisa, I-56127 Pisa (Italy); Bhuyan, B. [Indian Institute of Technology Guwahati, Assam 781039 (India); Bilka, T. [Faculty of Mathematics and Physics, Charles University, 121 16 Prague (Czech Republic); Bosi, F. [INFN Sezione di Pisa, I-56127 Pisa (Italy); Bosisio, L. [Dipartimento di Fisica, Università di Trieste, I-34127 Trieste (Italy); INFN Sezione di Trieste, I-34127 Trieste (Italy); and others

    2016-09-21

    The Belle II experiment at the SuperKEKB collider in Japan is designed to indirectly probe new physics using approximately 50 times the data recorded by its predecessor. An accurate determination of the decay-point position of subatomic particles such as beauty and charm hadrons as well as a precise measurement of low-momentum charged particles will play a key role in this pursuit. These will be accomplished by an inner tracking device comprising two layers of pixelated silicon detector and four layers of silicon vertex detector based on double-sided microstrip sensors. We describe herein the design, prototyping and construction efforts of the Belle-II silicon vertex detector.

  4. MPS II drift chamber system

    International Nuclear Information System (INIS)

    Platner, E.D.

    1982-01-01

    The MPS II detectors are narrow drift space chambers designed for high position resolution in a magnetic field and in a very high particle flux environment. Central to this implementation was the development of 3 multi-channel custom IC's and one multi-channel hybrid. The system is deadtimeless and requires no corrections on an anode-to-anode basis. Operational experience and relevance to ISABELLE detectors is discussed

  5. FRM-II conversion revisited

    International Nuclear Information System (INIS)

    Glaser, A.; Pistner, C.; Liebert, W.

    2000-01-01

    The possibilities for a conversion of the currently constructed research reactor FRM-II has been extensively discussed at various RERTR meetings over the past years. In order to support the ongoing decision-making process in Germany, we prepared computer simulations providing extra information on the scientific usability of the converted reactor based on designs proposed by ANL and TUM. The most important results of these calculations are presented and discussed. Special attention is thereby given to the specific German context. (author)

  6. TRANSWRAP II: problem definition manual

    International Nuclear Information System (INIS)

    Knittle, D.E.

    1981-02-01

    The TRANSWRAP II computer code, written in Fortran IV and described in this Problem Definition Manual, was developed to analytically predict the magnitude of pressure pulses of large scale sodium-wate reactions in LMFBR secondary systems. It is currently being used for the Clinch River Breeder Reactor Program. The code provides the options, flexibility and features necessary to consider any system configuration. The code methodology has been validated with the aid of extensive sodium-water reaction test programs

  7. Spectroscopic and thermal degradation behavior of Mg(II, Ca(II, Ba(II and Sr(II complexes with paracetamol drug

    Directory of Open Access Journals (Sweden)

    Moamen S. Refat

    2017-05-01

    Full Text Available Complexes of Mg(II, Ca(II, Ba(II and Sr(II with paracetamol drug were synthesized and characterized by elemental analysis, conductivity, UV–Vis, IR, and 1H NMR spectroscopy and thermal analysis, as well as screened for antimicrobial activity. The IR spectral data suggested that the ligand behaves as paracetamol behaves as a neutral bidentate ligand coordinated to the metal ions via the lone pair of electrons of nitrogen and carbonyl-O atoms of the amide group. From the microanalytical data, the stoichiometry of the complexes reacts with Mg(II, Ca(II, Ba(II and Sr(II by molar ratios (2:1 (paracetamol:metal ion. The thermal behavior (TG/DTG of the complexes was studied. The ligand and their metal complexes were screened against both of antibacterial and fungicidal activities.

  8. World War II Weather Record Transmittances

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — World War II Weather Record Transmittances are a record of the weather and meteorological data observed during World War II and transferred to the archive. It...

  9. Synthesis and characterization of heterobimetallic complexes of the type [Cu(pn2][MCl4] where M = Co(II, Ni(II, Cu(II, Zn(II, Cd(II, and Hg(II

    Directory of Open Access Journals (Sweden)

    Seema Yadav

    2016-11-01

    Full Text Available A series of new bimetallic transition metal complexes of the type [Cu(pn2] [MCl4] have been synthesized (where M = Co(II, Ni(II, Cu(II, Zn(II, Cd(II and Hg(II, pn = 1,3-diaminopropane and characterized by elemental analysis, molar conductance, TGA, IR and electronic spectra. All the compounds are 1:1 electrolyte in DMF. The Cu(II ion is square-planar while metal ions in the anionic moiety acquire their usual tetrahedral arrangement. On the basis of these studies it is concluded that anionic moiety is electrically stabilized by its cationic counterpart.

  10. Preparation of Schiff s base complexes of Mn(II), Co(II), Ni(II), Cu(II), Zn(II), and Cd(II) and their spectroscopic, magnetic, thermal, and antifungal studies

    International Nuclear Information System (INIS)

    Parekh, H.M.; Patel, M.N.

    2006-01-01

    The potassium salt of salicylidene-DL-alanine (KHL), bis(benzylidene)ethylenediamine (A 1 ), thiophene-o-carboxaldene-p-toluidine (A 2 ), and its metal complexes of the formula [(M II (L)(A)(H 2 O)] (M=Mn(II), Co(II), Ni(II), Cu(II), Zn(II), and Cd(II); A = A 1 or A 2 ) are prepared. They are characterized by elemental analysis, magnetic susceptibility measurements, thermogravimetric analysis, and infrared and electronic spectral studies. The electronic spectral and magnetic moment data suggest an octahedral geometry for the complexes. All of these complexes, metal nitrates, fungicides (bavistin and emcarb), and ligands are screened for their antifungal activity against Aspergillus niger, Fusarium oxysporum, and Aspergillus flavus using a plate poison technique. The complexes show higher activity than those of the free ligands, metal nitrate, and the control (DMSO) and moderate activity against bavistin and emcarb [ru

  11. Status of Gerda Phase II

    Energy Technology Data Exchange (ETDEWEB)

    Wagner, Victoria [Max-Planck-Institut fuer Kernphysik, Heidelberg (Germany); Collaboration: GERDA-Collaboration

    2016-07-01

    The GERDA experiment is designed to search for neutrinoless double beta (0νββ) decay of {sup 76}Ge. In Phase I of the experiment a background index (BI) of 10{sup -2} cts/(keV.kg.yr) was reached. No signal has been found and a lower limit on the half-life of 2.1.10{sup 25} yr (at 90% C.L.) is extracted. The aim of Phase II is to double the Ge mass and further reduce the BI by an order of magnitude to explore half-lives of about 10{sup 26} yr. Thirty new Broad Energy Germanium (BEGe) detectors have been produced. These detectors are distinct for their improved energy resolution and enhanced pulse shape discrimination of signal from background events. Further background reduction will be reached by an active veto to read out argon scintillation light. The Phase II commissioning showed that two of the major background components, external γ-rays from {sup 214}Bi and {sup 208}Tl decays, can be suppressed up to two orders of magnitude. This talk presents the current status of the GERDA Phase II upgrade.

  12. Testing the Gossamer Albatross II

    Science.gov (United States)

    1980-01-01

    The Gossamer Albatross II is seen here during a test flight at NASA's Dryden Flight Research Center, Edwards, California. The original Gossamer Albatross is best known for completing the first completely human powered flight across the English Channel on June 12, 1979. The Albatross II was the backup craft for the Channel flight. It was fitted with a small battery-powered electric motor and flight instruments for the NASA research program in low-speed flight. NASA completed its flight testing of the Gossamer Albatross II and began analysis of the results in April, 1980. During the six week program, 17 actual data gathering flights and 10 other flights were flown here as part of the joint NASA Langley/Dryden flight research program. The lightweight craft, carrying a miniaturized instrumentation system, was flown in three configurations; using human power, with a small electric motor, and towed with the propeller removed. Results from the program contributed to data on the unusual aerodynamic, performance, stability, and control characteristics of large, lightweight aircraft that fly at slow speeds for application to future high altitude aircraft. The Albatross' design and research data contributed to numerous later high altitude projects, including the Pathfinder.

  13. Light echoes - Type II supernovae

    International Nuclear Information System (INIS)

    Schaefer, B.E.

    1987-01-01

    Type II supernovae (SNs) light curves show a remarkable range of shapes. Data have been collected for the 12 Type II SNs that have light curve information for more than four months past maximum. Contrary to previous reports, it is found that (1) the decay rate after 100 days past maximum varies by almost an order of magnitude and (2) the light curve shapes are not bimodally distributed, but actually form a continuum. In addition, it is found that the extinctions to the SNs are related to the light curve shapes. This implies that the absorbing dust is local to the SNs. The dust is likely to be part of a circumstellar shell emitted by the SN progenitor that Dwek (1983) has used to explain infrared echoes. The optical depth of the shell can get quite large. In such cases, it is found that the photons scattered and delayed by reflection off dust grains will dominate the light curve several months after peak brightness. This light echo offers a straightforward explanation of the diversity of Type II SN light curves. 22 references

  14. Synthesis, spectral characterization thermal stability, antimicrobial studies and biodegradation of starch–thiourea based biodegradable polymeric ligand and its coordination complexes with [Mn(II), Co(II), Ni(II), Cu(II), and Zn(II)] metals

    OpenAIRE

    Nahid Nishat; Ashraf Malik

    2016-01-01

    A biodegradable polymer was synthesized by the modification reaction of polymeric starch with thiourea which is further modified by transition metals, Mn(II), Co(II), Ni(II), Cu(II) and Zn(II). All the polymeric compounds were characterized by (FT-IR) spectroscopy, 1H NMR spectroscopy, 13C NMR spectroscopy, UV–visible spectra, magnetic moment measurements, thermogravimetric analysis (TGA) and antibacterial activities. Polymer complexes of Mn(II), Co(II) and Ni(II) show octahedral geometry, wh...

  15. Levels of Cd (II, Mn (II, Pb (II, Cu (II, and Zn (II in Common Buzzard (Buteo buteo from Sicily (Italy by Derivative Stripping Potentiometry

    Directory of Open Access Journals (Sweden)

    P. Licata

    2010-01-01

    Full Text Available The purpose of this study was to determine the concentrations of heavy metals (Cd, Pb, Cu, Mn, and Zn in different organs (liver, kidney, muscle, lung, skin, and feathers of buzzards (Buteo buteo, utilized as a “biological indicator” for environmental contamination, from different areas of Sicily and to investigate the relationships between birds sex, age, and weight and metal levels in these samples. All samples of common buzzards were collected at the “Recovery Center of Wild Fauna” of Palermo, through the Zooprophilactic Institute. Potentiometric stripping analysis (PSA was used to determine the content of Cd(II, Cu(II, Mn(II, Pb(II, and Zn(II in bird tissues. For toxic metals, the highest levels of Pb were in liver and those of Cd in lung; Zn levels were higher than Cu and Mn in all tissues analyzed. The concentrations in liver, lung, kidney, and muscle could be considered as an indicative of chronic exposure to metals while the presence of metals in skin could be consequential to storing and elimination processes. The found concentrations of metals in the studied matrices required a highly sensitive method for their determination and a simple sample preparation procedure, and the proposed method was well suited for this purpose.

  16. Synthesis, spectral, thermal and antimicrobial studies on cobalt(II), nickel(II), copper(II), zinc(II) and palladium(II) complexes containing thiosemicarbazone ligand

    Science.gov (United States)

    El-Sawaf, Ayman K.; El-Essawy, Farag; Nassar, Amal A.; El-Samanody, El-Sayed A.

    2018-04-01

    The coordination characteristic of new N4-morpholinyl isatin-3-thiosemicarbazone (HL) towards Co(II), Ni(II), Cu(II), Zn(II) and Pd(II) has been studies. The structures of the complexes were described by elemental analyses, molar conductivity, magnetic, thermal and spectral (IR, UV-Vis, 1H and 13C NMR and ESR) studies. On the basis of analytical and spectral studies the ligand behaves as monobasic tridentate ONS donor forming two five membered rings towards cobalt, copper and palladium and afforded complexes of the kind [M(L)X], (Mdbnd Co, Cu or Pd; Xdbnd Cl, Br or OAc). Whereas the ligand bound to NiCl2 as neutral tridentate ONS donor and with ZnCl2 as neutral bidentate NS donor. The newly synthesized thiosemicarbazone ligand and some of its complexes were examined for antimicrobial activity against 2 gram negative bacterial strains (Escherichia coli Pseudomonas and aeruginosa), 2 gram positive bacterial strains (Streptococcus pneumoniae and Staphylococcus aureus)} and two Pathogenic fungi (Aspergillus fumigatus and Candida albicans). All metal complexes possess higher antimicrobial activity comparing with the free thiosemicarbazone ligand. The high potent activities of the complexes may arise from the coordination and chelation, which tends to make metal complexes act as more controlling and potent antimicrobial agents, thus hindering the growing of the microorganisms. The antimicrobial results also show that copper bromide complex is better antimicrobial agent as compared to the Schiff base and its metal complexes.

  17. Efficiency of Chitosan for the Removal of Pb (II, Fe (II and Cu (II Ions from Aqueous Solutions

    Directory of Open Access Journals (Sweden)

    Soheil Sobhanardakani

    2014-09-01

    Full Text Available Background: Heavy metals have been recognized as harmful environmental pollutant known to produce highly toxic effects on different organs and systems of both humans and animals. The aim of this paper is to evaluate the adsorption potential of chitosan for the removal of Pb(II, Fe(II and Cu(II ions from aqueous solutions. Methods: This study was conducted in laboratory scale. In this paper chitosan has been used as an adsorbent for the removal of Pb(II, Fe(II and Cu(II from aqueous solution. In batch tests, the effects of parameters like pH solution (1.0-8.0, initial metal concentrations (100-1000 mgL-1, contact time (5.0-150 min and adsorbent dose (1.0-7.0 g on the adsorption process were studied. Results: The results showed that the adsorption of Pb(II, Fe(II and Cu(II ions on chitosan strongly depends on pH. The experimental isothermal data were analyzed using the Langmuir and Freundlich equations and it was found that the removal process followed the Langmuir isotherm and maximum adsorption capacity for the adsorption of Pb(II, Fe(II and Cu(II ions by the chitosan were 55.5mg g−1, 71.4 mg g−1 and 59 mg g−1, respectively, under equilibrium conditions at 25±1 ºC. The adsorption process was found to be well described by the pseudo-second-order rate model. Conclusion: The obtained results showed that chitosan is a readily, available, economic adsorbent and was found suitable for removing Pb(II, Fe(II and Cu(II ions from aqueous solution.

  18. Sample Exchange Evaluation (SEE) Report - Phase II

    International Nuclear Information System (INIS)

    Winters, W.I.

    1994-01-01

    This report describes the results from Phase II of the Sample Exchange Evaluation (SEE) Program, a joint effort to compare analytical laboratory performance on samples from the Hanford Site's high-level waste tanks. In Phase II, the program has been expanded to include inorganic constituents in addition to radionuclides. Results from Phase II that exceeded 20% relative percent difference criteria are identified

  19. Competition from Cu(II), Zn(II) and Cd(II) in Pb(II) binding to Suwannee River Fulvic Acid

    NARCIS (Netherlands)

    Chakraborty, P.; Chakrabarti, C.L.

    2008-01-01

    This is a study of trace metal competition in the complexation of Pb(II) by well-characterized humic substances, namely Suwannee River Fulvic Acid (SRFA) in model solutions. It was found that Cu(II) seems to compete with Pb(II) for strong binding sites of SRFA when present at the same concentration

  20. Macrocyclic receptor showing extremely high Sr(II)/Ca(II) and Pb(II)/Ca(II) selectivities with potential application in chelation treatment of metal intoxication.

    Science.gov (United States)

    Ferreirós-Martínez, Raquel; Esteban-Gómez, David; Tóth, Éva; de Blas, Andrés; Platas-Iglesias, Carlos; Rodríguez-Blas, Teresa

    2011-04-18

    Herein we report a detailed investigation of the complexation properties of the macrocyclic decadentate receptor N,N'-Bis[(6-carboxy-2-pyridil)methyl]-4,13-diaza-18-crown-6 (H(2)bp18c6) toward different divalent metal ions [Zn(II), Cd(II), Pb(II), Sr(II), and Ca(II)] in aqueous solution. We have found that this ligand is especially suited for the complexation of large metal ions such as Sr(II) and Pb(II), which results in very high Pb(II)/Ca(II) and Pb(II)/Zn(II) selectivities (in fact, higher than those found for ligands widely used for the treatment of lead poisoning such as ethylenediaminetetraacetic acid (edta)), as well as in the highest Sr(II)/Ca(II) selectivity reported so far. These results have been rationalized on the basis of the structure of the complexes. X-ray crystal diffraction, (1)H and (13)C NMR spectroscopy, as well as theoretical calculations at the density functional theory (B3LYP) level have been performed. Our results indicate that for large metal ions such as Pb(II) and Sr(II) the most stable conformation is Δ(δλδ)(δλδ), while for Ca(II) our calculations predict the Δ(λδλ)(λδλ) form being the most stable one. The selectivity that bp18c6(2-) shows for Sr(II) over Ca(II) can be attributed to a better fit between the large Sr(II) ions and the relatively large crown fragment of the ligand. The X-ray crystal structure of the Pb(II) complex shows that the Δ(δλδ)(δλδ) conformation observed in solution is also maintained in the solid state. The Pb(II) ion is endocyclically coordinated, being directly bound to the 10 donor atoms of the ligand. The bond distances to the donor atoms of the pendant arms (2.55-2.60 Å) are substantially shorter than those between the metal ion and the donor atoms of the crown moiety (2.92-3.04 Å). This is a typical situation observed for the so-called hemidirected compounds, in which the Pb(II) lone pair is stereochemically active. The X-ray structures of the Zn(II) and Cd(II) complexes show that

  1. Eight joint BER II and BESSY II users meeting. Abstracts

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    2016-07-01

    The following topics were dealt with: Accelerator operation and projecs, photon science and instrumentation at BESSY II, status of energy materials in-situ Lab at BESSY II, high resolution spectrometer PEAXIS at BESSY II, sample environment at BESSY II, molecular control mechanisms in the Brr2 RNA helicase for efficient and regulated splicing, the Li conversion reaction of 4CoFe{sub 2}O{sub 4} nanoparticles, buried interfaces in lithium ion batteries probed with HAXPES, ARPES studies of the STO(001) 2DEG, all-in/all-out magnetic order in rare earth iridates, oxygen reduction reaction on graphene in Li-air batteries, electronic order in high-T{sub c} superconductors, in-siu observation of novel switching phenomena in highly porous metal-organic frameworks, photoinduced demagnetization and insulator-to-metal transition in ferromagnetic insulating BaFeO{sub 3} thin films, ARPES measurement of the ferroelectric bulk Rashba system GeTe, bisphenol A on Cu(111) and Ag(111), reverse water-gas shift or Sabathier methanation on N(110), structural studies of molecular machines, multi-MHz time-of-flight electronic band-structure imaging of graphene on Ir(111), diffusion pathways in ion conductors, ground-state potential energy surfaces around selected atoms from resonant inelastic X-ray scattering, solar energy in an emerging country, in-situ neutron analysis of electrode materials for electrochemical energy storage, structure and transport properties in thermoelectric skutterudites, investigation of the interphase formation on solid lithium-ion conductors by neutron reflectometry, load partitin and damage characterization of cast AlSi{sub 12}CuMgNi alloy with ceramic reinforcement, methane adsorption in highly porous metal-organics, structure and magnetic interactions in dimer system Ba{sub (3-x)}Sr{sub x}Cr{sub 2}O{sub 8}, distribution of S in C-S nanocomposites, current status of HFM-EXED FACITIY; SPIN NEAMTICITY IN s=1/2 frustrated zigzag chaIN β-TeVO{sub 4}, electronic

  2. Eight joint BER II and BESSY II users meeting. Abstracts

    International Nuclear Information System (INIS)

    2016-01-01

    The following topics were dealt with: Accelerator operation and projecs, photon science and instrumentation at BESSY II, status of energy materials in-situ Lab at BESSY II, high resolution spectrometer PEAXIS at BESSY II, sample environment at BESSY II, molecular control mechanisms in the Brr2 RNA helicase for efficient and regulated splicing, the Li conversion reaction of 4CoFe_2O_4 nanoparticles, buried interfaces in lithium ion batteries probed with HAXPES, ARPES studies of the STO(001) 2DEG, all-in/all-out magnetic order in rare earth iridates, oxygen reduction reaction on graphene in Li-air batteries, electronic order in high-T_c superconductors, in-siu observation of novel switching phenomena in highly porous metal-organic frameworks, photoinduced demagnetization and insulator-to-metal transition in ferromagnetic insulating BaFeO_3 thin films, ARPES measurement of the ferroelectric bulk Rashba system GeTe, bisphenol A on Cu(111) and Ag(111), reverse water-gas shift or Sabathier methanation on N(110), structural studies of molecular machines, multi-MHz time-of-flight electronic band-structure imaging of graphene on Ir(111), diffusion pathways in ion conductors, ground-state potential energy surfaces around selected atoms from resonant inelastic X-ray scattering, solar energy in an emerging country, in-situ neutron analysis of electrode materials for electrochemical energy storage, structure and transport properties in thermoelectric skutterudites, investigation of the interphase formation on solid lithium-ion conductors by neutron reflectometry, load partitin and damage characterization of cast AlSi_1_2CuMgNi alloy with ceramic reinforcement, methane adsorption in highly porous metal-organics, structure and magnetic interactions in dimer system Ba_(_3_-_x_)Sr_xCr_2O_8, distribution of S in C-S nanocomposites, current status of HFM-EXED FACITIY; SPIN NEAMTICITY IN s=1/2 frustrated zigzag chaIN β-TeVO_4, electronic properties of U(Ru_0_._9_2Rh_0_._0_8)_2Si_2 in

  3. Iodine capture by Hofmann-type clathrate Ni(II)(pz)[Ni(II)(CN)_4

    International Nuclear Information System (INIS)

    Massasso, Giovanni; Long, Jerome; Haines, Julien; Devautour-Vinot, Sabine; Maurin, Guillaume; Larionova, Joulia; Guerin, Christian; Guari, Yannick; Grandjean, Agnes; Onida, Barbara; Donnadieu, Bruno

    2014-01-01

    The thermally stable Hofmann-type clathrate framework Ni(II)(pz)[Ni(II)(CN)_4] (pz = pyrazine) was investigated for the efficient and reversible sorption of iodine (I_2) in the gaseous phase and in solution with a maximum adsorption capacity of 1 mol of I_2 per 1 mol of Ni(II)pz)[Ni(II)(CN)_4] in solution. (authors)

  4. Synthesis and Characterization of Multimetallic Fe(II) and Mn(II ...

    African Journals Online (AJOL)

    Iron(II) and Manganese(II) complexes of the resulting ligand were obtained from its reactions with Fe(II) and Mn(II) salts in absolute methanol for the metal to ligand ratio 2:3. These complexes were characterized by Solubility, Conductivity, IR and UV-VIS spectrometry, elemental analysis and mass spectrometry. Keywords: ...

  5. DNA damage by the cobalt (II) and zinc (II) complexes of ...

    African Journals Online (AJOL)

    STORAGESEVER

    2008-09-03

    Sep 3, 2008 ... distributed in grade 3. The results indicated that Co(II)-L induced a relatively high level of DNA damage in comparison with the level of damage induced by Zn(II)-L. Key words: Tetraazamacrocycle Zn(II) complex, tetraazamacrocycle Co(II) complex, Tetrahymena thermophila, DNA damage, the comet assay.

  6. Syntheses and spectroscopic properties of mercury(II) and nickel(II ...

    African Journals Online (AJOL)

    Mercury(II) complex, [Hg2(BPTU-2H)Cl2] and nickel(II) complex, [Ni(BPTU-H)2] were prepared by reacting Bis(N-phenylthiourea), BPTU, with mercury(II) chloride and nickel(II) acetate respectively. The complexes were characterized by IR, diffuse reflectance, 1H NMR spectra and elemental analysis. BPTU acts as ...

  7. Usus aquarum – Wasser und Wasserbauten im Leben der frühmittelalterlichen Gesellschaften Mitteleuropas (Bericht)

    Czech Academy of Sciences Publication Activity Database

    Poláček, Lumír

    2014-01-01

    Roč. 55, č. 2 (2014), s. 7-10 ISSN 1211-7250 R&D Projects: GA ČR(CZ) GAP405/11/2258 Keywords : Usus aquarum * water * water structures * Early Middle Ages * Central Europe * Mikulčice * river archaeology Subject RIV: AC - Archeology, Anthropology, Ethnology

  8. Second report of the national platform electromobility; Zweiter Bericht der Nationalen Plattform Elektromobilitaet

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    2011-05-15

    In the National Platform Electromobility, representatives from industry, science, politics, unions and societies in Germany agreed on a systematic, market-oriented and technology-open approach to become the main supplier and main market for electromobility up to the year 2020. A central component of the targeted German mean market for electromobility is an intelligent energy system: integration of electricity from renewable energy sources, demand-oriented development of a public charging infrastructure, development of an innovative charging structure. The common goal of the National Electromobility Platform is to build a self-supporting market for electric vehicles. The National Electromobility Platform will support the implementation of these intentions and measures. The underlying assumptions are reviewed annually. Derived recommendations are adapted, if necessary. Thus the National Electromobility Platform develops an annual progress report. With the end of the market scheduling phase by 2014, especially the market acceleration, demand for public infrastructure, costs and funding approaches for market acceleration as well as research and development will be re-evaluated.

  9. Second report of the national platform electromobility. Appendix; Zweiter Bericht der Nationalen Plattform Elektromobilitaet. Anhang

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    2011-05-15

    In the National Platform Electromobility, representatives from industry, science, politics, unions and societies in Germany agreed on a systematic, market-oriented and technology-open approach to become the main supplier and main market for electromobility up to the year 2020. Within the appendix of the second report to the National Platform Electromobility the following aspects are considered: (1) Content and criteria for the identification and evaluation of the emphases of flagship projects; (2) Flagship projects of the national conference on education; (3) Review on standardization activities; (4) A consistent design of public charging infrastructure; (5) Saving the distribution and financing of the public charging infrastructure; (6) Costs and payment reserves vehicle; (7) Criteria of tenders and awarding showcase projects; (8) Innovation promotion in Germany for renewable electromobility (I.D.E.E.) - standpoint of the WWF, climate alliance of the local authorities and the federal association renewable energies.

  10. Saarbergwerke AG. Report on the business year 1995; Saarbergwerke AG. Bericht ueber das Geschaeftsjahr 1995

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1997-12-31

    The business report 1995 contains informations about the position of the energy economics, the position of the Saarberg trust and the yearly balance. The activities of the Saarberg trust are reported. (RHM) [Deutsch] Der Geschaeftsbericht 1995 enthaelt Ausfuehrungen ueber die Lage der Energiewirtschaft, die Lage des Saarberg-Konzerns und den Jahresabschluss. Die Aktivitaeten des Saarberg-Konzerns werden dargestellt. (RHM)

  11. UVP-simulation game. Report and evaluation results. UVP-Planspiel. Bericht und Auswertungsergebnisse

    Energy Technology Data Exchange (ETDEWEB)

    Boehret, C.; Hofmann, M.; Froehlich, G.; Landfried, C.; Michler, H.P.

    1990-11-01

    After transfering the EC-directive of June 1985 under the UVPG (Umweltvertraeglichkeitspruefungsgesetz - Law on the Assessment of the Effects of certain public and private Projects on the Environment) of February 1990 into national law, it was necessary to develop administrative regulations and to adapt the 9. BImSchV (Bundesimmissionsschutzverordnung - Federal Regulation of Immission Protection). The drafts of these regulations have been tested with the method of a practice related simulation gaming by means of three cases taken from real life in which the team-players were the addressees of the regulations. The direct and indirect findings from the game can be summed up as follows: The drafts of the UVP-regulations have been judged in an ambiguous way; part of the UVP-regulations have been criticized more than those of the 9. BImSchV. Corrections are clearly required, but the regulations on the whole cannot be called 'unworkable'; this especially not, if the experiences of the simulation gaming are used for further development of the regulations. The report contains proposals for modifications. (orig.) With 16 refs., 63 tabs., 20 figs.

  12. Deutsches Wortgut in rumänischen Pflanzennamen. Ein Bericht aus ...

    African Journals Online (AJOL)

    vorgehoben wird (da der einzelne Sprecher Schöpfer der Sprache/Poesie wurde, wann immer er eine Blume nannte). Unserer Meinung nach ist ein botanisches Lexikon einer bestimmten Region, einmal bekannt, nicht nur ein Thesaurus, aber auch ...

  13. Baden-Wuerttemberg. Energy report `94; Baden-Wuerttemberg. Energie-Bericht `94

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1995-11-01

    The energy report reviews the energy policy of the Land Baden-Wuerttemberg in the light of the national and international situation in the year under report. Tables and diagrams present data and information on the worldwide energy consumption, the energy consumption in the European Union and in the Federal Republic of Germany as well as on the energy supplies of the Land Baden-Wuerttemberg; Energy consumption; primary energy consumption; end-use energy consumption; rational use of energy; mineral oil; coal; electricity; natural gas; district heating; renewable energy sources; energy supply structures; the energy balance of Baden-Wuerttemberg for the past year; and more. (orig./HS) [Deutsch] Der Energiebericht gibt einen Ueberblick ueber die Energiepolitik Baden-Wuerttembergs im nationalen und internationalen Rahmen fuer das Berichtsjahr. Tabellen und Graphiken informieren ueber die wichtigsten Daten zum Energieverbrauch weltweit, in der Europaeischen Union und in der Bundesrepublik Deutschland sowie zur Energieversorgung des Landes Baden-Wuerttemberg: Energieverbrauch; Primaerenergieverbrauch; Endenergieverbrauch; rationelle Nutzung von Energie; Mineraloel; Kohle; Strom; Erdgas; Fernwaerme; erneuerbare Energien; Versorgungsstrukturen; energiebedingte Emissionen; Energiebilanz Baden-Wuerttemberg fuer das Vorjahr; und mehr. (orig./HS)

  14. Nuclear power for the next generation. Proceedings. Kernenergie fuer die naechste Generation. Berichte

    Energy Technology Data Exchange (ETDEWEB)

    1986-01-01

    The Chernobyl reactor accident was just the last but not the only occasion that threw out the question of whether nuclear power generation has reached its peak, or probably already is on the decline, or whether there will be new chances for nuclear energy on the power market. The answer to these questions depends on a variety of factors, among which the development of demand for energy, and especially electrical energy, certainly is the decisive factor. The summarizing statements published in the proceedings in hand have been written in January 1986, i.e. before the Chernobyl reactor accident; but they still are relevant, as the long-term problems of energy policy persist, and nuclear energy has to tackle the same problems as before.

  15. Electricity demand and energy consumption in horticulture and conclusions bearing on energy economy. AEL-Bericht

    Energy Technology Data Exchange (ETDEWEB)

    1980-01-01

    The studies demonstrate that horticultural entreprises, esp. those with a higher electricity consumption, have often not settled for a more favourable electricity tariff. Nor do they use cheaper electricity at slack periods (night current) to the extent possible. Substantial improvement could be obtained above all by fully utilizing the installed capacity through purposeful utilization of machinery and interlocking of major consumers. Measures appropriate to this end are listed allowing a possible economic utilization of electric energy.

  16. Baden-Wuerttemberg. Energy report 97; Baden-Wuerttemberg. Energie-Bericht 97

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1998-03-01

    The energy report reviews the energy policy of the Land Baden-Wuerttemberg in the light of the national and international situation in the year under report. Tables and diagrams present data and information on the worldwide energy consumption, the energy consumption in the European Union and in the Federal Republic of Germany as well as on the energy supplies of the Land Baden-Wuerttemberg: energy consumption; primary energy consumption; end-use energy consumption; rational use of energy; mineral oil; coal; electricity; natural gas; district heating; renewable energy sources; energy supply structures; the energy balance of Baden-Wuerttemberg for the past year; and more. (orig.) [Deutsch] Der Energiebericht gibt einen Ueberblick ueber die Energiepolitik Baden-Wuerttembergs im nationalen und internationalen Rahmen fuer das Berichtsjahr. Tabellen und Graphiken informieren ueber die wichtigsten Daten zum Energieverbrauch weltweit, in der Europaeischen Union und in der Bundesrepublik Deutschland sowie zur Energieversorgung des Landes Baden-Wuerttemberg: Energieverbrauch; Primaerenergieverbrauch; Endenergieverbrauch; rationelle Nutzung von Energie; Mineraloel; Kohle; Strom; Erdgas; Fernwaerme; Erneuerbare Energien; Versorgungsstrukturen; Energiebedingte Emissionen; Energiebilanz Baden-Wuerttemberg fuer das Vorjahr; und mehr. (orig.)

  17. Practice Report / Bericht aus der Praxis : Peer teaching: From method to philosophy

    NARCIS (Netherlands)

    ten Cate, Olle

    2017-01-01

    Peer teaching or peer-assisted learning is a popular topic in the medical education literature. While not one method of education, a categorization is possible according to (a) the developmental distance between learner and peer teacher, (b) the scale or group size of learners in peer teaching

  18. Practice Report / Bericht aus der Praxis: Peer teaching: From method to philosophy.

    Science.gov (United States)

    Ten Cate, Olle

    2017-11-01

    Peer teaching or peer-assisted learning is a popular topic in the medical education literature. While not one method of education, a categorization is possible according to (a) the developmental distance between learner and peer teacher, (b) the scale or group size of learners in peer teaching arrangements and (c) the extent of formality or structure of the arrangement. That yields many different forms of peer teaching. Viewing peer teaching as a multifaceted method shows several benefits. On a deeper level however peer teaching may be viewed as a philosophy of medical education that has historical roots but aligns well with current thinking of teaching and learning across the continuum of medical education. Copyright © 2017. Published by Elsevier GmbH.

  19. BES-II fast data reconstruction

    International Nuclear Information System (INIS)

    Rong Gang; Zhang Jiawen; Guo Yiqing; Zhang Shaoqiang; Zhao Dixin

    2002-01-01

    The BES-II fast data reconstruction is reported. Based on PC FARM and/or a 'Distributed Clustered Linux PC System', BES-II fast data reconstruction system is set up. With this system the BES-II data can be fully reconstructed in about 20 minutes after data collection. It takes only 12 minutes to fully reconstruct 30000 events, collected with BES-II detector at BEPC Collider, with a P III-800 PC. The detector performance can be examined based on fully reconstructed data in about 20 minutes after data taking in the BES-II experiment

  20. Simultaneous Determination of Cobalt (II and Nickel (II By First Order Derivative Spectrophotometry in Micellar Media

    Directory of Open Access Journals (Sweden)

    Rajni Rohilla

    2012-01-01

    Full Text Available A first-derivative spectrophotometry method for the simultaneous determination of Co (II and Ni (II with Alizarin Red S in presence of Triton X-100 is described. Measurements were made at the zero-crossing wavelengths at 549.0 nm for Co (II and 546.0 nm for Ni (II. The linearity is obtained in the range of 0.291- 4.676 μg/ml of Ni (II and 0.293- 4.124 μg/ml of Co (II in the presence of each other by using first derivative spectrophotometric method. The possible interfering effects of various ions were studied. The validity of the method was examined by using synthetic mixtures of Co (II and Ni (II. The developed derivative procedure, using the zero crossing technique, has been successfully applied for the simultaneous analysis of Co (II and Ni (II in spiked water samples.

  1. DNA damage by the cobalt (II) and zinc (II) complexes of ...

    African Journals Online (AJOL)

    Using the single cell gel electrophoresis method, the tetraazamacrocycle Zn(II) complex (Zn(II)-L) and the tetraazamacrocycle Co(II) complex (Co(II)-L) were investigated focusing on their DNA damage to Tetrahymena thermophila. When the cells were treated with the 0.05, 0.25 and 0.50 mg/ml Zn(II)-L, the tail length ...

  2. (Diethylenetriaminebis(theophyllinatozinc(II dihydrate

    Directory of Open Access Journals (Sweden)

    Attila-Zsolt Kun

    2009-05-01

    Full Text Available In the title compound, [Zn(C7H7N4O22(C4H13N3]·2H2O, the ZnII ion is pentacoordinated by three N atoms of the diethylenetriamine ligand and one N atom of each of the two theophyllinate anions in a distorted trigonal-bipyramidal geometry. The Zn—N distances range from 2.076 (3 to 2.221 (3 Å. The crystal packing is stabilized by O—H...O, O—H...N and N—H...O hydrogen bonds involving the theophylline and diethylenetriamine ligands and uncoordinated water molecules.

  3. Actions against Asse II dismissed

    International Nuclear Information System (INIS)

    Anon.

    1980-01-01

    In the legal dispute over the storage of radioactive waste in the former Asse II salt mine near Wolfenbuettel, the Higher Administrative Court for Lower Saxony and Schleswig-Holstein in a decision dated January 17, 1980, dismissed as inadmissible the appeals brought by plaintiffs from the Federal Republic of Germany, Denmark and Austria against the decision by the Braunschweig Administrative Court, in which that action had been dismissed. Also more recent applications were declared to be inadmissible on the grounds that the Lower Saxony State Ministry of Social Affairs was not the proper defendant. No appeal was permitted. The written decision by the Court has not yet been published. (HSCH) [de

  4. Commissioning of NSLS-II

    Energy Technology Data Exchange (ETDEWEB)

    Willeke, F.

    2015-05-03

    NSLS-II, the new 3rd generation light source at BNL was designed for a brightness of 1022 photons s-1mm-2mrad-2 (0.1%BW)-1. It was constructed between 2009 and 2014. The storage ring was commissioned in April 2014 which was followed by insertion device and beamline commissioning in the fall of 2014. All ambitious design parameters of the facility have already been achieved except for commissioning the full beam intensity of 500mA which requires more RF installation. This paper reports on the results of commissioning.

  5. Reference design for LAMPF II

    International Nuclear Information System (INIS)

    Thiessen, H.A.

    1983-01-01

    A reference design for the 32-GeV LAMPF II proton accelerator is proposed. This design consists of a 30-Hz rapid-cycling synchrotron with a dc stretcher. A superiodicity 5 design with dispersion-free straight sections is suggested for both machines. Beam-dynamics calculations are partially complete and rf requirements are given. Apertures are calculated for 2 x 10 13 protons per pulse (100 μA average current). No significant problems are observed at any time in the cycle in a longitudinal beam-dynamics simulation including space charge

  6. Pep for PEP-II

    International Nuclear Information System (INIS)

    Anon.

    1995-01-01

    The major B-factory project at the Stanford Linear Accelerator Center have(SLAC) is well underway and moving along smartly, en route to commencement of operations in September 1998. Called PEP-II, the new facility is a joint venture of three California laboratories: Lawrence Berkeley Laboratory (LBL), Lawrence Livermore Laboratory (LLNL) and SLAC. Housed at SLAC in the tunnels and buildings built for the original PEP electron-positron collider in the late 1970s, it involves no conventional civil engineering. In fact, PEP-II is a recycling project in more ways than one: for example, most of the original PEP magnets have been renovated for reuse in the PEP-II high-energy ring. While some of them require substantial rework (to change their length, for instance), many of them merely require repainting and remeasuring. The work of building the hardware is divided up among the three laboratories. LBL is primarily responsible for the low-energy ring; LLNL is building most of the interaction region, the complicated part where the high and low energy rings come together; and SLAC is responsible for the rest. Proposed by President Clinton as a ''presidential initiative'' (December 1993, page 2), the project was given a four-year funding profile. The total cost of $177 million, excluding the BaBar detector (September, page 16), was planned by the US government to be entirely provided during the present administration, the last increment coming in the final quarter of 1997. Happily, the first two increments have been forthcoming as planned and the third is faring well in US Congress. The PEP-II design is based on two intersecting storage rings, one carrying 9 GeV electrons and the other 3.1 GeV positrons, operating with high beam currents (a few amperes) to produce a luminosity of 3 x 10 33 per sq cm per s. The asymmetry in the energies of the colliding particles means that the centre-ofmass of the electron-positron annihilation system moves rapidly in the

  7. PEP-II status report

    International Nuclear Information System (INIS)

    Dorfan, J.M.

    1998-06-01

    The main design features of the PEP-II asymmetric two-ring electron-positron B Factory collider, built at the Stanford Linear Accelerator Center, are described. This facility will complete construction in June 1998. The high energy ring, completed in May 1997, has had 3 months of commissioning and successfully stored 0.75 A of electrons. The success of the high energy ring testing validates not only its ring components, but also the injection system, the RF system and the control system all of which are common to the two rings

  8. Belle II Technical Design Report

    CERN Document Server

    Abe, T; Adamczyk, K; Ahn, S; Aihara, H; Akai, K; Aloi, M; Andricek, L; Aoki, K; Arai, Y; Arefiev, A; Arinstein, K; Arita, Y; Asner, D M; Aulchenko, V; Aushev, T; Aziz, T; Bakich, A M; Balagura, V; Ban, Y; Barberio, E; Barvich, T; Belous, K; Bergauer, T; Bhardwaj, V; Bhuyan, B; Blyth, S; Bondar, A; Bonvicini, G; Bozek, A; Bracko, M; Brodzicka, J; Brovchenko, O; Browder, T E; Cao, G; Chang, M -C; Chang, P; Chao, Y; Chekelian, V; Chen, A; Chen, K -F; Chen, P; Cheon, B G; Chiang, C -C; Chistov, R; Cho, K; Choi, S -K; Chung, K; Comerma, A; Cooney, M; Cowley, D E; Critchlow, T; Dalseno, J; Danilov, M; Dieguez, A; Dierlamm, A; Dillon, M; Dingfelder, J; Dolenec, R; Dolezal, Z; Drasal, Z; Drutskoy, A; Dungel, W; Dutta, D; Eidelman, S; Enomoto, A; Epifanov, D; Esen, S; Fast, J E; Feindt, M; Garcia, M Fernandez; Fifield, T; Fischer, P; Flanagan, J; Fourletov, S; Fourletova, J; Freixas, L; Frey, A; Friedl, M; Fruehwirth, R; Fujii, H; Fujikawa, M; Fukuma, Y; Funakoshi, Y; Furukawa, K; Fuster, J; Gabyshev, N; Cueto, A Gaspar de Valenzuela; Garmash, A; Garrido, L; Geisler, Ch; Gfall, I; Goh, Y M; Golob, B; Gorton, I; Grzymkowski, R; Guo, H; Ha, H; Haba, J; Hara, K; Hara, T; Haruyama, T; Hayasaka, K; Hayashi, K; Hayashii, H; Heck, M; Heindl, S; Heller, C; Hemperek, T; Higuchi, T; Horii, Y; Hou, W -S; Hsiung, Y B; Huang, C -H; Hwang, S; Hyun, H J; Igarashi, Y; Iglesias, C; Iida, Y; Iijima, T; Imamura, M; Inami, K; Irmler, C; Ishizuka, M; Itagaki, K; Itoh, R; Iwabuchi, M; Iwai, G; Iwai, M; Iwasaki, M; Iwasaki, M; Iwasaki, Y; Iwashita, T; Iwata, S; Jang, H; Ji, X; Jinno, T; Jones, M; Julius, T; Kageyama, T; Kah, D H; Kakuno, H; Kamitani, T; Kanazawa, K; Kapusta, P; Kataoka, S U; Katayama, N; Kawai, M; Kawai, Y; Kawasaki, T; Kennedy, J; Kichimi, H; Kikuchi, M; Kiesling, C; Kim, B K; Kim, G N; Kim, H J; Kim, H O; Kim, J -B; Kim, J H; Kim, M J; Kim, S K; Kim, K T; Kim, T Y; Kinoshita, K; Kishi, K; Kisielewski, B; van Dam, K Kleese; Knopf, J; Ko, B R; Koch, M; Kodys, P; Koffmane, C; Koga, Y; Kohriki, T; Koike, S; Koiso, H; Kondo, Y; Korpar, S; Kouzes, R T; Kreidl, Ch; Kreps, M; Krizan, P; Krokovny, P; Krueger, H; Kruth, A; Kuhn, W; Kuhr, T; Kumar, R; Kumita, T; Kupper, S; Kuzmin, A; Kvasnicka, P; Kwon, Y -J; Lacasta, C; Lange, J S; Lee, I -S; Lee, M J; Lee, M W; Lee, S -H; Lemarenko, M; Li, J; Li, W D; Li, Y; Libby, J; Limosani, A; Liu, C; Liu, H; Liu, Y; Liu, Z; Liventsev, D; Virto, A Lopez; Makida, Y; Mao, Z P; Marinas, C; Masuzawa, M; Matvienko, D; Mitaroff, W; Miyabayashi, K; Miyata, H; Miyazaki, Y; Miyoshi, T; Mizuk, R; Mohanty, G B; Mohapatra, D; Moll, A; Mori, T; Morita, A; Morita, Y; Moser, H -G; Martin, D Moya; Mueller, T; Muenchow, D; Murakami, J; Myung, S S; Nagamine, T; Nakamura, I; Nakamura, T T; Nakano, E; Nakano, H; Nakao, M; Nakazawa, H; Nam, S -H; Natkaniec, Z; Nedelkovska, E; Negishi, K; Neubauer, S; Ng, C; Ninkovic, J; Nishida, S; Nishimura, K; Novikov, E; Nozaki, T; Ogawa, S; Ohmi, K; Ohnishi, Y; Ohshima, T; Ohuchi, N; Oide, K; Olsen, S L; Ono, M; Ono, Y; Onuki, Y; Ostrowicz, W; Ozaki, H; Pakhlov, P; Pakhlova, G; Palka, H; Park, H; Park, H K; Peak, L S; Peng, T; Peric, I; Pernicka, M; Pestotnik, R; Petric, M; Piilonen, L E; Poluektov, A; Prim, M; Prothmann, K; Regimbal, K; Reisert, B; Richter, R H; Riera-Babures, J; Ritter, A; Ritter, A; Ritter, M; Roehrken, M; Rorie, J; Rosen, M; Rozanska, M; Ruckman, L; Rummel, S; Rusinov, V; Russell, R M; Ryu, S; Sahoo, H; Sakai, K; Sakai, Y; Santelj, L; Sasaki, T; Sato, N; Sato, Y; Scheirich, J; Schieck, J; Schwanda, C; Schwartz, A J; Schwenker, B; Seljak, A; Senyo, K; Seon, O -S; Sevior, M E; Shapkin, M; Shebalin, V; Shen, C P; Shibuya, H; Shiizuka, S; Shiu, J -G; Shwartz, B; Simon, F; Simonis, H J; Singh, J B; Sinha, R; Sitarz, M; Smerkol, P; Sokolov, A; Solovieva, E; Stanic, S; Staric, M; Stypula, J; Suetsugu, Y; Sugihara, S; Sugimura, T; Sumisawa, K; Sumiyoshi, T; Suzuki, K; Suzuki, S Y; Takagaki, H; Takasaki, F; Takeichi, H; Takubo, Y; Tanaka, M; Tanaka, S; Taniguchi, N; Tarkovsky, E; Tatishvili, G; Tawada, M; Taylor, G N; Teramoto, Y; Tikhomirov, I; Trabelsi, K; Tsuboyama, T; Tsunada, K; Tu, Y -C; Uchida, T; Uehara, S; Ueno, K; Uglov, T; Unno, Y; Uno, S; Urquijo, P; Ushiroda, Y; Usov, Y; Vahsen, S; Valentan, M; Vanhoefer, P; Varner, G; Varvell, K E; Vazquez, P; Vila, I; Vilella, E; Vinokurova, A; Visniakov, J; Vos, M; Wang, C H; Wang, J; Wang, M -Z; Wang, P; Wassatch, A; Watanabe, M; Watase, Y; Weiler, T; Wermes, N; Wescott, R E; White, E; Wicht, J; Widhalm, L; Williams, K M; Won, E; Xu, H; Yabsley, B D; Yamamoto, H; Yamaoka, H; Yamaoka, Y; Yamauchi, M; Yin, Y; Yoon, H; Yu, J; Yuan, C Z; Yusa, Y; Zander, D; Zdybal, M; Zhang, Z P; Zhao, J; Zhao, L; Zhao, Z; Zhilich, V; Zhou, P; Zhulanov, V; Zivko, T; Zupanc, A; Zyukova, O

    2010-01-01

    The Belle detector at the KEKB electron-positron collider has collected almost 1 billion Y(4S) events in its decade of operation. Super-KEKB, an upgrade of KEKB is under construction, to increase the luminosity by two orders of magnitude during a three-year shutdown, with an ultimate goal of 8E35 /cm^2 /s luminosity. To exploit the increased luminosity, an upgrade of the Belle detector has been proposed. A new international collaboration Belle-II, is being formed. The Technical Design Report presents physics motivation, basic methods of the accelerator upgrade, as well as key improvements of the detector.

  9. Solid Phase Extraction of Trace Al(III), Fe(II), Co(II), Cu(II), Cd(II) and Pb(II) Ions in Beverages on Functionalized Polymer Microspheres Prior to Flame Atomic Absorption Spectrometric Determinations.

    Science.gov (United States)

    Berber, Hale; Alpdogan, Güzin

    2017-01-01

    In this study, poly(glycidyl methacrylate-methyl methacrylate-divinylbenzene) was synthesized in the form of microspheres, and then functionalized by 2-aminobenzothiazole ligand. The sorption properties of these functionalized microspheres were investigated for separation, preconcentration and determination of Al(III), Fe(II), Co(II), Cu(II), Cd(II) and Pb(II) ions using flame atomic absorption spectrometry. The optimum pH values for quantitative sorption were 2 - 4, 5 - 8, 6 - 8, 4 - 6, 2 - 6 and 2 - 3 for Al(III), Fe(II), Co(II), Cu(II), Cd(II) and Pb(II), respectively, and also the highest sorption capacity of the functionalized microspheres was found to be for Cu(II) with the value of 1.87 mmol g -1 . The detection limits (3σ; N = 6) obtained for the studied metals in the optimal conditions were observed in the range of 0.26 - 2.20 μg L -1 . The proposed method was successfully applied to different beverage samples for the determination of Al(III), Fe(II), Co(II), Cu(II), Cd(II) and Pb(II) ions, with the relative standard deviation of <3.7%.

  10. Diet History Questionnaire II FAQs | EGRP/DCCPS/NCI/NIH

    Science.gov (United States)

    Answers to general questions about the Diet History Questionnaire II (DHQ II), as well as those related to DHQ II administration, validation, scanning, nutrient estimates, calculations, DHQ II modification, data quality, and more.

  11. potentiometric studies of the complexes formed by copper (ii)

    African Journals Online (AJOL)

    MBI

    The overall stability constants of copper (II) and zinc (II) ions with some polar ... The average number of coordinated amino acids to the copper (II) and zinc (II) ions .... of chelated rings (Yamuchi and Odani, 1996). ... Synthesis and techniques in.

  12. ERB-II operating experience

    International Nuclear Information System (INIS)

    Smith, R.N.; Cissel, D.W.; Smith, R.R.

    1977-01-01

    As originally designed and operated, EBR-II successfully demonstrated the concept of a sodium-cooled fast breeder power plant with a closed fuel reprocessing cycle (mini-nuclear park). Subsequent operation has been as an irradiation facility, a role which will continue into the foreseeable future. Since the beginning of operation in 1961, operating experience of EBR-II has been very satisfactory. Most of the components and systems have performed well. In particular, the mechanical performance of heat-removal systems has been excellent. A review of the operating experience reveals that all the original design objectives have been successfully demonstrated. To date, no failures or incidents resulting in serious in-core or out-of-core consequences have occurred. No water-to-sodium leaks have been detected over the life of the plant. At the present time, the facility is operating very well and continuously except for short shutdowns required by maintenance, refueling, modification, and minor repair. A plant factor of 76.9% was achieved for the calendar year 1976

  13. THE SPECTRUM OF Fe II

    Energy Technology Data Exchange (ETDEWEB)

    Nave, Gillian [National Institute of Standards and Technology, Gaithersburg, MD 20899-8422 (United States); Johansson, Sveneric, E-mail: gillian.nave@nist.gov [Lund Observatory, University of Lund, Box 43, SE-22100 Lund (Sweden)

    2013-01-15

    The spectrum of singly ionized iron (Fe II) has been recorded using high-resolution Fourier transform (FT) and grating spectroscopy over the wavelength range 900 A to 5.5 {mu}m. The spectra were observed in high-current continuous and pulsed hollow cathode discharges using FT spectrometers at the Kitt Peak National Observatory, Tucson, AZ and Imperial College, London and with the 10.7 m Normal Incidence Spectrograph at the National Institute of Standards and Technology. Roughly 12,900 lines were classified using 1027 energy levels of Fe II that were optimized to measured wavenumbers. The wavenumber uncertainties of lines in the FT spectra range from 10{sup -4} cm{sup -1} for strong lines around 4 {mu}m to 0.05 cm{sup -1} for weaker lines around 1500 A. The wavelength uncertainty of lines in the grating spectra is 0.005 A. The ionization energy of (130,655.4 {+-} 0.4) cm{sup -1} was estimated from the 3d{sup 6}({sup 5}D)5g and 3d{sup 6}({sup 5}D)6h levels.

  14. BNL ATF II beamlines design

    Energy Technology Data Exchange (ETDEWEB)

    Fedurin, M. [Brookhaven National Lab. (BNL), Upton, NY (United States); Jing, Y. [Brookhaven National Lab. (BNL), Upton, NY (United States); Stratakis, D. [Brookhaven National Lab. (BNL), Upton, NY (United States); Swinson, C. [Brookhaven National Lab. (BNL), Upton, NY (United States)

    2015-05-03

    The Brookhaven National Laboratory. Accelerator Test Facility (BNL ATF) is currently undergoing a major upgrade (ATF-II). Together with a new location and much improved facilities, the ATF will see an upgrade in its major capabilities: electron beam energy and quality and CO2 laser power. The electron beam energy will be increased in stages, first to 100-150 MeV followed by a further increase to 500 MeV. Combined with the planned increase in CO2 laser power (from 1-100 TW), the ATF-II will be a powerful tool for Advanced Accelerator research. A high-brightness electron beam, produced by a photocathode gun, will be accelerated and optionally delivered to multiple beamlines. Besides the energy range (up to a possible 500 MeV in the final stage) the electron beam can be tailored to each experiment with options such as: small transverse beam size (<10 um), short bunch length (<100 fsec) and, combined short and small bunch options. This report gives a detailed overview of the ATFII capabilities and beamlines configuration.

  15. District heating concept Hirtenwiesen II; Nahwaermekonzept Hirtenwiesen II

    Energy Technology Data Exchange (ETDEWEB)

    Wagner, Josef [Stadtwerke Crailsheim GmbH, Crailsheim (Germany)

    2009-07-01

    Hirtenwiesen II is a new urban development project on an abandoned industrial site west of Crailsheim, Germany. It will house a population of about 2,000 and provide a comprehensive infrastructure including kindergarten, schools, sports centers and shopping centers. Modern amenities will be combined with environment-friendly energy concepts based on solar energy. A school building - Lise-Meitner-Gymnasium - and a sports hall - Hirtenwiesenhalle - will be supplied with solar power as well. Solar energy will provide more than 50 % of the energy required, which is more than average. Also, the solar power plant will have a collector surface of 10,000 m{sup 3} and a capacity of 7 MW{sub th}, which will make it Germany's biggest individual thermal solar power plant. (orig./AKB)

  16. Quiet High Speed Fan II (QHSF II): Final Report

    Science.gov (United States)

    Kontos, Karen; Weir, Don; Ross, Dave

    2012-01-01

    This report details the aerodynamic, mechanical, structural design and fabrication of a Honey Engines Quiet High Speed Fan II (lower hub/tip ratio and higher specific flow than the Baseline I fan). This fan/nacelle system incorporates features such as advanced forward sweep and an advanced integrated fan/fan exit guide vane design that provides for the following characteristics: (1) Reduced noise at supersonic tip speeds, in comparison to current state-of-the-art fan technology; (2) Improved aeroelastic stability within the anticipated operating envelope; and (3) Aerodynamic performance consistent with current state-of-the-art fan technology. This fan was fabricated by Honeywell and tested in the NASA Glenn 9- by 15-Ft Low Speed Wind Tunnel for aerodynamic, aeromechanical, and acoustic performance.

  17. Synthesis, characterization and polymerization of methacrylates of copper (II), cobalt (II) and molybdenum (II). Generation of new materials

    International Nuclear Information System (INIS)

    Rojas Bolanos, Omar

    2006-01-01

    Coordination compounds of the species copper (II), cobalt (II) and molybdenum (II) with methacrylic acid were synthesized and characterized. Besides, it realized reactions of bromine addition to the doubles links of the species obtained previously, also too like reactions with dry HCl. Finally, it got hybrids materials by polymerization of the first compounds in an acrylic matrix. Research concluded with the characterization of all the products. (author) [es

  18. Shark class II invariant chain reveals ancient conserved relationships with cathepsins and MHC class II.

    Science.gov (United States)

    Criscitiello, Michael F; Ohta, Yuko; Graham, Matthew D; Eubanks, Jeannine O; Chen, Patricia L; Flajnik, Martin F

    2012-03-01

    The invariant chain (Ii) is the critical third chain required for the MHC class II heterodimer to be properly guided through the cell, loaded with peptide, and expressed on the surface of antigen presenting cells. Here, we report the isolation of the nurse shark Ii gene, and the comparative analysis of Ii splice variants, expression, genomic organization, predicted structure, and function throughout vertebrate evolution. Alternative splicing to yield Ii with and without the putative protease-protective, thyroglobulin-like domain is as ancient as the MHC-based adaptive immune system, as our analyses in shark and lizard further show conservation of this mechanism in all vertebrate classes except bony fish. Remarkable coordinate expression of Ii and class II was found in shark tissues. Conserved Ii residues and cathepsin L orthologs suggest their long co-evolution in the antigen presentation pathway, and genomic analyses suggest 450 million years of conserved Ii exon/intron structure. Other than an extended linker preceding the thyroglobulin-like domain in cartilaginous fish, the Ii gene and protein are predicted to have largely similar physiology from shark to man. Duplicated Ii genes found only in teleosts appear to have become sub-functionalized, as one form is predicted to play the same role as that mediated by Ii mRNA alternative splicing in all other vertebrate classes. No Ii homologs or potential ancestors of any of the functional Ii domains were found in the jawless fish or lower chordates. Copyright © 2011 Elsevier Ltd. All rights reserved.

  19. Chelation of Cu(II, Zn(II, and Fe(II by Tannin Constituents of Selected Edible Nuts

    Directory of Open Access Journals (Sweden)

    Magdalena Karamać

    2009-12-01

    Full Text Available The tannin fractions isolated from hazelnuts, walnuts and almonds were characterised by colorimetric assays and by an SE-HPLC technique. The complexation of Cu(II and Zn(II was determined by the reaction with tetramethylmurexide, whereas for Fe(II, ferrozine was employed. The walnut tannins exhibited a significantly weaker reaction with the vanillin/HCl reagent than hazelnut and almond tannins, but the protein precipitation capacity of the walnut fraction was high. The SE-HPLC chromatogram of the tannin fraction from hazelnuts revealed the presence of oligomers with higher molecular weights compared to that of almonds. Copper ions were most effectively chelated by the constituents of the tannin fractions of hazelnuts, walnuts and almonds. At a 0.2 mg/assay addition level, the walnut tannins complexed almost 100% Cu(II. The Fe(II complexation capacities of the tannin fractions of walnuts and hazelnuts were weaker in comparison to that of the almond tannin fraction, which at a 2.5 mg/assay addition level, bound Fe(II by ~90%. The capacity to chelate Zn(II was quite varied for the different nut tannin fractions: almond tannins bound as much as 84% Zn(II, whereas the value for walnut tannins was only 8.7%; and for hazelnut tannins, no Zn(II chelation took place at the levels tested.

  20. Electrochemical, spectroscopic, and photophysical properties of structurally diverse polyazine-bridged Ru(II),Pt(II) and Os(II),Ru(II),Pt(II) supramolecular motifs.

    Science.gov (United States)

    Knoll, Jessica D; Arachchige, Shamindri M; Wang, Guangbin; Rangan, Krishnan; Miao, Ran; Higgins, Samantha L H; Okyere, Benjamin; Zhao, Meihua; Croasdale, Paul; Magruder, Katherine; Sinclair, Brian; Wall, Candace; Brewer, Karen J

    2011-09-19

    Five new tetrametallic supramolecules of the motif [{(TL)(2)M(dpp)}(2)Ru(BL)PtCl(2)](6+) and three new trimetallic light absorbers [{(TL)(2)M(dpp)}(2)Ru(BL)](6+) (TL = bpy = 2,2'-bipyridine or phen = 1,10-phenanthroline; M = Ru(II) or Os(II); BL = dpp = 2,3-bis(2-pyridyl)pyrazine, dpq = 2,3-bis(2-pyridyl)quinoxaline, or bpm = 2,2'-bipyrimidine) were synthesized and their redox, spectroscopic, and photophysical properties investigated. The tetrametallic complexes couple a Pt(II)-based reactive metal center to Ru and/or Os light absorbers through two different polyazine BL to provide structural diversity and interesting resultant properties. The redox potential of the M(II/III) couple is modulated by M variation, with the terminal Ru(II/III) occurring at 1.58-1.61 V and terminal Os(II/III) couples at 1.07-1.18 V versus Ag/AgCl. [{(TL)(2)M(dpp)}(2)Ru(BL)](PF(6))(6) display terminal M(dπ)-based highest occupied molecular orbitals (HOMOs) with the dpp(π*)-based lowest unoccupied molecular orbital (LUMO) energy relatively unaffected by the nature of BL. The coupling of Pt to the BL results in orbital inversion with localization of the LUMO on the remote BL in the tetrametallic complexes, providing a lowest energy charge separated (CS) state with an oxidized terminal Ru or Os and spatially separated reduced BL. The complexes [{(TL)(2)M(dpp)}(2)Ru(BL)](6+) and [{(TL)(2)M(dpp)}(2)Ru(BL)PtCl(2)](6+) efficiently absorb light throughout the UV and visible regions with intense metal-to-ligand charge transfer (MLCT) transitions in the visible at about 540 nm (M = Ru) and 560 nm (M = Os) (ε ≈ 33,000-42,000 M(-1) cm(-1)) and direct excitation to the spin-forbidden (3)MLCT excited state in the Os complexes about 720 nm. All the trimetallic and tetrametallic Ru-based supramolecular systems emit from the terminal Ru(dπ)→dpp(π*) (3)MLCT state, λ(max)(em) ≈ 750 nm. The tetrametallic systems display complex excited state dynamics with quenching of the (3)MLCT emission at

  1. Elaboration of a Highly Porous RuII,II Analogue of HKUST-1.

    Science.gov (United States)

    Zhang, Wenhua; Freitag, Kerstin; Wannapaiboon, Suttipong; Schneider, Christian; Epp, Konstantin; Kieslich, Gregor; Fischer, Roland A

    2016-12-19

    When the dinuclear Ru II,II precursor [Ru 2 (OOCCH 3 ) 4 ] is employed under redox-inert conditions, a Ru II,II analogue of HKUST-1 was successfully prepared and characterized as a phase-pure microcrystalline powder. X-ray absorption near-edge spectroscopy confirms the oxidation state of the Ru centers of the paddle-wheel nodes in the framework. The porosity of 1371 m 2 /mmol of Ru II,II -HKUST-1 exceeds that of the parent compound HKUST1 (1049 m 2 / mmol).

  2. Quantum mechanics II advanced topics

    CERN Document Server

    Rajasekar, S

    2015-01-01

    Quantum Mechanics II: Advanced Topics uses more than a decade of research and the authors’ own teaching experience to expound on some of the more advanced topics and current research in quantum mechanics. A follow-up to the authors introductory book Quantum Mechanics I: The Fundamentals, this book begins with a chapter on quantum field theory, and goes on to present basic principles, key features, and applications. It outlines recent quantum technologies and phenomena, and introduces growing topics of interest in quantum mechanics. The authors describe promising applications that include ghost imaging, detection of weak amplitude objects, entangled two-photon microscopy, detection of small displacements, lithography, metrology, and teleportation of optical images. They also present worked-out examples and provide numerous problems at the end of each chapter.

  3. Transdermic absorption of Melagenina II

    International Nuclear Information System (INIS)

    Hernandez Gonzalez, I.; Martinez Lopez, B.; Ruiz Pena, M.; Caso Pena, R.

    1997-01-01

    The transdermic absorption of Melagenina II (MII) was evaluated. MII was a labelled with 125I by the yodogen method and purified by column chromatography with Sephadex LH-20 in ethanol: water (7:3). In vitro absorption of ( 125I ) - MII thought human skin was carried out in Keshary-Chien modified diffusion cells. Tape stripping method was applied after 24 hours to evaluate the accumulated activity in dermis and epidermis. In vivo assays were performed in Sprague Dawley rats to analyze absorption of MII until 24 hours after a single application and for five days a low penetrability of the drug while in vivo there were not found blood levels significantly greater than zero , nevertheless and important amount of radioactivity was found in feces and urine. The activity was concentrated mainly in the application site in both models

  4. HERMES II experimenters' manual (revised)

    International Nuclear Information System (INIS)

    Schuch, R.L.

    1977-04-01

    The HERMES II is a high-intensity laboratory photon source for gamma-ray radiation effects experiments as well as a high-energy pulsed electron beam generator for a variety of potential applications. The purpose of this manual is to serve as a basic source of information for prospective users of HERMES. Included is a brief discussion of the design and operation of the accelerator system as well as a summary of environmental data for x-ray operation and output characteristics for electron beam modes. The manual also contains a description of the HERMES experimental facilities, including geometry of the test cell, instrumentation and data collection capabilities, and services and support available to experimenters

  5. RTNS-II utilization plan

    Energy Technology Data Exchange (ETDEWEB)

    Zwilsky, Klaus M.

    1978-09-01

    This plan describes a general program for the effective utilization of this resource by the fusion materials community. Because its flux is low relative to levels expected in commercial fusion reactors, the RINS-II is not expected to produce data of direct engineering significance (with some exceptions). Rather, it will be used chiefly to aid in the development of models of high energy neutron effects. Such models are needed in projecting engineering data obtained in high flux fission reactors to the fusion environment. Fission reactors, because of their relatively soft neutron spectra, cannot produce the high ratio of transmutations to displacements (except in an important special case) or the high energy recoil atoms appropriate to fusion reactors utilizing the D-T reaction.

  6. PEP-II prototype klystron

    International Nuclear Information System (INIS)

    Fowkes, W.R.; Caryotakis, G.; Lee, T.G.; Pearson, C.; Wright, E.L.

    1993-04-01

    A 540-kW continuous-wave (cw) klystron operating at 476 MHz was developed for use as a power source for testing PEP-II rf accelerating cavities and rf windows. It also serves as a prototype for a 1.2 MW cw klystron presently being developed as a potential rf source for asymmetric colliding ring use. The design incorporates the concepts and many of the parts used in the original 353 MHz PEP klystron developed sixteen years ago. The superior computer simulation codes available today result in improved performance with the cavity frequencies, drift lengths, and output circuit optimized for the higher frequency.The design and operating results of this tube are described with particular emphasis on the factors which affect efficiency and stability

  7. Sample Exchange Evaluation (SEE) Report - Phase II

    Energy Technology Data Exchange (ETDEWEB)

    Winters, W.I.

    1994-09-28

    This report describes the results from Phase II of the Sample Exchange Evaluation (SEE) Program, a joint effort to compare analytical laboratory performance on samples from the Hanford Site`s high-level waste tanks. In Phase II, the program has been expanded to include inorganic constituents in addition to radionuclides. Results from Phase II that exceeded 20% relative percent difference criteria are identified.

  8. Start II, red ink, and Boris Yeltsin

    International Nuclear Information System (INIS)

    Arbatov, A.

    1993-01-01

    Apart from the vulnerability implied by the START II treaty, it will bear the burden of the general political opposition to the Yeltsin administration. START II will be seen as part of an overall Yeltsin-Andrei Kozyrev foreign policy that is under fire for selling out Russian national interests in Yugoslavia, the Persian Gulf, and elsewhere. This article discusses public opinion concerning START II, the cost of its implementation, and the general purpose of the treaty

  9. SWAMI II technology transfer plan

    International Nuclear Information System (INIS)

    Ward, C.R.; Peterson, K.D.; Harpring, L.J.; Immel, D.M.; Jones, J.D.; Mallet, W.R.

    1995-01-01

    Thousands of drums of radioactive/hazardous/mixed waste are currently stored at DOE sites throughout US; they are stored in warehouse facilities on an interim basis, pending final disposition. Recent emphasis on anticipated decommissioning of facilities indicates that many more drums of waste will be generated, requiring additional storage. Federal and state regulations dictate that hazardous waste covered by RCRA be inspected periodically for container degradation and to verify inventories. All known DOE waste storage facilities are currently inspected manually. A system to perform robotic inspection of waste drums is under development by the SRTC Robotics Group of WSRC; it is called the Stored Waste Autonomous Mobile Inspector (SWAMI). The first version, SWAMI I, was developed by the Savannah River Technology Center (SRTC) as a proof of principle system for autonomous inspection of drums in a warehouse. SWAMI I was based on the Transitions Research Corporation (TRC) HelpMate mobile robot. TRC modified the Helpmate to navigate in aisles of drums. SRTC added subsystems to SWAMI I to determine its position in open areas, read bar code labels on the drums up to three levels high, capture images of the drums and perform a radiation survey of the floor in the aisles. The radiation survey was based on SRTC patented technology first implemented on the Semi-Intelligent Mobile Observing Navigator (SIMON). The radiation survey is not essential for the inspection of drums, but is an option that can increase the utility and effectiveness of SWAMI in warehouses with radioactive and/or mixed waste. All the sensors on SWAMI I were fixed on the vehicle. From the success of SWAMI I, a second version, SWAMI II, was developed; it will be evaluated at Fernald and tested with two other mobile robots. Intent is to transfer the technology developed for SWAMI I and II to industry so that it can supply additional units for purchase for drum inspection

  10. MHC Class II epitope predictive algorithms

    DEFF Research Database (Denmark)

    Nielsen, Morten; Lund, Ole; Buus, S

    2010-01-01

    Major histocompatibility complex class II (MHC-II) molecules sample peptides from the extracellular space, allowing the immune system to detect the presence of foreign microbes from this compartment. To be able to predict the immune response to given pathogens, a number of methods have been...... developed to predict peptide-MHC binding. However, few methods other than the pioneering TEPITOPE/ProPred method have been developed for MHC-II. Despite recent progress in method development, the predictive performance for MHC-II remains significantly lower than what can be obtained for MHC-I. One reason...

  11. Spectroscopic and thermal degradation behavior of Mg(II), Ca(II), Ba(II) and Sr(II) complexes with paracetamol drug

    OpenAIRE

    Moamen S. Refat; Gehad G. Mohamed; Mohamed Y. El-Sayed; Hamada M.A. Killa; Hammad Fetooh

    2017-01-01

    Complexes of Mg(II), Ca(II), Ba(II) and Sr(II) with paracetamol drug were synthesized and characterized by elemental analysis, conductivity, UV–Vis, IR, and 1H NMR spectroscopy and thermal analysis, as well as screened for antimicrobial activity. The IR spectral data suggested that the ligand behaves as paracetamol behaves as a neutral bidentate ligand coordinated to the metal ions via the lone pair of electrons of nitrogen and carbonyl-O atoms of the amide group. From the microanalytical dat...

  12. TRUPACT-II Container Maintenance Program Plan

    International Nuclear Information System (INIS)

    1991-05-01

    This document details the maintenance, repair, and replacement of components, as well as the documentation required and the procedures to be followed to maintain the integrity of the TRUPACT-II container in accordance with OM-134, TRUPACT-II Container Operations and Maintenance Manual; and the TRUPACT-II Container Certificate of Compliance (Number 9218). The routine shipping and receiving inspections required by the Department of Transportation (DOT), Department of Energy (DOE), Nuclear Regulatory Commission (NRC) and other regulations are not addressed in this document. This document applies to all DOE shipping and receiving sites that use the TRUPACT-II containers

  13. Optimization of simultaneous electrochemical determination of Cd(II), Pb(II), Cu(II) and Hg(II) at carbon nanotube-modified graphite electrodes.

    Science.gov (United States)

    Pikna, L'ubomír; Heželová, Mária; Kováčová, Zuzana

    2015-01-01

    The health of the environment is worsening every day. Monitoring of potentially toxic elements and remediation of environmental pollution are necessary. Therefore, the research and development of simple, inexpensive, portable and effective sensors is important. Electrochemistry is a useful component of the field of environment monitoring. The present study focuses on evaluating and comparing three types of electrodes (PIGE, PIGE/MWCNT/HNO3 and PIGE/MWCNT/EDTA/HNO3) employed for the simultaneous electrochemical determination of four potentially toxic elements: Cd(II), Pb(II), Cu(II) and Hg(II). Cyclic voltammograms were measured in an acetate buffer. The LOD, LOQ, the standard and relative precisions of the method and a prediction intervals were calculated (according to the technical procedure DIN 32 645) for the three electrodes and for each measured element. The LOD for PIGE/CNT/HNO3 (the electrode with narrowest calculated prediction intervals) was 2.98 × 10(-7) mol L(-1) for Cd(II), 4.83 × 10(-7) mol L(-1) for Pb(II), 3.81 × 10(-7) mol L(-1) for Cu(II), 6.79 × 10(-7) mol L(-1) for Hg(II). One of the benefits of this study was the determination of the amount of Hg(II) in the mixture of other elements.

  14. Biosorption of Fe (II) and Cd (II) ions from aqueous solution using a ...

    African Journals Online (AJOL)

    ADOWIE PERE

    Biosorption of Fe (II) and Cd (II) ions from aqueous solution using a low cost ... human activities in the environment poses a lot of risk ... ion exchange or reverse osmosis, electrochemical treatment ..... is the adsorption coefficient, n indicates the.

  15. Serum insulin-like growth factor II (IGF-II) in chronic heart failure

    International Nuclear Information System (INIS)

    Tong Lijun; Chen Donghai; Ji Naijun; Fan Bifu; Wang Chengyao; Mei Yibin; Li Fuyuan; Kao Yan

    2004-01-01

    Objective: To investigate the clinical significance of changes of serum insulin-like growth factor II (IGF-II) levels in patients with chronic heart failure. Methods: Serum IGF-II levels were measured with RIA in 132 cases of chronic heart failure and 45 controls. Results: Serum IGF-II levels were significantly higher in patients with chronic heart failure than those in the controls (t=0.033, P<0.001). IGF-II levels were highest in grade IV CHF patients (vs grade II t=3.963, P<0.01; vs grade III, t=3.578, P<0.01). In the twelve patients died in hospital, the serum IGF-II levels were significantly higher than those patients recovered (t=7.141, P<0.01). Conclusion: Serum IGF-II levels were increased in CHF patients and were highest in the most severe cases. (authors)

  16. Syntheses and spectroscopic properties of mercury(II) and nickel(II ...

    African Journals Online (AJOL)

    Syntheses and spectroscopic properties of mercury(II) and nickel(II) ... The complexes were characterized by IR, diffuse reflectance, 1H NMR spectra and elemental ... coordinating through thiolato sulphur and hydrazinic nitrogen atoms.

  17. MHC class II expression in lung cancer.

    Science.gov (United States)

    He, Yayi; Rozeboom, Leslie; Rivard, Christopher J; Ellison, Kim; Dziadziuszko, Rafal; Yu, Hui; Zhou, Caicun; Hirsch, Fred R

    2017-10-01

    Immunotherapy is an exciting development in lung cancer research. In this study we described major histocompatibility complex (MHC) Class II protein expression in lung cancer cell lines and patient tissues. We studied MHC Class II (DP, DQ, DR) (CR3/43, Abcam) protein expression in 55 non-small cell lung cancer (NSCLC) cell lines, 42 small cell lung cancer (SCLC) cell lines and 278 lung cancer patient tissues by immunohistochemistry (IHC). Seven (12.7%) NSCLC cell lines were positive for MHC Class II. No SCLC cell lines were found to be MHC Class II positive. We assessed 139 lung cancer samples available in the Hirsch Lab for MHC Class II. There was no positive MHC Class II staining on SCLC tumor cells. MHC Class II expression on TILs in SCLC was significantly lower than that on TILs in NSCLC (P<0.001). MHC Class II was also assessed in an additional 139 NSCLC tumor tissues from Medical University of Gdansk, Poland. Patients with positive staining of MHC Class II on TILs had longer regression-free survival (RFS) and overall survival (OS) than those whose TILs were MHC Class II negative (2.980 years, 95% CI 1.628-4.332 vs. 1.050 years, 95% CI 0.556-1.554, P=0.028) (3.230 years, 95% CI 2.617-3.843 vs. 1.390 years, 95% CI 0.629-2.151, P=0.014). MHC Class II was expressed both in NSCLC cell lines and tissues. However, MHC Class II was not detected in SCLC cell lines or tissue tumor cells. MHC Class II expression was lower on SCLC TILs than on NSCLC TILs. Loss of expression of MHC Class II on SCLC tumor cells and reduced expression on SCLC TILs may be a means of escaping anti-cancer immunity. Higher MHC Class II expression on TILs was correlated with better prognosis in patients with NSCLC. Copyright © 2017. Published by Elsevier B.V.

  18. Competitive adsorption of copper(II), cadmium(II), lead(II) and zinc(II) onto basic oxygen furnace slag

    International Nuclear Information System (INIS)

    Xue Yongjie; Hou Haobo; Zhu Shujing

    2009-01-01

    Polluted and contaminated water can often contain more than one heavy metal species. It is possible that the behavior of a particular metal species in a solution system will be affected by the presence of other metals. In this study, we have investigated the adsorption of Cd(II), Cu(II), Pb(II), and Zn(II) onto basic oxygen furnace slag (BOF slag) in single- and multi-element solution systems as a function of pH and concentration, in a background solution of 0.01 M NaNO 3 . In adsorption edge experiments, the pH was varied from 2.0 to 13.0 with total metal concentration 0.84 mM in the single element system and 0.21 mM each of Cd(II), Cu(II), Pb(II), and Zn(II) in the multi-element system. The value of pH 50 (the pH at which 50% adsorption occurs) was found to follow the sequence Zn > Cu > Pb > Cd in single-element systems, but Pb > Cu > Zn > Cd in the multi-element system. Adsorption isotherms at pH 6.0 in the multi-element systems showed that there is competition among various metals for adsorption sites on BOF slag. The adsorption and potentiometric titrations data for various slag-metal systems were modeled using an extended constant-capacitance surface complexation model that assumed an ion-exchange process below pH 6.5 and the formation of inner-sphere surface complexes at higher pH. Inner-sphere complexation was more dominant for the Cu(II), Pb(II) and Zn(II) systems

  19. Competitive adsorption of copper(II), cadmium(II), lead(II) and zinc(II) onto basic oxygen furnace slag

    Energy Technology Data Exchange (ETDEWEB)

    Xue Yongjie [School of Resource and Environment Science, Wuhan University, Hubei, Wuhan (China); Wuhan Kaidi Electric Power Environmental Protection Co. Ltd., Hubei, Wuhan (China)], E-mail: xueyj@mail.whut.edu.cn; Hou Haobo; Zhu Shujing [School of Resource and Environment Science, Wuhan University, Hubei, Wuhan (China)

    2009-02-15

    Polluted and contaminated water can often contain more than one heavy metal species. It is possible that the behavior of a particular metal species in a solution system will be affected by the presence of other metals. In this study, we have investigated the adsorption of Cd(II), Cu(II), Pb(II), and Zn(II) onto basic oxygen furnace slag (BOF slag) in single- and multi-element solution systems as a function of pH and concentration, in a background solution of 0.01 M NaNO{sub 3}. In adsorption edge experiments, the pH was varied from 2.0 to 13.0 with total metal concentration 0.84 mM in the single element system and 0.21 mM each of Cd(II), Cu(II), Pb(II), and Zn(II) in the multi-element system. The value of pH{sub 50} (the pH at which 50% adsorption occurs) was found to follow the sequence Zn > Cu > Pb > Cd in single-element systems, but Pb > Cu > Zn > Cd in the multi-element system. Adsorption isotherms at pH 6.0 in the multi-element systems showed that there is competition among various metals for adsorption sites on BOF slag. The adsorption and potentiometric titrations data for various slag-metal systems were modeled using an extended constant-capacitance surface complexation model that assumed an ion-exchange process below pH 6.5 and the formation of inner-sphere surface complexes at higher pH. Inner-sphere complexation was more dominant for the Cu(II), Pb(II) and Zn(II) systems.

  20. Competitive adsorption of copper(II), cadmium(II), lead(II) and zinc(II) onto basic oxygen furnace slag.

    Science.gov (United States)

    Xue, Yongjie; Hou, Haobo; Zhu, Shujing

    2009-02-15

    Polluted and contaminated water can often contain more than one heavy metal species. It is possible that the behavior of a particular metal species in a solution system will be affected by the presence of other metals. In this study, we have investigated the adsorption of Cd(II), Cu(II), Pb(II), and Zn(II) onto basic oxygen furnace slag (BOF slag) in single- and multi-element solution systems as a function of pH and concentration, in a background solution of 0.01M NaNO(3). In adsorption edge experiments, the pH was varied from 2.0 to 13.0 with total metal concentration 0.84mM in the single element system and 0.21mM each of Cd(II), Cu(II), Pb(II), and Zn(II) in the multi-element system. The value of pH(50) (the pH at which 50% adsorption occurs) was found to follow the sequence Zn>Cu>Pb>Cd in single-element systems, but Pb>Cu>Zn>Cd in the multi-element system. Adsorption isotherms at pH 6.0 in the multi-element systems showed that there is competition among various metals for adsorption sites on BOF slag. The adsorption and potentiometric titrations data for various slag-metal systems were modeled using an extended constant-capacitance surface complexation model that assumed an ion-exchange process below pH 6.5 and the formation of inner-sphere surface complexes at higher pH. Inner-sphere complexation was more dominant for the Cu(II), Pb(II) and Zn(II) systems.

  1. Derivation of electron density and temperature from (S II) and (O II) line intensity ratios

    Energy Technology Data Exchange (ETDEWEB)

    Canto, J; Meaburn, J; Theokas, A C [Manchester Univ. (UK). Dept of Astronomy; Elliott, K H [Anglo-Australian Observatory, Epping (Australia)

    1980-12-01

    Line intensity ratios for (S II) and (O II) due to collisional de-excitation are briefly discussed. Comparison is made between various reaction rate parameters presented by separate investigators. Included are observations of ratios obtained from the Orion nebula which experimentally confirm the reaction rates of Pradhan as best representing the observed distribution of these ratios. (O II) and (S II) contour plots are also presented, which allow effective electron temperatures and densities to be estimated from pairs of line ratios.

  2. Low-temperature Synthesis of Tin(II) Oxide From Tin(II) ketoacidoximate Precursor

    KAUST Repository

    Alshankiti, Buthainah

    2015-01-01

    Sn (II) oxide finds numerous applications in different fields such as thin film transistors1, solar cells2 and sensors.3 In this study we present the fabrication of tin monoxide SnO by using Sn (II) ketoacid oximate complexes as precursors. Tin (II

  3. Mutation and biochemical analysis in carnitine palmitoyltransferase type II (CPT II) deficiency

    DEFF Research Database (Denmark)

    Olpin, S E; Afifi, A; Clark, S

    2003-01-01

    Carnitine palmitoyltransferase type II (CPT II) deficiency has three basic phenotypes, late-onset muscular (mild), infantile/juvenile hepatic (intermediate) and severe neonatal. We have measured fatty acid oxidation and CPT II activity and performed mutation studies in 24 symptomatic patients...

  4. Biosorption of Cd(II) and Zn(II) by nostoc commune: isotherm and kinetics studies

    Energy Technology Data Exchange (ETDEWEB)

    Morsy, Fatthy M. [Faculty of Science, Botany Department, Assiut University, Assiut (Egypt); Hassan, Sedky H.A. [Department of Biological Environment, Kangwon National University, Kangwon-do (Korea, Republic of); Koutb, Mostafa [Faculty of Science, Botany Department, Assiut University, Assiut (Egypt); Umm Al-Qura University, Faculty of Applied Science, Biology Department, Mecca (Saudi Arabia)

    2011-07-15

    In this study, Nostoc commune (cyanobacterium) was used as an inexpensive and efficient biosorbent for Cd(II) and Zn(II) removal from aqueous solutions. The effect of various physicochemical factors on Cd(II) and Zn(II) biosorption such as pH 2.0-7.0, initial metal concentration 0.0-300 mg/L and contact time 0-120 min were studied. Optimum pH for removal of Cd(II) and Zn(II) was 6.0, while the contact time was 30 min at room temperature. The nature of biosorbent and metal ion interaction was evaluated by infrared (IR) technique. IR analysis of bacterial biomass revealed the presence of amino, carboxyl, hydroxyl, and carbonyl groups, which are responsible for biosorption of Cd(II) and Zn (II). The maximum biosorption capacities for Cd(II) and Zn(II) biosorption by N. commune calculated from Langmuir biosorption isotherm were 126.32 and 115.41 mg/g, respectively. The biosorption isotherm for two biosorbents fitted well with Freundlich isotherm than Langmuir model with correlation coefficient (r{sup 2} < 0.99). The biosorption kinetic data were fitted well with the pseudo-second-order kinetic model. Thus, this study indicated that the N. commune is an efficient biosorbent for the removal of Cd(II) and Zn(II) from aqueous solutions. (Copyright copyright 2011 WILEY-VCH Verlag GmbH and Co. KGaA, Weinheim)

  5. Synthesis, spectroscopic and antimicrobial properties of Co(II), Ni (II ...

    African Journals Online (AJOL)

    The objective of this study is to investigate the antimicrobial activity of novel Schiff base metal complexes. The resistance of micro-organisms to classical antimicrobial compounds poses a challenge to effective management and treatment of some diseases. In line with this, copper (II), nickel (II) and cobalt (II) complexes of ...

  6. The CDF SVX II detector upgrade

    International Nuclear Information System (INIS)

    Skarha, J.E.

    1993-10-01

    The proposed CDF SVX II detector upgrade for secondary vertex detection during the Fermilab Tevatron Run II collider run is described. The general design and important features of this silicon vertex detector are presented. The CDF physics goals which are addressed by this detector are also given

  7. Photocleavage of DNA by copper (II) complexes

    Indian Academy of Sciences (India)

    The chemistry of ternary and binary copper(II) complexes showing efficient visible lightinduced DNA cleavage activity is summarized in this article. The role of the metal in photo-induced DNA cleavage reactions is explored by designing complex molecules having a variety of ligands. Ternary copper(II) complexes with amino ...

  8. TRUPACT-II procedures and maintenance instructions

    International Nuclear Information System (INIS)

    1994-01-01

    The purpose of this document is to provide the technical requirements for operation, inspection and maintenance of a TRUPACT-II Shipping Package and directly related components. This document shall supply the minimum requirements as specified in the TRUPACT-II Safety Analysis Report for Packaging (SARP) and Certificate of Compliance (C of C) 9218. In the event there is a conflict between this document and the TRUPACT-II SARP (NRC Certificate of Compliance No. 9218), the TRUPACT-II SARP shall govern. This document details the operations, maintenance, repair, replacement of components, as well as the documentation required and the procedures to be followed to maintain the integrity of the TRUPACT-II container. These procedures may be modified for site use, but as a minimum all parameters and format listed herein must be included in any site modified version. For convenience and where applicable steps may be performed out of sequence. Packaging and payload handling equipment and transport trailers have been specifically designed for use with the TRUPACT-II Packaging. This document discusses the minimum required procedures for use of the adjustable center of gravity lift fixture and the TRUPACT-II transport trailer in conjunction with the TRUPACT-II Packaging

  9. World War II Homefront: A Historiography.

    Science.gov (United States)

    Winkler, Allan M.

    2002-01-01

    Highlights the scholarship that exists on the World War II homefront covering topics such as World War II as a good war, Franklin D. Roosevelt, economic policy, propaganda, status of women and women's employment, the role of African Americans, racial violence, and the Japanese American experience. (CMK)

  10. 24 CFR 202.12 - Title II.

    Science.gov (United States)

    2010-04-01

    ... INSTITUTIONS AND MORTGAGEES Title I and Title II Specific Requirements § 202.12 Title II. (a) Tiered pricing—(1... rate up to two percentage points under the mortgagee's customary lending practices must be based on... after accounting for the value of servicing rights generated by making the loan and other income to the...

  11. World War II Memorial Learning Activities.

    Science.gov (United States)

    Tennessee State Dept. of Education, Nashville.

    These learning activities can help students get the most out of a visit to the Tennessee World War II Memorial, a group of ten pylons located in Nashville (Tennessee). Each pylon contains informational text about the events of World War II. The ten pylons are listed as: (1) "Pylon E-1--Terror: America Enters the War against Fascism, June…

  12. Technical specifications: Tower Shielding Reactor II

    International Nuclear Information System (INIS)

    1979-02-01

    The technical specifications define the key limitations that must be observed for safe operation of the Tower Shielding Reactor II (TSR-II) and an envelope of operation within which there is reasonable assurance that these limits cannot be exceeded. The specifications were written to satisfy the requirements of the Department of Energy (DOE) Manual Chapter 0540, September 1, 1972

  13. DART II documentation. Volume III. Appendices

    Energy Technology Data Exchange (ETDEWEB)

    1979-10-01

    The DART II is a remote, interactive, microprocessor-based data acquistion system suitable for use with air monitors. This volume of DART II documentation contains the following appendixes: adjustment and calibration procedures; mother board signature list; schematic diagrams; device specification sheets; ROM program listing; 6800 microprocessor instruction list, octal listing; and cable lists. (RWR)

  14. Sex differences in angiotensin II- induced hypertension

    Directory of Open Access Journals (Sweden)

    B. Xue

    2007-05-01

    Full Text Available Sex differences in the development of hypertension and cardiovascular disease have been described in humans and in animal models. In this paper we will review some of our studies which have as their emphasis the examination of the role of sex differences and sex steroids in modulating the central actions of angiotensin II (ANG II via interactions with free radicals and nitric oxide, generating pathways within brain circumventricular organs and in central sympathomodulatory systems. Our studies indicate that low-dose infusions of ANG II result in hypertension in wild-type male mice but not in intact wild-type females. Furthermore, we have demonstrated that ANG II-induced hypertension in males is blocked by central infusions of the androgen receptor antagonist, flutamide, and by central infusions of the superoxide dismutase mimetic, tempol. We have also found that, in comparison to females, males show greater levels of intracellular reactive oxygen species in circumventricular organ neurons following long-term ANG II infusions. In female mice, ovariectomy, central blockade of estrogen receptors or total knockout of estrogen a receptors augments the pressor effects of ANG II. Finally, in females but not in males, central blockade of nitric oxide synthase increases the pressor effects of ANG II. Taken together, these results suggest that sex differences and estrogen and testosterone play important roles in the development of ANG II-induced hypertension.

  15. Oral Assessment Kit, Levels II & III. Draft.

    Science.gov (United States)

    Agrelo-Gonzalez, Maria; And Others

    The assessment packet includes a series of oral tests to help develop speaking as an integral part of second language instruction at levels II and III. It contains: 8 mini-tests for use at level II; 9 mini-tests for use at level III; a rating scale and score sheet masters for evaluating performance on these tests; and a collection of suggested…

  16. Metallothionein-I+II in neuroprotection

    DEFF Research Database (Denmark)

    Pedersen, Mie Ø; Jensen, Rikke; Pedersen, Dan S

    2009-01-01

    -I+II decrease inflammation and secondary tissue damage (oxidative stress, neurodegeneration, and apoptosis) and promote post-injury repair and regeneration (angiogenesis, neurogenesis, neuronal sprouting and tissue remodelling). Intracellularly the molecular MT-I+II actions involve metal ion control...... encephalomyelitis. (c) 2009 International Union of Biochemistry and Molecular Biology, Inc....

  17. TRUPACT-II container maintenance program plan

    International Nuclear Information System (INIS)

    1990-11-01

    This document details the maintenance/repair and replacement of components, as well as the documentation required and the procedures to be followed to maintain the integrity of the TRUPACT-II container, in accordance with requirements of the TRUPACT-II Container Operations and Maintenance Manual, OM-134, the TRUPACT-II Container Safety Analysis Report (SARP), and the TRUPACT-II Container Certificate of Compliance (Number 9218). The routine shipping and receiving inspections required by the Department of Transportation (DOT), Department of Energy (DOE), Nuclear Regulatory Commission (NRC) and other regulations are not addressed in this document. This document applies to all DOE shipping and receiving sites that use the TRUPACT-II containers

  18. ETA-II accelerator upgrades

    International Nuclear Information System (INIS)

    Nilson, D.G.; Deadrick, F.J.; Hibbs, S.M.; Sampayan, S.E.; Petersen, D.E.

    1991-09-01

    We discuss recent improvements to the ETA-II linear induction electron accelerator. The accelerator's cells have been carefully reconditioned to raise the maximum accelerating gap voltage from approximately 100 kV to 125 kV. Insulators of Rexolite plastic in a new ''zero-gap'' arrangement replaced the alumina originals after several alternative materials were investigated. A new multi-cable current feed system will be used to eliminate pulse reflection interactions encountered in earlier experiments. Improved alignment fixtures have been installed to help minimize beam perturbation due to poorly aligned intercell magnets between 10-cell groups. A stretched wire alignment technique (SWAT) has been utilized to enhance overall magnetic alignment, and to characterize irreducible alignment errors. These changes are in conjunction with an expansion of the accelerator from a 20-cell to a 60-cell configuration. When completed, the upgraded accelerator is expected to deliver 2.5 kA of electron beam current at 7.5 MeV in bursts of up to fifty 70-ns pulses at a 5-kHz repetition rate. A 5.5-meter-long wiggler will convert the energy into 3-GW microwave pulses at 140 GHz for plasma heating experiments in the Microwave Tokamak Experiment (MTX)

  19. The Steksovo II burial ground

    Directory of Open Access Journals (Sweden)

    Martianov Vladimir N.

    2014-12-01

    Full Text Available The article is dedicated to the results of many-years’ (1990-2010 excavations on the ancient Mordovian Steksovo II burial ground site. The burial ground had functioned in the 3rd to 13th centuries AD. The investigations revealed hundreds of burials, which enabled the researchers to judge upon the wealth of material items found and the variety of burial rites of the population that had formed the burial ground. The 1st millennium AD is characterized by bi-ritualism, while inhumation is characteristic of the 11-13th-century period; horses’ burials were also discovered. The data of the burial ground make it possible to modify the concept of the stages in ancient Mordovians ethnogenesis. It is generally attributed to the Erzya Mordvins, but in early burials the combination of the Erzya and Moksha ancientries is traced. Complexes of the items of crucial importance for the chronology of the burial are discussed in the article with a representation of statistical data characterizing funeral rites and traditions.

  20. Aspects of differential geometry II

    CERN Document Server

    Gilkey, Peter

    2015-01-01

    Differential Geometry is a wide field. We have chosen to concentrate upon certain aspects that are appropriate for an introduction to the subject; we have not attempted an encyclopedic treatment. Book II deals with more advanced material than Book I and is aimed at the graduate level. Chapter 4 deals with additional topics in Riemannian geometry. Properties of real analytic curves given by a single ODE and of surfaces given by a pair of ODEs are studied, and the volume of geodesic balls is treated. An introduction to both holomorphic and Kähler geometry is given. In Chapter 5, the basic properties of de Rham cohomology are discussed, the Hodge Decomposition Theorem, Poincaré duality, and the Künneth formula are proved, and a brief introduction to the theory of characteristic classes is given. In Chapter 6, Lie groups and Lie algebras are dealt with. The exponential map, the classical groups, and geodesics in the context of a bi-invariant metric are discussed. The de Rham cohomology of compact Lie groups an...

  1. TRUPACT-II, a regulatory perspective

    International Nuclear Information System (INIS)

    Gregory, P.C.; Spooner, O.R.

    1995-01-01

    The Transuranic Package Transporter II (TRUPACT-II) is a US Nuclear Regulatory Commission (NRC) certified Type B packaging for the shipment of contact-handled transuranic (CH-TRU) material by the US Department of Energy (DOE). The NRC approved the TRUPACT-II design as meeting the requirements of Title 10, Code of Federal Regulations, Part 71 (10 CFR 71) and issued Certificate of Compliance (CofC) Number 9218 to the DOE. There are currently 15 certified TRUPACT-IIs. Additional TRUPACT-IIs will be required to make more than 15,000 shipments of CH-TRU waste to the Waste Isolation Pilot Plant (WIPP) site near Carlsbad, New Mexico. The TRUPACT-II may also be used for the DOE inter-site and intra-site shipments of CH-TRU waste. The Land Withdrawal Act (Public Law 102-579), enacted by the US Congress, October 30, 1992, and an agreement between the DOE and the State of New Mexico, signed August 4, 1987, both stipulate that only NRC approved packaging may be used for shipments of TRU waste to the WIPP. Early in the TRUPACT-II development phase it was decided that the transportation system (tractor, trailer, and TRUPACT-II) should be highway legal on all routes without the need for oversize and/or overweight permits. In large measure, public acceptance of the DOE's efforts to safely transport CH-TRU waste depends on the public's perception that the TRUPACT-II is in compliance with all applicable regulations, standards, and quality assurance requirements. This paper addresses some of the numerous regulations applicable to Type B packaging, and it describes how the TRUPACT-II complies with these regulations

  2. Equilibrium and kinetic studies of Pb(II, Cd(II and Zn(II sorption by Lagenaria vulgaris shell

    Directory of Open Access Journals (Sweden)

    Mitić-Stojanović Dragana-Linda

    2012-01-01

    Full Text Available The sorption of lead, cadmium and zinc ions from aqueous solution by Lagenaria vulgaris shell biosorbent (LVB in batch system was investigated. The effect of relevant parameters such as contact time, biosorbent dosage and initial metal ions concentration was evaluated. The Pb(II, Cd(II and Zn(II sorption equilibrium (when 98% of initial metal ions were sorbed was attained within 15, 20 and 25 min, respectively. The pseudo first, pseudo-second order, Chrastil’s and intra-particle diffusion models were used to describe the kinetic data. The experimental data fitted the pseudo-second order kinetic model and intra-particle diffusion model. Removal efficiency of lead(II, cadmium(II and zinc(II ions rapidly increased with increasing biosorbent dose from 0.5 to 8.0 g dm-3. Optimal biosorbent dose was set to 4.0 g dm-3. An increase in the initial metal concentration increases the sorption capacity. The sorption data of investigated metal ions are fitted to Langmuir, Freundlich and Temkin isotherm models. Langmuir model best fitted the equilibrium data (r2 > 0.99. Maximal sorption capacities of LVB for Pb(II, Cd(II and Zn(II at 25.0±0.5°C were 0.130, 0.103 and 0.098 mM g-1, respectively. The desorption experiments showed that the LVB could be reused for six cycles with a minimum loss of the initial sorption capacity.

  3. Multi-metals column adsorption of lead(II), cadmium(II) and manganese(II) onto natural bentonite clay.

    Science.gov (United States)

    Alexander, Jock Asanja; Surajudeen, Abdulsalam; Aliyu, El-Nafaty Usman; Omeiza, Aroke Umar; Zaini, Muhammad Abbas Ahmad

    2017-10-01

    The present work was aimed at evaluating the multi-metals column adsorption of lead(II), cadmium(II) and manganese(II) ions onto natural bentonite. The bentonite clay adsorbent was characterized for physical and chemical properties using X-ray diffraction, X-ray fluorescence, Brunauer-Emmett-Teller surface area and cation exchange capacity. The column performance was evaluated using adsorbent bed height of 5.0 cm, with varying influent concentrations (10 mg/L and 50 mg/L) and flow rates (1.4 mL/min and 2.4 mL/min). The result shows that the breakthrough time for all metal ions ranged from 50 to 480 minutes. The maximum adsorption capacity was obtained at initial concentration of 10 mg/L and flow rate of 1.4 mL/min, with 2.22 mg/g of lead(II), 1.71 mg/g of cadmium(II) and 0.37 mg/g of manganese(II). The order of metal ions removal by natural bentonite is lead(II) > cadmium(II) > manganese(II). The sorption performance and the dynamic behaviour of the column were predicted using Adams-Bohart, Thomas, and Yoon-Nelson models. The linear regression analysis demonstrated that the Thomas and Yoon-Nelson models fitted well with the column adsorption data for all metal ions. The natural bentonite was effective for the treatment of wastewater laden with multi-metals, and the process parameters obtained from this work can be used at the industrial scale.

  4. Unsaturated b-ketoesters and their Ni(II, Cu(II and Zn(II complexes

    Directory of Open Access Journals (Sweden)

    MUHAMMED BASHEER UMMATHUR

    2009-03-01

    Full Text Available A new series of b-ketoesters in which the keto group is attached to the olefinic linkage were synthesized by the reaction of methyl acetoacetate and aromatic aldehydes under specified conditions. The existence of these compounds predominantly in the intramolecularly hydrogen bonded enol form was well demonstrated from their IR, 1H-NMR and mass spectral data. Details on the formation of their [ML2] complexes with Ni(II, Cu(II and Zn(II and the nature of the bonding are discussed on the basis of analytical and spectral data.

  5. Adsorption of Cu(II), Hg(II), and Ni(II) ions by modified natural wool chelating fibers

    Energy Technology Data Exchange (ETDEWEB)

    Monier, M., E-mail: monierchem@yahoo.com [Chemistry Department, Drexel University, Philadelphia, PA (United States); Chemistry Department, Faculty of Science, Mansoura University, Mansoura (Egypt); Ayad, D.M.; Sarhan, A.A. [Chemistry Department, Faculty of Science, Mansoura University, Mansoura (Egypt)

    2010-04-15

    The graft copolymerization of ethyl acrylate (EA) onto natural wool fibers initiated by potassium persulphate and Mohr's salt redox initiator system in limited aqueous medium was carried out in heterogeneous media. Ester groups of the grafted copolymers were partially converted into hydrazide function groups followed by hydrazone formation through reaction with isatin. Also the application of the modified fibers for metal ion uptake was studied using Cu(II), Hg(II) and Ni(II). The modified chelating fibers were characterized using FTIR spectroscopy, SEM and X-ray diffraction.

  6. Adsorption of Cu(II), Hg(II), and Ni(II) ions by modified natural wool chelating fibers.

    Science.gov (United States)

    Monier, M; Ayad, D M; Sarhan, A A

    2010-04-15

    The graft copolymerization of ethyl acrylate (EA) onto natural wool fibers initiated by potassium persulphate and Mohr's salt redox initiator system in limited aqueous medium was carried out in heterogeneous media. Ester groups of the grafted copolymers were partially converted into hydrazide function groups followed by hydrazone formation through reaction with isatin. Also the application of the modified fibers for metal ion uptake was studied using Cu(II), Hg(II) and Ni(II). The modified chelating fibers were characterized using FTIR spectroscopy, SEM and X-ray diffraction. 2009 Elsevier B.V. All rights reserved.

  7. Adsorption of Cu(II), Hg(II), and Ni(II) ions by modified natural wool chelating fibers

    International Nuclear Information System (INIS)

    Monier, M.; Ayad, D.M.; Sarhan, A.A.

    2010-01-01

    The graft copolymerization of ethyl acrylate (EA) onto natural wool fibers initiated by potassium persulphate and Mohr's salt redox initiator system in limited aqueous medium was carried out in heterogeneous media. Ester groups of the grafted copolymers were partially converted into hydrazide function groups followed by hydrazone formation through reaction with isatin. Also the application of the modified fibers for metal ion uptake was studied using Cu(II), Hg(II) and Ni(II). The modified chelating fibers were characterized using FTIR spectroscopy, SEM and X-ray diffraction.

  8. Determination of activities of human carbonic anhydrase II inhibitors ...

    African Journals Online (AJOL)

    Purpose: To evaluate the activities of new curcumin analogs as carbonic anhydrase II (CA-II) inhibitor. Methods: Carbonic anhydrase II (CA-II) inhibition was determined by each ligand capability to inhibit the esterase activity of CA-II using 4-NPA as a substrate in 96-well plates. Dimethyl sulfoxide was used to dissolve each ...

  9. Investigation of the impacts of elevated atmospheric CO{sub 2}-concentrations during the Free-Air Carbon Dioxide Enrichment-Experiment. Development of universal solutions; Untersuchung der Auswirkungen erhoehter atmosphaerischer CO{sub 2}-Konzentrationen innerhalb des Free-Air Carbon Dioxide Enrichment-Experimentes. Ableitung allgemeiner Modelloesungen

    Energy Technology Data Exchange (ETDEWEB)

    Kartschall, T.; Michaelis, P. [Potsdam-Institut fuer Klimafolgenforschung e.V., Potsdam (Germany). Abt. Globaler Wandel und Natuerliche Systeme; Graefe, J.; Waloszczyk, K. [Professor-Hellriegel-Institut e.V., Bernburg (Germany); Grossman-Clarke, S.

    1999-06-01

    An improved version of the wheat model demeter including modules for important and commonly usable ecosystem compartments (i) light interception in homogenous and rowed canopies (ii) energy and gas exchange including photosynthesis (iii) water, temperature, carbon and nitrogen dynamics in mineral soils was developed. Due to the generic properties of the detailed model solutions qualitative and quantitative explanations about direct and indirect impacts of elevated atmospheric CO{sub 2} concentrations on Graminaceae (C{sub 3}-Type) under limited water and nitrogen supply are possible. These solutions have been tested under a wide range of geographic (33 bis 52 N), soil and climatic conditions. The model was validated on a wide spectrum of temporal (time steps ranging from one minute up to one day, simulation periods ranging from several hours to several years) and spatial scales (Submodel photosynthesis of leaf level, the entire model on canopy level, regional yield studies for the entire State of Brandenburg). (orig.) [German] Es wurde eine verbesserte Version des Modells demeter mit modularem Aufbau fuer wichtige und allgemein anwendbare Oekosystemteile (i) Lichtverteilung in homogenen geschlossenen bzw. gereihten Bestaenden; (ii) Energie- und Gasaustausch einschliesslich Photosynthese; (iii) Dynamik von Wasser, Temperatur, Kohlenstoff- und Stickstoffumsatz in Mineralboeden; entwickelt. Durch den generischen Charakter der detaillierten Modelloesungen sind qualitative und quantitative Aussagen zu direkten und indirekten Auswirkungen erhoehter atmosphaerischer CO{sub 2}-Konzentrationen auf Graminaceae des C{sub 3}-Typs bei Wasser- und Stickstofflimitierung unter breiteren geographischen (33 bis 52 N), Boden- und klimatischen Bedingungen moeglich. Das Modell wurde auf einem breiten Spektrum zeitlicher (Taktzeiten von einer Minute bis zu einem Tag, Simulationszeiten von mehreren Stunden bis zu mehreren Jahren) und raeumlicher Skalen (Teilmodell Photosynthese auf

  10. Solid-phase extraction of Mn(II), Co(II), Ni(II), Cu(II), Cd(II) and Pb(II) ions from environmental samples by flame atomic absorption spectrometry (FAAS)

    Energy Technology Data Exchange (ETDEWEB)

    Duran, Celal [Department of Chemistry, Faculty of Art and Science, Karadeniz Technical University, 61080 Trabzon (Turkey); Gundogdu, Ali [Department of Chemistry, Faculty of Art and Science, Karadeniz Technical University, 61080 Trabzon (Turkey); Bulut, Volkan Numan [Department of Chemistry, Giresun Faculty of Art and Science, Karadeniz Technical University, 28049 Giresun (Turkey); Soylak, Mustafa [Department of Chemistry, Faculty of Art and Science, Erciyes University, 38039 Kayseri (Turkey)]. E-mail: soylak@erciyes.edu.tr; Elci, Latif [Department of Chemistry, Faculty of Art and Science, Pamukkale University, 20020 Denizli (Turkey); Sentuerk, Hasan Basri [Department of Chemistry, Faculty of Art and Science, Karadeniz Technical University, 61080 Trabzon (Turkey); Tuefekci, Mehmet [Department of Chemistry, Faculty of Art and Science, Karadeniz Technical University, 61080 Trabzon (Turkey)

    2007-07-19

    A new method using a column packed with Amberlite XAD-2010 resin as a solid-phase extractant has been developed for the multi-element preconcentration of Mn(II), Co(II), Ni(II), Cu(II), Cd(II), and Pb(II) ions based on their complex formation with the sodium diethyldithiocarbamate (Na-DDTC) prior to flame atomic absorption spectrometric (FAAS) determinations. Metal complexes sorbed on the resin were eluted by 1 mol L{sup -1} HNO{sub 3} in acetone. Effects of the analytical conditions over the preconcentration yields of the metal ions, such as pH, quantity of Na-DDTC, eluent type, sample volume and flow rate, foreign ions etc. have been investigated. The limits of detection (LOD) of the analytes were found in the range 0.08-0.26 {mu}g L{sup -1}. The method was validated by analyzing three certified reference materials. The method has been applied for the determination of trace elements in some environmental samples.

  11. TFOS DEWS II pathophysiology report.

    Science.gov (United States)

    Bron, Anthony J; de Paiva, Cintia S; Chauhan, Sunil K; Bonini, Stefano; Gabison, Eric E; Jain, Sandeep; Knop, Erich; Markoulli, Maria; Ogawa, Yoko; Perez, Victor; Uchino, Yuichi; Yokoi, Norihiko; Zoukhri, Driss; Sullivan, David A

    2017-07-01

    The TFOS DEWS II Pathophysiology Subcommittee reviewed the mechanisms involved in the initiation and perpetuation of dry eye disease. Its central mechanism is evaporative water loss leading to hyperosmolar tissue damage. Research in human disease and in animal models has shown that this, either directly or by inducing inflammation, causes a loss of both epithelial and goblet cells. The consequent decrease in surface wettability leads to early tear film breakup and amplifies hyperosmolarity via a Vicious Circle. Pain in dry eye is caused by tear hyperosmolarity, loss of lubrication, inflammatory mediators and neurosensory factors, while visual symptoms arise from tear and ocular surface irregularity. Increased friction targets damage to the lids and ocular surface, resulting in characteristic punctate epithelial keratitis, superior limbic keratoconjunctivitis, filamentary keratitis, lid parallel conjunctival folds, and lid wiper epitheliopathy. Hybrid dry eye disease, with features of both aqueous deficiency and increased evaporation, is common and efforts should be made to determine the relative contribution of each form to the total picture. To this end, practical methods are needed to measure tear evaporation in the clinic, and similarly, methods are needed to measure osmolarity at the tissue level across the ocular surface, to better determine the severity of dry eye. Areas for future research include the role of genetic mechanisms in non-Sjögren syndrome dry eye, the targeting of the terminal duct in meibomian gland disease and the influence of gaze dynamics and the closed eye state on tear stability and ocular surface inflammation. Copyright © 2017 Elsevier Inc. All rights reserved.

  12. HERBICIDAS INIBIDORES DO FOTOSSISTEMA II – PARTE II / PHOTOSYSTEM II INHIBITOR HERBICIDES - PART

    Directory of Open Access Journals (Sweden)

    ILCA P. DE F. E SILVA

    2013-11-01

    Full Text Available Os herbicidas inibidores do fotossistema II (PSII ligam-se ao sítio da QB localizado na proteína D1 o qual se localiza na membrana dos tilacóides dos cloroplastos, causando, o bloqueia do transporte de elétrons da QA para QB, tendo como consequência, a peroxidação dos lipídios. Os principais fatores que afetam a evolução da resistência de plantas daninhas aos herbicidas têm sido agrupados em: genéticos, bioecológicos e agronômicos. A resistência de plantas daninhas a herbicidas é definida como a habilidade de uma planta sobreviver e reproduzir, após exposição a uma dose de herbicida normalmente letal para um biótipo normal da planta. A seletividade de um herbicida está relacionada à capacidade de eliminar plantas daninhas sem interferir na qualidade da planta de interesse econômico.

  13. IGF-II receptors and IGF-II-stimulated glucose transport in human fat cells

    International Nuclear Information System (INIS)

    Sinha, M.K.; Buchanan, C.; Raineri-Maldonado, C.; Khazanie, P.; Atkinson, S.; DiMarchi, R.; Caro, J.F.

    1990-01-01

    Insulin-like growth factor II (IGF-II) receptors have been described in rat but not in human adipocytes. In both species, IGF-II has been reported to stimulate glucose transport by interacting with the insulin receptor. In this study, we have unequivocally demonstrated the presence of IGF-II receptors in human adipocytes. 125I-labeled IGF-II specifically binds to intact adipocytes, membranes, and lectin-purified detergent solubilized extracts. Through the use of 0.5 mM disuccinimidyl suberate, 125I-IGF-II is cross-linked to a 260-kDa protein that is identified as the IGF-II receptor by displacement experiments with unlabeled IGF-II, IGF-I, and insulin and either by immunoprecipitation or by Western blot analysis with mannose 6-phosphate receptor antibodies. The concentrations of IGF-II required for half-maximal and maximal stimulation of glucose transport in human adipocytes are 35 and 100 times more than that of insulin. The possibility of IGF-II stimulating glucose transport by interacting predominantly with the insulin receptor is suggested by the following: (1) the concentration of IGF-II that inhibits half of insulin binding is only 20 times more than that of insulin; (2) the lack of an additive effect of IGF-II and insulin for maximal stimulation of glucose transport; (3) the ability of monoclonal insulin receptor antibodies to decrease glucose transport stimulated by submaximal concentrations of both IGF-II and insulin; and (4) the ability of IGF-II to stimulate insulin receptor autophosphorylation albeit at a reduced potency when compared with insulin

  14. Use of APACHE II and SAPS II to predict mortality for hemorrhagic and ischemic stroke patients.

    Science.gov (United States)

    Moon, Byeong Hoo; Park, Sang Kyu; Jang, Dong Kyu; Jang, Kyoung Sool; Kim, Jong Tae; Han, Yong Min

    2015-01-01

    We studied the applicability of the Acute Physiology and Chronic Health Evaluation II (APACHE II) and Simplified Acute Physiology Score II (SAPS II) in patients admitted to the intensive care unit (ICU) with acute stroke and compared the results with the Glasgow Coma Scale (GCS) and National Institutes of Health Stroke Scale (NIHSS). We also conducted a comparative study of accuracy for predicting hemorrhagic and ischemic stroke mortality. Between January 2011 and December 2012, ischemic or hemorrhagic stroke patients admitted to the ICU were included in the study. APACHE II and SAPS II-predicted mortalities were compared using a calibration curve, the Hosmer-Lemeshow goodness-of-fit test, and the receiver operating characteristic (ROC) curve, and the results were compared with the GCS and NIHSS. Overall 498 patients were included in this study. The observed mortality was 26.3%, whereas APACHE II and SAPS II-predicted mortalities were 35.12% and 35.34%, respectively. The mean GCS and NIHSS scores were 9.43 and 21.63, respectively. The calibration curve was close to the line of perfect prediction. The ROC curve showed a slightly better prediction of mortality for APACHE II in hemorrhagic stroke patients and SAPS II in ischemic stroke patients. The GCS and NIHSS were inferior in predicting mortality in both patient groups. Although both the APACHE II and SAPS II systems can be used to measure performance in the neurosurgical ICU setting, the accuracy of APACHE II in hemorrhagic stroke patients and SAPS II in ischemic stroke patients was superior. Copyright © 2014 Elsevier Ltd. All rights reserved.

  15. Forced convection heat transfer in He II

    International Nuclear Information System (INIS)

    Kashani, A.

    1986-01-01

    An investigation of forced convection heat transfer in He II is conducted. The study includes both experimental and theoretical treatments of the problem. The experiment consists of a hydraulic pump and a copper flow tube, 3 mm in ID and 2m long. The system allows measurements of one-dimensional heat and mass transfer in He II. The heat transfer experiments are performed by applying heat at the midpoint along the length of the flow tube. Two modes of heat input are employed, i.e., step function heat input and square pulse heat input. The heat transfer results are discussed in terms of temperature distribution in the tube. The experimental temperature profiles are compared with numerical solutions of an analytical model developed from the He II energy equation. The bath temperature is set at three different values of 1.65, 1.80, and 1.95 K. The He II flow velocity is varied up to 90 cm/s. Pressure is monitored at each end of the flow tube, and the He II pressure drop is obtained for different flow velocities. Results indicate that He II heat transfer by forced convention is considerably higher than that by internal convection. The theoretical model is in close agreement with the experiment. He II pressure drop and friction factor are very similar to those of an ordinary fluid

  16. Role of dust in H II regions

    International Nuclear Information System (INIS)

    Sarazin, C.L.

    1975-01-01

    The purpose of this dissertation is to determine quantitatively the effects of U.V. absorbing dust on H II regions, and compare these effects with observations. Many observations indicate that dust grains are present within H II regions. An analytic theory is presented which describes all three of the effects of dust in H II regions. Although this model is relatively crude, it is useful in determining the approximate size of the modifications due to dust. In order to explore this problem more carefully, detailed numerical models of H II regions with dust were constructed. The ionization and thermal structure of these model H II regions is discussed. The observational consequences of the presence of dust are explored; the optical line intensities, radio continuum and line fluxes, and infrared emission of model H II regions with dust are given. These numerical models are compared with observations of diffuse nebulae. The optical line ratios are compared to several nearby bright H II regions, and it is found that the dust models may explain several anomalies in their spectrum

  17. Oxidation of Fe(II) in rainwater.

    Science.gov (United States)

    Willey, J D; Whitehead, R F; Kieber, R J; Hardison, D R

    2005-04-15

    Photochemically produced Fe(II) is oxidized within hours under environmentally realistic conditions in rainwater. The diurnal variation between photochemical production and reoxidation of Fe(II) observed in our laboratory accurately mimics the behavior of ferrous iron observed in field studies where the highest concentrations of dissolved Fe(ll) occur in afternoon rain during the period of maximum sunlight intensity followed by gradually decreasing concentrations eventually returning to early morning pre-light values. The experimental work presented here, along with the results of kinetics studies done by others, suggests thatthe primary process responsible for the decline in photochemically produced Fe(II) concentrations is oxidation by hydrogen peroxide. This reaction is first order with respect to both the concentrations of Fe(II) and H2O2. The second-order rate constant determined for six different authentic rain samples varied over an order of magnitude and was always less than or equal to the rate constant determined for this reaction in simple acidic solutions. Oxidation of photochemically produced ferrous iron by other oxidants including molecular oxygen, ozone, hydroxyl radical, hydroperoxyl/superoxide radical, and hexavalent chromium were found to be insignificant under the conditions present in rainwater. This study shows that Fe(II) occurs as at least two different chemical species in rain; photochemically produced Fe(II) that is oxidized over time periods of hours, and a background Fe(II) that is protected against oxidation, perhaps by organic complexation, and is stable against oxidation for days. Because the rate of oxidation of photochemically produced Fe(II) does not increase with increasing rainwater pH, the speciation of this more labile form of Fe(II) is also not controlled by simple hydrolysis reactions.

  18. Status Report on PEP-II Performance

    International Nuclear Information System (INIS)

    Matter, Regina S.

    2002-01-01

    PEP-II [1-9] is an e+e- collider with asymmetric energies (3.1 and 9 GeV, respectively) in a 2200 m tunnel at the Stanford Linear Accelerator Center. The collider produces B mesons to study a particle physics effect called CP violation as well as other physics topics. PEP-II was completed in 1998 with the first luminosity generated in July of that year. The installation of the BaBar Detector was finished in May 1999. The overall layout of PEP-II is shown in Figure 1 and the interaction region of PEP-II in Figure 2. The accelerator parameters and achievements of the High Energy Ring (HER) are listed in Table 1 and those for the Low Energy Ring (LER) in Table 2. The two beams collide at a single point in the IR2 hall where the BaBar detector is located. Beam parameters at the best luminosity are shown in Table 3 and PEP-II milestones in Table 4. In August 1999 PEP-II passed the world's record for luminosity which was 8.1x10 32 /cm 2 /s. The present luminosity in PEP-II is 2.15x10 33 /cm 2 /s which is 72% of the design. In June 2000 PEP-II delivered an integrated luminosity of 150 pb -1 in one day, which is above the design integrated luminosity per day of 135 pb -1 . Over the past year PEP-II has delivered over 12 fb -1 to BaBar. BaBar has logged over 11 pb -1 . The present plan is collide until the end of October 2000 followed by a three month installation period

  19. Synthesis and characterization of polychelates of Cu(II), Ni(II), Co(II), Mn(II), Zn(II), oxovanadium(IV) and dioxouranium(VI) with 2,4-dihydroxybenzaldehyde-urea-formaldehyde polymer

    International Nuclear Information System (INIS)

    Patel, G.C.; Pancholi, H.B.; Patel, M.M.

    1991-01-01

    Polychelates of Cu(II), Ni(II), Co(II), Mn(II), Zn(II), oxovandium(IV) and dioxouranium(VI) with 2,4-dihydroxybenzaldehyde (2,4-DB)-urea(U)-formaldehyde(F) polymer (2,4-DBUF) have been prepared. Elemental analyses of the polychelates indicate a metal:ligand ratio of 1:2. The structures of the polychelates have been assigned on the basis of their elemental analyses, IR, reflectance spectra, magnetic moment, thermal data and their electrical conductivity behaviour. (author). 1 tab., 18 refs

  20. Level II Ergonomic Analyses, Dover AFB, DE

    Science.gov (United States)

    1999-02-01

    IERA-RS-BR-TR-1999-0002 UNITED STATES AIR FORCE IERA Level II Ergonomie Analyses, Dover AFB, DE Andrew Marcotte Marilyn Joyce The Joyce...Project (070401881, Washington, DC 20503. 1. AGENCY USE ONLY (Leave blank) 2. REPORT DATE 4. TITLE AND SUBTITLE Level II Ergonomie Analyses, Dover...1.0 INTRODUCTION 1-1 1.1 Purpose Of The Level II Ergonomie Analyses : 1-1 1.2 Approach 1-1 1.2.1 Initial Shop Selection and Administration of the

  1. Overview of the SECOM II communications system

    International Nuclear Information System (INIS)

    Olson, W.D.

    1977-04-01

    The conversion of the SECOM system to the SECOM II configuration has been completed and all communications between the central control station and vehicles carrying nuclear weapons and special nuclear materials are being handled by the SECOM II system. A summary of the system characteristics and the improvements achieved over the all-voice system is shown. Through the combined efforts of ALO and Sandia personnel, the transition from SECOM to SECOM II was achieved with a minimum disruption to the operation of the ERDA transportation system

  2. Angiotensin II and Renal Tubular Ion Transport

    Directory of Open Access Journals (Sweden)

    Patricia Valles

    2005-01-01

    Evidence for the regulation of H+-ATPase activity in vivo and in vitro by trafficking/exocytosis has been provided. An additional level of H+-ATPase regulation via protein synthesis may be important as well. Recently, we have shown that both aldosterone and angiotensin II provide such a mechanism of regulation in vivo at the level of the medullary collecting tubule. Interestingly, in this part of the nephron, the effects of aldosterone and angiotensin II are not sodium dependent, whereas in the cortical collecting duct, both aldosterone and angiotensin II, by contrast, affect H+ secretion by sodium-dependent mechanisms.

  3. International cooperation at RTNS-II

    International Nuclear Information System (INIS)

    Logan, C.M.

    1984-02-01

    The Rotating Target Neutron Source-II (RTNS-II) facility at LLNL is a unique materials-test facility. It provides the most intense source of 14-MeV neutrons in the world. Dedicated operation in support of the fusion-materials-research community began in early 1979. Three years later, the Japanese Ministry of Education, Science, and Culture (Monbusho) and the US Department of Energy agreed to jointly support the RTNS-II operation and to share in the use of the facility

  4. LHC II system sensitivity to magnetic fluids

    CERN Document Server

    Cotae, Vlad

    2005-01-01

    Experiments have been designed to reveal the influences of ferrofluid treatment and static magnetic field exposure on the photosynthetic system II, where the light harvesting complex (LHC II) controls the ratio chlorophyll a/ chlorophyll b (revealing, indirectly, the photosynthesis rate). Spectrophotometric measurement of chlorophyll content revealed different influences for relatively low ferrofluid concentrations (10-30 mul/l) in comparison to higher concentrations (70-100 mul/l). The overlapped effect of the static magnetic field shaped better the stimulatory ferrofluid action on LHC II system in young poppy plantlets.

  5. Phase II clinical development of new drugs

    CERN Document Server

    Ting, Naitee; Ho, Shuyen; Cappelleri, Joseph C

    2017-01-01

    This book focuses on how to appropriately plan and develop a Phase II program, and how to design Phase II clinical trials and analyze their data. It provides a comprehensive overview of the entire drug development process and highlights key questions that need to be addressed for the successful execution of Phase II, so as to increase its success in Phase III and for drug approval. Lastly it warns project team members of the common potential pitfalls and offers tips on how to avoid them.

  6. Comparative analysis of Carnaval II Library

    International Nuclear Information System (INIS)

    Santos Bastos, W. dos

    1981-01-01

    The Carnaval II cross sections library from the french fast reactor calculation system is evaluated in two ways: 1 0 ) a comparative analysis of the calculations system for fast reactors at IEN (Instituto de Engenharia Nuclear) using a 'benchmark' model is done; 2 0 ) a comparative analysis in relation to the french system itself is also done, using calculations realized with two versions of the french library: the SETR-II and the CARNAVAL IV, the first one being anterior and the second one posterior to the Carnaval II version, the one used by IEN. (Author) [pt

  7. Synthesis, spectral characterization thermal stability, antimicrobial studies and biodegradation of starch–thiourea based biodegradable polymeric ligand and its coordination complexes with [Mn(II, Co(II, Ni(II, Cu(II, and Zn(II] metals

    Directory of Open Access Journals (Sweden)

    Nahid Nishat

    2016-09-01

    Full Text Available A biodegradable polymer was synthesized by the modification reaction of polymeric starch with thiourea which is further modified by transition metals, Mn(II, Co(II, Ni(II, Cu(II and Zn(II. All the polymeric compounds were characterized by (FT-IR spectroscopy, 1H NMR spectroscopy, 13C NMR spectroscopy, UV–visible spectra, magnetic moment measurements, thermogravimetric analysis (TGA and antibacterial activities. Polymer complexes of Mn(II, Co(II and Ni(II show octahedral geometry, while polymer complexes of Cu(II and Zn(II show square planar and tetrahedral geometry, respectively. The TGA revealed that all the polymer metal complexes are more thermally stable than their parental ligand. In addition, biodegradable studies of all the polymeric compounds were also carried out through ASTM-D-5338-93 standards of biodegradable polymers by CO2 evolution method which says that coordination decreases biodegradability. The antibacterial activity was screened with the agar well diffusion method against some selected microorganisms. Among all the complexes, the antibacterial activity of the Cu(II polymer–metal complex showed the highest zone of inhibition because of its higher stability constant.

  8. Synthesis and studies on Cu(II), Co(II), Ni(II) complexes of Knoevenagel β-diketone ligands

    Science.gov (United States)

    Sumathi, S.; Tharmaraj, P.; Sheela, C. D.; Anitha, C.

    2012-11-01

    Transition metal complexes of various acetylacetone based ligands of the type ML [where M = Cu(II), Ni(II), Co(II); L = 3-(aryl)-pentane-2,4-dione] have been synthesized. The structural features have been derived from their elemental analysis, magnetic susceptibility, molar conductance, IR, UV-Vis, 1H NMR, Mass and ESR spectral studies. Conductivity measurements reveal that all the complexes are non-electrolytic in nature. Spectroscopic and other analytical data of the complexes suggest octahedral geometry for other metal(II) complexes. The redox behavior of the copper(II) complexes have been studied by cyclic voltammetry. The free ligands and their metal complexes have been screened for their in vitro biological activities against the bacteria Pseudomonas aeruginosa, Escherichia coli and Staphylococcus aureus as well as the fungus Candida albicans by well diffusion method. The zone of inhibition value indicates that the most of the metal(II) complexes are found to possess increased activities compared to those of the free ligands. All synthesized compounds may serve as potential photoactive materials as indicated from their characteristic fluorescence properties. The second harmonic generation (SHG) efficiency of the ligands (L1-L3) was found to be considerable effect than that of urea and KDP (potassium dihydrogen phosphate).

  9. Pecan nutshell as biosorbent to remove Cu(II), Mn(II) and Pb(II) from aqueous solutions.

    Science.gov (United States)

    Vaghetti, Julio C P; Lima, Eder C; Royer, Betina; da Cunha, Bruna M; Cardoso, Natali F; Brasil, Jorge L; Dias, Silvio L P

    2009-02-15

    In the present study we reported for the first time the feasibility of pecan nutshell (PNS, Carya illinoensis) as an alternative biosorbent to remove Cu(II), Mn(II) and Pb(II) metallic ions from aqueous solutions. The ability of PNS to remove the metallic ions was investigated by using batch biosorption procedure. The effects such as, pH, biosorbent dosage on the adsorption capacities of PNS were studied. Four kinetic models were tested, being the adsorption kinetics better fitted to fractionary-order kinetic model. Besides that, the kinetic data were also fitted to intra-particle diffusion model, presenting three linear regions, indicating that the kinetics of adsorption should follow multiple sorption rates. The equilibrium data were fitted to Langmuir, Freundlich, Sips and Redlich-Peterson isotherm models. Taking into account a statistical error function, the data were best fitted to Sips isotherm model. The maximum biosorption capacities of PNS were 1.35, 1.78 and 0.946mmolg(-1) for Cu(II), Mn(II) and Pb(II), respectively.

  10. Concurrent hyperfractionated accelerated radiotherapy with 5-FU and once weekly cisplatin in locally advanced head and neck cancer. The 10-year results of a prospective phase II trial

    Energy Technology Data Exchange (ETDEWEB)

    Budach, V.; Boehmer, D.; Badakhshi, H.; Jahn, U.; Stromberger, C. [Campus Virchow Klinikum, Charite Universitaetsmedizin Berlin, Department for Radiooncology, Clinic for Radiooncology, Berlin (Germany); Becker, E.T. [Charite Universitaetsmedizin, Department of Otorhinolaryngology, Berlin (Germany); Wernecke, K.D. [Sostana Statistics GmbH, Charite Universitaetsmedizin Berlin, Berlin (Germany)

    2014-03-15

    In this study, the acute toxicity and long-term outcome of a hyperfractionated accelerated chemoradiation regimen with cisplatin/5-fluorouracil (5-FU) in patients with locally advanced squamous cell carcinomas of head and neck were evaluated. From 2000-2002, 38 patients with stage III (5.3 %) and stage IV (94.7 %) head and neck cancer were enrolled in a phase II study. Patients received hyperfractionated-accelerated radiotherapy with 72 Gy in 15 fractions of 2 Gy followed by 1.4 Gy twice daily with concurrent, continuous infusion 5-FU of 600 mg/m{sup 2} on days 1-5 and 6 cycles of weekly cisplatin (30 mg/m{sup 2}). Acute toxicities (CTCAEv2.0), locoregional control (LRC), metastases-free (MFS), and overall survival (OS) were analyzed and exploratively compared with the ARO 95-06 trial. Median follow-up was 11.4 years (95 % CI 8.6-14.2) and mean dose 71.6 Gy. Of the patients, 82 % had 6 (n = 15) or 5 (n = 16) cycles of cisplatin, 5 and 2 patients received 4 and 3 cycles, respectively. Grade 3 anemia, leukopenia, and thrombocytopenia were observed in 15.8, 15.8, and 2.6 %, respectively. Grade 3 mucositis in 50 %, grade 3 and 4 dysphagia in 55 and 13 %. The 2-, 5-, and 10-year LRC was 65, 53.6, and 48.2 %, the MFS was 77.5, 66.7, and 57.2 % and the OS 59.6, 29.2, and 15 %, respectively. Chemoradiation with 5-FU and cisplatin seems feasible and superior in terms of LRC and OS to the ARO 95-06C-HART arm at 2 years. However, this did not persist at the 5- and 10-year follow-ups. (orig.) [German] Untersuchung der Akuttoxizitaet und des Langzeitueberlebens einer hyperfraktioniert-akzelerierten simultanen Radiochemotherapie mit Cisplatin/5-Fluorouracil (5-FU) bei Patienten mit lokal fortgeschrittenen Kopf-Hals-Tumoren. Von 2000 bis 2002 wurden 38 Patienten mit Plattenepithelkarzinomen der Kopf-Hals-Region im Stadium III (5,3 %) und IV (94,7 %) eingeschlossen. Es erfolgte eine simultane hyperfraktionierte akzelerierte Radiochemotherapie mit 72 Gy in 15 Fraktionen a 2 Gy

  11. HPC Benchmark Suite NMx, Phase II

    Data.gov (United States)

    National Aeronautics and Space Administration — In the phase II effort, Intelligent Automation Inc., (IAI) and University of Central Florida (UCF) propose to develop a comprehensive numerical test suite for...

  12. NNDSS - Table II. Babesiosis to Campylobacteriosis

    Data.gov (United States)

    U.S. Department of Health & Human Services — NNDSS - Table II. Babesiosis to Campylobacteriosis - 2018. In this Table, provisional cases of selected notifiable diseases (≥1,000 cases reported during the...

  13. NNDSS - Table II. Cryptosporidiosis to Dengue

    Data.gov (United States)

    U.S. Department of Health & Human Services — NNDSS - Table II. Cryptosporidiosis to Dengue - 2015.In this Table, provisional cases of selected notifiable diseases (≥1,000 cases reported during the preceding...

  14. NNDSS - Table II. Cryptosporidiosis to Dengue

    Data.gov (United States)

    U.S. Department of Health & Human Services — NNDSS - Table II. Cryptosporidiosis to Dengue - 2016. In this Table, provisional* cases of selected† notifiable diseases (≥1,000 cases reported during the preceding...

  15. NNDSS - Table II. Shiga toxin to Shigellosis

    Data.gov (United States)

    U.S. Department of Health & Human Services — NNDSS - Table II. Shiga toxin to Shigellosis - 2015. In this Table, provisional cases of selected notifiable diseases (≥1,000 cases reported during the preceding...

  16. NNDSS - Table II. West Nile virus disease

    Data.gov (United States)

    U.S. Department of Health & Human Services — NNDSS - Table II. West Nile virus disease - 2015.In this Table, provisional cases of selected notifiable diseases (≥1,000 cases reported during the preceding year),...

  17. Murine Automated Urine Sampler (MAUS), Phase II

    Data.gov (United States)

    National Aeronautics and Space Administration — This SBIR Phase II effort involves the development of a novel rodent spaceflight habitat, focusing on care and monitoring of mice for gravitational physiology...

  18. It's Time to Rethink JPME II

    National Research Council Canada - National Science Library

    Feyedelem, Christopher

    2004-01-01

    .... Subsequent legislation created a two-phased approach to intermediate and senior level Joint Professional Military Education with Phase II being taught at the Joint Forces Staff College in Norfolk, Virginia...

  19. Training experience at Experimental Breeder Reactor II

    International Nuclear Information System (INIS)

    Driscoll, J.W.; McCormick, R.P.; McCreery, H.I.

    1978-01-01

    The EBR-II Training Group develops, maintains,and oversees training programs and activities associated with the EBR-II Project. The group originally spent all its time on EBR-II plant-operations training, but has gradually spread its work into other areas. These other areas of training now include mechanical maintenance, fuel manufacturing facility, instrumentation and control, fissile fuel handling, and emergency activities. This report describes each of the programs and gives a statistical breakdown of the time spent by the Training Group for each program. The major training programs for the EBR-II Project are presented by multimedia methods at a pace controlled by the student. The Training Group has much experience in the use of audio-visual techniques and equipment, including video-tapes, 35 mm slides, Super 8 and 16 mm film, models, and filmstrips. The effectiveness of these techniques is evaluated in this report

  20. Wavelets: Applications to Image Compression-II

    Indian Academy of Sciences (India)

    Wavelets: Applications to Image Compression-II. Sachin P ... successful application of wavelets in image com- ... b) Soft threshold: In this case, all the coefficients x ..... [8] http://www.jpeg.org} Official site of the Joint Photographic Experts Group.

  1. High Resolution Autostereoscopic Cockpit Display, Phase II

    Data.gov (United States)

    National Aeronautics and Space Administration — During this Phase II program Dimension Technologies Inc. (DTI) proposes to design and build an autostereoscopic (glasses-free 3D) LCD based aircraft cockpit display...

  2. The world's reactors No. 82: Atucha II

    International Nuclear Information System (INIS)

    Anon.

    1982-01-01

    Detailed information on Atucha II, a 745 MWe pressure-vessel PHWR, is presented in the form of a wall chart. Plant specifications and full colour cutaway drawings of the power station are included. (U.K.)

  3. ROSA-II test data report, 6

    International Nuclear Information System (INIS)

    1976-12-01

    Results of the ROSA-II test simulating a loss-of-coolant accident in a light water reactor (LWR) are presented, including the test conditions and interpretation of the phenomena for test runs 411, 314, 315 and 316. (auth.)

  4. Time-dependent, Bianchi II, rotating universe

    International Nuclear Information System (INIS)

    Reboucas, M.J.

    1981-01-01

    An exact cosmological solution of Einstein's equations which has time-dependent rotation is presented. The t-constant sections are of Bianchi type II. The source of this geometry is a fluid which has not been thermalized. (Author) [pt

  5. Pavement performance evaluation, phase II : data collection.

    Science.gov (United States)

    2008-12-01

    Phase I and II of this study tested approximately 1500 rehabilitated pavements (asphalt and PCC) : throughout the State. These pavements ranged from 5 to 15 years old and were intended to develop a : snapshot of how various rehabilitations were perfo...

  6. Manganese(II) chelate contrast media

    International Nuclear Information System (INIS)

    Rocklage, S.M.; Quay, S.C.

    1994-01-01

    New chelate forming compounds for use as contrast media in NMR imaging are described. Especially mentioned are manganese(II) ion chelates of N,N' dipyridoxaldiamine, N,N' diacetic acid, and salts and esters thereof. 1 fig

  7. NNDSS - Table II. Mumps to Rabies, animal

    Data.gov (United States)

    U.S. Department of Health & Human Services — NNDSS - Table II. Mumps to Rabies, animal - 2014.In this Table, all conditions with a 5-year average annual national total of more than or equals 1,000 cases but...

  8. NNDSS - Table II. Mumps to Rabies, animal

    Data.gov (United States)

    U.S. Department of Health & Human Services — NNDSS - Table II. Mumps to Rabies, animal - 2015.In this Table, provisional cases of selected notifiable diseases (≥1,000 cases reported during the preceding year),...

  9. NNDSS - Table II. Mumps to Rabies, animal

    Data.gov (United States)

    U.S. Department of Health & Human Services — NNDSS - Table II. Mumps to Rabies, animal - 2016. In this Table, provisional* cases of selected† notifiable diseases (≥1,000 cases reported during the preceding...

  10. NNDSS - Table II. Legionellosis to Malaria

    Data.gov (United States)

    U.S. Department of Health & Human Services — NNDSS - Table II. Legionellosis to Malaria - 2017. In this Table, provisional cases of selected notifiable diseases (≥1,000 cases reported during the preceding...

  11. NNDSS - Table II. Hepatitis (viral, acute) C

    Data.gov (United States)

    U.S. Department of Health & Human Services — NNDSS - Table II. Hepatitis (viral, acute) C - 2017. In this Table, provisional cases of selected notifiable diseases (≥1,000 cases reported during the preceding...

  12. NNDSS - Table II. Babesiosis to Campylobacteriosis

    Data.gov (United States)

    U.S. Department of Health & Human Services — NNDSS - Table II. Babesiosis to Campylobacteriosis - 2017. In this Table, provisional cases of selected notifiable diseases (≥1,000 cases reported during the...

  13. NNDSS - Table II. West Nile virus disease

    Data.gov (United States)

    U.S. Department of Health & Human Services — NNDSS - Table II. West Nile virus disease - 2017. In this Table, provisional cases of selected notifiable diseases (≥1,000 cases reported during the preceding year),...

  14. NNDSS - Table II. Giardiasis to Haemophilus influenza

    Data.gov (United States)

    U.S. Department of Health & Human Services — NNDSS - Table II. Giardiasis to Haemophilus influenza - 2017. In this Table, provisional cases of selected notifiable diseases (≥1,000 cases reported during the...

  15. NNDSS - Table II. Meningococcal to Pertussis

    Data.gov (United States)

    U.S. Department of Health & Human Services — NNDSS - Table II. Meningococcal to Pertussis - 2017. In this Table, provisional cases of selected notifiable diseases (≥1,000 cases reported during the preceding...

  16. NNDSS - Table II. Ehrlichiosis and Anaplasmosis

    Data.gov (United States)

    U.S. Department of Health & Human Services — NNDSS - Table II. Ehrlichiosis and Anaplasmosis - 2017. In this Table, provisional cases of selected notifiable diseases (≥1,000 cases reported during the preceding...

  17. NNDSS - Table II. Cryptosporidiosis to Dengue

    Data.gov (United States)

    U.S. Department of Health & Human Services — NNDSS - Table II. Cryptosporidiosis to Dengue - 2017. In this Table, provisional cases of selected notifiable diseases (≥1,000 cases reported during the preceding...

  18. NNDSS - Table II. Tetanus to Varicella

    Data.gov (United States)

    U.S. Department of Health & Human Services — NNDSS - Table II. Tetanus to Varicella - 2017. In this Table, provisional cases of selected notifiable diseases (≥1,000 cases reported during the preceding year),...

  19. NNDSS - Table II. Chlamydia to Coccidioidomycosis

    Data.gov (United States)

    U.S. Department of Health & Human Services — NNDSS - Table II. Chlamydia to Coccidioidomycosis - 2017. In this Table, provisional cases of selected notifiable diseases (≥1,000 cases reported during the...

  20. NNDSS - Table II. Salmonellosis to Shigellosis

    Data.gov (United States)

    U.S. Department of Health & Human Services — NNDSS - Table II. Salmonellosis to Shigellosis - 2017. In this Table, provisional cases of selected notifiable diseases (≥1,000 cases reported during the preceding...

  1. NNDSS - Table II. West Nile to Zika

    Data.gov (United States)

    U.S. Department of Health & Human Services — NNDSS - Table II. West Nile to Zika - 2018. In this Table, provisional cases of selected notifiable diseases (≥1,000 cases reported during the preceding year), and...

  2. Genetics Home Reference: mucopolysaccharidosis type II

    Science.gov (United States)

    ... but they typically live into adulthood and their intelligence is not affected. Heart disease and airway obstruction are major causes of death in people with both types of MPS II. Related Information What does it ...

  3. NNDSS - Table II. Babesiosis to Coccidioidomycosis

    Data.gov (United States)

    U.S. Department of Health & Human Services — NNDSS - Table II. Babesiosis to Coccidioidomycosis - 2014.In this Table, provisional cases of selected notifiable diseases (≥1,000 cases reported during the...

  4. Titanium Heat Pipe Thermal Plane, Phase II

    Data.gov (United States)

    National Aeronautics and Space Administration — The objective of the Phase II program is to complete the development of the titanium heat pipe thermal plane and establish all necessary steps for production of this...

  5. Oxygen-Methane Thruster, Phase II

    Data.gov (United States)

    National Aeronautics and Space Administration — Two main innovations will be developed in the Phase II effort that are fundamentally associated with our gaseous oxygen/gaseous methane RCS thruster. The first...

  6. Innovation in the Sky, Phase II

    Data.gov (United States)

    National Aeronautics and Space Administration — This Phase II proposal presents a scope of work to develop reliable Sense and Avoid for BVLOS Unmanned Aerial Vehicle [UAV] operations. We first analyze a) the...

  7. THE LIMITS OF BASEL II ACCORD

    OpenAIRE

    Zapodeanu Daniela; Gall Raluca Dorina

    2009-01-01

    Even though the actual Basel II Settlement has many advantages like: more transparent and detailed bank information, the rating systems, the internal models of evaluation for risks, the three pillars which represent a whole, an equitable bank competition,

  8. NNDSS - Table II. Giardiasis to Haemophilus influenza

    Data.gov (United States)

    U.S. Department of Health & Human Services — NNDSS - Table II. Giardiasis to Haemophilus influenza - 2014. In this Table, all conditions with a 5-year average annual national total of more than or equals 1,000...

  9. NNDSS - Table II. Giardiasis to Haemophilus influenza

    Data.gov (United States)

    U.S. Department of Health & Human Services — NNDSS - Table II. Giardiasis to Haemophilus influenza - 2018. In this Table, provisional cases of selected notifiable diseases (≥1,000 cases reported during the...

  10. NNDSS - Table II. Giardiasis to Haemophilus influenza

    Data.gov (United States)

    U.S. Department of Health & Human Services — NNDSS - Table II. Giardiasis to Haemophilus influenza - 2015.In this Table, provisional cases of selected notifiable diseases (≥1,000 cases reported during the...

  11. NNDSS - Table II. Giardiasis to Haemophilus influenza

    Data.gov (United States)

    U.S. Department of Health & Human Services — NNDSS - Table II. Giardiasis to Haemophilus influenza - 2016. In this Table, provisional* cases of selected† notifiable diseases (≥1,000 cases reported during the...

  12. NNDSS - Table II. Hepatitis (viral, acute)

    Data.gov (United States)

    U.S. Department of Health & Human Services — NNDSS - Table II. Hepatitis (viral, acute) - 2015.In this Table, provisional cases of selected notifiable diseases (≥1,000 cases reported during the preceding year),...

  13. NNDSS - Table II. Hepatitis (viral, acute)

    Data.gov (United States)

    U.S. Department of Health & Human Services — NNDSS - Table II. Hepatitis (viral, acute) - 2016. In this Table, provisional* cases of selected† notifiable diseases (≥1,000 cases reported during the preceding...

  14. NNDSS - Table II. Hepatitis (viral, acute)

    Data.gov (United States)

    U.S. Department of Health & Human Services — NNDSS - Table II. Hepatitis (viral, acute) - 2014.In this Table, all conditions with a 5-year average annual national total of more than or equals 1,000 cases but...

  15. NNDSS - Table II. Meningococcal disease to Pertussis

    Data.gov (United States)

    U.S. Department of Health & Human Services — NNDSS - Table II. Meningococcal disease to Pertussis - 2018. In this Table, provisional cases of selected notifiable diseases (≥1,000 cases reported during the...

  16. NNDSS - Table II. Chlamydia to Coccidioidomycosis

    Data.gov (United States)

    U.S. Department of Health & Human Services — NNDSS - Table II. Chlamydia to Coccidioidomycosis - 2016. In this Table, provisional* cases of selected† notifiable diseases (≥1,000 cases reported during the...

  17. NNDSS - Table II. Tetanus to Varicella

    Data.gov (United States)

    U.S. Department of Health & Human Services — NNDSS - Table II. Tetanus to Varicella - 2018. In this Table, provisional cases of selected notifiable diseases (≥1,000 cases reported during the preceding year),...

  18. Crew Cerebral Oxygen Monitor, Phase II

    Data.gov (United States)

    National Aeronautics and Space Administration — This Phase II SBIR proposal is aimed at developing a non-invasive, optical method for monitoring crew member state of awareness in operational environments. All...

  19. Transport with Astra in TJ-II

    International Nuclear Information System (INIS)

    Lopez-Bruna, D.; Castejon, F.; Fontdecaba, J. M.

    2004-01-01

    This report describes the adaptation of the numerical transport shell ASTRA for performing plasma calculations in the TJ-II stellarator device. Firstly, an approximation to the TJ-II geometry is made and a simple transport model is shared with two other codes in order to compare these codes (PROCTR, PRETOR-Stellarator) with ASTRA as calculation tool for TJ-II plasmas are provided: interpretative and predictive transport. The first consists in estimating the transport coefficients from real experimental data, thes being taken from three TJ-II discharges. The predictive facet is illustrated using a model that is able to includes self-consistently the dynamics of transport barriers. The report includes this model, written in the ASTRA programming language, to illustrate the use of ASTRA. (Author) 26 refs

  20. NNDSS - Table II. Invasive Pneumococcal to Legionellosis

    Data.gov (United States)

    U.S. Department of Health & Human Services — NNDSS - Table II. Invasive Pneumococcal to Legionellosis - 2014.In this Table, all conditions with a 5-year average annual national total of more than or equals...

  1. NNDSS - Table II. Legionellosis to Malaria

    Data.gov (United States)

    U.S. Department of Health & Human Services — NNDSS - Table II. Legionellosis to Malaria - 2018. In this Table, provisional cases of selected notifiable diseases (≥1,000 cases reported during the preceding...

  2. NNDSS - Table II. Lyme disease to Meningococcal

    Data.gov (United States)

    U.S. Department of Health & Human Services — NNDSS - Table II. Lyme disease to Meningococcal - 2015.In this Table, provisional cases of selected notifiable diseases (≥1,000 cases reported during the preceding...

  3. NNDSS - Table II. Lyme disease to Meningococcal

    Data.gov (United States)

    U.S. Department of Health & Human Services — NNDSS - Table II. Lyme disease to Meningococcal - 2014In this Table, all conditions with a 5-year average annual national total of more than or equals 1,000 cases...

  4. NNDSS - Table II. Lyme disease to Meningococcal

    Data.gov (United States)

    U.S. Department of Health & Human Services — NNDSS - Table II. Lyme disease to Meningococcal - 2016. In this Table, provisional* cases of selected† notifiable diseases (≥1,000 cases reported during the...

  5. Silver Biocide Analysis & Control Device, Phase II

    Data.gov (United States)

    National Aeronautics and Space Administration — Rapid, accurate measurement and process control of silver ion biocide concentrations in future space missions is needed. The purpose of the Phase II program is to...

  6. NNDSS - Table II. Salmonellosis to Shigellosis

    Data.gov (United States)

    U.S. Department of Health & Human Services — NNDSS - Table II. Salmonellosis to Shigellosis - 2014.In this Table, all conditions with a 5-year average annual national total of more than or equals 1,000 cases...

  7. NNDSS - Table II. West Nile virus disease

    Data.gov (United States)

    U.S. Department of Health & Human Services — NNDSS - Table II. West Nile virus disease - 2016. In this Table, provisional* cases of selected† notifiable diseases (≥1,000 cases reported during the preceding...

  8. TRUPACT-II container maintenance program plan

    International Nuclear Information System (INIS)

    1990-01-01

    This document details the maintenance/repair and replacement of components, as well as the documentation required and the procedures to be followed to maintain the integrity of the TRUPACT-II container

  9. NNDSS - Table II. Rubella to Salmonellosis

    Data.gov (United States)

    U.S. Department of Health & Human Services — NNDSS - Table II. Rubella to Salmonellosis - 2016. In this Table, provisional* cases of selected† notifiable diseases (≥1,000 cases reported during the preceding...

  10. TJ-II Library Manual (Version 2)

    International Nuclear Information System (INIS)

    Tribaldos, V.; Milligen, B. Ph. van; Lopez-Fraguas, A.

    2001-01-01

    This is a manual of use of the TJ2 Numerical Library that has been developed for making numerical computations of different TJ-II configurations. This manual is a new version of the earlier manual CIEMAT report 806. (Author)

  11. Aleksi II kritikujet "Kod da Vintshi"

    Index Scriptorium Estoniae

    2006-01-01

    Dan Browni samanimelise romaani järgi valminud põnevusfilm "Da Vinci kood" : režissöör Ron Howard : Ameerika Ühendriigid 2006. Venemaa patriarh Aleksius II nimetas filmi linastamist lugupidamatuseks moraalinormide vastu

  12. Overviews of EMRAS I and II

    International Nuclear Information System (INIS)

    Kawaguchi, Isao

    2011-01-01

    Recently there has been attracting growing interest in impacts of irradiation to wildlife organisms. In IAEA, biota dosimetry working group (BWG) was established in Environmental Modeling for Radiation Safety (EMRAS) program, which aimed to intercompare biota dose assessment models to validate their assumptions and estimations. After EMRAS program finished, new program which is referred as EMRAS II was set on January 2009. In EMRAS II, there are three themes, and 9 working groups were established. One of three themes is related to environmental protection, and three working groups (Biota modeling, wildlife transfer coefficient handbook, biota dose effects modeling) were constituted in it. In this report, activities of EMRAS I BWG and EMRAS II theme II are summarized. (author)

  13. Stability constants of glutarate complexes of copper(II), zinc(II), cobalt(II) and uranyl(II) by paper electrophoresis

    International Nuclear Information System (INIS)

    Singh, R.K.P.; Yadava, J.R.; Yadava, K.L.

    1981-01-01

    Stability constants of Copper(II), Zinc(II), Cobalt(II) and Uranyl(II) glutarates have been determined by paper electrophoresis. Glutaric acid (0.005 mol dmsup(-3)) was added to the background electrolyte : 0.1 mol dmsup(-3) HClO 4 . The proportions of (CH 2 ) 3 COOH COO - and (CH 2 ) 3 C 2 O 4 2- were varied by changing the pH of the electrolyte. These anions yielded the complexes Cu(CH 2 ) 3 C 2 O 4 , [Zn(CH 2 ) 3 COOH COO] + [Co(CH 2 ) 3 COOH COO] + and UO 2 (CH 2 ) 3 C 2 O 4 whose stability constants are found to be 10sup(3.9), 10sup(2.9), 10sup(2.7) and 10sup(13.5) respectively. (author)

  14. NNDSS - Table II. Ehrlichiosis/Anaplasmosis

    Data.gov (United States)

    U.S. Department of Health & Human Services — NNDSS - Table II. Ehrlichiosis/Anaplasmosis - 2015.In this Table, provisional cases of selected notifiable diseases (≥1,000 cases reported during the preceding...

  15. NNDSS - Table II. Tetanus to Vibriosis

    Data.gov (United States)

    U.S. Department of Health & Human Services — NNDSS - Table II. Tetanus to Vibriosis - 2016. In this Table, provisional* cases of selected† notifiable diseases (≥1,000 cases reported during the preceding year),...

  16. NNDSS - Table II. Shiga toxin to Shigellosis

    Data.gov (United States)

    U.S. Department of Health & Human Services — NNDSS - Table II. Shiga toxin to Shigellosis - 2016. In this Table, provisional* cases of selected† notifiable diseases (≥1,000 cases reported during the preceding...

  17. NNDSS - Table II. Babesiosis to Campylobacteriosis

    Data.gov (United States)

    U.S. Department of Health & Human Services — NNDSS - Table II. Babesiosis to Campylobacteriosis - 2016. In this Table, provisional* cases of selected† notifiable diseases (≥1,000 cases reported during the...

  18. NNDSS - Table II. Babesiosis to Campylobacteriosis

    Data.gov (United States)

    U.S. Department of Health & Human Services — NNDSS - Table II. Babesiosis to Campylobacteriosis - 2015.In this Table, provisional cases of selected notifiable diseases (≥1,000 cases reported during the...

  19. NNDSS - Table II. Rubella to Salmonellosis

    Data.gov (United States)

    U.S. Department of Health & Human Services — NNDSS - Table II. Rubella to Salmonellosis - 2015.In this Table, provisional cases of selected notifiable diseases (≥1,000 cases reported during the preceding year),...

  20. NNDSS - Table II. Tetanus to Vibriosis

    Data.gov (United States)

    U.S. Department of Health & Human Services — NNDSS - Table II. Tetanus to Vibriosis - 2015.In this Table, provisional cases of selected notifiable diseases (≥1,000 cases reported during the preceding year), and...

  1. NNDSS - Table II. Chlamydia to Coccidioidomycosis

    Data.gov (United States)

    U.S. Department of Health & Human Services — NNDSS - Table II. Chlamydia to Coccidioidomycosis - 2015.In this Table, provisional cases of selected notifiable diseases (≥1,000 cases reported during the preceding...

  2. NNDSS - Table II. Ehrlichiosis/Anaplasmosis

    Data.gov (United States)

    U.S. Department of Health & Human Services — NNDSS - Table II. Ehrlichiosis/Anaplasmosis - 2016. In this Table, provisional* cases of selected† notifiable diseases (≥1,000 cases reported during the preceding...

  3. NNDSS - Table II. Invasive Pneumococcal to Legionellosis

    Data.gov (United States)

    U.S. Department of Health & Human Services — NNDSS - Table II. Invasive Pneumococcal to Legionellosis - 2015.In this Table, provisional cases of selected notifiable diseases (≥1,000 cases reported during the...

  4. NNDSS - Table II. Invasive Pneumococcal to Legionellosis

    Data.gov (United States)

    U.S. Department of Health & Human Services — NNDSS - Table II. Invasive Pneumococcal to Legionellosis - 2016. In this Table, provisional* cases of selected† notifiable diseases (≥1,000 cases reported during the...

  5. NSLS-II Radio Frequency Systems

    Energy Technology Data Exchange (ETDEWEB)

    Rose J.; Gao F.; Goel, A.; Holub, B.; Kulpin, J.; Marques, C.; Yeddulla, M.

    2015-05-03

    The National Synchrotron Light Source II is a 3 GeV X-ray user facility commissioned in 2014. The NSLS-II RF system consists of the master oscillator, digital low level RF controllers, linac, booster and storage ring RF sub-systems, as well as a supporting cryogenic system. Here we will report on RF commissioning and early operation experience of the system.

  6. SATA II - Stochastic Algebraic Topology and Applications

    Science.gov (United States)

    2017-01-30

    AFRL-AFOSR-UK-TR-2017-0018 SATA II - Stochastic Algebraic Topology and Applications 150032 Robert Adler TECHNION ISRAEL INSTITUTE OF TECHNOLOGY Final...REPORT TYPE Final 3. DATES COVERED (From - To) 15 Dec 2014 to 14 Dec 2016 4. TITLE AND SUBTITLE SATA II - Stochastic Algebraic Topology and Applications... Topology and Applications Continuation of, and associated with SATA: Stochastic Algebraic Topology and Applications FA8655-11-1-3039, 09/1/2011–08/31/2014

  7. Military Family Coping Project - Phase II

    Science.gov (United States)

    2015-05-01

    Anxiety, Life Satisfaction , Addiction, Trauma 4 The Military Family Coping Project reflects two phases. The first consisted of a series of focus...need for and guided the work of the Military Family Coping Project Phase II funded by TATRC. The Military Family Coping Project Phase II was...solidarity. For the purposes of family functioning analyses, married and unmarried soldiers were analyzed separately because marital status affects

  8. EBR-II: summary of operating experience

    International Nuclear Information System (INIS)

    Perry, W.H.; Leman, J.D.; Lentz, G.L.; Longua, K.J.; Olson, W.H.; Shields, J.A.; Wolz, G.C.

    1978-01-01

    Experimental Breeder Reactor II (EBR-II) is an unmoderated, sodium-cooled reactor with a design power of 62.5 MWt. The primary cooling system is a submerged-pool type. The early operation of the reactor successfully demonstrated the feasibility of a sodium-cooled fast breeder reactor operating as an integrated reactor, power plant, and fuel-processing facility. In 1967, the role of EBR-II was reoriented from a demonstration plant to an irradiation facility. Many changes have been made and are continuing to be made to increase the usefulness of EBR-II for irradiation and safety tests. A review of EBR-II's operating history reveals a plant that has demonstrated high availability, stable and safe operating characteristics, and excellent performance of sodium components. Levels of radiation exposure to the operating and maintenance workers have been low; and fission-gas releases to the atmosphere have been minimal. Driver-fuel performance has been excellent. The repairability of radioactive sodium components has been successfully demonstrated a number of times. Recent highlights include installation and successful operation of (1) the hydrogen-meter leak detectors for the steam generators, (2) the cover-gas-cleanup system and (3) the cesium trap in the primary sodium. Irradiations now being conducted in EBR-II include the run-beyond-cladding breach fuel tests for mixed-oxide and carbide elements. Studies are in progress to determine EBR-II's capability for conducting important ''operational safety'' tests. These tests would extend the need and usefulness of EBR-II into the 1980's

  9. Performance of dipole magnets in helium II

    International Nuclear Information System (INIS)

    Althaus, R.; Caspi, S.; Gilbert, W.S.; Hassenzahl, W.; Meuser, R.; Rechen, J.; Taylor, C.; Warren, R.

    1981-03-01

    Data from tests in He II of four 1-meter-long magnets are presented. The maximum quench current is increased up to 30 percent, compared with tests in He I. Data from calorimetric measurements of heat generated during cyclic operation are presented. Quenches were induced by heaters placed near the conductor, and the energy required to induce quenches in He II and in He I are compared

  10. ANADP II Program Committee Closing Remarks 2013

    OpenAIRE

    Program Committee

    2014-01-01

    Aligning National Approaches to Digital Preservation: An Action Assembly Biblioteca de Catalunya (National Library of Catalonia) November 18-20, 2013, Barcelona, Spain summary The Aligning National Approaches to Digital Preservation (ANADP) II Action Assembly will align digital preservation efforts internationally between communities—including national libraries, academic libraries, public libraries, research centers, archives, corporations, and funding agencies. ANADP II will be a highly par...

  11. Química general II

    OpenAIRE

    Olba Torrent, Amparo

    2018-01-01

    El document forma part dels materials docents programats mitjançant l'ajut del Servei de Política Lingüística de la Universitat de València Temes de l'assignatura: Química general II del primer curs del Grau de Química Topics of the course: General Chemistry II in the first year of the Degree in Chemistry

  12. TFOS DEWS II Report Executive Summary.

    Science.gov (United States)

    Craig, Jennifer P; Nelson, J Daniel; Azar, Dimitri T; Belmonte, Carlos; Bron, Anthony J; Chauhan, Sunil K; de Paiva, Cintia S; Gomes, José A P; Hammitt, Katherine M; Jones, Lyndon; Nichols, Jason J; Nichols, Kelly K; Novack, Gary D; Stapleton, Fiona J; Willcox, Mark D P; Wolffsohn, James S; Sullivan, David A

    2017-10-01

    This article presents an Executive Summary of the conclusions and recommendations of the 10-chapter TFOS DEWS II report. The entire TFOS DEWS II report was published in the July 2017 issue of The Ocular Surface. A downloadable version of the document and additional material, including videos of diagnostic and management techniques, are available on the TFOS website: www.TearFilm.org. Copyright © 2017 Elsevier Inc. All rights reserved.

  13. Emodin (1,3,8-trihydroxy-6-methylanthraquinone): a spectrophotometric reagent for the determination of beryllium(II), magnesium(II) and calcium(II)

    International Nuclear Information System (INIS)

    Pal, T.; Jana, N.R.

    1993-01-01

    The individual determination of Be II , Mg II or Ca II by conventional spectrophotometry and simultaneous determination of Mg II and Ca II in mixtures by first-derivative spectrophotometry are possible at trace levels, using emodin (1,3,8-trihydroxy-6-methylanthraquinone) as spectrophotometric reagent. Interference from other metal species, application of these methods to rock samples and statistical analysis of the results are discussed. (author)

  14. The H II regions of IC 1613

    International Nuclear Information System (INIS)

    Hodge, P.; Lee, M.G.; Gurwell, M.

    1990-01-01

    Narrow-band CCD H-alpha imaging of the Local Group irregular galaxy IC 1613 has revealed a total of 77 H II regions, five of which are complexes of several smaller emission regions. Positions, H-alpha luminosities, and sizes of these objects are tabulated. The H-alpha luminosity function has the same shape as that for more luminous galaxies, following a power law with an exponent of -1.6. The faintest H II regions are at the low-luminosity end of the generally observed luminosity function for H II regions in galaxies, with fluxes of only 10 to the 35th erg/sec. The size distribution has an exponential shape, as for other galaxies, with a size scale of 56 pc. The morphologies of different H II regions are discussed and compared to those in other galaxies. Published radio continuum maps compare well with the H-alpha emission distribution. The distribution of H I is also similar in the central areas to the H II with, however, a tendency for the H II regions to lie to one side of H I peaks. 31 refs

  15. Differential Effect of Solution Conditions on the Conformation of the Actinoporins Sticholysin II and Equinatoxin II

    Directory of Open Access Journals (Sweden)

    EDSON V.F. FAUTH

    2014-12-01

    Full Text Available Actinoporins are a family of pore-forming proteins with hemolytic activity. The structural basis for such activity appears to depend on their correct folding. Such folding encompasses a phosphocholine binding site, a tryptophan-rich region and the activity-related N-terminus segment. Additionally, different solution conditions are known to be able to influence the pore formation by actinoporins, as for Sticholysin II (StnII and Equinatoxin II (EqtxII. In this context, the current work intends to characterize the influence of distinct solution conditions in the conformational behavior of these proteins through molecular dynamics (MD simulations. The obtained data offer structural insights into actinoporins dynamics in solution, characterizing its conformational behavior at the atomic level, in accordance with previous experimental data on StnII and EqtxII hemolytic activities.

  16. Adsorption study of cadmium (II) and lead (II) on radish peels

    International Nuclear Information System (INIS)

    Anwar, J.; Shafique, U.; Salman, M.; Zaman, W.; Memoona, M.

    2009-01-01

    The removal efficiency of heavy metals like Cd(II) and Pb(II) from aqueous solutions by adsorption on Raphanus sativus (Radish peels) has been studied. The effects of time, pH, concentration of adsorbent and agitation speed on adsorption have been evaluated. It is found that radish peels powder has high removal efficiency for both the metals. Batch adsorption study has shown that Cd(II) and Pb(II) has been removed up to 88% and 86% respectively. Adsorption equilibriums for both metals have been described by the Langmuir isotherm. The maximum amount of heavy metals (Q ) adsorbed at max equilibrium were 7.5 and 1.23 mg/g for Cd(II) and Pb(II) respectively as evaluated by Langmuir isotherm. It is concluded that waste materials like radish peels can be used for removal of heavy metals from aqueous streams. (author)

  17. Spectrophotometric determination of cobalt(II), nickel(II) and copper (II) with 1-(2 pyridylazo)-2-naphthol in micellar medium

    International Nuclear Information System (INIS)

    Shar, G.A.; Soomro, G.A.

    2004-01-01

    Spectrophotometric determination of cobalt(II), nickel(II) and copper(II) is carried out with 1-(2 pyridylazo)-2-naphthol as a complexing reagent in aqueous phase using non-ionic surfactant Tween 80. Beer's law is obeyed for Co(II), Ni(II) and Cu(II) over the range 0.5 - 4.0, 0.5 - 4.0 and 0.5 - 3.0 ngmL/sup -1/ with detection limit (2 σ) of 6.7, 3.2 and 3.9 ngmL/sup -1/. The max molar absorption, molar absorptivity, Sandell's sensitivity of Co(II), Ni(II) and Cu(II) are 580 nm, 570 nm and 555 nm; max (104 mol/sup -1/ cm /sup -1/) is 0.87, 1.8 and 1.6 and 6.8, 3.3 and 3.9 ng cm-2 respectively. The pH at which complex is formed for Co(II), Ni(II) and Cu(II) is 5, 5.5 and 6.5 respectively. The critical micelle concentration (CMC) of Tween 80 is 5%. The present method is compared with that of atomic absorption spectroscopy and no significant difference is noted between the two methods at 95% confidence level. The method has been applied to the determination of Co(II), Ni(II) and Cu(II) in industrial waste water and pharmaceutical samples. (author)

  18. Microcephalic osteodysplastic primordial dwarfism type II (MOPD II) with multiple vascular complications misdiagnosed as Dubowitz syndrome

    OpenAIRE

    Dieks, Jana-Katharina; Baumer, Alessandra; Wilichowski, Ekkehard; Rauch, Anita; Sigler, Matthias

    2014-01-01

    To date, the genetic basis of Dubowitz syndrome (short stature, microcephaly, facial abnormalities, eczema) is unknown and vascular complications are not known to be associated with this syndrome. In microcephalic osteodysplastic primordial dwarfism type II (MOPD II; disproportionate short statue, microcephaly, facial abnormalities), however, cerebral aneurysms and other vascular abnormalities are frequent complications. MOPD II is a genetic disorder caused by mutations in the pericentrin (PC...

  19. Removal of nickel(II and palladium(II from surface waters

    Directory of Open Access Journals (Sweden)

    V. Sharifzade

    2013-04-01

    Full Text Available A new sorbent was prepared using alumina and 5-Br-PADAP, and its adsorption ability for the removal of Ni(II and Pd(II from different waters was investigated. The procedure is based on retention of the analytes on the alumina load with 5-Br-PADAP at pH ~ 6. The separation/preconcentration conditions for the quantitative recoveries were investigated. The limit of detections (LOD based on three times the standard deviations of the blank, were 0.187 and 0.253 ng mL-1 for Ni(II and Pd(II, respectively. Obtained sorption capacities for 1 g sorbent were 6.0 mg Ni(II and 11.0 mg Pd(II. The linearity was maintained in the concentration range of 0.625 to 6.0 ng mL-1 for Ni(II and 0.416 to 7.0 ng mL-1 for Pd(II in the original solution. Eight replicate determinations of a mixture containing 2.0 µg mL-1 each of the elements in the final solution gave relative standard deviation of ±0.82 and ±1.12% for Ni(II and Pd(II, respectively. The proposed method was successfully applied to the determination trace amounts of Ni(II and Pd(II in the surface water samples.DOI: http://dx.doi.org/10.4314/bcse.v27i1.2

  20. Interaction of Cr (III), Ni (II), Pb (II) with DTPA complexes of essential metal ions

    International Nuclear Information System (INIS)

    Gulzar, S.; Zahida; Maqsood, T.; Naqvi, R.R.

    2002-01-01

    With the increase of anthropogenic activities in the environment, heavy metal toxicity (Chromium, Nickel and Lead) is more common now. DTPA (diethylene triamine pentaacetic acid) a polyamino carboxylic acid is widely used to form hydrophilic and stable complexes with most of the metal ions. In this spectrophotometric study, concentration of Cr(III), Ni(II) and Pb(II) (toxic metal ions) exchanged with Fe(III), Zn(II) and Ca(II) from their DTPA complexes were estimated at pH 4,7 and 9. Concentration of added metal was varied from 1-4 times to that of complexed metal. (author)

  1. SEPARATION OF Fe (III, Cr(III, Cu(II, Ni(II, Co(II, AND Pb(II METAL IONS USING POLY(EUGENYL OXYACETIC ACID AS AN ION CARRIER BY A LIQUID MEMBRANE TRANSPORT METHOD

    Directory of Open Access Journals (Sweden)

    La Harimu

    2010-06-01

    Full Text Available Fe (III, Cr(III, Cu(II, Ni(II, Co(II, and Pb(II  metal ions had been separated using poly(eugenyl oxyacetic acid as an ion carrier by bulk liquid membrane transport method. The effect of pH, polyeugenyl oxyacetic acid ion carrier concentration, nitric acid concentration in the stripping solution, transport time, and metal concentration were optimized. The result showed that the optimum condition for transport of metal ions was at pH 4 for ion Fe(III and at pH 5 for Cr(III, Cu(II, Ni(II, Co(II, and Pb(II ions. The carrier volumes were optimum with concentration of 1 x 10-3 M at 7.5 mL for Cr(III, Cu (II,  Ni(II, Co(II ions and at 8.5 mL for Fe(III and Pb(II ions. The concentration of HNO3 in stripping phase was optimum at 2 M for Fe(III and Cu(II ions, 1 M for Cr(III, Ni(II and Co(II ions, and 0.5 M for Pb(II ion. The optimum transport times were 36 h for Fe(III and Co(II ions, and 48 h for Cr(III, Cu (II, Ni(II, and Pb(II ions. The concentration of metal ions accurately transported were 2.5 x 10-4 M for Fe(III and Cr(III ions, and 1 M for Cu (II, Ni(II, Co(II, and Pb(II ions. Compared to other metal ions the transport of Fe(III was the highest with selectivity order of Fe(III > Cr(III > Pb(II > Cu(II > Ni(II > Co(II. At optimum condition, Fe(III ion was transported through the membrane at 46.46%.   Keywords: poly(eugenyl oxyacetic acid, transport, liquid membrane, Fe (III, Cr(III, Cu(II, Ni(II, Co(II, and Pb(II ions

  2. The physics design of EBR-II

    International Nuclear Information System (INIS)

    Loewenstein, W.B.

    1962-01-01

    The physics design oi EBR-II. Calculations of the static, dynamic and long-term reactivity behaviour of EBR-II are reported together with results and analysis of EBR-II dry critical and ZPR-III mock-up experiments. Particular emphasis is given to reactor-physics design problems which arise after the conceptual design is established and before the reactor is built or placed into operation. Reactor-safety analyses and hazards-evaluation considerations are described with their influence on the reactor design. The manner of utilizing the EBR-II mock-up on ZPR-III data and the EBR-II dry critical data is described. These experiments, their analysis and theoretical predictions are the basis for predetermining the physics behaviour of the reactor system. The limitations inherent in applying the experimental data to the performance of the power-reactor system are explored in some detail. This includes the specification of reactor core size and/or fuel-alloy enrichment, provisions for adequate operating and shut-down reactivity, determination of operative temperature and power coefficients of reactivity, and details of power- and flux-distribution as a function of position within the reactor structure. The overall problem of transferring information from simple idealized analytical or experimental geometry to actual hexagonal reactor geometry is described. Nuclear performance, including breeding, of the actual reactor system is compared with that of the idealized conceptual system. The long-term reactivity and power behaviour of the reactor blanket is described within the framework of the proposed cycling of the fuel and blanket alloy. Safety considerations, including normal and abnormal rates of reactivity-insertion, the implication of postulated reactivity effects based on the physical behaviour of the fuel alloy and reactor structure as well as extrapolation of TREAT experiments to the EBR-II system are analysed. The EBR-II core melt-down problem is reviewed. (author

  3. Accentuated hyperparathyroidism in type II Bartter syndrome.

    Science.gov (United States)

    Landau, Daniel; Gurevich, Evgenia; Sinai-Treiman, Levana; Shalev, Hannah

    2016-07-01

    Bartter syndrome (BS) may be associated with different degrees of hypercalciuria, but marked parathyroid hormone (PTH) abnormalities have not been described. We compared clinical and laboratory data of patients with either ROMK-deficient type II BS (n = 14) or Barttin-deficient type IV BS (n = 20). Only BS-IV patients remained mildly hypokalemic in spite of a higher need for potassium supplementation. Estimated glomerular filtration rate (eGFR) was mildly decreased in only four BS-IV patients. Average PTH values were significantly higher in BS-II (160.6 ± 85.8 vs. 92.5 ± 48 pg/ml in BS-IV, p = 0.006). In both groups, there was a positive correlation between age and log(PTH). Levels of 25(OH) vitamin D were not different. Total serum calcium was lower (within normal limits) and age-related serum phosphate (Pi)-SDS was increased in BS-II (1.19 ± 0.71 vs. 0.01 ± 1.04 in BS-IV, p < 0.001). The GFR threshold for Pi reabsorption was higher in BS-II (5.63 ± 1.25 vs. 4.36 ± 0.98, p = 0.002). Spot urine calcium/creatinine ratio and nephrocalcinosis rate (100 vs. 16 %) were higher in the BS-II group. PTH, serum Pi levels, and urinary threshold for Pi reabsorption are significantly elevated in type II vs. type IV BS, suggesting a PTH resistance state. This may be a response to more severe long-standing hypercalciuria, leading to a higher rate of nephrocalcinosis in BS-II.

  4. Removal of Pb(II), Cu(II) and Cd(II) from aqueous solution by some fungi and natural adsorbents in single and multiple metal systems

    International Nuclear Information System (INIS)

    Shoaib, A.; Badar, T.; Aslam, N.

    2011-01-01

    Six fungal and 10 natural biosorbents were analyzed for their Cu(II), Cd(II) and Pb(II) uptake capacity from single, binary and ternary metal ion system. Preliminary screening biosorption of assays revealed 2 fungi (Aspergillus niger and Cunninghamella echinulata) and three natural [Cicer arietinum husk, Moringa oleifera flower and soil (clay)] adsorbents hold considerable high adsorption efficiency and capacity for 3 meta l ions amongst the adsorbents. Further biosorption trials with five elected adsorbents showed a considerable reduction in metal uptake capability of adsorbents in binary- and ternary systems as compared to singly metal system. Cd(II) manifested the highest inhibitory effect on the biosorption of other metal ions, followed by Pb(II) and Cu(II). On account of metal preference, the selectivity order for metal ion towards the studied biomass matrices was Pb(II) (40-90%) > Cd(II) (2-53%) > Cu(II) (2-30%). (author)

  5. Structural properties of MHC class II ligands, implications for the prediction of MHC class II epitopes.

    Directory of Open Access Journals (Sweden)

    Kasper Winther Jørgensen

    2010-12-01

    Full Text Available Major Histocompatibility class II (MHC-II molecules sample peptides from the extracellular space allowing the immune system to detect the presence of foreign microbes from this compartment. Prediction of MHC class II ligands is complicated by the open binding cleft of the MHC class II molecule, allowing binding of peptides extending out of the binding groove. Furthermore, only a few HLA-DR alleles have been characterized with a sufficient number of peptides (100-200 peptides per allele to derive accurate description of their binding motif. Little work has been performed characterizing structural properties of MHC class II ligands. Here, we perform one such large-scale analysis. A large set of SYFPEITHI MHC class II ligands covering more than 20 different HLA-DR molecules was analyzed in terms of their secondary structure and surface exposure characteristics in the context of the native structure of the corresponding source protein. We demonstrated that MHC class II ligands are significantly more exposed and have significantly more coil content than other peptides in the same protein with similar predicted binding affinity. We next exploited this observation to derive an improved prediction method for MHC class II ligands by integrating prediction of MHC- peptide binding with prediction of surface exposure and protein secondary structure. This combined prediction method was shown to significantly outperform the state-of-the-art MHC class II peptide binding prediction method when used to identify MHC class II ligands. We also tried to integrate N- and O-glycosylation in our prediction methods but this additional information was found not to improve prediction performance. In summary, these findings strongly suggest that local structural properties influence antigen processing and/or the accessibility of peptides to the MHC class II molecule.

  6. Spectroscopic evaluation of Co(II), Ni(II) and Cu(II) complexes derived from thiosemicarbazone and semicarbazone

    Science.gov (United States)

    Chandra, Sulekh; Kumar, Anil

    2007-12-01

    Co(II), Ni(II) and Cu(II) complexes were synthesized with thiosemicarbazone (L 1) and semicarbazone (L 2) derived from 2-acetyl furan. These complexes were characterized by elemental analysis, molar conductance, magnetic moment, mass, IR, electronic and EPR spectral studies. The molar conductance measurement of the complexes in DMSO corresponds to non-electrolytic nature. All the complexes are of high-spin type. On the basis of different spectral studies six coordinated geometry may be assigned for all the complexes except Co(L) 2(SO 4) and Cu(L) 2(SO 4) [where L = L 1 and L 2] which are of five coordinated square pyramidal geometry.

  7. Selective Hg(II) adsorption from aqueous solutions of Hg(II) and Pb(II) by hydrolyzed acrylamide-grafted PET films.

    Science.gov (United States)

    Rahman, Nazia; Sato, Nobuhiro; Sugiyama, Masaaki; Hidaka, Yoshiki; Okabe, Hirotaka; Hara, Kazuhiro

    2014-01-01

    Selective Hg(II) adsorption from aqueous solutions of Hg(II) and Pb(II) using hydrolyzed acrylamide (AAm)-grafted polyethylene terephthalate (PET) films was examined to explore the potential reuse of waste PET materials. Selective recovery of Hg(II) from a mixture of soft acids with similar structure, such as Hg(II) and Pb(II), is important to allow the reuse of recovered Hg(II). An adsorbent for selective Hg(II) adsorption was prepared by γ-ray-induced grafting of AAm onto PET films followed by partial hydrolysis through KOH treatment. The adsorption capacity of the AAm-grafted PET films for Hg(II) ions increased from 15 to 70 mg/g after partial hydrolysis because of the reduction of hydrogen bonding between -CONH2 groups and the corresponding improved access of metal ions to the amide groups. The prepared adsorbent was characterized by Fourier transform infrared spectroscopy and scanning electron microscopy. The absorbent film showed high selectivity for the adsorption of Hg(II) over Pb(II) throughout the entire initial metal concentration range (100-500 mg/L) and pH range (2.2-5.6) studied. The high selectivity is attributed to the ability of Hg(II) ions to form covalent bonds with the amide groups. The calculated selectivity coefficient for the adsorbent binding Hg(II) over Pb(II) was 19.2 at pH 4.5 with an initial metal concentration of 100 mg/L. Selective Hg(II) adsorption equilibrium data followed the Langmuir model and kinetic data were well fitted by a pseudo-second-order equation. The adsorbed Hg(II) and Pb(II) ions were effectively desorbed from the adsorbent film by acid treatment, and the regenerated film showed no marked loss of adsorption capacity upon reuse for selective Hg(II) adsorption.

  8. An updated Type II supernova Hubble diagram

    Science.gov (United States)

    Gall, E. E. E.; Kotak, R.; Leibundgut, B.; Taubenberger, S.; Hillebrandt, W.; Kromer, M.; Burgett, W. S.; Chambers, K.; Flewelling, H.; Huber, M. E.; Kaiser, N.; Kudritzki, R. P.; Magnier, E. A.; Metcalfe, N.; Smith, K.; Tonry, J. L.; Wainscoat, R. J.; Waters, C.

    2018-03-01

    We present photometry and spectroscopy of nine Type II-P/L supernovae (SNe) with redshifts in the 0.045 ≲ z ≲ 0.335 range, with a view to re-examining their utility as distance indicators. Specifically, we apply the expanding photosphere method (EPM) and the standardized candle method (SCM) to each target, and find that both methods yield distances that are in reasonable agreement with each other. The current record-holder for the highest-redshift spectroscopically confirmed supernova (SN) II-P is PS1-13bni (z = 0.335-0.012+0.009), and illustrates the promise of Type II SNe as cosmological tools. We updated existing EPM and SCM Hubble diagrams by adding our sample to those previously published. Within the context of Type II SN distance measuring techniques, we investigated two related questions. First, we explored the possibility of utilising spectral lines other than the traditionally used Fe IIλ5169 to infer the photospheric velocity of SN ejecta. Using local well-observed objects, we derive an epoch-dependent relation between the strong Balmer line and Fe IIλ5169 velocities that is applicable 30 to 40 days post-explosion. Motivated in part by the continuum of key observables such as rise time and decline rates exhibited from II-P to II-L SNe, we assessed the possibility of using Hubble-flow Type II-L SNe as distance indicators. These yield similar distances as the Type II-P SNe. Although these initial results are encouraging, a significantly larger sample of SNe II-L would be required to draw definitive conclusions. Tables A.1, A.3, A.5, A.7, A.9, A.11, A.13, A.15 and A.17 are also available at the CDS via anonymous ftp to http://cdsarc.u-strasbg.fr (http://130.79.128.5) or via http://cdsarc.u-strasbg.fr/viz-bin/qcat?J/A+A/611/A25

  9. Early characteristic radiographic changes in mucolipidosis II

    Energy Technology Data Exchange (ETDEWEB)

    Lai, Lillian M. [Lucile Packard Children' s Hospital and Stanford University, Pediatric Radiology, Palo Alto, CA (United States); Lachman, Ralph S. [Lucile Packard Children' s Hospital and Stanford University, Pediatric Radiology, Palo Alto, CA (United States); University of California, International Skeletal Dysplasia Registry, Los Angeles, CA (United States)

    2016-11-15

    Although mucolipidosis type II has similar metabolic abnormalities to those found in all the mucopolysaccharidoses and mucolipidoses, there are distinctive diagnostic radiographic changes of mucolipidosis II in the perinatal/newborn/infant period. To describe the early characteristic radiographic changes of mucolipidosis II and to document when these changes manifest and resolve. We retrospectively reviewed radiographs and clinical records of 19 cases of mucolipidosis II from the International Skeletal Dysplasia Registry (1971-present; fetal age to 21/2 years). A radiologist with special expertise in skeletal dysplasias evaluated the radiographs. The most common abnormalities were increased vertebral body height (80%, nonspecific), talocalcaneal stippling (86%), periosteal cloaking (74%) and vertebral body rounding (50%). Unreported findings included sacrococcygeal sclerosis (54%) and vertebral body sclerosis (13%). Rickets and hyperparathyroidism-like (pseudohyperparathyroidism) changes (rarely reported) were found in 33% of cases. These changes invariably started in the newborn period and resolved by 1 year of age. The conversion from these early infantile radiographic features to dysostosis multiplex changes occurred in 41% of cases, and within the first year after birth. Several findings strongly suggest the diagnosis of mucolipidosis II, including cloaking in combination with one or more of the following radiographic criteria: talocalcaneal stippling, sacrococcygeal or generalized vertebral body sclerosis, vertebral body rounding, or rickets/hyperparathyroidism-like changes in the perinatal/newborn/infancy period. These findings are not found in the other two forms of mucolipidosis nor in any of the mucopolysaccharidoses. (orig.)

  10. Early characteristic radiographic changes in mucolipidosis II

    International Nuclear Information System (INIS)

    Lai, Lillian M.; Lachman, Ralph S.

    2016-01-01

    Although mucolipidosis type II has similar metabolic abnormalities to those found in all the mucopolysaccharidoses and mucolipidoses, there are distinctive diagnostic radiographic changes of mucolipidosis II in the perinatal/newborn/infant period. To describe the early characteristic radiographic changes of mucolipidosis II and to document when these changes manifest and resolve. We retrospectively reviewed radiographs and clinical records of 19 cases of mucolipidosis II from the International Skeletal Dysplasia Registry (1971-present; fetal age to 21/2 years). A radiologist with special expertise in skeletal dysplasias evaluated the radiographs. The most common abnormalities were increased vertebral body height (80%, nonspecific), talocalcaneal stippling (86%), periosteal cloaking (74%) and vertebral body rounding (50%). Unreported findings included sacrococcygeal sclerosis (54%) and vertebral body sclerosis (13%). Rickets and hyperparathyroidism-like (pseudohyperparathyroidism) changes (rarely reported) were found in 33% of cases. These changes invariably started in the newborn period and resolved by 1 year of age. The conversion from these early infantile radiographic features to dysostosis multiplex changes occurred in 41% of cases, and within the first year after birth. Several findings strongly suggest the diagnosis of mucolipidosis II, including cloaking in combination with one or more of the following radiographic criteria: talocalcaneal stippling, sacrococcygeal or generalized vertebral body sclerosis, vertebral body rounding, or rickets/hyperparathyroidism-like changes in the perinatal/newborn/infancy period. These findings are not found in the other two forms of mucolipidosis nor in any of the mucopolysaccharidoses. (orig.)

  11. Belle-II Experiment Network Requirements

    Energy Technology Data Exchange (ETDEWEB)

    Asner, David [Pacific Northwest National Laboratory (PNNL), Richland, WA (United States); Bell, Greg [ESnet; Carlson, Tim [Pacific Northwest National Laboratory (PNNL), Richland, WA (United States); Cowley, David [Pacific Northwest National Laboratory (PNNL), Richland, WA (United States); Dart, Eli [ESnet; Erwin, Brock [Pacific Northwest National Laboratory (PNNL), Richland, WA (United States); Godang, Romulus [Univ. of South Alabama, Mobile, AL (United States); Hara, Takanori [High Energy Accelerator Research Organization (KEK), Tsukuba (Japan); Johnson, Jerry [Pacific Northwest National Laboratory (PNNL), Richland, WA (United States); Johnson, Ron [Univ. of Washington, Seattle, WA (United States); Johnston, Bill [ESnet; Dam, Kerstin Kleese-van [Pacific Northwest National Laboratory (PNNL), Richland, WA (United States); Kaneko, Toshiaki [High Energy Accelerator Research Organization (KEK), Tsukuba (Japan); Kubota, Yoshihiro [NII; Kuhr, Thomas [Karlsruhe Inst. of Technology (KIT) (Germany); McCoy, John [Pacific Northwest National Laboratory (PNNL), Richland, WA (United States); Miyake, Hideki [High Energy Accelerator Research Organization (KEK), Tsukuba (Japan); Monga, Inder [ESnet; Nakamura, Motonori [NII; Piilonen, Leo [Virginia Polytechnic Inst. and State Univ. (Virginia Tech), Blacksburg, VA (United States); Pordes, Ruth [Fermi National Accelerator Lab. (FNAL), Batavia, IL (United States); Ray, Douglas [Pacific Northwest National Laboratory (PNNL), Richland, WA (United States); Russell, Richard [Pacific Northwest National Laboratory (PNNL), Richland, WA (United States); Schram, Malachi [Pacific Northwest National Laboratory (PNNL), Richland, WA (United States); Schroeder, Jim [Pacific Northwest National Laboratory (PNNL), Richland, WA (United States); Sevior, Martin [Univ. of Melbourne (Australia); Singh, Surya [Pacific Northwest National Laboratory (PNNL), Richland, WA (United States); Suzuki, Soh [High Energy Accelerator Research Organization (KEK), Tsukuba (Japan); Sasaki, Takashi [High Energy Accelerator Research Organization (KEK), Tsukuba (Japan); Williams, Jim [Indiana Univ., Bloomington, IN (United States)

    2013-05-28

    The Belle experiment, part of a broad-based search for new physics, is a collaboration of ~400 physicists from 55 institutions across four continents. The Belle detector is located at the KEKB accelerator in Tsukuba, Japan. The Belle detector was operated at the asymmetric electron-positron collider KEKB from 1999-2010. The detector accumulated more than 1 ab-1 of integrated luminosity, corresponding to more than 2 PB of data near 10 GeV center-of-mass energy. Recently, KEK has initiated a $400 million accelerator upgrade to be called SuperKEKB, designed to produce instantaneous and integrated luminosity two orders of magnitude greater than KEKB. The new international collaboration at SuperKEKB is called Belle II. The first data from Belle II/SuperKEKB is expected in 2015. In October 2012, senior members of the Belle-II collaboration gathered at PNNL to discuss the computing and neworking requirements of the Belle-II experiment with ESnet staff and other computing and networking experts. The day-and-a-half-long workshop characterized the instruments and facilities used in the experiment, the process of science for Belle-II, and the computing and networking equipment and configuration requirements to realize the full scientific potential of the collaboration's work.

  12. FRM-II research neutron source commissioned

    International Nuclear Information System (INIS)

    Anon.

    2004-01-01

    On March 2, 2004, the Heinz Maier-Leibnitz research neutron source (FRM-II) generated neutrons for the first time. This marked the most important step on the way to using FRM-II for scientific purposes. On this occasion, this unique research facility in the world was dedicated in a ceremony attended by approximately 1000 representatives of politics, industry, and science. The keynote speaker, Federal Minister of the Interior Otto Schily; Bavarian Minister President Edmund Stoiber; Professor Claus Weyrich (Member of the Executive Board of Siemens AG); Dr. Thomas Goppel (Bavarian State Minister for Science, Research, and Arts); Professor Wolfgang A. Herman (President of the Technical University of Munich); Hannelore Gabor (2nd Mayor of the host municipality of Garching); and Professor Winfried Petry (Scientific Director of FRM-II) underlined the great importance of FRM-II for science, research, medicine, and technology. FRM-II will not only fill the 'neutron gap', but create extremely brilliant working conditions thanks to its considerably higher neutron flux compared to that of its predecessor, the legendary Atomic Egg. After the first conceptual design studies starting in 1980, the ground breaking ceremony in August 1996, and the third partial permit issued at Easter of 2003, a unique tool is now available for modern science and for medical and technical applications. (orig.) [de

  13. LCLS-II Cryomodules Production at Fermilab

    Energy Technology Data Exchange (ETDEWEB)

    Arkan, Tug [Fermilab; Grimm, Chuck [Fermilab; Kaluzny, Joshua [Fermilab; Orlov, Yuriy [Fermilab; Peterson, Thomas [Fermilab; Premo, Ken [Fermilab

    2017-05-01

    LCLS-II is an upgrade project for the linear coherent light source (LCLS) at SLAC. The LCLS-II linac will consist of thirty-five 1.3 GHz and two 3.9 GHz superconducting RF continuous wave (CW) cryomodules that Fermilab and Jefferson Lab (JLab) will assemble in collaboration with SLAC. The LCLS-II 1.3 GHz cryomodule design is based on the European XFEL pulsed-mode cryomodule design with modifications needed for CW operation. Fermilab and JLab will each assemble and test a prototype 1.3 GHz cryomodule to assess the results of the CW modifications, in advance of 16 and 17 production 1.3 GHz cryomodules, respectively. Fermilab is solely responsible for the 3.9 GHz cryomodules. After the prototype cryomodule tests are complete and lessons learned incorporated, both laboratories will increase their cryomodule production rates to meet the challenging LCLS-II project requirement of approximately one cryomodule per month per laboratory. This paper presents the Fermilab Cryomodule Assembly Facility (CAF) infrastructure for LCLS-II cryomodule production, the Fermilab prototype 1.3 GHz CW cryomodule (pCM) assembly and readiness for production assembly.

  14. Centrifuge workers study. Phase II, completion report

    Energy Technology Data Exchange (ETDEWEB)

    Wooten, H.D.

    1994-09-01

    Phase II of the Centrifuge Workers Study was a follow-up to the Phase I efforts. The Phase I results had indicated a higher risk than expected among centrifuge workers for developing bladder cancer when compared with the risk in the general population for developing this same type of cancer. However, no specific agent could be identified as the causative agent for these bladder cancers. As the Phase II Report states, Phase I had been limited to workers who had the greatest potential for exposure to substances used in the centrifuge process. Phase II was designed to expand the survey to evaluate the health of all employees who had ever worked in Centrifuge Program Departments 1330-1339 but who had not been interviewed in Phase I. Employees in analytical laboratories and maintenance departments who provided support services for the Centrifuge Program were also included in Phase II. In December 1989, the Oak Ridge Associated Universities (ORAU), now known as Oak Ridge Institute for Science and Education (ORISE), was contracted to conduct a follow-up study (Phase II). Phase H of the Centrifuge Workers Study expanded the survey to include all former centrifuge workers who were not included in Phase I. ORISE was chosen because they had performed the Phase I tasks and summarized the corresponding survey data therefrom.

  15. Centrifuge workers study. Phase II, completion report

    International Nuclear Information System (INIS)

    Wooten, H.D.

    1994-09-01

    Phase II of the Centrifuge Workers Study was a follow-up to the Phase I efforts. The Phase I results had indicated a higher risk than expected among centrifuge workers for developing bladder cancer when compared with the risk in the general population for developing this same type of cancer. However, no specific agent could be identified as the causative agent for these bladder cancers. As the Phase II Report states, Phase I had been limited to workers who had the greatest potential for exposure to substances used in the centrifuge process. Phase II was designed to expand the survey to evaluate the health of all employees who had ever worked in Centrifuge Program Departments 1330-1339 but who had not been interviewed in Phase I. Employees in analytical laboratories and maintenance departments who provided support services for the Centrifuge Program were also included in Phase II. In December 1989, the Oak Ridge Associated Universities (ORAU), now known as Oak Ridge Institute for Science and Education (ORISE), was contracted to conduct a follow-up study (Phase II). Phase H of the Centrifuge Workers Study expanded the survey to include all former centrifuge workers who were not included in Phase I. ORISE was chosen because they had performed the Phase I tasks and summarized the corresponding survey data therefrom

  16. Morphological caracteristics of malocclusion class II

    Directory of Open Access Journals (Sweden)

    Pavlović J.

    2015-01-01

    Full Text Available Class II malocclusion are complex anomalies of the skeletal and dental systems. The aim of this study is that the rengenkefalometrics analysis closer determine the morphological characteristics of this malocclusion. For this study were used 30 patients aged 18-30, previously clinically diagnosed class II, before the planned orthodontic treatment. The results analisis lateral cephalometric radiographs were compared with the 30 patients with class I malocclusion. Analyzed three linear and two angular cranial base dimensions and nine angular and four linear measures from the facial skeleton. The Results show: No statistically significant differensis in cranial base angle (SNBa and anterior cranial base length (S-N between class II and control Class I. Angle maxillar prognathism ( SNA is no signifikant different between class I and Class II but SNB angle were signifikant smaller. The length of maxillary base (A'-SnP is longer and the length of mandibule (Pg'-MT1/MT is signifficantly smaller. The gonial angle (ArGo-Me was smaller with open articular angle (GoArSN. Morphological characteristics of class II malocclusion are , retrognathic and smaller mandibular ligth, normognathic and longer maxilla, open articular angle with vertical tendency of the craniofacial growth pattern.

  17. PEP-II injection timing and controls

    International Nuclear Information System (INIS)

    Bharadwaj, V.; Browne, M.; Crane, M.; Gromme, T.; Himel, T.; Ross, M.; Stanek, M.; Ronan, M.

    1997-07-01

    Hardware has been built and software written and incorporated in the existing SLC accelerator control system to control injection of beam pulses from the accelerator into the PEP-II storage rings currently under construction. Hardware includes a CAMAC module to delay the machine timing fiducial in order that a beam pulse extracted from a damping ring will be injected into a selected group of four 476 MHz buckets in a PEP-II ring. Further timing control is accomplished by shifting the phase of the bunches stored in the damping rings before extraction while leaving the phase of the PEP-II stored beam unchanged. The software which drives timing devices on a pulse-to-pulse basis relies on a dedicated communication link on which one scheduling microprocessor broadcasts a 128-bit message to all distributed control microprocessors at 360 Hz. PEP-II injection will be driven by the scheduling microprocessor according to lists specifying bucket numbers in arbitrary order, and according to scheduling constraints maximizing the useful beam delivered to the SLC collider currently in operation. These lists will be generated by a microprocessor monitoring the current stored per bucket in each of the PEP-II rings

  18. Accident analysis for PRC-II reactor

    International Nuclear Information System (INIS)

    Wei Yongren; Tang Gang; Wu Qing; Lu Yili; Liu Zhifeng

    1997-12-01

    The computer codes, calculation models, transient results, sensitivity research, design improvement, and safety evaluation used in accident analysis for PRC-II Reactor (The Second Pulsed Reactor in China) are introduced. PRC-II Reactor is built in big populous city, so the public pay close attention to reactor safety. Consequently, Some hypothetical accidents are analyzed. They include an uncontrolled control rod withdrawal at rated power, a pulse rod ejection at rated power, and loss of coolant accident. Calculation model which completely depict the principle and process for each accident is established and the relevant analysis code is developed. This work also includes comprehensive computing and analyzing transients for each accident of PRC-II Reactor; the influences in the reactor safety of all kind of sensitive parameters; evaluating the function of engineered safety feature. The measures to alleviate the consequence of accident are suggested and taken in the construction design of PRC-II Reactor. The properties of reactor safety are comprehensively evaluated. A new advanced calculation model (True Core Uncovered Model) of LOCA of PRC-II Reactor and the relevant code (MCRLOCA) are first put forward

  19. The PIP-II Conceptual Design Report

    Energy Technology Data Exchange (ETDEWEB)

    Ball, M. [Fermi National Accelerator Lab. (FNAL), Batavia, IL (United States); Burov, A. [Fermi National Accelerator Lab. (FNAL), Batavia, IL (United States); Chase, B. [Fermi National Accelerator Lab. (FNAL), Batavia, IL (United States); Chakravarty, A. [Fermi National Accelerator Lab. (FNAL), Batavia, IL (United States); Chen, A. [Fermi National Accelerator Lab. (FNAL), Batavia, IL (United States); Dixon, S. [Fermi National Accelerator Lab. (FNAL), Batavia, IL (United States); Edelen, J. [Fermi National Accelerator Lab. (FNAL), Batavia, IL (United States); Grassellino, A. [Fermi National Accelerator Lab. (FNAL), Batavia, IL (United States); Johnson, D. [Fermi National Accelerator Lab. (FNAL), Batavia, IL (United States); Holmes, S. [Fermi National Accelerator Lab. (FNAL), Batavia, IL (United States); Kazakov, S. [Fermi National Accelerator Lab. (FNAL), Batavia, IL (United States); Klebaner, A. [Fermi National Accelerator Lab. (FNAL), Batavia, IL (United States); Kourbanis, I. [Fermi National Accelerator Lab. (FNAL), Batavia, IL (United States); Leveling, A. [Fermi National Accelerator Lab. (FNAL), Batavia, IL (United States); Melnychuk, O. [Fermi National Accelerator Lab. (FNAL), Batavia, IL (United States); Neuffer, D. [Fermi National Accelerator Lab. (FNAL), Batavia, IL (United States); Nicol, T. [Fermi National Accelerator Lab. (FNAL), Batavia, IL (United States); Ostiguy, J. -F. [Fermi National Accelerator Lab. (FNAL), Batavia, IL (United States); Pasquinelli, R. [Fermi National Accelerator Lab. (FNAL), Batavia, IL (United States); Passarelli, D. [Fermi National Accelerator Lab. (FNAL), Batavia, IL (United States); Ristori, L. [Fermi National Accelerator Lab. (FNAL), Batavia, IL (United States); Pellico, W. [Fermi National Accelerator Lab. (FNAL), Batavia, IL (United States); Patrick, J. [Fermi National Accelerator Lab. (FNAL), Batavia, IL (United States); Prost, L. [Fermi National Accelerator Lab. (FNAL), Batavia, IL (United States); Rakhno, I. [Fermi National Accelerator Lab. (FNAL), Batavia, IL (United States); Saini, A. [Fermi National Accelerator Lab. (FNAL), Batavia, IL (United States); Schappert, W. [Fermi National Accelerator Lab. (FNAL), Batavia, IL (United States); Shemyakin, A. [Fermi National Accelerator Lab. (FNAL), Batavia, IL (United States); Steimel, J. [Fermi National Accelerator Lab. (FNAL), Batavia, IL (United States); Scarpine, V. [Fermi National Accelerator Lab. (FNAL), Batavia, IL (United States); Vivoli, A. [Fermi National Accelerator Lab. (FNAL), Batavia, IL (United States); Warner, A. [Fermi National Accelerator Lab. (FNAL), Batavia, IL (United States); Yakovlev, V. [Fermi National Accelerator Lab. (FNAL), Batavia, IL (United States); Ostroumov, P. [Argonne National Lab. (ANL), Argonne, IL (United States); Conway, Z. [Argonne National Lab. (ANL), Argonne, IL (United States)

    2017-03-01

    The Proton Improvement Plan-II (PIP-II) encompasses a set of upgrades and improvements to the Fermilab accelerator complex aimed at supporting a world-leading neutrino program over the next several decades. PIP-II is an integral part of the strategic plan for U.S. High Energy Physics as described in the Particle Physics Project Prioritization Panel (P5) report of May 2014 and formalized through the Mission Need Statement approved in November 2015. As an immediate goal, PIP-II is focused on upgrades to the Fermilab accelerator complex capable of providing proton beam power in excess of 1 MW on target at the initiation of the Long Baseline Neutrino Facility/Deep Underground Neutrino Experiment (LBNF/DUNE) program, currently anticipated for the mid- 2020s. PIP-II is a part of a longer-term goal of establishing a high-intensity proton facility that is unique within the world, ultimately leading to multi-MW capabilities at Fermilab....

  20. TRUPACT-II Operating and Maintenance Instructions

    Energy Technology Data Exchange (ETDEWEB)

    Westinghouse Electric Corporation, Waste Isolation Division

    1999-12-31

    The purpose of this document is to provide the technical requirements for preparation for use, operation, inspection, and maintenance of a Transuranic Package Transporter Model II (TRUPACT-II) Shipping Package and directly related components. This document complies with the minimum requirements as specified in the TRUPACT-II Safety Analysis Report for Packaging (SARP) and Nuclear Regulatory Commission (NRC) Certificate of Compliance (C of C) 9218. In the event there is a conflict between this document and the TRUPACT-II SARP, the TRUPACT-II SARP shall govern. TRUPACT-II C of C number 9218 states, ''... each package must be prepared for shipment and operated in accordance with the procedures described in Chapter 7.0, Operating Procedures, of the application.'' It further states, ''... each package must be tested and maintained in accordance with the procedures described in Chapter 8.0, Acceptance Tests and Maintenance Program of the application.'' Chapter 9 of the TRUPACT-II SARP charges the Westinghouse Electric Corporation Waste Isolation Division (WID) with assuring that the TRUPACT-II is used in accordance with the requirements of the C of C. To meet this requirement and verify consistency of operations when loading and unloading the TRUPACT-II on the trailer, placing a payload in the packaging, unloading the payload from the packaging, or performing maintenance, the U.S. Department of Energy Carlsbad Area Office (U.S. DOE/CAO) finds it necessary to implement the changes that follow. This TRUPACT-II maintenance document represents a change to previous philosophy regarding site specific procedures for the use of the TRUPACT-II. This document details the instructions to be followed to consistently operate and maintain the TRUPACT-II. The intent of these instructions is to ensure that all users of the TRUPACT-II follow the same or equivalent instructions. Users may achieve this intent by any of the following methods: (1

  1. Complexes of Cu(II), Ni(II), Co(II), oxovanadium(IV) and dioxouranium(VI) with N,N'-ethylenebis (2-hydroxy-4-methylpropiophenoneimine)

    International Nuclear Information System (INIS)

    Patel, M.M.; Patel, M.R.; Patel, M.N.; Patel, R.P.

    1982-01-01

    Complexes of Cu(II), Ni(II), Co(II), oxovanadium(IV) and dioxouranium(VI) with the schiff base, N,N'-ethylenebis(2-hydroxy-4-methylpropiophenoneimine)(4-MeOHPEN), have been synthesised and characterised on the basis of elemental analyses, conductivity, magnetic moment, electronic and infrared spectral data. Square-planar structures are suggested for Cu(II), Ni(II) and Co(II) complexes while a distorted square-pyramidal structure is suggested for the oxovanadium(IV) complex. (author)

  2. The type II collagen fragments Helix-II and CTX-II reveal different enzymatic pathways of human cartilage collagen degradation

    DEFF Research Database (Denmark)

    Charni-Ben Tabassi, N; Desmarais, S; Jensen, Anne-Christine Bay

    2008-01-01

    human recombinant cathepsins (Cats) and matrix-metalloproteases (MMPs). Next, we analyzed the spontaneous release of Helix-II and CTX-II from cartilage sections of patients with knee OA who were immediately deep frozen after joint replacement to preserve endogenous enzyme activity until assay. Cartilage....... Cat D was unable to digest intact cartilage. MMPs-1, -3, -7, -9, and -13 efficiently released CTX-II, but only small amount of Helix-II. Neither CTX-II nor Helix-II alone was able to reflect accurately the collagenolytic activity of Cats and MMPs as reflected by the release of hydroxyproline. In OA...

  3. Alcatel-Lucent Network Routing Specialist II (NRS II) Self-Study Guide Preparing for the NRS II Certification Exams

    CERN Document Server

    Warnock, Glenn

    2011-01-01

    The definitive resource for the NRS II exams—three complete courses in a book Alcatel-Lucent is a world leader in designing and developing scalable systems for service providers. If you are a network designer or operator who uses Alcatel-Lucent's 7750 family of service routers, prepare for certification as an A-L network routing specialist with this complete self-study course. You'll get thorough preparation for the NRS II exams while you learn to build state-of-the-art, scalable IP/MPLS-based service networks. The book provides you with an in-depth understanding of the protocols and tec

  4. Elimination of Cu (II) and Zn (II) ions in mono-element and the bi ...

    African Journals Online (AJOL)

    Elimination of Cu (II) and Zn (II) ions in mono-element and the bi-element aqueous solutions by adsorption on natural clay of Bikougou (Gabon) ... The modeling of the experimental results is better achieved by application of. Freundlich adsorption isotherm and Langmuir adsorption isotherm concerning the adsorption of Cu ...

  5. Biosorption of cadmium (II) and lead (II) from aqueous solutions using mushrooms: A comparative study

    Energy Technology Data Exchange (ETDEWEB)

    Vimala, R., E-mail: vimararagu@yahoo.co.in [School of Biotechnology, Chemical and Biomedical Engineering, VIT University, Vellore 632014, Tamil Nadu (India); Das, Nilanjana [School of Biotechnology, Chemical and Biomedical Engineering, VIT University, Vellore 632014, Tamil Nadu (India)

    2009-08-30

    Sorption capacity of oyster mushroom (Pleurotus platypus), button mushroom (Agaricus bisporus) and milky mushroom (Calocybe indica) were evaluated on biosorption of heavy metals, viz. cadmium (II) and lead (II) from aqueous solutions. The optimum sorption conditions were studied for each metal separately. The desired pH of the aqueous solution was found to be 6.0 for the removal of cadmium (II) and 5.0 for removal of lead (II) for all the mushrooms. The percent removal of both the metals was found to increase with the increase in biosorbent dosage and contact time. The fitness of the biosorption data for Langmuir and Freundlich adsorption models was investigated. It was found that biosorption of cadmium (II) and lead (II) ions onto the biomass of the three mushrooms were better suitable to Langmuir than Freundlich adsorption model. P. platypus showed the highest metal uptake potential for cadmium (q{sub max} 34.96 mg/g) whereas A. bisporus exhibited maximum potential for lead (q{sub max} 33.78 mg/g). Milky mushroom showed the lowest metal uptake capacity for both the metals. The present data confirms that mushrooms may be used as efficient biosorbent for the removal of cadmium (II) and lead (II) ions from aqueous solution.

  6. Interesting properties of some iron(II), copper(I) and copper(II ...

    Indian Academy of Sciences (India)

    Administrator

    Tridendate ligands with nitrogen centers, generally well-known as the tripod ligands, have been of considerable interest to inorganic chemists dealing with the preparation of model compounds for hemocyanin, tyrosinase etc. We have found that such ligands when complexed with iron(II) and copper(II) and copper(I) ions ...

  7. Cobalt(III), nickel(II) and ruthenium(II) complexes of 1,10 ...

    Indian Academy of Sciences (India)

    Co(II) and Ru(II) complexes investigated in this study effect photocleavage of the supercoiled ... DNA is related to their utility in the design and development of synthetic restriction ..... ∗Quasi-reversible/irreversible (electrochemical behaviour of ...

  8. Receptors for insulin-like growth factor II (IGF-II) in the rat kidney glomerulus

    International Nuclear Information System (INIS)

    Haskell, J.F.; Pillion, D.J.; Meezan, E.

    1986-01-01

    Renal glomeruli were isolated by a technique involving renal perfusion with a solution containing magnetic iron oxide particles, followed by homogenization, sieving and isolation over a strong magnet. Isolated glomeruli were treated with 1% Triton X-100 to solubilize plasma membrane components while insoluble basement membrane components were removed by centrifugation. [ 125 I]Insulin-like growth factor-II (IGF-II) binding to this preparation was competitively inhibited by increasing amounts of unlabelled IGF-II, with 50% inhibition of binding observed at an IGF-II concentration of 1 ng/ml. [ 125 I]IGF-II was covalently cross-linked to its receptor with disuccinimidyl suberate in two tissues known to contain IGF-II receptors, the rat chondrosarcoma chondrocyte and the rat kidney tubule, as well as in rat renal glomeruli. In all three cases, a specific high-molecular weight (Mr = 255,000) band could be identified on autoradiograms of dodecyl sulfate polyacrylamide gels. These results indicate that the rat glomerulus contains a high-affinity receptor for IGF-II. This finding is consistent with the hypothesis that IGF-II plays a role in glomerular growth and differentiation

  9. 30 CFR Appendix II to Subpart D of... - Appendix II to Subpart D of Part 18

    Science.gov (United States)

    2010-07-01

    ... LABOR TESTING, EVALUATION, AND APPROVAL OF MINING PRODUCTS ELECTRIC MOTOR-DRIVEN MINE EQUIPMENT AND ACCESSORIES Machines Assembled With Certified or Explosion-Proof Components, Field Modifications of Approved Machines, and Permits To Use Experimental Equipment Pt. 18, Subpt. D, App. II Appendix II to Subpart D of...

  10. Synthesis, characterisation and electrochemical behaviour of Cu(II)

    Indian Academy of Sciences (India)

    Neutral tetradentate N2O2 type complexes of Cu(II), Ni(II), Co(II) and Zn(II) have been synthesised using the Schiff base formed by the condensation of acetylacetone and p-anisidine. Microanalysis, molar conductance, magnetic susceptibility, IR, UV-Vis, 1H NMR, CV and EPR studies have been carried out to determine the ...

  11. ORF Alignment: NC_002950 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available gth = 151 ... Query: 3 ... PLVSIIMGSTSDLPIMEKAAKMLDEMQIPFEMLALSAHRTPAEVETFAHEARARGIKV...II 62 ... PLVSIIMGSTSDLPIMEKAAKMLDEMQIPFEMLALSAHRTPAEVETFAHEARARGIKVII Sbjct: 1 ... PLVSIIMGSTSDLPIMEKAAKMLDEMQIPFEM

  12. Biosorption of copper(II) and lead(II) onto potassium hydroxide treated pine cone powder.

    Science.gov (United States)

    Ofomaja, A E; Naidoo, E B; Modise, S J

    2010-08-01

    Pine cone powder surface was treated with potassium hydroxide and applied for copper(II) and lead(II) removal from solution. Isotherm experiments and desorption tests were conducted and kinetic analysis was performed with increasing temperatures. As solution pH increased, the biosorption capacity and the change in hydrogen ion concentration in solution increased. The change in hydrogen ion concentration for lead(II) biosorption was slightly higher than for copper(II) biosorption. The results revealed that ion-exchange is the main mechanism for biosorption for both metal ions. The pseudo-first order kinetic model was unable to describe the biosorption process throughout the effective biosorption period while the modified pseudo-first order kinetics gave a better fit but could not predict the experimentally observed equilibrium capacities. The pseudo-second order kinetics gave a better fit to the experimental data over the temperature range from 291 to 347 K and the equilibrium capacity increased from 15.73 to 19.22 mg g(-1) for copper(II) and from 23.74 to 26.27 for lead(II). Activation energy was higher for lead(II) (22.40 kJ mol(-1)) than for copper(II) (20.36 kJ mol(-1)). The free energy of activation was higher for lead(II) than for copper(II) and the values of DeltaH* and DeltaS* indicate that the contribution of reorientation to the activation stage is higher for lead(II) than copper(II). This implies that lead(II) biosorption is more spontaneous than copper(II) biosorption. Equilibrium studies showed that the Langmuir isotherm gave a better fit for the equilibrium data indicating monolayer coverage of the biosorbent surface. There was only a small interaction between metal ions when simultaneously biosorbed and cation competition was higher for the Cu-Pb system than for the Pb-Cu system. Desorption studies and the Dubinin-Radushkevich isotherm and energy parameter, E, also support the ion-exchange mechanism. Copyright 2010 Elsevier Ltd. All rights reserved.

  13. Data handling at EBR-II [Experimental Breeder Reactor II] for advanced diagnostics and control work

    International Nuclear Information System (INIS)

    Lindsay, R.W.; Schorzman, L.W.

    1988-01-01

    Improved control and diagnostics systems are being developed for nuclear and other applications. The Experimental Breeder Reactor II (EBR-II) Division of Argonne National Laboratory has embarked on a project to upgrade the EBR-II control and data handling systems. The nature of the work at EBR-II requires that reactor plant data be readily available for experimenters, and that the plant control systems be flexible to accommodate testing and development needs. In addition, operational concerns require that improved operator interfaces and computerized diagnostics be included in the reactor plant control system. The EBR-II systems have been upgraded to incorporate new data handling computers, new digital plant process controllers, and new displays and diagnostics are being developed and tested for permanent use. In addition, improved engineering surveillance will be possible with the new systems

  14. Foam separation of Cu (II) and Ni(II) from aqueous solutions and simulated wastewaters

    International Nuclear Information System (INIS)

    Shakir, K.; Beheir, Sh.G.; Aziz, M.

    2003-01-01

    Batch experiments on the removal of Cu(II) and Ni(II) from aqueous solutions were performed through two foam separation techniques: precipitate flotation (PTF) an adsorbing colloid flotation (ACF). In ACF, Fe(III), oxyhydroxide was used as co precipitant and/or adsorbing colloid and sodium lauryl sulfate was used as a collector. ACF required a lower collector concentration than PTF. foreign ions were found to decrease the percent removal, the extent of decrease being higher by divalent ions than that by monovalent ones. However, the percent removal could be improved, even in presence of foreign ions, by addition of Al(II) as an activator. High removals could be attained for Cu(II) and Ni(II) from simulated wastewaters containing different concentrations of both metal ions. The addition of concentrations below the limits recommended by the egyptian regulations for environmental discharge

  15. Standardization of radioimmunoassay for dosage of angiotensin II (ang-II) and its methodological evaluation

    International Nuclear Information System (INIS)

    Mantovani, Milene; Mecawi, Andre S.; Elias, Lucila L.K.; Antunes-Rodrigues, Jose

    2011-01-01

    This paper standardizes the radioimmunoassay (RIA) for dosage of ANG-II of rats, after experimental conditions of saline hypertonic (2%), treating with losartan (antagonist of ANG-II), hydric privation, and acute hemorrhage (25%). After that, the plasmatic ANG-II was extracted for dosage of RIA, whose sensitiveness was of 1.95 pg/m L, with detection of 1.95 to 1000 pg/m L. The treatment with saline reduced the concentration of ANG-II, while the administration pf losartan, the hydric administration and the hemorrhage increase the values, related to the control group. Those results indicate variations in the plasmatic concentration of ANG-II according to the experimental protocols, validating the method for evaluation of activity renin-angiotensin

  16. Synthesis, investigation and spectroscopic characterization of piroxicam ternary complexes of Fe(II), Fe(III), Co(II), Ni(II), Cu(II) and Zn(II) with glycine and DL-phenylalanine

    Science.gov (United States)

    Mohamed, Gehad G.; El-Gamel, Nadia E. A.

    2004-11-01

    The ternary piroxicam (Pir; 4-hydroxy-2-methyl- N-(2-pyridyl)-2H-1,2-benzothiazine-3-carboxamide 1,1-dioxide) complexes of Fe(II), Fe(III), Co(II), Ni(II), Cu(II) and Zn(II) with various amino acids (AA) such as glycine (Gly) or DL-phenylalanine (PhA) were prepared and characterized by elemental analyses, molar conductance, IR, UV-Vis, magnetic moment, diffuse reflectance and X-ray powder diffraction. The UV-Vis spectra of Pir and the effect of metal chelation on the different interligand transitions are discussed in detailed manner. IR and UV-Vis spectra confirm that Pir behaves as a neutral bidentate ligand coordinated to the metal ions via the pyridine- N and carbonyl group of the amide moiety. Gly molecule acted as a uninegatively monodentate ligand and coordinate to the metal ions through its carboxylic group, in addition PhA acted as a uninegatively bidentate ligand and coordinate to the metal ions through its carboxylic and amino groups. All the chelates have octahedral geometrical structures while Cu(II)- and Zn(II)-ternary chelates with PhA have square planar geometrical structures. The molar conductance data reveal that most of these chelates are non electrolytes, while Fe(III)-Pir-Gly, Co(II)-, Ni(II)-, Cu(II)- and Zn(II)-Pir-PhA cheletes were 1:1 electrolytes. X-ray powder diffraction is used as a new tool to estimate the crystallinity of chelates as well as to elucidate their geometrical structures.

  17. Recovery of Cd(II), Co(II) and Ni(II) from Chloride Medium by Solvent Extraction Using CYANEX 923 and CYANEX 272 I

    International Nuclear Information System (INIS)

    Ahmed, M.; El Dessouky, S.I.; El-Nadi, Y.A.; Daoud, J.A.; Saad, E.A.

    2008-01-01

    The paper aims to study the extraction and separation of Cd(II), Co(II) and Ni(II) from their mixtures in hydrochloric acid medium with CYANEX 923 in kerosene. Preliminary investigations showed that only Cd(II) is extracted with CYANEX 923 while Co(II) and Ni(II) are not extracted. Different parameters affecting the extraction of Cd(II) with CYANEX 923 such as hydrochloric acid, hydrogen ion, extractant and metal concentrations, temperature investigations were also investigated. The stoichiometry of the extracted metal species investigated was found to be HCdCl 3 . 2 CYANEX 923. The stripping of the extracted Cd(II) species is obtained with 0.1 M HCl solution. Co(II) was found to be extracted with CYANEX 272 at ph 5.8 leaving Ni(II) in the solution. A developed process for the sequential of Cd(II), Co(II) and Ni(II) from their mixture in hydrochloric acid medium is proposed

  18. Population II brown dwarfs and dark haloes

    International Nuclear Information System (INIS)

    Zinnecker, H.

    1986-01-01

    Opacity-limited fragmentation is investigated as a function of the dust-to-gas ratio and it is found that the characteristic protostellar mass Msub(*) is metallicity-dependent. This dependence is such that, for the low metallicity gas out of which the stars of Population II formed in the halo, Msub(*) is less than 0.1 M solar mass. If applicable, these theoretical considerations would predict that substellar masses have formed more frequently under the metal-poor conditions in the early Galaxy (Population II brown dwarfs). Thus the missing mass in the Galactic halo and in the dark haloes around other spirals may well reside in these metal-poor Population II brown dwarfs. (author)

  19. Test of GERDA Phase II detector assembly

    Energy Technology Data Exchange (ETDEWEB)

    Bode, Tobias; Gusev, Konstantin [Technische Universitaet Muenchen (Germany); Schwingenheuer, Bernhard; Wagner, Victoria [Max-Planck Institut fuer Kernphysik, Heidelberg (Germany); Collaboration: GERDA-Collaboration

    2014-07-01

    The GERDA experiment searches for the lepton number violating neutrinoless double beta decay (0νββ) of {sup 76}Ge. The experiment uses HPGe detectors enriched in {sup 76}Ge as source and detection material. In GERDA Phase I five BEGe detectors were operated successfully. These detectors are distinguished for improved energy resolution and enhanced pulse shape discrimination (PSD) against background events. In Phase II additional 25 BEGe detectors will be installed. New electronics and radio-pure low-mass holders were specially designed for Phase II. Prior to the installation in GERDA all BEGe detectors are tested in their final assembly in the LNGS underground laboratory. This talk presents the mechanics and performance of the GERDA Phase II detector assembly.

  20. Sister chromatid segregation in meiosis II

    Science.gov (United States)

    Wassmann, Katja

    2013-01-01

    Meiotic divisions (meiosis I and II) are specialized cell divisions to generate haploid gametes. The first meiotic division with the separation of chromosomes is named reductional division. The second division, which takes place immediately after meiosis I without intervening S-phase, is equational, with the separation of sister chromatids, similar to mitosis. This meiotic segregation pattern requires the two-step removal of the cohesin complex holding sister chromatids together: cohesin is removed from chromosome arms that have been subjected to homologous recombination in meiosis I and from the centromere region in meiosis II. Cohesin in the centromere region is protected from removal in meiosis I, but this protection has to be removed—deprotected”—for sister chromatid segregation in meiosis II. Whereas the mechanisms of cohesin protection are quite well understood, the mechanisms of deprotection have been largely unknown until recently. In this review I summarize our current knowledge on cohesin deprotection. PMID:23574717

  1. Combination of the LEP II ffbar Results

    CERN Document Server

    Geweniger, C; Elsing, M; Goy, C; Holt, J; Liebig, W; Minard, M N; Renton, P B; Riemann, S; Sachs, K; Ward, P; Wynhoff, S

    2002-01-01

    Preliminary combinations of measurements of the 4 LEP collaborations of the process e+e-->ffbar at LEP-II are presented, using data from the full LEP-II data set where available. Cross-sections and forward-backward asymmetry measurements are combined for the full LEP-II data set. Combined differential cross-sections $\\frac{{\\rm d}\\sigma}{{\\rm d}\\cos\\theta}$ for electron-pairs, muon pair and tau-pair final states are presented. Measurements of the production of heavy flavours are combined. The combined results are interpreted in terms of contact interactions and the exchange Z' bosons and leptoquarks, and within models of low scale gravity in large extra dimensions.

  2. PBFA II energy storage section design

    International Nuclear Information System (INIS)

    Wilson, J.M.

    1983-01-01

    PBFA II will be the second thirty-six module accelerator built at Sandia National Laboratories for particle beam fusion feasibility studies. Each module of the machine will deliver 2.8 terawatts to a central experimental chamber. The total power delivered (100 terawatts) is expected to permit ignition scaling studies beginning in 1986. The PBFA II energy storage system consists of thirty-six 6.0 mv, 400 kj. Marx generators with their high voltage trigger and charging systems, and electromechanical output switching system. The paper describes the current design of this section of the machine. Constraints imposed by the existing tank and building are presented, as they relate to locating support systems in the oil section of PBFA II. The charging system and output switches have been designed and are described. A conceptual design for the Marx triggering system is also presented. Additional hardware (monitors, grounding connections, etc.) is discussed briefly with design details given where available

  3. Intrafibrillar Mineral May be Absent in Dentinogenesis Imperfecta Type II (DI-II)

    Energy Technology Data Exchange (ETDEWEB)

    Pople, John A

    2001-03-29

    High-resolution synchrotron radiation computed tomography (SRCT) and small angle x-ray scattering (SAXS) were performed on normal and dentinogenesis imperfecta type II (DI-II) teeth. Three normal and three DI-II human third molars were used in this study. The normal molars were unerupted and had intact enamel; donors were female and ranged in age from 18-21y. The DI-II specimens, which were also unerupted with intact enamel, came from a single female donor age 20y. SRCT showed that the mineral concentration was 33% lower on average in the DI-II dentin with respect to normal dentin. The SAXS spectra from normal dentin exhibited low-angle diffraction peaks at harmonics of 67.6 nm, consistent with nucleation and growth of the apatite phase within gaps in the collagen fibrils (intrafibrillar mineralization). In contrast, the low-angle peaks were almost nonexistent in the DI-II dentin. Crystallite thickness was independent of location in both DI-II and normal dentin, although the crystallites were significantly thicker in DI-II dentin (6.8 nm (s.d. = 0.5) vs 5.1 nm (s.d. = 0.6)). The shape factor of the crystallites, as determined by SAXS, showed a continuous progression in normal dentin from roughly one-dimensional (needle-like) near the pulp to two-dimensional (plate-like) near the dentin-enamel junction. The crystallites in DI-II dentin, on the other hand, remained needle-like throughout. The above observations are consistent with an absence of intrafibrillar mineral in DI-II dentin.

  4. Intrafibrillar Mineral May be Absent in Dentinogenesis Imperfecta Type II (DI-II); TOPICAL

    International Nuclear Information System (INIS)

    Pople, John A.

    2001-01-01

    High-resolution synchrotron radiation computed tomography (SRCT) and small angle x-ray scattering (SAXS) were performed on normal and dentinogenesis imperfecta type II (DI-II) teeth. Three normal and three DI-II human third molars were used in this study. The normal molars were unerupted and had intact enamel; donors were female and ranged in age from 18-21y. The DI-II specimens, which were also unerupted with intact enamel, came from a single female donor age 20y. SRCT showed that the mineral concentration was 33% lower on average in the DI-II dentin with respect to normal dentin. The SAXS spectra from normal dentin exhibited low-angle diffraction peaks at harmonics of 67.6 nm, consistent with nucleation and growth of the apatite phase within gaps in the collagen fibrils (intrafibrillar mineralization). In contrast, the low-angle peaks were almost nonexistent in the DI-II dentin. Crystallite thickness was independent of location in both DI-II and normal dentin, although the crystallites were significantly thicker in DI-II dentin (6.8 nm (s.d.= 0.5) vs 5.1 nm (s.d.= 0.6)). The shape factor of the crystallites, as determined by SAXS, showed a continuous progression in normal dentin from roughly one-dimensional (needle-like) near the pulp to two-dimensional (plate-like) near the dentin-enamel junction. The crystallites in DI-II dentin, on the other hand, remained needle-like throughout. The above observations are consistent with an absence of intrafibrillar mineral in DI-II dentin

  5. DO GIANT PLANETS SURVIVE TYPE II MIGRATION?

    International Nuclear Information System (INIS)

    Hasegawa, Yasuhiro; Ida, Shigeru

    2013-01-01

    Planetary migration is one of the most serious problems to systematically understand the observations of exoplanets. We clarify that the theoretically predicted type II, migration (like type I migration) is too fast, by developing detailed analytical arguments in which the timescale of type II migration is compared with the disk lifetime. In the disk-dominated regime, the type II migration timescale is characterized by a local viscous diffusion timescale, while the disk lifetime is characterized by a global diffusion timescale that is much longer than the local one. Even in the planet-dominated regime where the inertia of the planet mass reduces the migration speed, the timescale is still shorter than the disk lifetime except in the final disk evolution stage where the total disk mass decays below the planet mass. This suggests that most giant planets plunge into the central stars within the disk lifetime, and it contradicts the exoplanet observations that gas giants are piled up at r ∼> 1 AU. We examine additional processes that may arise in protoplanetary disks: dead zones, photoevaporation of gas, and gas flow across a gap formed by a type II migrator. Although they make the type II migration timescale closer to the disk lifetime, we show that none of them can act as an effective barrier for rapid type II migration with the current knowledge of these processes. We point out that gas flow across a gap and the fraction of the flow accreted onto the planets are uncertain and they may have the potential to solve the problem. Much more detailed investigation for each process may be needed to explain the observed distribution of gas giants in extrasolar planetary systems

  6. Harmonic Cavity Performance for NSLS-II

    CERN Document Server

    Blednykh, Alexei; Podobedov, Boris; Rose, James; Towne, Nathan A; Wang, Jiunn-Ming

    2005-01-01

    NSLS-II is a 3 GeV ultra-high brightness storage ring that is planned to succeed the present NSLS rings at Brookhaven. Ultra-low emittance bunch combined with a short bunch length results in the Touschek lifetime of only a few hours, which strongly advocates including harmonic RF in the baseline design of NSLS-II. This paper describes the required harmonic RF parameters, trade-offs between the possible choices and the expected system performance, including the implications on lifetime and instabilities.

  7. The Mark II Vertex Drift Chamber

    International Nuclear Information System (INIS)

    Alexander, J.P.; Baggs, R.; Fujino, D.

    1989-03-01

    We have completed constructing and begun operating the Mark II Drift Chamber Vertex Detector. The chamber, based on a modified jet cell design, achieves 30 μm spatial resolution and 2 gas mixtures. Special emphasis has been placed on controlling systematic errors including the use of novel construction techniques which permit accurate wire placement. Chamber performance has been studied with cosmic ray tracks collected with the chamber located both inside and outside the Mark II. Results on spatial resolution, average pulse shape, and some properties of CO 2 mixtures are presented. 10 refs., 12 figs., 1 tab

  8. Developments and new performance of Saturne II

    International Nuclear Information System (INIS)

    Ciret, J.C.

    1979-01-01

    The development of Saturne II aims to improve the quality, diversity and reliability of the beams which are or will be delivered to physicists. The significant development projects (polarized ions, heavy ions, Mimas, SPES II, etc.) are dealt with separately and specifically by other authors. Only the new performance and qualities of the beam delivered to physicists in the future are described here. The purpose of these developments is to meet the short and long term requirements expressed by the physicists and concern the Machine and the Areas [fr

  9. The 'miniskirt' counter array at CDF II

    International Nuclear Information System (INIS)

    Artikov, A.; Budagov, Yu.; Bellettini, G.

    2002-01-01

    Muon detection is fundamental to many of the interesting analyses at CDF II. For more efficient muon registration in Run II it was decided to increase geometrical coverage. The so-called 'miniskirt' counters are part of this upgrade. The original design parameters of the 'miniskirt' and mixed 'miniskirt' scintillation counters for the CDF Muon System are presented. The modifications, testing and installation of these counters within the CDF Upgrade Project are described in detail. The timing characteristics of mixed 'miniskirt' counters are also investigated using cosmic muons. The measurements show that the time resolution does not exceed 2.2 ns

  10. Validation of SAGE II ozone measurements

    Science.gov (United States)

    Cunnold, D. M.; Chu, W. P.; Mccormick, M. P.; Veiga, R. E.; Barnes, R. A.

    1989-01-01

    Five ozone profiles from the Stratospheric Aerosol and Gas Experiment (SAGE) II are compared with coincident ozonesonde measurements obtained at Natal, Brazil, and Wallops Island, Virginia. It is shown that the mean difference between all of the measurements is about 1 percent and that the agreement is within 7 percent at altitudes between 20 and 53 km. Good agreement is also found for ozone mixing ratios on pressure surfaces. It is concluded that the SAGE II profiles provide useful ozone information up to about 60 km altitude.

  11. Rare kaon decays at LAMPF II

    International Nuclear Information System (INIS)

    Sanford, T.W.L.

    1982-06-01

    At LAMPF II, intense beams of kaons will be available that will enable the rare kaon-decay processes to be investigated. This note explores some of the possibilities, which divide into two classes: (1) those that test the standard model of Weinberg and Salam and (2) those that are sensitive to new interactions. For both classes, experiments have been limited not by systematic errors but rather by statistical ones. LAMPF II with its intense flux of kaons thus will enable the frontier of rare kaon decay to be realistically probed

  12. The PIP-II Reference Design Report

    Energy Technology Data Exchange (ETDEWEB)

    Lebedev, Valeri, [Fermi National Accelerator Lab. (FNAL), Batavia, IL (United States); et al.

    2015-06-01

    The Proton Improvement Plan-II (PIP-II) is a high-intensity proton facility being developed to support a world-leading neutrino program over the next two decades at Fermilab. PIP-II is an integral part of the U.S. Intensity Frontier Roadmap as described in the Particle Physics Project Prioritization Panel (P5) report of May 2014 [1]. As an immediate goal PIP-II is focused on upgrades to the Fermilab accelerator complex capable of providing a beam power in excess of 1 MW on target at the initiation of LBNF [1,2] operations. PIP-II is a part of a longer-term concept for a sustained campaign of upgrades and improvements to achieve multi-MW capabilities at Fermilab. PIP-II is based on three major thrusts. They are (1) the recently completed upgrades to the Recycler and Main Injector (MI) for the NOvA experiment, (2) the Proton Improvement Plan [3] currently underway, and (3) the Project X Reference Design [4]. Note that: The Proton Improvement Plan (PIP) consolidates a set of improvements to the existing Linac, Booster, and Main Injector (MI) aimed at supporting 15 Hz Booster beam operation. In combination, the NOvA upgrades and PIP create a capability of delivering 700 kW beam power from the Main Injector at 120 GeV; The scope of the Project X Reference Design Report was aimed well beyond PIP. It described a complete concept for a multi-MW proton facility that could support a broad particle physics program based on neutrino, kaon, muon, and nucleon experiments [5,6]. The Project X conceptual design has evolved over a number of years, incorporating continuous input on physics research goals and advances in the underlying technology development programs [7,8,9]. PIP-II, to high degree, inherits these goals as the goals for future developments and upgrades. This document (PIP-II Reference Design Report) describes an initial step in the development of the Fermilab accelerating complex. The plan described in this Report balances the far-term goals of the Laboratory

  13. Genetic heterogeneity of Usher syndrome type II.

    OpenAIRE

    Pieke Dahl, S; Kimberling, WJ; Gorin, MB; Weston, MD; Furman, JM; Pikus, A; Moller, C

    1993-01-01

    Usher syndrome is an autosomal recessive disorder characterised by retinitis pigmentosa and congenital sensorineural hearing loss. A gene for Usher syndrome type II (USH2) has been localised to chromosome 1q32-q41. DNA from a family with four of seven sibs affected with clinical characteristics of Usher syndrome type II was genotyped using markers spanning the 1q32-1q41 region. These included D1S70 and D1S81, which are believed to flank USH2. Genotypic results and subsequent linkage analysis ...

  14. Site Environmental Report for 1998 Volume II

    International Nuclear Information System (INIS)

    Ruggieri, Michael

    1999-01-01

    Volume II of the Site Environment Report for 1998 is provided by Ernest Orlando Lawrence Berkeley National Laboratory as a supplemental appendix to the report printed in volume I. Volume II contains the environmental monitoring and sampling data used to generate summary results in the main report for routine and non routine activities at the Laboratory (except for groundwater sampling data, which may be found in the reports referred to in chapter 6). Data presented in the tables are given in International System of Units (SI) units of measure

  15. Advanced neutron instrumentation at FRM-II

    International Nuclear Information System (INIS)

    Petry, Winfried

    2003-01-01

    The construction of the new German high flux neutron source FRM-II is finished and FRM-II is waiting for its licence to start nuclear operation. With the beginning of the routine operation 22 instruments will be in action, including 5 irradiation facilities and 17 beam tube instruments, most of them use neutron scattering techniques. Additional instruments are under construction. Some of these instruments are unique, others are expected to be the best of their kind, all instruments are based on innovative techniques. (author)

  16. Analysis of the PISC II trials results

    International Nuclear Information System (INIS)

    Haines, N.

    1988-01-01

    The paper presents the analysis scheme of the Programme for the Inspection of Steel Components PISC II trial results. The objective of the PISC II exercise is to evaluate the effectiveness of current and advanced NDT techniques for inspection of reactor pressure vessel components. The analysis scheme takes data from the Round Robin Trial (RRT) and Destructive Examination, then reduces it to a manageable form in order to present useful conclusions on the effectiveness of NDT. A description is given of the data provided by RRT, the data analysis scheme, the definition of analysis parameters, and the main methods of data presentation. (U.K.)

  17. SURF II: Characteristics, facilities, and plans

    International Nuclear Information System (INIS)

    Madden, R.P.; Canfield, R.; Furst, M.; Hamilton, A.; Hughey, L.

    1992-01-01

    This facility report describes the Synchrotron Ultraviolet Radiation Facility (SURF II) operated by the National Institute of Standards and Technology, Gaithersburg, Maryland. SURF II is a 300-MeV electron storage ring which provides well characterized continuum radiation from the far infrared to the soft x-ray region with the critical wavelength at 17.4 nm. Brief descriptions are given of the user facilities, the characteristics of the synchrotron radiation, the main storage ring, the injector system and each of the operating beam lines, and associated instruments. Further description is given of expansion plans for additional beam lines

  18. Synchrotron power supply of TARN II

    International Nuclear Information System (INIS)

    Watanabe, Shin-ichi.

    1991-07-01

    The construction and performance of synchrotron power supply of TARN II are described. The 1.1 GeV synchrotron-cooler TARN II has been constructed at Institute for Nuclear Study, University of Tokyo. Constructed power supply for the dipole magnets is 600 V, 2500 A operated in the mode of trapezoid wave form with the repetition cycle of 0.1 Hz. The stability of magnetic field within 10 -3 and tracking error of 10 -4 have been attained with the aid of computer control system. First trial of synchrotron acceleration of He 2+ beam has been done up to 600 MeV in April, 1991. (author)

  19. New possible resonance for population II Cepheids

    International Nuclear Information System (INIS)

    Cox, A.N.; Kidman, R.B.

    1984-01-01

    Light and velocity curves of some radial mode variable stars seem to indicate a resonance where the second overtone has a period exactly half that of the fundamental mode. The two classes of stars that show this resonance by bumps in their light curves are the classical Cepheids and the population II BL Her variables. We here propose that there is another resonance for the population II W Vir variables where the ratio of the first overtone to the fundamental periods is 0.5

  20. Anti-inflammatory drugs interacting with Zn(II), Cd(II) and Pt(II) metal ions.

    Science.gov (United States)

    Dendrinou-Samara, C; Tsotsou, G; Ekateriniadou, L V; Kortsaris, A H; Raptopoulou, C P; Terzis, A; Kyriakidis, D A; Kessissoglou, D P

    1998-09-01

    Complexes of Zn(II), Cd(II) and Pt(II) metal ions with the anti-inflammatory drugs, 1-methyl-5-(p-toluoyl)-1H-pyrrole-2-acetic acid (Tolmetin), alpha-methyl-4-(2-methylpropyl)benzeneacetic acid (Ibuprofen), 6-methoxy-alpha-methylnaphthalene-2-acetic acid (Naproxen) and 1-(4-chlorobenzoyl)-5-methoxy-2-methyl-1H-indole-3-acetic acid (indomethacin) have been synthesized and characterized. In the structurally characterized Cd(naproxen)2 complex the anti-inflammatory drugs acts as bidentate chelate ligand coordinatively bound to metal ions through the deprotonated carboxylate group. Crystal data for 1: [C32H26O8Cd], orthorhombic, space group P22(1)2(1), a = 5.693(2) (A), b = 8.760(3) (A), c = 30.74(1) (A), V = 1533(1) A3, Z = 2. Antibacterial and growth inhibitory activity is higher than that of the parent ligands or the platinum(II) diamine compounds.