Dicty_cDB: Contig-U16346-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available 1 ( DV865969 ) CRP5701 Creeping bentgrass EST Agrostis stolonife... 44 8.6 1 ( D...04_028 O. Alba 47RDOAH ... 44 8.6 1 ( DW230377 ) GH_OVfbl_01-01-10R_A06_InvR_28Jan04_048_R Ovules ... 44 8.6

Physiological and metabolic effects of 5-aminolevulinic acid for mitigating salinity stress in creeping bentgrass.

Directory of Open Access Journals (Sweden)

Zhimin Yang

Full Text Available The objectives of this study were to determine whether foliar application of a chlorophyll precursor, 5-aminolevulinic acid (ALA, could mitigate salinity stress damages in perennial grass species by regulating photosynthetic activities, ion content, antioxidant metabolism, or metabolite accumulation. A salinity-sensitive perennial grass species, creeping bentgrass (Agrostis stolonifera, was irrigated daily with 200 mM NaCl for 28 d, which were foliar sprayed with water or ALA (0.5 mg L-1 weekly during the experiment in growth chamber. Foliar application of ALA was effective in mitigating physiological damage resulting from salinity stress, as manifested by increased turf quality, shoot growth rate, leaf relative water content, chlorophyll content, net photosynthetic rate, stomatal conductance and transpiration rate. Foliar application of ALA also alleviated membrane damages, as shown by lower membrane electrolyte leakage and lipid peroxidation, which was associated with increases in the activities of antioxidant enzymes. Leaf content of Na+ was reduced and the ratio of K+/Na+ was increased with ALA application under salinity stress. The positive effects of ALA for salinity tolerance were also associated with the accumulation of organic acids (α-ketoglutaric acid, succinic acid, and malic acid, amino acids (alanine, 5-oxoproline, aspartic acid, and γ -aminobutyric acid, and sugars (glucose, fructose, galactose, lyxose, allose, xylose, sucrose, and maltose. ALA-mitigation of physiological damages by salinity could be due to suppression of Na+ accumulation and enhanced physiological and metabolic activities related to photosynthesis, respiration, osmotic regulation, and antioxidant defense.

Identification and Pathogenicity of Bacteria Associated with Etiolation and Decline of Creeping Bentgrass Golf Course Putting Greens.

Science.gov (United States)

Roberts, Joseph A; Ma, Bangya; Tredway, Lane P; Ritchie, David F; Kerns, James P

2018-01-01

Bacterial etiolation and decline has developed into a widespread issue with creeping bentgrass (CBG) (Agrostis stolonifera) putting green turf. The condition is characterized by an abnormal elongation of turfgrass stems and leaves that in rare cases progresses into a rapid and widespread necrosis and decline. Recent reports have cited bacteria, Acidovorax avenae and Xanthomonas translucens, as causal agents; however, few cases exist where either bacterium were isolated in conjunction with turf exhibiting bacterial disease symptoms. From 2010 to 2014, turfgrass from 62 locations submitted to the NC State Turf Diagnostic Clinic exhibiting bacterial etiolation and/or decline symptoms were sampled for the presence of bacterial pathogens. Isolated bacteria were identified using rRNA sequencing of the 16S subunit and internal transcribed spacer region (16S-23S or ITS). Results showed diverse bacteria isolated from symptomatic turf and A. avenae and X. translucens were only isolated in 26% of samples. Frequently isolated bacterial species were examined for pathogenicity to 4-week-old 'G2' CBG seedlings and 8-week-old 'A-1' CBG turfgrass stands in the greenhouse. While results confirmed pathogenicity of A. avenae and X. translucens, Pantoea ananatis was also shown to infect CBG turf; although pathogenicity varied among isolated strains. These results illustrate that multiple bacteria are associated with bacterial disease and shed new light on culturable bacteria living in CBG turfgrass putting greens. Future research to evaluate additional microorganisms (i.e., bacteria and fungi) could provide new information on host-microbe interactions and possibly develop ideas for management tactics to reduce turfgrass pests.

Cottonwoods of the Midwest: A Community Profile

Science.gov (United States)

2008-05-01

As a component of the floodplain forest, cottonwoods provide habitat for many species of birds to roost, nest, and feed in the branches and bole...in the western United States (Malanson 1993). Cottonwood seedlings are preferred forage for cattle , which also trample young plants. Invasive...Cooper and Van Haverbeke 1990; Taylor 2001) Common Name Scientific Name Eastern Plains Invasive Graminoids Creeping bentgrass Agrostis stolonifera

COLONIZATION AND DIFFERENTIATION IN THE CLONAL PERENNIAL AGROSTIS-STOLONIFERA

NARCIS (Netherlands)

Kik, C; van Andel, Jelte; van Delden, Wilke; Joenje, W; Bijlsma, Rudolf

1990-01-01

(1) Colonization and differentiation were studied in four populations (inland meadow, salt-marsh, polder and sand-dune) of the widespread grass Agrostis stolonifera. A common-garden experiment showed that the overall population variability could be divided, through the use of principal component

Inter-specific competitive stress does not affect the magnitude of inbreeding depression

OpenAIRE

Willi, Yvonne; Dietrich, Stefan; van Kleunen, Mark; Fischer, Markus

2007-01-01

Hypothesis: Stressful inter-specific competition enhances inbreeding depression.Organisms: Creeping spearwort (Ranunculus reptans L.) and its common competitor, thecreeping bentgrass (Agrostis stolonifera L.).Field site: Outdoor common garden experiment at the University of Potsdam.Methods: We collected plants of 12 natural populations of R. reptans differing in mean parental inbreeding coefficient (0.01–0.26). We performed within-population crosses for twogenerations and kept the offspring i...

AsHSP17, a creeping bentgrass small heat shock protein modulates plant photosynthesis and ABA-dependent and independent signalling to attenuate plant response to abiotic stress.

Science.gov (United States)

Sun, Xinbo; Sun, Chunyu; Li, Zhigang; Hu, Qian; Han, Liebao; Luo, Hong

2016-06-01

Heat shock proteins (HSPs) are molecular chaperones that accumulate in response to heat and other abiotic stressors. Small HSPs (sHSPs) belong to the most ubiquitous HSP subgroup with molecular weights ranging from 12 to 42 kDa. We have cloned a new sHSP gene, AsHSP17 from creeping bentgrass (Agrostis stolonifera) and studied its role in plant response to environmental stress. AsHSP17 encodes a protein of 17 kDa. Its expression was strongly induced by heat in both leaf and root tissues, and by salt and abscisic acid (ABA) in roots. Transgenic Arabidopsis plants constitutively expressing AsHSP17 exhibited enhanced sensitivity to heat and salt stress accompanied by reduced leaf chlorophyll content and decreased photosynthesis under both normal and stressed conditions compared to wild type. Overexpression of AsHSP17 also led to hypersensitivity to exogenous ABA and salinity during germination and post-germinative growth. Gene expression analysis indicated that AsHSP17 modulates expression of photosynthesis-related genes and regulates ABA biosynthesis, metabolism and ABA signalling as well as ABA-independent stress signalling. Our results suggest that AsHSP17 may function as a protein chaperone to negatively regulate plant responses to adverse environmental stresses through modulating photosynthesis and ABA-dependent and independent signalling pathways. © 2015 John Wiley & Sons Ltd.

Constitutive Expression of a miR319 Gene Alters Plant Development and Enhances Salt and Drought Tolerance in Transgenic Creeping Bentgrass1[W][OA

Science.gov (United States)

Zhou, Man; Li, Dayong; Li, Zhigang; Hu, Qian; Yang, Chunhua; Zhu, Lihuang; Luo, Hong

2013-01-01

MicroRNA319 (miR319) is one of the first characterized and conserved microRNA families in plants and has been demonstrated to target TCP (for TEOSINTE BRANCHED/CYCLOIDEA/PROLIFERATING CELL FACTORS [PCF]) genes encoding plant-specific transcription factors. MiR319 expression is regulated by environmental stimuli, suggesting its involvement in plant stress response, although experimental evidence is lacking and the underlying mechanism remains elusive. This study investigates the role that miR319 plays in the plant response to abiotic stress using transgenic creeping bentgrass (Agrostis stolonifera) overexpressing a rice (Oryza sativa) miR319 gene, Osa-miR319a. We found that transgenic plants overexpressing Osa-miR319a displayed morphological changes and exhibited enhanced drought and salt tolerance associated with increased leaf wax content and water retention but reduced sodium uptake. Gene expression analysis indicated that at least four putative miR319 target genes, AsPCF5, AsPCF6, AsPCF8, and AsTCP14, and a homolog of the rice NAC domain gene AsNAC60 were down-regulated in transgenic plants. Our results demonstrate that miR319 controls plant responses to drought and salinity stress. The enhanced abiotic stress tolerance in transgenic plants is related to significant down-regulation of miR319 target genes, implying their potential for use in the development of novel molecular strategies to genetically engineer crop species for enhanced resistance to environmental stress. PMID:23292790

An influence of abiotic factors on the germinability of Agrostis species and Poa species

Directory of Open Access Journals (Sweden)

Pavel Knot

2006-01-01

Full Text Available The objective of this contribution is to interpret the impact of some abiotic factors on the germinability. Primarily was observed the stress that they cause on germinability and also on the energy of other perennial grass caryopsis' germinability. Withal there were considered differences in germinability of some perennial grass species, variances of strains and the influence of today`s seeds dressing technologies, which are used to improve the germination. The light factor has the biggest influence of all factors on germination of Agrostis stolonifera (Penn G-2, Providence, Poa supina (Supranova and Poa pratensis (Julius, Julius PreGerm. All these species had germination evidential higher in the light, than in the dark. With species Poa pratensis (Coctail, Coctail Headstart and Poa annua were not observed any essential variations between the dark and the light variants. Only with Poa annua there were reached noticeably lower values with variant in the light, where was used polyethyleneglycol, than in the dark. The analysis of variance demonstrated, that the biggest influence had the factor of stratification together with the light factor with Agrostis capilaris (Bardot and Agrostis stolonifera Providence. With Poa annua there was established the biggest influence of the light factor together with the factor of the used medium. The factor of stratification noticeably affected only the germination of Agrostis capillaris Bardot. The germination of Agrostis stolonifera Providence, Poa pratensis Cocktail, Cocktail Headstart, Julius and Poa annua was not noticeably affected by stratification. The reaction on the factor of stratification was with Agrostis capillaris Bardot in the dark adverse and in the light minimal. Poa pratensis Julius PreGerm germination was negative in the dark as well as in the light. With Poa supina Supranova it was not the most important factor, but still affected the germination significiantly. The nitrogen nutrition, as the

On the ecological genetics of the clonal perennial Agrostis stolonifera

NARCIS (Netherlands)

Kik, Christoffel

1987-01-01

There have to date been few studies specifically addressed to the evolution of clonal organisms. The present study attempts to fill this gap and aims to analyse the distribution pattern of a clonal plant species, using the wide-spread grass Agrostis stolonifera L.(Creeping Bent) as a model species.

Genetics of zinc tolerance in Anthoxanthum odoratum and Agrostis tenuis

Energy Technology Data Exchange (ETDEWEB)

Gartside, D W; McNeilly, T

1974-01-01

The genetic control of zinc tolerance in the grass Anthoxanthum odoratum and Agrostis tenuis has been examined using both the pair cross technique and the diallele analysis procedure used by others. Evidence is presented that the genetic control of zinc tolerance in both species is dominant and directional with a high degree of additive genetic variance.

The role of large container seedlings in afforesting oaks in bottomlands

Science.gov (United States)

Daniel C. Dey; John M. Kabrick; Michael Gold

2006-01-01

We planted large container (RPM®) and 1-0 bareroot seedlings of pin oak (Quercus palustris Muenchh.) and swamp white oak (Q. bicolor Willd.) in crop fields in the Missouri River floodplain. We also evaluated the benefits of soil mounding and a grass (Agrostis gigantea Roth) cover crop. RPM®) oak seedlings had significantly greater...

Variability of Caltha palustris L. populations in garden culture

Directory of Open Access Journals (Sweden)

Krystyna Falińska

2014-01-01

Full Text Available On the basis of studies performed in the experimental garden the character of the variability of Caltha palustris L. populations is described. Individuals were bred under uniform conditions from diaspores of meadow, springwood, flood-plain forest and alder forest populations. The results obtained allow to evaluate the hypothesis concerning the ecological preference of cytotypes (S m i t 1967, 1968 and the somewhat different ecological requirements of two subspecies: C. palustris ssp. palustris and C. palustris ssp. cornuta. It was found that each population includes individuals with different cytotypes. The situation is similar as far as subspecies are concerned, distinguished on the basis of fruit morphology (Fig. 1. It should be stressed, however, that, investigations of many years duration raised serious doubts as to the diagnostic value of fruit morphology (Figs. 2, 3. On the basis of the preserved differences between the populations in shoot habitus, reproduction and phenology in garden culture, a springwood and an alder forest ecotype were distinguished. Meadow and flood-plain populations exhibited a transitional character with certain similarities both to the alder forest and to the springwood populations.

A new marsh plant community of Eleocharito palustris-Alismatetum lanceolati (Eleocharito palustris-Sagittarion sagittifoliae alliance in Slovakia

Directory of Open Access Journals (Sweden)

Richard Hrivnák

2015-10-01

Full Text Available Open and species-poor stands with a dominance of Alisma lanceolatum were recorded in periodically flooded habitats of the southern part of central Slovakia (Ipeľ River catchment area during the summer of 2013. Phytosociological relevés correspond to the association Eleocharito palustris-Alismatetum lanceolati (alliance Eleocharito palustris-Sagittarion sagittifoliae, which is reported and documented here for the first time from the territory of Slovakia. It inhabits predominantly temporarily flooded depressions on agricultural land – wet arable fields and extensively used pastures. Detrended correspondence analysis showed that the variability in species composition was most significantly influenced by water depth, the presence of arable fields in the contact area and water conductivity. Special attention was paid to a detailed description of the floristic composition, habitat requirements, distribution patterns and nomenclature of the community.

Final report: 'Rhodopseudomonas palustris' genome workshop to be held in Spring of 2001; FINAL

International Nuclear Information System (INIS)

Harwood, Caroline S.

2002-01-01

The 'Rhodopseudomonas palustris' genome workshop took place in Iowa City on April 6-8, 2001. The purpose of the meeting was to instruct members of the annotation working group in approaches to accomplishing the 'human' phase of the 'R. palustris' genome annotation. A partial draft of a paper describing the 'Rhodopseudomonas palustris' genome has been written and a full version of the paper should be ready for submission by the end of the summer 2002

Louisiana’s Palustris Experimental Forest: 75 years of research that transformed the South

Science.gov (United States)

James P. Barnett; James D. Haywood; Henry A. Pearson

2011-01-01

The Palustris Experimental Forest, located on Kisatchie National Forest, has been in existence for 75 years. Research at Palustris has focused on southern pine reforestation technology, including seed production, bareroot nursery production, direct seeding, and planting container seedlings. After establishing pine plantations, researchers developed stand management...

Acclimation strategy of Rhodopseudomonas palustris to high light irradiance.

Science.gov (United States)

Muzziotti, Dayana; Adessi, Alessandra; Faraloni, Cecilia; Torzillo, Giuseppe; De Philippis, Roberto

2017-04-01

The ability of Rhodopseudomonas palustris cells to rapidly acclimate to high light irradiance is an essential issue when cells are grown under sunlight. The aim of this study was to investigate the photo-acclimation process in Rhodopseudomonas palustris 42OL under different culturing conditions: (i) anaerobic (AnG), (ii) aerobic (AG), and (iii) under H 2 -producing (HP) conditions both at low (LL) and high light (HL) irradiances. The results obtained clearly showed that the photosynthetic unit was significantly affected by the light irradiance at which Rp. palustris 42OL was grown. The synthesis of carotenoids was affected by both illumination and culturing conditions. At LL, lycopene was the main carotenoid synthetized under all conditions tested, while at HL under HP conditions, it resulted the predominant carotenoid. Oppositely, under AnG and AG at HL, rhodovibrin was the major carotenoid detected. The increase in light intensity produced a deeper variation in light-harvesting complexes (LHC) ratio. These findings are important for understanding the ecological distribution of PNSB in natural environments, mostly characterized by high light intensities, and for its growth outdoors. Copyright © 2017 Elsevier GmbH. All rights reserved.

High-throughput transcriptome sequencing analysis provides preliminary insights into the biotransformation mechanism of Rhodopseudomonas palustris treated with alpha-rhamnetin-3-rhamnoside.

Science.gov (United States)

Bi, Lei; Guan, Chun-jie; Yang, Guan-e; Yang, Fei; Yan, Hong-yu; Li, Qing-shan

2016-04-01

The purple photosynthetic bacterium Rhodopseudomonas palustris has been widely applied to enhance the therapeutic effects of traditional Chinese medicine using novel biotransformation technology. However, comprehensive studies of the R. palustris biotransformation mechanism are rare. Therefore, investigation of the expression patterns of genes involved in metabolic pathways that are active during the biotransformation process is essential to elucidate this complicated mechanism. To promote further study of the biotransformation of R. palustris, we assembled all R. palustris transcripts using Trinity software and performed differential expression analysis of the resulting unigenes. A total of 9725, 7341 and 10,963 unigenes were obtained by assembling the alpha-rhamnetin-3-rhamnoside-treated R. palustris (RPB) reads, control R. palustris (RPS) reads and combined RPB&RPS reads, respectively. A total of 9971 unigenes assembled from the RPB&RPS reads were mapped to the nr, nt, Swiss-Prot, Gene Ontology (GO), Clusters of Orthologous Groups (COGs) and Kyoto Encyclopedia of Genes and Genomes (KEGG) (E-value biotransformation in R. palustris. Furthermore, we propose two putative ARR biotransformation mechanisms in R. palustris. These analytical results represent a useful genomic resource for in-depth research into the molecular basis of biotransformation and genetic modification in R. palustris. Copyright © 2016 Elsevier GmbH. All rights reserved.

Ecosystem carbon stocks in Pinus palustris forests

Science.gov (United States)

Lisa Samuelson; Tom Stokes; John R. Butnor; Kurt H. Johnsen; Carlos A. Gonzalez-Benecke; Pete Anderson; Jason Jackson; Lorenzo Ferrari; Tim A. Martin; Wendell P. Cropper

2014-01-01

Longleaf pine (Pinus palustris Mill.) restoration in the southeastern United States offers opportunities for carbon (C) sequestration. Ecosystem C stocks are not well understood in longleaf pine forests, which are typically of low density and maintained by prescribed fire. The objectives of this research were to develop allometric equations for...

Complete chloroplast genome sequences of Hordeum vulgare, Sorghum bicolor and Agrostis stolonifera, and comparative analyses with other grass genomes

Science.gov (United States)

Saski, Christopher; Lee, Seung-Bum; Fjellheim, Siri; Guda, Chittibabu; Jansen, Robert K.; Luo, Hong; Tomkins, Jeffrey; Rognli, Odd Arne; Clarke, Jihong Liu

2009-01-01

Comparisons of complete chloroplast genome sequences of Hordeum vulgare, Sorghum bicolor and Agrostis stolonifera to six published grass chloroplast genomes reveal that gene content and order are similar but two microstructural changes have occurred. First, the expansion of the IR at the SSC/IRa boundary that duplicates a portion of the 5′ end of ndhH is restricted to the three genera of the subfamily Pooideae (Agrostis, Hordeum and Triticum). Second, a 6 bp deletion in ndhK is shared by Agrostis, Hordeum, Oryza and Triticum, and this event supports the sister relationship between the subfamilies Erhartoideae and Pooideae. Repeat analysis identified 19–37 direct and inverted repeats 30 bp or longer with a sequence identity of at least 90%. Seventeen of the 26 shared repeats are found in all the grass chloroplast genomes examined and are located in the same genes or intergenic spacer (IGS) regions. Examination of simple sequence repeats (SSRs) identified 16–21 potential polymorphic SSRs. Five IGS regions have 100% sequence identity among Zea mays, Saccharum officinarum and Sorghum bicolor, whereas no spacer regions were identical among Oryza sativa, Triticum aestivum, H. vulgare and A. stolonifera despite their close phylogenetic relationship. Alignment of EST sequences and DNA coding sequences identified six C–U conversions in both Sorghum bicolor and H. vulgare but only one in A. stolonifera. Phylogenetic trees based on DNA sequences of 61 protein-coding genes of 38 taxa using both maximum parsimony and likelihood methods provide moderate support for a sister relationship between the subfamilies Erhartoideae and Pooideae. PMID:17534593

Development of antioxidative effect in ice cream with Kalakai (Stenochlaena palustris) water extract

Science.gov (United States)

Hadhiwaluyo, Kristania; Rahmawati, Della; Gunawan Puteri, Maria D. P. T.

2017-11-01

Kalakai (Stenochlaena. palustris) extract was used to develop the ice cream. The antioxidant activity of the extracts and its stability over process and storage were evaluated through various antioxidant assay including DPPH assay, Folin-Ciocalteau assay and aluminum chloride colorimetric method. In general, the leaves of S. palustris had a significantly higher antioxidant activity (p ice cream without affecting the sensory properties of the ice cream. In addition, the high phenolic and flavonoid content also suggest the more compounds that were capable to act as an antioxidant. The result of the stability test also suggested the ability low temperature storage and processing in maintaining the stability of the antioxidant activity of the extract (p > 0.05) over processing and storage. Thus, this strengthen the feasibility of S. palustris to be used as a potential functional food ingredient that is low cost and easily accessible with an antioxidant activity and safe iron content that is beneficial to increase the quality of food produced including in ice cream.

Sequence Analysis of the Cryptic Plasmid pMG101 from Rhodopseudomonas palustris and Construction of Stable Cloning Vectors

Science.gov (United States)

Inui, Masayuki; Roh, Jung Hyeob; Zahn, Kenneth; Yukawa, Hideaki

2000-01-01

A 15-kb cryptic plasmid was obtained from a natural isolate of Rhodopseudomonas palustris. The plasmid, designated pMG101, was able to replicate in R. palustris and in closely related strains of Bradyrhizobium japonicum and phototrophic Bradyrhizobium species. However, it was unable to replicate in the purple nonsulfur bacterium Rhodobacter sphaeroides and in Rhizobium species. The replication region of pMG101 was localized to a 3.0-kb SalI-XhoI fragment, and this fragment was stably maintained in R. palustris for over 100 generations in the absence of selection. The complete nucleotide sequence of this fragment revealed two open reading frames (ORFs), ORF1 and ORF2. The deduced amino acid sequence of ORF1 is similar to sequences of Par proteins, which mediate plasmid stability from certain plasmids, while ORF2 was identified as a putative rep gene, coding for an initiator of plasmid replication, based on homology with the Rep proteins of several other plasmids. The function of these sequences was studied by deletion mapping and gene disruptions of ORF1 and ORF2. pMG101-based Escherichia coli-R. palustris shuttle cloning vectors pMG103 and pMG105 were constructed and were stably maintained in R. palustris growing under nonselective conditions. The ability of plasmid pMG101 to replicate in R. palustris and its close phylogenetic relatives should enable broad application of these vectors within this group of α-proteobacteria. PMID:10618203

Acquisition of the ability for Rhodopseudomonas palustris to degrade chlorinated benzoic acids as the sole carbon source

NARCIS (Netherlands)

Oda, Y; de Vries, YP; Forney, LJ; Gottschal, JC

2001-01-01

Three strains of Rhodopseudomonas palustris were isolated from phototrophic enrichment cultures containing 3-chlorobenzoate (3-CBA) and benzoate (BA). These new strains as well as several previously described strains of R. palustris were tested in this study and shown to degrade 3-CBA if grown in

Aberrante Epigynenbildungen bei der Wolfspinne Pardosa palustris (Araneae, Lycosidae

Directory of Open Access Journals (Sweden)

Martin, Dieter

2013-11-01

Full Text Available Two cases of aberrant epigyne shape in Pardosa palustris (Linnaeus, 1758 are described. Characteristic is the absence of the posterior lateral parts of the septum. Possible causes, such as `genital damage` during mating or the effects of parasite infestation, are discussed.

The anaerobic phototrophic metabolism of 3-chlorobenzoate by Rhodopseudomonas palustris

Energy Technology Data Exchange (ETDEWEB)

Kamal, V S

1992-10-09

The degradation of chlorinated aromatic compounds by anaerobic bacteria is now known to be an important mechanism of bioremediation. In an experimental study, a mixed phototrophic culture was found to metabolize 3-chlorobenzoate in the presence of benzoate following adaptation on a benzoate and 3-chlorobenzoate medium for 7 weeks. The dominant bacterial isolate was identified as Rhodopseudomonas palustris. Radioisotopic studies showed [sup 14]C-3-chlorobenzoate was converted by the isolate to [sup 14]CO[sub 2] and cell biomass in the absence of oxygen and in the presence of a cosubstrate red light. Cyclohexane carboxylate was able to replace the cosubstrate, benzoate. The isolate also metabolized 3-chlorobenzoate in the presence of pimelic acid, sodium acetate, and sodium succinate; however, the metabolic rate was reduced. Gas chromatography mass spectrometry and high pressure liquid chromatography indicated the intracellular presence of 3-chlorobenzoate and benzoyl-CoA. Cell-free extracts produced benzoate and benzoyl-CoA. A probable route of 3-chlorobenzoate metabolism via dehalogenation followed by steps similar to the benzoate reductive ring fission pathway is suggested. Comparison of kinetic coefficients showed a higher affinity of the isolate for benzoate. Isolates from representative samples of various freshwater and wastewater ecosystems indicated widespread ecological distribution of R. palustris and the common occurrence of the 3-chlorobenzoate metabolic phenotype. R. palustris was found to grow in mixed anaerobic cultures and retained its 3-chlorobenzoate degradation property. 91 refs., 25 figs., 14 tabs.

Phytotoxic activity of flavonoids from Dicranostyles ampla.

Science.gov (United States)

Castro, Amaya; Cantrell, Charles L; Hale, Amber L; Duke, Stephen O

2010-08-01

Crude extracts from over 16 species of plants from the family Convolvulaceae were evaluated for phytotoxic activity against Agrostis stolonifera (bentgrass) and Lactuca sativa (lettuce) at 1000 microg/mL. Ethanol extracts of Dicranostyles ampla Ducke were among the most active of those species tested. Systematic bioassay-guided fractionation of the ethanol extract of the aerial parts from this species was performed to identify specifically the phytotoxic compounds. Two phytotoxic flavonoids, dihydromyricetin (1) and myricetin-3-O-alpha-rhamnoside or myricetrin (2), were found to be responsible for much of the activity of the extract as a whole in the A. stolonifera and L. sativa bioassay. In a Lemna paucicostata bioassay, 1 and 2 had no activity at 100 microM.

Notes i contribucions al coneixement de la flora de Menorca (X). Notes florístiques

OpenAIRE

Fraga-Arguimbau, Pere

2014-01-01

Es donen a conèixer noves dades corològiques i observacions taxonòmiques per a la flora de Menorca referents a 50 tàxons. D'aquests 13 són novetat per a la flora de les Balears: Agrostis stolonifera subsp. gaditana (Boiss. & Reut.) Valdés & H. Scholz, Asteriscus pygmaeus (DC.) Coss. & Durieu, Callitriche obtnsangula Le Gall, Dactylis glomerata subsp. hackelii (Asch. & Graebn.) Cif. & Giacom., Daucus muricatus (L.) L., Ehrharta calycina J.E. Sm., Eleocharis palustris subsp. waltersii Bures & D...

Revealing the functions of the transketolase enzyme isoforms in Rhodopseudomonas palustris using a systems biology approach.

Directory of Open Access Journals (Sweden)

Chia-Wei Hu

Full Text Available BACKGROUND: Rhodopseudomonas palustris (R. palustris is a purple non-sulfur anoxygenic phototrophic bacterium that belongs to the class of proteobacteria. It is capable of absorbing atmospheric carbon dioxide and converting it to biomass via the process of photosynthesis and the Calvin-Benson-Bassham (CBB cycle. Transketolase is a key enzyme involved in the CBB cycle. Here, we reveal the functions of transketolase isoforms I and II in R. palustris using a systems biology approach. METHODOLOGY/PRINCIPAL FINDINGS: By measuring growth ability, we found that transketolase could enhance the autotrophic growth and biomass production of R. palustris. Microarray and real-time quantitative PCR revealed that transketolase isoforms I and II were involved in different carbon metabolic pathways. In addition, immunogold staining demonstrated that the two transketolase isoforms had different spatial localizations: transketolase I was primarily associated with the intracytoplasmic membrane (ICM but transketolase II was mostly distributed in the cytoplasm. Comparative proteomic analysis and network construction of transketolase over-expression and negative control (NC strains revealed that protein folding, transcriptional regulation, amino acid transport and CBB cycle-associated carbon metabolism were enriched in the transketolase I over-expressed strain. In contrast, ATP synthesis, carbohydrate transport, glycolysis-associated carbon metabolism and CBB cycle-associated carbon metabolism were enriched in the transketolase II over-expressed strain. Furthermore, ATP synthesis assays showed a significant increase in ATP synthesis in the transketolase II over-expressed strain. A PEPCK activity assay showed that PEPCK activity was higher in transketolase over-expressed strains than in the negative control strain. CONCLUSIONS/SIGNIFICANCE: Taken together, our results indicate that the two isoforms of transketolase in R. palustris could affect photoautotrophic growth

Adaptation of a lead-tolerant population of Agrostis tenuis to low soil fertility

Energy Technology Data Exchange (ETDEWEB)

Jowett, D

1959-07-04

A population of Agrostis tenuis growing on lead ore grindings at Goginan was found to be tolerant of lead. The pasture populations responded to calcium and phosphate, whereas the lead mine population showed no response to calcium and a lesser response to phosphate. The lead mine population data was included. A considerable range of adaption to soil mineral levels has now been found in this species. It has populations tolerant of lead, copper, and nickel poisoning, and of low levels of calcium and phosphate. In lead mine habitats A tenuis is not replaced by A. canina as in more normal habitats. A tenuis is subject to the most extreme conditions of low fertility. 4 tables.

Effects of metal ions on biomass and 5-aminolevulinic acid production in Rhodopseudomonas palustris wastewater treatment.

Science.gov (United States)

Liu, Shuli; Zhang, Guangming; Li, Jianzheng; Li, Xiangkun; Zhang, Jie

2016-01-01

This work investigated the effects of eight metal ions on Rhodopseudomonas palustris growth and 5-aminolevulinic acid (ALA) yield in wastewater treatment. Results show that metal ions (Mg(2+) of 15 mmol/L, Fe(2+) of 400 μmol/L, Co(2+) of 4 μmol/L, Ni(2+) of 8 μmol/L and Zn(2+) of 4 μmol/L) could effectively improve the chemical oxygen demand (COD) removal, Rp. palustris biomass and ALA yield. The highest ALA yield of 13.1 mg/g-biomass was achieved with Fe(2+) of 400 μmol/L. ALA yields were differentially increased under different metal ions in the following order: Fe(2+) group > Mg(2+) group > Co(2+) group = Ni(2+) group > Zn(2+) group = Mo(2+) group > control. Cu(2+) and Mn(2+) inhibited Rp. palustris growth and ALA production. Mechanism analysis revealed that metal ions changed ALA yields by influencing the activities of ALA synthetase and ALA dehydratase.

?-Oryzanols of North American Wild Rice (Zizania palustris)

OpenAIRE

Aladedunye, Felix; Przybylski, Roman; Rudzinska, Magdalena; Klensporf-Pawlik, Dorota

2013-01-01

?-Oryzanol, a natural mixture of ferulic acid esters of triterpene alcohols and sterols, are an important bioactive components present in rice bran oil. In light of the recent increase in the popularity of wild rice among consumers, and the possibility of a direct relationship between ?-oryzanol composition and its bioactivity, the oryzanol profile of major wild rice (Zizania palustris) grown in North America was studied and compared to regular brown rice (Oryza sativa L.). A total of twenty-...

Mortalidade em florestas de Pinus palustris causada por tempestade de raios

Science.gov (United States)

Kenneth W. Outcalt; Jorge Paladino Corrêa de Lima; Jose Américo de Mello Filho

2002-01-01

The importance of lightning as an ignition source for the fire driven Pinus palustris ecosystem is widely recognized. Lightning also impacts this system on a smaller scale by causing individual tree mortality. The objective of this study was to determine the level of mortality due to lightning activity at the Department of Energy's Savannah...

Phytodesalinization potential of Typha angustifolia, Juncus maritimus, and Eleocharis palustris for removal of de-icing salts from runoff water.

Science.gov (United States)

Guesdon, Gaëlle; de Santiago-Martín, Ana; Galvez-Cloutier, Rosa

2016-10-01

Typha angustifolia, Juncus maritimus, and Eleocharis palustris were evaluated for de-icing salt removal from runoff water. Plants were exposed to a range of de-icing salt levels (0.2, 0.7, 4, 8, and 13 dS m(-1)) in laboratory-scale subsurface constructed wetlands (CWs) for 2 months under greenhouse conditions. Effluent characteristics, plant height, biomass, and Cl and Na removal rates and uptake were monitored. More water volume was retained in CWs of T. angustifolia (∼60 %) than of J. maritimus and E. palustris (∼37.5 %), which accounted for the electrical conductivity increase in effluents (1.3-1.9-fold). Based on the NaCl removal rate, T. angustifolia showed the greatest phytodesalinization ability (31-60 %) with the highest removal at the lowest salt levels (0.2-0.7 dS m(-1)), followed by J. maritimus (22-36 %) without differences in removal among levels, and E. palustris (3-26 %) presenting a removal rate highly decreased with increasing salt levels. Plant height and biomass were stimulated at low de-icing salt levels, but, at higher levels, T. angustifolia and E. palustris growth was inhibited (tolerance index ∼67 and 10 %, respectively, in the worst cases). Salt amounts in aboveground biomass in g m(-2) differed among levels and ranged as follows: 13.6-29.1 (Cl), 4.2-9.3 (Na; T. angustifolia); 7.0-12.0 (Cl), 2.7-6.4 (Na; J. maritimus); and 0.9-7.6 (Cl), 0.3-1.6 (Na; E. palustris). Chloride and Na translocation decreased with de-icing salt increase in T. angustifolia, while no significant differences were found in J. maritimus, which is interesting for harvesting purposes.

Forest floor depth mediates understory vigor in xeric Pinus palustris ecosystems

Science.gov (United States)

J. Kevin Hiers; Joseph J. O' Brien; Rodney E. Will; Robert J. Mitchell

2007-01-01

Longleaf pine (Pinus palustris) woodlands and savannas are among the most frequently burned ecosystems in the world with fire return intervals of 1–10 years. This fire regime has maintained high levels of biodiversity in terms of both species richness and endemism. Land use changes have reduced the area of this ecosystem by .95%, and inadequate fire...

Aptitude of Lymnaea palustris and L. stagnalis to Fasciola hepatica larval development through the infection of several successive generations of 4-mm-high snails.

Science.gov (United States)

Vignoles, P; Rondelaud, D; Dreyfuss, G

2016-06-01

Bimiracidial infections of Lymnaea palustris and Lymnaea stagnalis (shell height at exposure, 4 mm) with Fasciola hepatica were carried out during six successive snail generations to determine if prevalence and intensity of snail infection increased over time through descendants issuing from eggs laid by parents already exposed to this digenean. Controls were constituted by a French population of Galba truncatula (a single generation) infected according to the same protocol. In a first experiment performed with the F1 to F5 generations of L. palustris, the prevalence and intensity of F. hepatica infection in snails progressively increased. Immature rediae and a few cercariae-containing rediae of the digenean were observed in L. stagnalis from the F3 generation, but no free cercaria was noted in the bodies of this lymnaeid from the F4 to F6 generations. In another experiment carried out with the F6 generation of L. palustris, the prevalence of F. hepatica infection and the number of shed cercariae were significantly lower in L. palustris than in G. truncatula. This mode of snail infection suggests an explanation for cases of human fasciolosis occurring in central France after the collection of wild watercress from beds where L. palustris was the sole lymnaeid.

Photometabolism of Heterocyclic Aromatic Compounds by Rhodopseudomonas palustris OU 11

Science.gov (United States)

Sasikala, C.; Ramana, C. V.; Rao, P. Raghuveer

1994-01-01

Rhodopseudomonas palustris OU 11 (ATCC 51186; DSM 7375) isolated from a pond of chemical industry effluent could anaerobically photometabolize heterocyclic aromatic compounds belonging to the pyridine and pyrazine groups only after a period of adaptation on pyrazinoic acid of 5 to 6 weeks. Growth on heterocyclic compounds was light dependent. The effects of various concentrations of heterocyclic compounds on growth suggest that higher concentrations of these compounds inhibit growth and are toxic. PMID:16349307

Metabolite responses to exogenous application of nitrogen, cytokinin, and ethylene inhibitors in relation to heat-induced senescence in creeping bentgrass.

Directory of Open Access Journals (Sweden)

David Jespersen

Full Text Available The exogenous application of ethylene inhibitors, cytokinins, or nitrogen has previously been shown to suppress heat-induced senescence and improve heat tolerance in cool-season grasses. The objectives of this study were to examine metabolic profiles altered by exogenous treatment of creeping bentgrass with an ethylene inhibitor, cytokinin or nitrogen under heat stress and to determine metabolic pathways regulated by those compounds in association with their effectiveness for improving heat tolerance. Creeping bentgrass (Agostis stolonifera plants (cv. Penncross were foliar sprayed with 18 mM carbonyldiamide (N source, 25 μM aminoethoxyvinylglycine (AVG, ethylene inhibitor, 25 μM zeatin riboside (ZR, cytokinin, or a water control, and then exposed to 20/15°C (day/night or 35/30°C (heat stress in growth chambers. All three exogenous treatments suppressed leaf senescence, as manifested by increased turf quality and chlorophyll content, and reduced electrolyte leakage under heat stress. Polar metabolite profiling identified increases in the content of certain organic acids (i.e. citric and malic acid, sugar alcohols, disaccharides (sucrose, and decreased accumulations of monosaccharides (i.e. glucose and fructose with exogenous treatment of N, AVG, or ZR at the previously mentioned concentrations when compared to the untreated control under heat stress. Nitrogen stimulated amino acid accumulation whereas AVG and ZR reduced amino acid accumulation compared to the untreated control under heat stress. These results revealed that the alleviation of heat-induced leaf senescence by N, AVG, and ZR could be due to changes in the accumulation of metabolites involved in osmoregulation, antioxidant metabolism, carbon and nitrogen metabolism, as well as stress signaling molecules.

Traffic-emitted metal status and uptake by Carex meyeriana Kunth and Thelypteris palustris var. pubescens Fernald growing in roadside turfy swamp in the Changbai Mountain area, China.

Science.gov (United States)

Wang, Hong; Nie, Lei; Xu, Yan; Li, Miao; Lv, Yan

2018-04-26

Six traffic-emitted metals (Cr, Zn, Cu, Cd, Pb, and Ni) were determined in soil and plants for below- and aboveground parts along different distances from highway to evaluate their behavior and uptake by Carex meyeriana Kunth and Thelypteris palustris var. pubescens Fernald growing in turfy swamps. The results indicated that the different plant tissues showed significantly different levels of metal content. Nonlinear regression analysis indicated that metal contents leveled off at constant values before they decreased as the distance from the roadside increased. The high R 2 values of the regression model indicated good fit of the exponential function applied to depict the distribution pattern of the metal elements. It was deduced that Cr, Cu, and Cd in Thelypteris palustris var. pubescens Fernald were mainly derived from the soil; Carex meyeriana Kunth and Thelypteris palustris var. pubescens Fernald absorbed Pb mainly through the stomata from atmospheric depositions; Cr, Cu, and Cd in Carex meyeriana Kunth and Zn in Thelypteris palustris var. pubescens Fernald were mainly affected by soil and atmospheric depositions. After excluding the effects of traffic, only the bioaccumulation factor of Cd (1.34) in Carex meyeriana Kunth and the translocation factor of Zn (1.13) in Thelypteris palustris var. pubescens Fernald were greater than 1, suggesting that Carex meyeriana Kunth could be a good candidate for assimilating Cd from soils and Thelypteris palustris var. pubescens Fernald could be suitable for the phytoextraction of Zn.

Arsenic-Redox Transformation and Plant Growth Promotion by Purple Nonsulfur Bacteria Rhodopseudomonas palustris CS2 and Rhodopseudomonas faecalis SS5.

Science.gov (United States)

Batool, Kanza; Tuz Zahra, Fatima; Rehman, Yasir

2017-01-01

Arsenic (As) is a well-known toxic metalloid found naturally and released by different industries, especially in developing countries. Purple nonsulfur bacteria (PNSB) are known for wastewater treatment and plant growth promoting abilities. As-resistant PNSB were isolated from a fish pond. Based on As-resistance and plant growth promoting attributes, 2 isolates CS2 and SS5 were selected and identified as Rhodopseudomonas palustris and Rhodopseudomonas faecalis , respectively, through 16S rRNA gene sequencing. Maximum As(V) resistance shown by R. faecalis SS5 and R. palustris CS2 was up to 150 and 100 mM, respectively. R . palustris CS2 showed highest As(V) reduction up to 62.9% (6.29 ± 0.24 mM), while R. faecalis SS5 showed maximum As(III) oxidation up to 96% (4.8 ± 0.32 mM), respectively. Highest auxin production was observed by R. palustris CS2 and R. faecalis SS, up to 77.18 ± 3.7 and 76.67 ± 2.8  μ g mL -1 , respectively. Effects of these PNSB were tested on the growth of Vigna mungo plants. A statistically significant increase in growth was observed in plants inoculated with isolates compared to uninoculated plants, both in presence and in absence of As. R. palustris CS2 treated plants showed 17% (28.1 ± 0.87 cm) increase in shoot length and 21.7% (7.07 ± 0.42 cm) increase in root length, whereas R. faecalis SS5 treated plants showed 12.8% (27.09 ± 0.81 cm) increase in shoot length and 18.8% (6.9 ± 0.34 cm) increase in root length as compared to the control plants. In presence of As, R. palustris CS2 increased shoot length up to 26.3% (21.0 ± 1.1 cm), while root length increased up to 31.3% (5.3 ± 0.4 cm), whereas R. faecalis SS5 inoculated plants showed 25% (20.7 ± 1.4 cm) increase in shoot length and 33.3% (5.4 ± 0.65 cm) increase in root length as compared to the control plants. Bacteria with such diverse abilities could be ideal for plant growth promotion in As-contaminated sites.

The potential of Thelypteris palustris and Asparagus sprengeri in phytoremediation of arsenic contamination.

Science.gov (United States)

Anderson, LaShunda L; Walsh, Maud; Roy, Amitava; Bianchetti, Christopher M; Merchan, Gregory

2011-02-01

The potential of two plants, Thelypteris palustris (marsh fern) and Asparagus sprengeri (asparagus fern), for phytoremediation of arsenic contamination was evaluated. The plants were chosen for this study because of the discovery of the arsenic hyperaccumulating fern, Pteris vittata (Ma et al., 2001) and previous research indicating asparagus fern's ability to tolerate > 1200 ppm soil arsenic. Objectives were (1) to assess if selected plants are arsenic hyperaccumulators; and (2) to assess changes in the species of arsenic upon accumulation in selected plants. Greenhouse hydroponic experiments arsenic treatment levels were established by adding potassium arsenate to solution. All plants were placed into the hydroponic experiments while still potted in their growth media. Marsh fern and Asparagus fern can both accumulate arsenic. Marsh fern bioaccumulation factors (> 10) are in the range of known hyperaccumulator, Pteris vittata Therefore, Thelypteris palustris is may be a good candidate for remediation of arsenic soil contamination levels of arsenic. Total oxidation of As (III) to As (V) does not occur in asparagus fern. The asparagus fern is arsenic tolerant (bioaccumulation factors phytoremediation candidate.

A two-step fermentation of distillers' grains using Trichoderma viride and Rhodopseudomonas palustris for fish feed.

Science.gov (United States)

Zhang, Jian; Zhang, Wen-Xue; Li, Shun-Zhou; You, Ling; Zhang, Chao; Sun, Chuan-Ze; Liu, Xiao-Bin

2013-10-01

It is important to provide added value or to make full use of the co-product of grains from ethanol production. In order to convert distillers' grains into a high-quality feed, the Trichoderma viride and Rhodopseudomonas palustris fermentation were combined and investigated in this study. The T. viride fermentation was carried out in an aerobic fermentation installation in favoring of the growth of the fungi and the degradation of the cellulose, and then the fermentation of R. palustris was performed to increase the content of protein with an anaerobic installation. After the two step fermentations, the true protein content of dried distiller' grains increased from 11.4 to 33.6 % (w/w) (the content of crude protein from 14.5 to 39.7 %), the crude fiber content decreased from 21.3 to 7.6 % (w/w), the crude fat content increased from 5.5 to 7.9 % (w/w), the crude ash decreased from 14.6 to 10.2 % (w/w), the total phosphorus content increased from 0.4 to 1.2 % (w/w), and the water content was 11.8 % (w/w). The dried and fermented grains contain the R. palustris viable count of 5.3 × 10¹¹ CFU/g dry matter. The results may support a new application of an active photosynthetic bacteria fish feed in fisheries industry and offer a reference for the further study of lignocellulosic materials as raw materials converting into high-quality feed.

Phenotype fingerprinting suggests the involvement of single-genotype consortia in degradation of aromatic compounds by Rhodopseudomonas palustris.

Directory of Open Access Journals (Sweden)

Tatiana V Karpinets

Full Text Available Anaerobic degradation of complex organic compounds by microorganisms is crucial for development of innovative biotechnologies for bioethanol production and for efficient degradation of environmental pollutants. In natural environments, the degradation is usually accomplished by syntrophic consortia comprised of different bacterial species. This strategy allows consortium organisms to reduce efforts required for maintenance of the redox homeostasis at each syntrophic level. Cellular mechanisms that maintain the redox homeostasis during the degradation of aromatic compounds by one organism are not fully understood. Here we present a hypothesis that the metabolically versatile phototrophic bacterium Rhodopseudomonas palustris forms its own syntrophic consortia, when it grows anaerobically on p-coumarate or benzoate as a sole carbon source. We have revealed the consortia from large-scale measurements of mRNA and protein expressions under p-coumarate, benzoate and succinate degrading conditions using a novel computational approach referred as phenotype fingerprinting. In this approach, marker genes for known R. palustris phenotypes are employed to determine the relative expression levels of genes and proteins in aromatics versus non-aromatics degrading condition. Subpopulations of the consortia are inferred from the expression of phenotypes and known metabolic modes of the R. palustris growth. We find that p-coumarate degrading conditions may lead to at least three R. palustris subpopulations utilizing p-coumarate, benzoate, and CO2 and H2. Benzoate degrading conditions may also produce at least three subpopulations utilizing benzoate, CO2 and H2, and N2 and formate. Communication among syntrophs and inter-syntrophic dynamics in each consortium are indicated by up-regulation of transporters and genes involved in the curli formation and chemotaxis. The N2-fixing subpopulation in the benzoate degrading consortium has preferential activation of the

Population Genetic Structure of Cochliobolus miyabeanus on Cultivated Wild Rice (Zizania palustris L.) in Minnesota

Science.gov (United States)

Cochliobolus miyabeanus (Bipolaris oryzae) is the causal agent of fungal brown spot (FBS) in wild rice (Zizania palustris L.), an aquatic grass, endemic in Minnesota, Wisconsin, and parts of Canada. Grain yield losses can reach up to 74% when the disease starts at the boot stage and continues until ...

Muscle Senescence in Short-Lived Wild Mammals, the Soricine Shrews Blarina brevicauda and Sorex palustris

Science.gov (United States)

HINDLE, ALLYSON G.; LAWLER, JOHN M.; CAMPBELL, KEVIN L.; HORNING, MARKUS

2015-01-01

Red-toothed (soricine) shrews are consummate predators exhibiting the highest energy turnovers and shortest life spans (ca. 18 months) of any mammal, yet virtually nothing is known regarding their physiological aging. We assessed the emerging pattern of skeletal muscle senescence (contractile/connective tissue components) in sympatric species, the semi-aquatic water shrew (WS), Sorex palustris, and the terrestrial short-tailed shrew (STS), Blarina brevicauda, to determine if muscle aging occurs in wild, short-lived mammals (H0: shrews do not survive to an age where senescence occurs), and if so, whether these alterations are species-specific. Gracilis muscles were collected from first-year (n = 17) and second-year (n = 17) field-caught shrews. Consistent with typical mammalian aging, collagen content (% area) increased with age in both species (S. palustris: ~50%; B. brevicauda: ~60%). Muscle was dominated by stiffer Type I collagen, and the ratio of collagen Type I:Type III more than doubled with age. The area ratio of muscle:collagen decreased with age in both species, but was considerably lower in adult STS, suggesting species-specificity of senescence. Extracellular space was age-elevated in B. brevicauda, but was preserved in S. palustris (~50 vs. 10% elevation). Though juvenile interspecific comparisons revealed no significance, adult WS myocytes had 68% larger cross-sectional area and occurred at 28% lower fibers/area than those of adult STS. We demonstrate that age-related muscle senescence does occur in wild-caught, short-lived mammals, and we therefore reject this classic aging theory tenet. Our findings moreover illustrate that differential age adjustments in contractile/connective tissue components of muscle occur in the two species of wild-caught shrews. PMID:19296507

Effect of natural West African phosphates on phosphorus uptake by Agrostis and on isotopically dilutable phosphorus (L-value) in five tropical soils

International Nuclear Information System (INIS)

Pichot, J.; Truong, B.; Beunard, P.

1979-01-01

Six natural West African phosphates are compared with a weak Tunisian phosphate and triple superphosphate in five types of tropical soil. The study consists of a pot experiment using Agrostis as the test plant, over several cuttings, in order to evaluate the uptake of phosphorus by plants and the isotopically dilutable phosphorus of the soil (L-value). The results show that there are very great differences between phosphates from the points of view of speed and degree of solubilization and that the L-value is a good criterion for assessing these differences. (author)

Cholinesterase inhibitory activity and chemical constituents of Stenochlaena palustris fronds at two different stages of maturity

Directory of Open Access Journals (Sweden)

Nelson Jeng-Yeou Chear

2016-04-01

Full Text Available Stenochlaena palustris fronds are popular as a vegetable in Southeast Asia. The objectives of this study were to evaluate the anticholinesterase properties and phytochemical profiles of the young and mature fronds of this plant. Both types of fronds were found to have selective inhibitory effect against butyrylcholinesterase compared with acetylcholinesterase. However, different sets of compounds were responsible for their activity. In young fronds, an antibutyrylcholinesterase effect was observed in the hexane extract, which was comprised of a variety of aliphatic hydrocarbons, fatty acids, and phytosterols. In the mature fronds, inhibitory activity was observed in the methanol extract, which contained a series of kaempferol glycosides. Our results provided novel information concerning the ability of S. palustris to inhibit cholinesterase and its phytochemical profile. Further research to investigate the potential use of this plant against Alzheimer's disease is warranted, however, young and mature fronds should be distinguished due to their phytochemical differences.

Muscle senescence in short-lived wild mammals, the soricine shrews Blarina brevicauda and Sorex palustris.

Science.gov (United States)

Hindle, Allyson G; Lawler, John M; Campbell, Kevin L; Horning, Markus

2009-06-01

Red-toothed (soricine) shrews are consummate predators exhibiting the highest energy turnovers and shortest life spans (ca. 18 months) of any mammal, yet virtually nothing is known regarding their physiological aging. We assessed the emerging pattern of skeletal muscle senescence (contractile/connective tissue components) in sympatric species, the semi-aquatic water shrew (WS), Sorex palustris, and the terrestrial short-tailed shrew (STS), Blarina brevicauda, to determine if muscle aging occurs in wild, short-lived mammals (H(0): shrews do not survive to an age where senescence occurs), and if so, whether these alterations are species-specific. Gracilis muscles were collected from first-year (n=17) and second-year (n=17) field-caught shrews. Consistent with typical mammalian aging, collagen content (% area) increased with age in both species (S. palustris: approximately 50%; B. brevicauda: approximately 60%). Muscle was dominated by stiffer Type I collagen, and the ratio of collagen Type I:Type III more than doubled with age. The area ratio of muscle:collagen decreased with age in both species, but was considerably lower in adult STS, suggesting species-specificity of senescence. Extracellular space was age-elevated in B. brevicauda, but was preserved in S. palustris ( approximately 50 vs. 10% elevation). Though juvenile interspecific comparisons revealed no significance, adult WS myocytes had 68% larger cross-sectional area and occurred at 28% lower fibers/area than those of adult STS. We demonstrate that age-related muscle senescence does occur in wild-caught, short-lived mammals, and we therefore reject this classic aging theory tenet. Our findings moreover illustrate that differential age adjustments in contractile/connective tissue components of muscle occur in the two species of wild-caught shrews. (c) 2009 Wiley-Liss, Inc.

Ethylene regulates fast apoplastic acidification and expansin A transcription during submergence-induced petiole elongation in Rumex palustris

NARCIS (Netherlands)

Vreeburg, RAM; Benschop, JJ; Peeters, AJM; Colmer, TD; Ammerlaan, AHM; Staal, M; Elzenga, TM; Staals, RHJ; Darley, CP; McQueen-Mason, SJ; Voesenek, LACJ

The semi-aquatic dicot Rumex palustris responds to complete submergence by enhanced elongation of young petioles. This elongation of petiole cells brings leaf blades above the water surface, thus reinstating gas exchange with the atmosphere and increasing survival in flood-prone environments. We

The role of oxalic acid in tolerance to N’N-napthaloylhydroxylamine in Tyromyces palustris

Science.gov (United States)

R.A. Arango; C.A. Clausen; Frederick Green

2006-01-01

Certain wood decay fungi exhibit tolerance to one or more wood preservatives. Copper tolerance of brown-rot fungi has been studied in our laboratory for the past six years. We have observed some degree of tolerance to N’N-naphthaloylhydroxamine (NHA), a recently patented termite bait, by the brown-rot fungus Tyromyces palustris TYP-6137. In an effort to try and confirm...

Nursery response of container Pinus palustris seedlings to nitrogen supply and subsequent effects on outplanting performance

Science.gov (United States)

D. Paul Jackson; R. Kasten Dumroese; James P. Barnett

2012-01-01

Container longleaf pine (Pinus palustris) seedlings often survive and grow better after outplanting than bareroot seedlings. Because of this, most longleaf pine are now produced in containers. Little is known about nursery fertilization effects on the quality of container longleaf pine seedlings and how that influences outplanting performance. We compared various...

Assessing longleaf pine (Pinus palustris) restoration after southern pine beetle kill using a compact experimental design

Science.gov (United States)

J.-P. Berrill; C.M. Dagley

2010-01-01

A compact experimental design and analysis is presented of longleaf pine (Pinus palustris) survival and growth in a restoration project in the Piedmont region of Georgia, USA. Longleaf pine seedlings were planted after salvage logging and broadcast burning in areas of catastrophic southern pine beetle (Dendroctonus frontalis) attacks on even-aged mixed pine-hardwood...

Identification of protein W, the elusive sixth subunit of the Rhodopseudomonas palustris reaction center-light harvesting 1 core complex.

Science.gov (United States)

Jackson, Philip J; Hitchcock, Andrew; Swainsbury, David J K; Qian, Pu; Martin, Elizabeth C; Farmer, David A; Dickman, Mark J; Canniffe, Daniel P; Hunter, C Neil

2018-02-01

The X-ray crystal structure of the Rhodopseudomonas (Rps.) palustris reaction center-light harvesting 1 (RC-LH1) core complex revealed the presence of a sixth protein component, variably referred to in the literature as helix W, subunit W or protein W. The position of this protein prevents closure of the LH1 ring, possibly to allow diffusion of ubiquinone/ubiquinol between the RC and the cytochrome bc 1 complex in analogous fashion to the well-studied PufX protein from Rhodobacter sphaeroides. The identity and function of helix W have remained unknown for over 13years; here we use a combination of biochemistry, mass spectrometry, molecular genetics and electron microscopy to identify this protein as RPA4402 in Rps. palustris CGA009. Protein W shares key conserved sequence features with PufX homologs, and although a deletion mutant was able to grow under photosynthetic conditions with no discernible phenotype, we show that a tagged version of protein W pulls down the RC-LH1 complex. Protein W is not encoded in the photosynthesis gene cluster and our data indicate that only approximately 10% of wild-type Rps. palustris core complexes contain this non-essential subunit; functional and evolutionary consequences of this observation are discussed. The ability to purify uniform RC-LH1 and RC-LH1-protein W preparations will also be beneficial for future structural studies of these bacterial core complexes. Copyright © 2017 The Authors. Published by Elsevier B.V. All rights reserved.

Ecosystem engineering potential of the gastropod Terebralia palustris (Linnaeus, 1767) in mangrove wastewater wetlands - A controlled mesocosm experiment

Energy Technology Data Exchange (ETDEWEB)

Penha-Lopes, Gil, E-mail: gil.penha-lopes@biology-research.co [Centro de Oceanografia - Laboratorio Maritimo da Guia, Departamento de Biologia Animal, Faculdade de Ciencias da Universidade de Lisboa, Avenida Na, Senhora do Cabo 939, 2750-374 Cascais (Portugal); Department of Analytical and Environmental Chemistry, Vrije Universiteit Brussels, Brussels (Belgium); Bartolini, Fabrizio [Dipartimento di Biologia Evoluzionistica, Universita degli Studi di Firenze, via Romana 17, I-50125 Firenze (Italy); Limbu, Samwel [University of Dar es Salaam, Department of Aquatic Sciences and Fisheries, P.O. Box 35064, Dar es Salaam (Tanzania, United Republic of); Cannicci, Stefano [Dipartimento di Biologia Evoluzionistica, Universita degli Studi di Firenze, via Romana 17, I-50125 Firenze (Italy); Mgaya, Yunus [University of Dar es Salaam, Department of Aquatic Sciences and Fisheries, P.O. Box 35064, Dar es Salaam (Tanzania, United Republic of); Kristensen, Erik [Institute of Biology, University of Southern Denmark, DK-5230 Odense M (Denmark); Paula, Jose [Centro de Oceanografia - Laboratorio Maritimo da Guia, Departamento de Biologia Animal, Faculdade de Ciencias da Universidade de Lisboa, Avenida Na, Senhora do Cabo 939, 2750-374 Cascais (Portugal)

2010-01-15

The effect of different sewage concentrations (0, 20, 60 and 100%), vegetation (Bare, Avicennia marina or Rhizophora mucronata) and immersion periods (immersion/emersion period of 12/12 h or 3/3 days just for 100%) conditions were studied for 6 months on survival and growth rates of Terebralia palustris (Linnaeus, 1767). Gastropods' activity and ecosystem engineering preformed at bare and A. marina planted cells and 3 sewage conditions (0, 20 and 60%) were determined. Survival rates were higher than 70% in all treatments. Growth rate decreased significantly with increasing sewage concentrations (mainly at unplanted conditions) and longer immersion periods. A complete shift (from immersion to emersion periods) and a significant decrease in mobility and consequently its engineer potential, due to sewage contamination, lead to a 3-4 fold decrease in the amount of sediment disturbed. Sewage contamination, primary producers' abundance and environmental conditions may have influenced the gastropods survival, growth and its ecosystem engineering potential. - Terebralia palustris high ecosystem engineering potential in constructed mangrove wetlands.

Hydrogen production under salt stress conditions by a freshwater Rhodopseudomonas palustris strain.

Science.gov (United States)

Adessi, Alessandra; Concato, Margherita; Sanchini, Andrea; Rossi, Federico; De Philippis, Roberto

2016-03-01

Hydrogen represents a possible alternative energy carrier to face the growing request for energy and the shortage of fossil fuels. Photofermentation for the production of H2 constitutes a promising way for integrating the production of energy with waste treatments. Many wastes are characterized by high salinity, and polluted seawater can as well be considered as a substrate. Moreover, the application of seawater for bacterial culturing is considered cost-effective. The aims of this study were to assess the capability of the metabolically versatile freshwater Rhodopseudomonas palustris 42OL of producing hydrogen on salt-containing substrates and to investigate its salt stress response strategy, never described before. R. palustris 42OL was able to produce hydrogen in media containing up to 3 % added salt concentration and to grow in media containing up to 4.5 % salinity without the addition of exogenous osmoprotectants. While the hydrogen production performances in absence of sea salts were higher than in their presence, there was no significant difference in performances between 1 and 2 % of added sea salts. Nitrogenase expression levels indicated that the enzyme was not directly inhibited during salt stress, but a regulation of its expression may have occurred in response to salt concentration increase. During cell growth and hydrogen production in the presence of salts, trehalose was accumulated as a compatible solute; it protected the enzymatic functionality against salt stress, thus allowing hydrogen production. The possibility of producing hydrogen on salt-containing substrates widens the range of wastes that can be efficiently used in production processes.

Heavy metal tolerance in populations of Agrostis tenuis Sibth and other grasses

Energy Technology Data Exchange (ETDEWEB)

Gregory, R P.G.; Bradshaw, A D

1965-01-01

Populations of Agrostis tenuis can be found growing on a variety of different mine workings in conditions of metal contamination toxic to most higher plants. Samples of such populations together with samples of populations taken from ordinary pastures were tested for tolerance to high concentrations of copper, nickel, lead and zinc by measuring the effect of these metals on the rooting of tillers. The soils in which the populations were originally growing were analyzed for each of the four metals and the tolerances of the populations have been related to the levels of the metals in the soils. In general, the mine populations show remarkable tolerance to the particular metals present in high quantities in the soils of their original habitats: the pasture populations do not show this tolerance. The tolerance is specific, for, except in the case of zinc and nickel, tolerance to one metal is not accompanied by tolerance to any other. There must, therefore, be three specific tolerances in the one species. Individual tolerances can however occur together and this can be related to the occurrence of the two metals together in toxic quantities in the soil. The tolerances must be genetically controlled but the physiological mechanism involved is not clear. A number of other species were also shown to have populations tolerant to high levels of zinc. 27 references, 7 figures, 6 tables.

Modeling silviculture after natural disturbance to sustain biodiversity in the longleaf pine (Pinus palustris) ecosystem : balancing complexity and implementation

Science.gov (United States)

Brian J. Palik; Robert J. Mitchell; J. Kevin Hiers

2002-01-01

Modeling silviculture after natural disturbance to maintain biodiversity is a popular concept, yet its application remains elusive. We discuss difficulties inherent to this idea, and suggest approaches to facilitate implementation, using longleaf pine (Pinus palustris) as an example. Natural disturbance regimes are spatially and temporally variable. Variability...

Experiments on accumulation of phosphorus in the plants Myosotis palustris, Glyceria maxima and Nasturtium officinale

Directory of Open Access Journals (Sweden)

O. Prokopchuk

2016-10-01

Full Text Available The problem of availability of quality water is highly relevant today, so the technologies of prediction and prevention of water pollution and purification are very important. Biological methods of cleaning, in paticular cleaning water by the so-called method of biosorption, have been increasingly used in the last decade. This method means the removal of dangerous substances and improvement of water condition by using aquatic organisms, in particular plants. Therefore, in view of the rich experience of research conducted in the biosorption sphere, we decided to predict the effectiveness of this method by using the cumulative ability of higher water plants to absorb phosphorus compounds. For this purpose, we selected water and plant samples (Glyceria maxima (C. Hartm. Holmb., Nasturtium officinale R. Br., Myosotis palustris (L. L. from the river Seret (Ternopil, Ukraine. The plants were placed into sterilized glass jars filled with 3 liters of water from the river Seret (control samples and still tap water with addition of sodium phosphate with phosphorus concentration of 3.5 mg/dm³ (research sample, which were cultured in laboratory conditions for four months. We determined the content of phosphates, permanganate and dichromate oxidation in the water and the total content of phosphorus in the plants. We traced the dynamic of organic substances and the content of phosphates in the water, the accumulation of phosphorus in plants and the rate of accumulation of phosphorus in the plants and in the water. We calculated correlation coefficients to detect the dependence between phosphorus indicators in the aquatic plants and the concentration of phosphate ions in the water. We found that M. palustris had the greatest capacity to accumulate phosphorus and the highest rate of phosphorus accumulation from water, which allows us to consider it the most effective aquatic plant for absorption of elements and decreasing water pollution. We also established

Spatial and temporal distribution of fungicides applied to creeping bentgrass.

Science.gov (United States)

Hockemeyer, Kurt R; Latin, Richard

2015-05-01

Turf managers often rely on fungicides to limit damage caused by root diseases. Because fungicides are applied to aboveground surfaces and do not move basipetally, they are effective against root pathogens only when fungitoxic concentrations migrate to the rhizosphere. This research focused on the distribution of modern fungicides in verdure, thatch, sand, and roots of creeping bentgrass [ L. var. (Huds.) Farw.] maintained as a putting green. The fungicides azoxystrobin (methyl (E)-2-[2-[6-(2-cyanophenoxy)pyrimidin-4-yloxy]phenyl]-3-methoxyacrylate), propiconazole (1,2,4-triazole, 1-((2-(2,4-dichlorophenyl)-4-propyl-1,3-dioxolan-2-yl)methyl), pyraclostrobin (carbamic acid, [2-[[[1-(4-chlorophenyl)-1H-pyrazol-3-yl]oxy]methyl]phenyl]methoxy-,methyl ester), and thiophanate-methyl (dimethyl 4,'4-o-phenylenebis[3-thioallophanate]) were applied to replicate field plots in a water volume of 815 L ha. Plots were sampled at 0, 3, 7, 10, 14, 17, and 21 d after application by extracting cores measuring 1.9 cm in diameter by 3.8 cm deep. Cores were separated into verdure/thatch, sand, and roots before quantitative determination (liquid chromatography, triple quadrupole mass spectrometry) of fungicide residues. Fungicide residues in verdure/thatch declined steadily with time and support previously reported results describing fungicide depletion. Fungicides were detected in roots and sand within 5 h of application at very low (1-15 mg kg) concentrations and remained at low levels throughout the sampling period. Fungicides differed with respect to amounts recovered per turfgrass component. Azoxystrobin and propiconazole were associated with roots for the duration of the experiment, but pyraclostrobin was nearly undetectable. Near-zero levels of all fungicides were detected in the sand component. Half-life values in the verdure/thatch component ranged from 2.3 to 18.9 d. Copyright © by the American Society of Agronomy, Crop Science Society of America, and Soil Science Society of

Preservation of H₂ production activity in nanoporous latex coatings of Rhodopseudomonas palustris CGA009 during dry storage at ambient temperatures: Preservation of R. palustris latex coatings

Energy Technology Data Exchange (ETDEWEB)

Piskorska, M. [Univ. of South Carolina, Aiken, SC (United States); Soule, T. [Savannah River Site (SRS), Aiken, SC (United States). Savannah River National Lab. (SRNL); Gosse, J. L. [North Carolina State Univ., Raleigh, NC (United States); Milliken, C. [Savannah River Site (SRS), Aiken, SC (United States). Savannah River National Lab. (SRNL); Flickinger, M. C. [North Carolina State Univ., Raleigh, NC (United States); Smith, G. W. [Univ. of South Carolina, Aiken, SC (United States); Yeager, C. M. [Savannah River Site (SRS), Aiken, SC (United States). Savannah River National Lab. (SRNL)

2013-01-21

To assess the applicability of latex cell coatings as an ‘off-the-shelf’ biocatalyst, the effect of osmoprotectants, temperature, humidity and O₂ on preservation of H₂ production in Rhodopseudomonas palustris coatings was evaluated. Immediately following latex coating coalescence (24 h) and for up to 2 weeks of dry storage, rehydrated coatings containing different osmoprotectants displayed similar rates of H2 production. Beyond 2 weeks of storage, sorbitol-treated coatings lost all H₂ production activity, whereas considerable H₂ production was still detected in sucrose- and trehalose-stabilized coatings. The relative humidity level at which the coatings were stored had a significant impact on the recovery and subsequent rates of H₂ production. After 4 weeks storage under air at 60% humidity, coatings produced only trace amounts of H₂ (0–0.1% headspace accumulation), whereas those stored at < 5% humidity retained 27–53% of their H₂ production activity after 8 weeks of storage. In conWhen stored in argon at < 5% humidity and room temperature, R. palustris coatings retained full H₂ production activity for 3 months, implicating oxidative damage as a key factor limiting coating storage. Overall, the results demonstrate that biocatalytic latex coatings are an attractive cell immobilization platform for preservation of bioactivity in the dry state.

Correlation between oxalic acid production and tolerance of Tyromyces palustris strain TYP-6137 to N',N-naphthaloylhydroxamine

Science.gov (United States)

Rachel A. Arango; Patricia K. Lebow; Frederick III Green

2009-01-01

Eleven strains of T. palustris were evaluated for mass loss and production of phosphate buffer soluble oxalic acid on pine wood blocks treated with 0.5% N’,N-naphthaloylhydroxamine (NHA) in a soil-block test. After 12 weeks higher percentage mass loss was observed in control groups for 10 strains, while TYP-6137 was shown to be tolerant with no difference between the...

Two Distinct Aerobic Methionine Salvage Pathways Generate Volatile Methanethiol in Rhodopseudomonas palustris

Science.gov (United States)

Miller, Anthony R.; North, Justin A.; Wildenthal, John A.

2018-01-01

ABSTRACT 5′-Methyl-thioadenosine (MTA) is a dead-end, sulfur-containing metabolite and cellular inhibitor that arises from S-adenosyl-l-methionine-dependent reactions. Recent studies have indicated that there are diverse bacterial methionine salvage pathways (MSPs) for MTA detoxification and sulfur salvage. Here, via a combination of gene deletions and directed metabolite detection studies, we report that under aerobic conditions the facultatively anaerobic bacterium Rhodopseudomonas palustris employs both an MTA-isoprenoid shunt identical to that previously described in Rhodospirillum rubrum and a second novel MSP, both of which generate a methanethiol intermediate. The additional R. palustris aerobic MSP, a dihydroxyacetone phosphate (DHAP)-methanethiol shunt, initially converts MTA to 2-(methylthio)ethanol and DHAP. This is identical to the initial steps of the recently reported anaerobic ethylene-forming MSP, the DHAP-ethylene shunt. The aerobic DHAP-methanethiol shunt then further metabolizes 2-(methylthio)ethanol to methanethiol, which can be directly utilized by O-acetyl-l-homoserine sulfhydrylase to regenerate methionine. This is in contrast to the anaerobic DHAP-ethylene shunt, which metabolizes 2-(methylthio)ethanol to ethylene and an unknown organo-sulfur intermediate, revealing functional diversity in MSPs utilizing a 2-(methylthio)ethanol intermediate. When MTA was fed to aerobically growing cells, the rate of volatile methanethiol release was constant irrespective of the presence of sulfate, suggesting a general housekeeping function for these MSPs up through the methanethiol production step. Methanethiol and dimethyl sulfide (DMS), two of the most important compounds of the global sulfur cycle, appear to arise not only from marine ecosystems but from terrestrial ones as well. These results reveal a possible route by which methanethiol might be biologically produced in soil and freshwater environments. PMID:29636438

Long-term effects of fire and fire-return interval on population structure and growth of longleaf pine (Pinus palustris)

Science.gov (United States)

Chelcy R. Ford; Emily S. Minor; Gordon A. Fox

2010-01-01

We investigated the effect of fire and fire frequency on stand structure and longleaf pine (Pinus palustris P. Mill.) growth and population demography in an experimental research area in a southwest Florida sandhill community. Data were collected from replicated plots that had prescribed fire-return intervals of 1, 2, 5, or 7 years or were left...

Influence of residual basal area on longleaf pine (Pinus palustris Mill.) first year germination and establishment under selection silviculture

Science.gov (United States)

Ferhat Kara; Edward F. Loewenstein

2015-01-01

Even-aged silvicultural methods have been successfully used to manage longleaf pine (Pinus palustris Mill.) forests for wood production; however, successful use of uneven-aged methods to manage this ecosystem is less well documented. In this study, the effects of varying levels of residual basal area (RBA) (9.2, 13.8, and 18.4 m2...

Genome assembly of the fungus Cochliobolus miyabeanus, and transcriptome analysis during early stages of infection on American wild rice (Zizania palustris L.)

Science.gov (United States)

Cochliobolus miyabeanus causes a severe, yield-reducing leaf spot disease on rice (Oryza sativa) and two North American specialty crops, American wildrice (Zizania palustris) and switchgrass (Panicum virgatum). Despite the importance of the pathogen in wildrice, little is known about mechanisms of p...

Comparison of red-cockaded woodpecker (Picoides borealis) nestling diet in old-growth and old-field longleaf pine (Pinus palustris) habitats

Science.gov (United States)

James L. Hanula; R. Todd Engstrom

2000-01-01

Automatic cameras were used to record adult red-cockaded woodpecker (Picoides borealis) nest visits with food for nestlings. Diet of nestlings on or near an old-growth longleaf pine (Pinus palustris) remnant in southern Georgia was compared to that in longleaf pine stands established on old farm fields in western South Carolina....

Effects of site preparation treatments on early growth and survival of planted longleaf pine (Pinus palustris Mill.) seedlings in North Carolina

Science.gov (United States)

Benjamin O. Knapp; G. Geoff Wang; Joan L. Walker; Susan Cohen

2006-01-01

We tested the effects of eight site preparation treatments on early growth and survival of container-grown longleaf pine (Pinus palustris Mill.) seedlings. Treatments included an untreated check, six combinations of two initial vegetation control treatments (chopping or herbicide) with three planting site conditions (flat [no additional treatment],...

Differential responses of the freshwater wetland species Juncus effusus L. and Caltha palustris L. to iron supply in sulfidic environments

International Nuclear Information System (INIS)

Welle, Marlies E.W. van der; Niggebrugge, Karla; Lamers, Leon P.M.; Roelofs, Jan G.M.

2007-01-01

Sulfur pollution can lead to serious problems in freshwater wetlands, including phosphorus eutrophication and sulfide toxicity. We tested the effects of anaerobic iron-rich groundwater discharge in fens, simulated by iron injection, on two characteristic species (Juncus effusus and Caltha palustris) in a sulfidic environment. Biomass production of C. palustris roots showed an optimum response to the combined addition of iron and sulfide, with highest values at intermediate concentrations of both substances. Iron deficiency apparently occurred at low iron concentrations, while at high iron concentrations, growth was decreased. For J. effusus, in contrast, no toxic effects were found of both iron and sulfide. This could be explained by larger radial oxygen loss (ROL) of J. effusus and could not be explained by differences in phosphorous concentrations. The results of our experiments confirm that iron-rich groundwater discharge has the potential to affect vegetation composition through toxicity modification in sulfidic environments. - Toxicity of iron and sulfide are interacting with each other and have the potential to affect vegetation composition

Isolation of a phytotoxic isocoumarin from Diaporthe eres-infected Hedera helix (English ivy) and synthesis of its phytotoxic analogs.

Science.gov (United States)

Meepagala, Kumudini M; Briscoe, William E; Techen, Natascha; Johnson, Robert D; Clausen, Brandon M; Duke, Stephen O

2018-01-01

The fungus Diaporthe eres was isolated from a fungal pathogen-infected leaf of Hedera helix (English ivy) exhibiting necrosis. It is hypothesized that the causative fungus produces phytotoxins as evidenced by necrotic lesions on the leaves. The fungus was isolated and grown in Czapek Dox broth culture medium and potato dextrose broth culture medium and identified as Diaporthe eres. The ethyl acetate extracts of the culture broths were phytotoxic to lettuce (Lactuca sativa) and bentgrass (Agrostis stolonifera). 3,4-Dihydro-8-hydroxy-3,5-dimethylisocoumarin (1) and tyrosol (2) were isolated and identified as the phytotoxic constituents. Six analogs of 3,4-dihydro-isocoumarin were synthesized and shown to be phytotoxic. The synthesized 3,4-dihydro-8-hydroxy-3,7-dimethylisocoumarin and 3,4-dihydro-8-hydroxy-3,3,7-trimethylisocoumarin were two- to three-fold more phytotoxic than the naturally occurring 1 in a Lemna paucicostata growth bioassay. Synthesis and herbicidal activities of the several new analogs of 1 are reported for the first time. These promising molecules should be used as templates for synthesis and testing of more analogs. © 2017 Society of Chemical Industry. © 2017 Society of Chemical Industry.

Antiprotozoal and antimicrobial compounds from the plant pathogen Septoria pistaciarum.

Science.gov (United States)

Kumarihamy, Mallika; Khan, Shabana I; Jacob, Melissa; Tekwani, Babu L; Duke, Stephen O; Ferreira, Daneel; Nanayakkara, N P Dhammika

2012-05-25

Four new 1,4-dihydroxy-5-phenyl-2-pyridinone alkaloids, 17-hydroxy-N-(O-methyl)septoriamycin A (1), 17-acetoxy-N-(O-methyl)septoriamycin A (2), 13-(S)-hydroxy-N-(O-methyl)septoriamycin A (3), and 13-(R)-hydroxy-N-(O-methyl)septoriamycin A (4), together with the known compounds (+)-cercosporin (5), (+)-14-O-acetylcercosporin (6), (+)-di-O-acetylcercosporin (7), lumichrome, and brassicasterol, were isolated from an ethyl acetate extract of a culture medium of Septoria pistaciarum. Methylation of septoriamycin A (8) with diazomethane yielded three di-O-methyl analogues, two of which existed as mixtures of rotamers. We previously reported antimalarial activity of septoriamycin A. This compound also exhibited significant activity against Leishmania donovani promastigotes. Compounds 5-7 showed moderate in vitro activity against L. donovani promastigotes and chloroquine-sensitive (D6) and -resistant (W2) strains of Plasmodium falciparum, whereas compound 5 was fairly active against methicillin-sensitive and methicillin-resistant strains of Staphylococcus aureus. Compounds 5-7 also displayed moderate phytotoxic activity against both a dicot (lettuce, Lactuca sativa) and a monocot (bentgrass, Agrostis stolonifera) and cytotoxicity against a panel of cell lines.

Transfer of the high-GC cyclohexane carboxylate degradation pathway from Rhodopseudomonas palustris to Escherichia coli for production of biotin.

Science.gov (United States)

Bernstein, Jeffrey R; Bulter, Thomas; Liao, James C

2008-01-01

This work demonstrates the transfer of the five-gene cyclohexane carboxylate (CHC) degradation pathway from the high-GC alphaproteobacterium Rhodopseudomonas palustris to Escherichia coli, a gammaproteobacterium. The degradation product of this pathway is pimeloyl-CoA, a key metabolite in E. coli's biotin biosynthetic pathway. This pathway is useful for biotin overproduction in E. coli; however, the expression of GC-rich genes is troublesome in this host. When the native R. palustris CHC degradation pathway is transferred to a DeltabioH pimeloyl-CoA auxotroph of E. coli, it is unable to complement growth in the presence of CHC. To overcome this expression problem we redesigned the operon with decreased GC content and removed stretches of high-GC intergenic DNA which comprise the 5' untranslated region of each gene, replacing these features with shorter low-GC sequences. We show this synthetic construct enables growth of the DeltabioH strain in the presence of CHC. When the synthetic degradation pathway is overexpressed in conjunction with the downstream genes for biotin biosynthesis, we measured significant accumulation of biotin in the growth medium, showing that the pathway transfer is successfully integrated with the host metabolism.

Toxicity of sulfide to early life stages of wild rice (Zizania palustris).

Science.gov (United States)

Fort, Douglas J; Todhunter, Kevin; Fort, Troy D; Mathis, Michael B; Walker, Rachel; Hansel, Mike; Hall, Scott; Richards, Robin; Anderson, Kurt

2017-08-01

The sensitivity of wild rice (Zizania palustris) to sulfide is not well understood. Because sulfate in surface waters is reduced to sulfide by anaerobic bacteria in sediments and historical information indicated that 10 mg/L sulfate in Minnesota (USA) surface water reduced Z. palustris abundance, the Minnesota Pollution Control Agency established 10 mg/L sulfate as a water quality criterion in 1973. A 21-d daily-renewal hydroponic study was conducted to evaluate sulfide toxicity to wild rice and the potential mitigation of sulfide toxicity by iron (Fe). The hydroponic design used hypoxic test media for seed and root exposure and aerobic headspace for the vegetative portion of the plant. Test concentrations were 0.3, 1.6, 3.1, 7.8, and 12.5 mg/L sulfide in test media with 0.8, 2.8, and 10.8 mg/L total Fe used to evaluate the impact of iron on sulfide toxicity. Visual assessments (i.e., no plants harvested) of seed activation, mesocotyl emergence, seedling survival, and phytoxicity were conducted 10 d after dark-phase exposure. Each treatment was also evaluated for time to 30% emergence (ET30), total plant biomass, root and shoot lengths, and signs of phytotoxicity at study conclusion (21 d). The results indicate that exposure of developing wild rice to sulfide at ≥3.1 mg sulfide/L in the presence of 0.8 mg/L Fe reduced mesocotyl emergence. Sulfide toxicity was mitigated by the addition of Fe at 2.8 mg/L and 10.8 mg/L relative to the control value of 0.8 mg Fe/L, demonstrating the importance of iron in mitigating sulfide toxicity to wild rice. Ultimately, determination of site-specific sulfate criteria taking into account factors that alter toxicity, including sediment Fe and organic carbon, are necessary. Environ Toxicol Chem 2017;36:2217-2226. © 2017 SETAC. © 2017 SETAC.

High-resolution bioactivity profiling combined with HPLC-HRMS-SPE-NMR: α-glucosidase inhibitors and acetylated ellagic acid rhamnosides from Myrcia palustris DC. (Myrtaceae)

DEFF Research Database (Denmark)

Wubshet, Sileshi Gizachew; Moresco, Henrique H.; Tahtah, Yousof

2015-01-01

, and therefore improved drug leads or functional foods containing α-glucosidase inhibitors are needed for management of blood glucose. In this study, leaves of Myrcia palustris were investigated by high-resolution α-glucosidase inhibition profiling combined with HPLC–HRMS–SPE–NMR. This led to identification...

Detection and enumeration of methanotrophs in acidic Sphagnum peat by 16S rRNA fluorescence in situ hybridization, including the use of newly developed oligonucleotide probes for Methylocella palustris.

Science.gov (United States)

Dedysh, S N; Derakshani, M; Liesack, W

2001-10-01

Two 16S rRNA-targeted oligonucleotide probes, Mcell-1026 and Mcell-181, were developed for specific detection of the acidophilic methanotroph Methylocella palustris using fluorescence in situ hybridization (FISH). The fluorescence signal of probe Mcell-181 was enhanced by its combined application with the oligonucleotide helper probe H158. Mcell-1026 and Mcell-181, as well as 16S rRNA oligonucleotide probes with reported group specificity for either type I methanotrophs (probes M-84 and M-705) or the Methylosinus/Methylocystis group of type II methanotrophs (probes MA-221 and M-450), were used in FISH to determine the abundance of distinct methanotroph groups in a Sphagnum peat sample of pH 4.2. M. palustris was enumerated at greater than 10(6) cells per g of peat (wet weight), while the detectable population size of type I methanotrophs was three orders of magnitude below the population level of M. palustris. The cell counts with probe MA-221 suggested that only 10(4) type II methanotrophs per g of peat (wet weight) were present, while the use of probe M-450 revealed more than 10(6) type II methanotroph cells per g of the same samples. This discrepancy was due to the fact that probe M-450 targets almost all currently known strains of Methylosinus and Methylocystis, whereas probe MA-221, originally described as group specific, does not detect a large proportion of Methylocystis strains. The total number of methanotrophic bacteria detected by FISH was 3.0 (+/-0.2) x 10(6) cells per g (wet weight) of peat. This was about 0.8% of the total bacterial cell number. Thus, our study clearly suggests that M. palustris and a defined population of Methylocystis spp. were the predominant methanotrophs detectable by FISH in an acidic Sphagnum peat bog.

Promoting effects of a single Rhodopseudomonas palustris inoculant on plant growth by Brassica rapa chinensis under low fertilizer input.

Science.gov (United States)

Wong, Wai-Tak; Tseng, Ching-Han; Hsu, Shu-Hua; Lur, Huu-Sheng; Mo, Chia-Wei; Huang, Chu-Ning; Hsu, Shu-Chiung; Lee, Kung-Ta; Liu, Chi-Te

2014-09-17

Several Rhodopseudomonas palustris strains have been isolated from rice paddy fields in Taiwan by combining the Winogradsky column method and molecular marker detection. These isolates were initially screened by employing seed germination and seedling vigor assays to evaluate their potential as inoculants. To fulfill the demand in the present farming system for reducing the application of chemical fertilizers, we assessed the plant growth-promoting effects of the R. palustris YSC3, YSC4, and PS3 inoculants on Brassica rapa chinensis (Chinese cabbage) cultivated under a half quantity of fertilizer. The results obtained showed that supplementation with approximately 4.0×10(6) CFU g(-1) soil of the PS3 inoculant at half the amount of fertilizer consistently produced the same plant growth potential as 100% fertility, and also increased the nitrogen use efficiency of the applied fertilizer nutrients. Furthermore, we noted that the plant growth-promotion rate elicited by PS3 was markedly higher with old seeds than with new seeds, suggesting it has the potential to boost the development of seedlings that were germinated from carry-over seeds of poor quality. These beneficial traits suggest that the PS3 isolate may serve as a potential PGPR inoculant for integrated nutrient management in agriculture.

How Posttranslational Modification of Nitrogenase Is Circumvented in Rhodopseudomonas palustris Strains That Produce Hydrogen Gas Constitutively

Science.gov (United States)

Heiniger, Erin K.; Oda, Yasuhiro; Samanta, Sudip K.

2012-01-01

Nitrogenase catalyzes the conversion of dinitrogen gas (N2) and protons to ammonia and hydrogen gas (H2). This is a catalytically difficult reaction that requires large amounts of ATP and reducing power. Thus, nitrogenase is not normally expressed or active in bacteria grown with a readily utilized nitrogen source like ammonium. nifA* mutants of the purple nonsulfur phototrophic bacterium Rhodopseudomonas palustris have been described that express nitrogenase genes constitutively and produce H2 when grown with ammonium as a nitrogen source. This raised the regulatory paradox of why these mutants are apparently resistant to a known posttranslational modification system that should switch off the activity of nitrogenase. Microarray, mutation analysis, and gene expression studies showed that posttranslational regulation of nitrogenase activity in R. palustris depends on two proteins: DraT2, an ADP-ribosyltransferase, and GlnK2, an NtrC-regulated PII protein. GlnK2 was not well expressed in ammonium-grown NifA* cells and thus not available to activate the DraT2 nitrogenase modification enzyme. In addition, the NifA* strain had elevated nitrogenase activity due to overexpression of the nif genes, and this increased amount of expression overwhelmed a basal level of activity of DraT2 in ammonium-grown cells. Thus, insufficient levels of both GlnK2 and DraT2 allow H2 production by an nifA* mutant grown with ammonium. Inactivation of the nitrogenase posttranslational modification system by mutation of draT2 resulted in increased H2 production by ammonium-grown NifA* cells. PMID:22179236

Endemic Marsh Mongoose Herpestes palustris (Carnivora: Herpestidae of East Kolkata Wetlands, India: a status report

Directory of Open Access Journals (Sweden)

J.K. Mallick

2009-04-01

Full Text Available Marsh Mongoose Herpestes palustris is the only extant endemic mammal of the East Kolkata wetlands, which has been declared a RAMSAR site in 2002. Since its first description by the scientists of the Zoological Survey of India, the population of this species has dwindled to an alarming state due to reclamation of the Salt Lake City and Rajarhat expansion, as well as from other anthropogenic causes. Recently, during a field survey only a small population of this endangered mongoose was found in a single location. Immediate conservation measures are required to be taken by the concerned authorities to stop its probable extinction in the near future.

Purification, molecular cloning, and enzymatic properties of a family 12 endoglucanase (EG-II) from fomitopsis palustris: role of EG-II in larch holocellulose hydrolysis.

Science.gov (United States)

Shimokawa, Tomoko; Shibuya, Hajime; Nojiri, Masanobu; Yoshida, Shigeki; Ishihara, Mitsuro

2008-09-01

A family 12 endoglucanase with a molecular mass of 23,926 Da (EG-II) from the brown-rot basidiomycete Fomitopsis palustris was purified and characterized. One of the roles of EG-II in wood degradation is thought to be to loosen the polysaccharide network in cell walls by disentangling hemicelluloses that are associated with cellulose.

Photo-biotechnology as a tool to improve agronomic traits in crops.

Science.gov (United States)

Gururani, Mayank Anand; Ganesan, Markkandan; Song, Pill-Soon

2015-01-01

Phytochromes are photosensory phosphoproteins with crucial roles in plant developmental responses to light. Functional studies of individual phytochromes have revealed their distinct roles in the plant's life cycle. Given the importance of phytochromes in key plant developmental processes, genetically manipulating phytochrome expression offers a promising approach to crop improvement. Photo-biotechnology refers to the transgenic expression of phytochrome transgenes or variants of such transgenes. Several studies have indicated that crop cultivars can be improved by modulating the expression of phytochrome genes. The improved traits include enhanced yield, improved grass quality, shade-tolerance, and stress resistance. In this review, we discuss the transgenic expression of phytochrome A and its hyperactive mutant (Ser599Ala-PhyA) in selected crops, such as Zoysia japonica (Japanese lawn grass), Agrostis stolonifera (creeping bentgrass), Oryza sativa (rice), Solanum tuberosum (potato), and Ipomea batatas (sweet potato). The transgenic expression of PhyA and its mutant in various plant species imparts biotechnologically useful traits. Here, we highlight recent advances in the field of photo-biotechnology and review the results of studies in which phytochromes or variants of phytochromes were transgenically expressed in various plant species. We conclude that photo-biotechnology offers an excellent platform for developing crops with improved properties. Copyright © 2014 Elsevier Inc. All rights reserved.

Differences in mycorrhizal communities between Epipactis palustris, E. helleborine and its presumed sister species E. neerlandica.

Science.gov (United States)

Jacquemyn, Hans; Waud, Michael; Lievens, Bart; Brys, Rein

2016-07-01

In orchid species that have populations occurring in strongly contrasting habitats, mycorrhizal divergence and other habitat-specific adaptations may lead to the formation of reproductively isolated taxa and ultimately to species formation. However, little is known about the mycorrhizal communities associated with recently diverged sister taxa that occupy different habitats. In this study, 454 amplicon pyrosequencing was used to investigate mycorrhizal communities associating with Epipactis helleborine in its typical forest habitat and with its presumed sister species E. neerlandica that almost exclusively occurs in coastal dune habitats. Samples of the phylogenetically more distant E. palustris, which co-occurred with E. neerlandica, were also included to investigate the role of habitat-specific conditions on mycorrhizal communities. A total of 105 operational taxonomic units (OTUs) of putative orchid mycorrhizal fungi were observed in the three studied species. The majority of these fungi were endophytic fungi of Helotiales and ectomycorrhizal fungi belonging to Thelephoraceae, Sebacinaceae and Inocybaceae. In addition, a large number of other ectomycorrhizal taxa were detected, including Cortinarius, Cenococcum, Tuber, Geopora, Wilcoxina, Meliniomyces, Hebeloma, Tricholoma, Russula and Peziza Mycorrhizal communities differed significantly between the three species, but differences were most pronounced between the forest species (E. helleborine) and the two dune slack species (E. neerlandica and E. palustris). The results clearly showed that recently diverged orchid species that occupy different habitats were characterized by significantly different mycorrhizal communities and call for more detailed experiments that aim at elucidating the contribution of habitat-specific adaptations in general and mycorrhizal divergence in particular to the process of speciation in orchids. © The Author 2016. Published by Oxford University Press on behalf of the Annals of Botany

The dtudy of physiological and biochemical responses of Agrostis stolonifera and Festuca arundinacea Schreb. under drought stress

Directory of Open Access Journals (Sweden)

Mohammad Hassan Alibiglouei

2014-12-01

Full Text Available Drought stress is a main limiting factor of turfgrass growth in arid and semi-arid regions. Therefore, in this study, the physiological and biochemical changes in two turfgrass species Agrostis stolonifera and Festuca arundinacea schreb during drought stress (70-75 centibar in a 40-day period and recovery were investigated. Control plants during drought stress were regularly irrigated at soil field capacity (20-25 centibar. The results showed that leaf relative water content and leaf chlorophyll content with long-term stress decreased. Electrolyte leakage and proline during drought stress significantly increased and in recovery stage, the level of electrolyte leakage and proline reached to the control. The activity of peroxidase and superoxide dismutase in two turfgrass significantly increased after 30 days and then significantly reduced. In F. arundinacea schreb the activity of ascorbat peroxidase after 20 days significantly increased and then significantly reduced. Also, in F. arundinacea schreb species the activity of catalase increased during drought stress and in recovery stage the activity of catalase reduced. In studied species during drought stress and recovery stage, the activity of ascorbat peroxidase and catalase significantly increased compared to the control. These results suggested that the resistant species F. arundinacea schreb, under drought stress had a low level of electrolyte leakage, higher level of relative water content and chlorophyll destruction was less than A. stolonifera.

Hydrogen production using Rhodopseudomonas palustris WP 3-5 with hydrogen fermentation reactor effluent

International Nuclear Information System (INIS)

Chi-Mei Lee; Kuo-Tsang Hung

2006-01-01

The possibility of utilizing the dark hydrogen fermentation stage effluents for photo hydrogen production using purple non-sulfur bacteria should be elucidated. In the previous experiments, Rhodopseudomonas palustris WP3-5 was proven to efficiently produce hydrogen from the effluent of hydrogen fermentation reactors. The highest hydrogen production rate was obtained at a HRT value of 48 h when feeding a 5 fold effluent dilution from anaerobic hydrogen fermentation. Besides, hydrogen production occurred only when the NH 4 + concentration was below 17 mg-NH 4 + /l. Therefore, for successful fermentation effluent utilization, the most important things were to decrease the optimal HRT, increase the optimal substrate concentration and increase the tolerable ammonia concentration. In this study, a lab-scale serial photo-bioreactor was constructed. The reactor overall hydrogen production efficiency with synthetic wastewater exhibiting an organic acid profile identical to that of anaerobic hydrogen fermentation reactor effluent and with effluent from two anaerobic hydrogen fermentation reactors was evaluated. (authors)

Uranium interaction with two multi-resistant environmental bacteria: Cupriavidus metallidurans CH34 and Rhodopseudomonas palustris.

Science.gov (United States)

Llorens, Isabelle; Untereiner, Guillaume; Jaillard, Danielle; Gouget, Barbara; Chapon, Virginie; Carriere, Marie

2012-01-01

Depending on speciation, U environmental contamination may be spread through the environment or inversely restrained to a limited area. Induction of U precipitation via biogenic or non-biogenic processes would reduce the dissemination of U contamination. To this aim U oxidation/reduction processes triggered by bacteria are presently intensively studied. Using X-ray absorption analysis, we describe in the present article the ability of Cupriavidus metallidurans CH34 and Rhodopseudomonas palustris, highly resistant to a variety of metals and metalloids or to organic pollutants, to withstand high concentrations of U and to immobilize it either through biosorption or through reduction to non-uraninite U(IV)-phosphate or U(IV)-carboxylate compounds. These bacterial strains are thus good candidates for U bioremediation strategies, particularly in the context of multi-pollutant or mixed-waste contaminations.

Uranium Interaction with Two Multi-Resistant Environmental Bacteria: Cupriavidus metallidurans CH34 and Rhodopseudomonas palustris

Science.gov (United States)

Llorens, Isabelle; Untereiner, Guillaume; Jaillard, Danielle; Gouget, Barbara; Chapon, Virginie; Carriere, Marie

2012-01-01

Depending on speciation, U environmental contamination may be spread through the environment or inversely restrained to a limited area. Induction of U precipitation via biogenic or non-biogenic processes would reduce the dissemination of U contamination. To this aim U oxidation/reduction processes triggered by bacteria are presently intensively studied. Using X-ray absorption analysis, we describe in the present article the ability of Cupriavidus metallidurans CH34 and Rhodopseudomonas palustris, highly resistant to a variety of metals and metalloids or to organic pollutants, to withstand high concentrations of U and to immobilize it either through biosorption or through reduction to non-uraninite U(IV)-phosphate or U(IV)-carboxylate compounds. These bacterial strains are thus good candidates for U bioremediation strategies, particularly in the context of multi-pollutant or mixed-waste contaminations. PMID:23251623

Allodaposuchus palustris sp. nov. from the upper cretaceous of Fumanya (South-Eastern Pyrenees, Iberian Peninsula: systematics, palaeoecology and palaeobiogeography of the enigmatic allodaposuchian crocodylians.

Directory of Open Access Journals (Sweden)

Alejandro Blanco

Full Text Available The controversial European genus Allodaposuchus is currently composed of two species (A. precedens, A. subjuniperus and it has been traditionally considered a basal eusuchian clade of crocodylomorphs. In the present work, the new species A. palustris is erected on the base of cranial and postcranial remains from the lower Maastrichtian of the southern Pyrenees. Phylogenetic analyses here including both cranial and postcranial data support the hypothesis that Allodaposuchus is included within Crocodylia. The studied specimen suggests little change in postcranial skeleton along the evolutionary history of crocodylians, except for some bone elements such as the axis, the first caudal vertebra and the ilium. The specimen was found in an organic mudstone corresponding to a coastal wetland environment. Thus, A. palustris from Fumanya is the first Allodaposuchus reported in lacustrine-palustrine settings that expand the ecological range for this genus. The S-DIVA palaeobiogeographic reconstruction of ancestral area suggests that early members of Crocodylia rapidly widespread for the Northern Hemisphere landmasses no later than the Campanian, leading the apparition of endemic groups. In that way "Allodaposuchia" represents an endemic European clade probably originated in the Ibero-Armorican domain in the late Campanian and dispersed by the Southern European archipelago prior to the early Maastrichtian.

Current status of Marsh Crocodiles Crocodylus palustris (Reptilia: Crocodylidae in Vishwamitri River, Vadodara City, Gujarat, India

Directory of Open Access Journals (Sweden)

R. Vyas

2012-11-01

Full Text Available Data presented here is based on a three year study (2008-2010 on a population of Mugger Crocodylus palustris inhabiting Vishwamitri River near Vadodara City, Gujarat State, India. In total, 155 Muggers were counted in the 25km river stretch during 2010. In all, 40 burrows were observed along the river bank, and the same were clumped in certain sections of the river. Muggers fed eight species of birds, and domestic livestock in addition to scavenging. Eight instances of human-crocodile conflicts were observed including four human causalities. A total 90 Muggers were rescued from the urban areas and the same were relocated elsewhere in the river system. Various types of threats to Mugger were also noticed including habitat loss, alteration and soil erosion and mortality due to rail traffic. The present study suggests further research to propose strategies to conserve this population.

Effects of a copper-tolerant grass (Agrostis capillaris) on the ecosystem of a copper-contaminated arable soil

Energy Technology Data Exchange (ETDEWEB)

Boon, G.T. [State Univ. Groningen (Netherlands); Bouwman, L.A.; Bloem, J.; Roemkens, P.F.A.M. [Research Inst. for Agrobiology and Soil Fertility, Haren (Netherlands)

1998-10-01

To test how a dysfunctioning ecosystem of a severely metal-polluted soil responds to renewed plant growth, a pot experiment was conducted with soil from an experimental arable field with pH and copper gradients imposed 13 years ago. In this experiment, four pH/copper combinations from this field were either planted with a pH- and copper-resistant grass cultivar or remained fallow. During a 10-week period, the dynamics of the microbial activity and of the abundances of bacteria, protozoa. and nematodes were measured, as were the dynamics of several chemical soil parameters. After 13 years of copper, which had resulted in severely reduced crop growth, no effects were observed on bacterial numbers, respiration, or protozoan numbers, but bacterial growth was strongly reduced in the low pH plots, and even more so in low pH plots enriched with copper. Of the organisms, only nematodes were negatively affected under conditions of high copper load at low pH. In these plots, numbers belonging to all feeding categories were strongly reduced. Planting of a copper-tolerant grass variety, Agrostis capillaris L. var. Parys Mountain, resulted within 10 weeks in faster bacterial growth and more protozoa and bacterivorous nematodes in comparison with fallow controls; these effects were markedly strongest in the acidic, copper-enriched soils. During incubation, fungivorous nematodes increased in all treatments, in fallow and in planted pots and in the pots with high-copper, low-pH soil. The results of this experiment suggest that introduction of plant growth is one of the major causes of increased biological activity in acidic contaminated soils. Planting such soils with metal-tolerant plant species can reestablish the necessary food base to support soil organism growth, and this can lead to numerous positive effects, reversing the loss of soil functions due to the high copper levels under acidic conditions.

Optimization of phototrophic hydrogen production by Rhodopseudomonas palustris PBUM001 via statistical experimental design

Energy Technology Data Exchange (ETDEWEB)

Jamil, Zadariana [Department of Civil Engineering, Faculty of Engineering, University of Malaya (Malaysia); Faculty of Civil Engineering, Technology University of MARA (Malaysia); Mohamad Annuar, Mohamad Suffian; Vikineswary, S. [Institute of Biological Sciences, University of Malaya (Malaysia); Ibrahim, Shaliza [Department of Civil Engineering, Faculty of Engineering, University of Malaya (Malaysia)

2009-09-15

Phototrophic hydrogen production by indigenous purple non-sulfur bacteria, Rhodopseudomonas palustris PBUM001 from palm oil mill effluent (POME) was optimized using response surface methodology (RSM). The process parameters studied include inoculum sizes (% v/v), POME concentration (% v/v), light intensity (klux), agitation (rpm) and pH. The experimental data on cumulative hydrogen production and COD reduction were fitted into a quadratic polynomial model using response surface regression analysis. The path to optimal process conditions was determined by analyzing response surface three-dimensional surface plot and contour plot. Statistical analysis on experimental data collected following Box-Behnken design showed that 100% (v/v) POME concentration, 10% (v/v) inoculum size, light intensity at 4.0 klux, agitation rate at 250 rpm and pH of 6 were the best conditions. The maximum predicted cumulative hydrogen production and COD reduction obtained under these conditions was 1.05 ml H{sub 2}/ml POME and 31.71% respectively. Subsequent verification experiments at optimal process values gave the maximum yield of cumulative hydrogen at 0.66 {+-} 0.07 ml H{sub 2}/ml POME and COD reduction at 30.54 {+-} 9.85%. (author)

Size-dependent distribution and feeding habits of Terebralia palustris in mangrove habitats of Gazi Bay, Kenya

Science.gov (United States)

Pape, Ellen; Muthumbi, Agnes; Kamanu, Chomba Peter; Vanreusel, Ann

2008-03-01

The gastropod Terebralia palustris often dominates the surface of muddy to sandy substrates of intertidal mudflats and mangrove forests, where they clearly destabilize the sediment. In the present study, it was investigated whether and to what extent the behaviour of juvenile and adult snails differs among habitats (mudflat vs. mangrove stand) in a Sonneratia alba mangal at Gazi Bay, Kenya. For this purpose we: (1) examined their distribution along three land-sea transects; and (2) applied stable isotope analysis to determine the feeding patterns of different-sized snails from the mangrove and mudflat habitats. Additionally, we investigated if these gastropods exert an impact on microphytobenthic (diatom) biomass, and whether this is size-dependent. The latter objective was met by either enclosing or excluding different-sized snails from experimental cages on the intertidal mudflat and the subsequent assessment of a change in pigment concentration of the sediment surface. In agreement with several previous studies conducted in other mangroves and geographical locations, a spatial segregation was demonstrated between juveniles (more common on the mudflat) and adults (more common in the mangrove forest). On the intertidal mudflat juveniles avoided sediment patches characterized by highly saline water in intertidal pools and a high mud content, while adults tended to dwell on substrates covered by a high amount of leaf litter. Stable carbon isotope analysis of the foot tissue of snails sampled from the S. alba stand and the mudflat indicated a transition in food source when a shell length of 51 mm is reached. Considering the δ13C value of juveniles, it seems they might be selecting for microphytobenthos, which might explain their preference for the mudflat. The diet of size classes found in both habitats did not differ significantly, although juveniles inhabiting the mangrove forest were slightly more depleted in 13C compared to those residing on the mudflat

A Tribal Story Written in Silica: Using Phytoliths to Research the Effects of Mining on Past Wild Rice (Zizania palustris) Abundance in Sandy Lake, Minnesota

Science.gov (United States)

Clarke, I. R.; Jones, M. A.; Yost, C. L.; Drake, C.; Ladwig, J. L.; Myrbo, A.; Howes, T.

2014-12-01

Wild rice (Zizania palustris, manoomin) is an emergent aquatic plant that grows annually in the northern Great Lakes region of North America. This region is also rich in iron ore deposits and correspondingly has an extensive history of mining activities. Wild rice no longer grows in some areas where it was previously abundant. Sandy Lake, located in St. Louis County on federally protected lands that are ceded territory of the Fond du Lac Band of Lake Superior Chippewa in Minnesota and downstream of the nearby U.S. Steel Minntac mine, was selected as a test site. This lake has a history of ricing activities by the Ojibwe (Chippewa) People, for whom manoomin has cultural importance. Lake cores were taken on June 17, 2014 by LacCore and FDLRM staff and samples were obtained. This project used phytolith analysis to answer the question of past wild rice presence and abundance in Sandy Lake. Phytoliths are microscopic opal silica deposits produced in some plants. Zizania palustris produces phytolith morphotypes that are unequivocally diagnostic of this species in this region. Microscopic slides were prepared and analyzed for wild rice phytoliths. Concentration values ranged from 25 to 4379 phytoliths per cm3/year, and wild rice accumulation figures ranged from 7 to 789 phytoliths/cm2/year, the maximum values of which occurred in the 1920s and generally declined to the current lowest levels observed. Mining has likely impacted wild rice populations by causing increased sulfate levels and possibly contributing to higher lake levels.

Evaluation of Wildlife Mitigation Sites at the Chief Joseph Dam Project (1993/1994 Season)

Science.gov (United States)

1994-07-22

clematis RAMUALER. Ifr . Site COST Cormes stolonifera red-osier dogwood CORNACLAE P,, Iff Site CRCO Crataegus columbiana Columbia hawthorn RC)SACEAE R...firitillary __________ EiS, BE GAAR Galillardla aristata gaillardia COMPOSnAE ES, BE GAAP Galiwn aparine bedsmrw _____________ Irr. Site GABO Galium...spicalum bluebunch wheatgras GRAMINEAE BS, BB AG Agrotids sp bentgrass GRAMINEAE Ifr . Site, near shore AGIN Agroawis interrupta internited bentgrass

Methylocella palustris gen. nov., sp. nov., a new methane-oxidizing acidophilic bacterium from peat bogs, representing a novel subtype of serine-pathway methanotrophs.

Science.gov (United States)

Dedysh, S N; Liesack, W; Khmelenina, V N; Suzina, N E; Trotsenko, Y A; Semrau, J D; Bares, A M; Panikov, N S; Tiedje, J M

2000-05-01

A new genus, Methylocella, and a new species, Methylocella palustris, are proposed for three strains of methane-oxidizing bacteria isolated from acidic Sphagnum peat bogs. These bacteria are aerobic, Gram-negative, colourless, non-motile, straight and curved rods that utilize the serine pathway for carbon assimilation, multiply by normal cell division and contain intracellular poly-beta-hydroxybutyrate granules (one at each pole). These strains use methane and methanol as sole sources of carbon and energy and are moderately acidophilic organisms with growth between pH 4.5 and pH 7.0, the optimum being at pH 5.0-5.5. The temperature range for growth is 10-28 degrees C with the optimum at 15-20 degrees C. The intracytoplasmic membrane system is different from those of type I and II methanotrophs. Cells contain an extensive periplasmic space and a vesicular membrane system connected to the cytoplasmic membrane. The strains grew only on media with a low salt content (0.2-0.5 g l(-1)). All three strains were found to possess soluble methane monooxygenase and are able to fix atmospheric nitrogen via an oxygen-sensitive nitrogenase. No products were observed in a PCR with particulate methane monooxygenase-targeted primers; hybridization with a pmoA probe was also negative. The major phospholipid fatty acids are 18:1 acids. The G+C content of the DNA is 61.2 mol%. The three strains share identical 16S rRNA gene sequences and represent a novel lineage of methane-oxidizing bacteria within the alpha-subclass of the class Proteobacteria and are only moderately related to type II methanotrophs of the Methylocystis-Methylosinus group. The three strains are most closely related to the acidophilic heterotrophic bacterium Beijerinckia indica subsp. indica (96.5% 16S rDNA sequence similarity). Collectively, these strains comprise a new species and genus Methylocella palustris gen. nov., sp. nov.; strain KT (= ATCC 700799T) is the type strain.

Action of sulfurous acid on pollen. [Hepatica triloba; Helleborus orientalis; Vinca minor; Viola tricolor; Primula officinalis; Lilium candidum; Petunia; Pisum; Helleborus viridus; Galanthus nivealis; Vinca major; Convallaria maialis; Narcissus poeticus; Caltha palustris; Cystisus laburnum; Orchis maculata; Bilbergia; Eranthus; Crocus

Energy Technology Data Exchange (ETDEWEB)

Sabachnikoff, V

1912-01-23

The following ornamental plants: Hepatica triloba, Helleborus orientalis, Vinca minor, Viola tricolor, Primula officinalis, Lilium candidum, Petunia, Pisum, Helleborus viridus, Galanthus nivealis, Vinca major, Convallaria maialis, Narcissus poeticus, Caltha palustris, Cystisus laburnum, Orchis maculata, Bilbergia, Eranthus, and Crocus were tested for seed production. Exposure to sulfuric acid ranged from three to forty-eight hours. Responses were noted for varying concentrations.

Wetlands Research Program. Corps of Engineers Wetlands Delineation Manual. Appendix C. Sections 1 and 2. Region 2 - Southeast.

Science.gov (United States)

1987-01-01

22 7.V.: 14 -1b Jil -7 1 N.- .- WETLANDS RESEARCH PROGRAM TECHNICAL REPORT Y-87-1 CORPS OF ENGINEERS WETLANDS DELINEATION MANUAL APPENDIX C SECTIONS ...ARMYLA- US Army Corps of Engineers Washington, DC 20314-1000 B , , , -I *. 4 -w *" APPENDIX C SECTION 1 NATIONAL LIST OF PLANT SPECIES THAT OCCUR IN...Redtop FACW A. hiernalia (Walter) B.S.P. Winter bent FAC A. scabra Wilid. Rough bentgrass FAC A. st~nfyaL. Carpet bentgrass FACW Aletris aurea

Different Metabolomic Responses to Carbon Starvation between Light and Dark Conditions in the Purple Photosynthetic Bacterium, Rhodopseudomonas palustris.

Science.gov (United States)

Kanno, Nanako; Matsuura, Katsumi; Haruta, Shin

2018-03-29

Purple photosynthetic bacteria utilize light energy for growth. We previously demonstrated that light energy contributed to prolonging the survival of multiple purple bacteria under carbon-starved conditions. In order to clarify the effects of illumination on metabolic states under carbon-starved, non-growing conditions, we herein compared the metabolic profiles of starved cells in the light and dark using the purple bacterium, Rhodopseudomonas palustris. The metabolic profiles of starved cells in the light were markedly different from those in the dark. After starvation for 5 d in the light, cells showed increases in the amount of ATP and the NAD + /NADH ratio. Decreases in the amounts of most metabolites related to glycolysis and the TCA cycle in energy-rich starved cells suggest the active utilization of these metabolites for the modification of cellular components. Starvation in the dark induced the consumption of cellular compounds such as amino acids, indicating that the degradation of these cellular components produced ATP in order to maintain viability under energy-poor conditions. The present results suggest that intracellular energy levels alter survival strategies under carbon-starved conditions through metabolism.

Cloning and characterization of a pyrethroid pesticide decomposing esterase gene, Est3385, from Rhodopseudomonas palustris PSB-S.

Science.gov (United States)

Luo, Xiangwen; Zhang, Deyong; Zhou, Xuguo; Du, Jiao; Zhang, Songbai; Liu, Yong

2018-05-09

Full length open reading frame of pyrethroid detoxification gene, Est3385, contains 963 nucleotides. This gene was identified and cloned based on the genome sequence of Rhodopseudomonas palustris PSB-S available at the GneBank. The predicted amino acid sequence of Est3385 shared moderate identities (30-46%) with the known homologous esterases. Phylogenetic analysis revealed that Est3385 was a member in the esterase family I. Recombinant Est3385 was heterologous expressed in E. coli, purified and characterized for its substrate specificity, kinetics and stability under various conditions. The optimal temperature and pH for Est3385 were 35 °C and 6.0, respectively. This enzyme could detoxify various pyrethroid pesticides and degrade the optimal substrate fenpropathrin with a Km and Vmax value of 0.734 ± 0.013 mmol·l -1 and 0.918 ± 0.025 U·µg -1 , respectively. No cofactor was found to affect Est3385 activity but substantial reduction of enzymatic activity was observed when metal ions were applied. Taken together, a new pyrethroid degradation esterase was identified and characterized. Modification of Est3385 with protein engineering toolsets should enhance its potential for field application to reduce the pesticide residue from agroecosystems.

Hydraulic architecture and tracheid allometry in mature Pinus palustris and Pinus elliottii trees.

Science.gov (United States)

Gonzalez-Benecke, C A; Martin, T A; Peter, G F

2010-03-01

Pinus palustris Mill. (longleaf pine, LL) and Pinus elliottii Engelm. var. elliottii (slash pine, SL) frequently co-occur in lower coastal plain flatwoods of the USA, with LL typically inhabiting slightly higher and better-drained microsites than SL. The hydraulic architecture and tracheid dimensions of roots, trunk and branches of mature LL and SL trees were compared to understand their role in species microsite occupation. Root xylem had higher sapwood-specific hydraulic conductivity (k(s)) and was less resistant to cavitation compared with branches and trunk sapwood. Root k(s) of LL was significantly higher than SL, whereas branch and trunk k(s) did not differ between species. No differences in vulnerability to cavitation were observed in any of the organs between species. Across all organs, there was a significant but weak trade-off between water conduction efficiency and safety. Tracheid hydraulic diameter (D(h)) was strongly correlated with k(s) across all organs, explaining >73% of the variation in k(s). In contrast, tracheid length (L(t)) explained only 2.4% of the variability. Nevertheless, for trunk xylem, k(s) was 39.5% higher at 20 m compared with 1.8 m; this increase in k(s) was uncorrelated with D(h) and cell-wall thickness but was strongly correlated with the difference in L(t). Tracheid allometry markedly changed between sapwood of roots, trunks and branches, possibly reflecting different mechanical constraints. Even though vulnerability to cavitation was not different for sapwood of roots, branches or the trunks of LL and SL, higher sapwood to leaf area ratio and higher maximum sapwood-specific hydraulic conductivity in roots of LL are functional traits that may provide LL with a competitive advantage on drier soil microsites.

An evaluation of memory accuracy in food hoarding marsh tits Poecile palustris--how accurate are they compared to humans?

Science.gov (United States)

Brodin, Anders; Urhan, A Utku

2013-07-01

Laboratory studies of scatter hoarding birds have become a model system for spatial memory studies. Considering that such birds are known to have a good spatial memory, recovery success in lab studies seems low. In parids (titmice and chickadees) typically ranging between 25 and 60% if five seeds are cached in 50-128 available caching sites. Since these birds store many thousands of food items in nature in one autumn one might expect that they should easily retrieve five seeds in a laboratory where they know the environment with its caching sites in detail. We designed a laboratory set up to be as similar as possible with previous studies and trained wild caught marsh tits Poecile palustris to store and retrieve in this set up. Our results agree closely with earlier studies, of the first ten looks around 40% were correct when the birds had stored five seeds in 100 available sites both 5 and 24h after storing. The cumulative success curve suggests high success during the first 15 looks where after it declines. Humans performed much better, in the first five looks most subjects were 100% correct. We discuss possible reasons for why the birds were not doing better. Copyright © 2013 Elsevier B.V. All rights reserved.

Sulfide Generated by Sulfate Reduction is a Primary Controller of the Occurrence of Wild Rice (Zizania palustris) in Shallow Aquatic Ecosystems

Science.gov (United States)

Myrbo, A.; Swain, E. B.; Engstrom, D. R.; Coleman Wasik, J.; Brenner, J.; Dykhuizen Shore, M.; Peters, E. B.; Blaha, G.

2017-11-01

Field observations suggest that surface water sulfate concentrations control the distribution of wild rice, an aquatic grass (Zizania palustris). However, hydroponic studies show that sulfate is not toxic to wild rice at even unrealistically high concentrations. To determine how sulfate might directly or indirectly affect wild rice, potential wild rice habitat was characterized for 64 chemical and physical variables in over 100 sites spanning a relatively steep climatic and geological gradient in Minnesota. Habitat suitability was assessed by comparing the occurrence of wild rice with the field variables, through binary logistic regression. This analysis demonstrated that sulfide in sediment pore water, generated by the microbial reduction of sulfate that diffuses or advects into the sediment, is the primary control of wild rice occurrence. Water temperature and water transparency independently control the suitability of habitat for wild rice. In addition to generating phytotoxic sulfide, sulfate reduction also supports anaerobic decomposition of organic matter, releasing nutrients that can compound the harm of direct sulfide toxicity. These results are important because they show that increases in sulfate loading to surface water can have multiple negative consequences for ecosystems, even though sulfate itself is relatively benign.

Sustainable Use of Biotechnology for Bioenergy Feedstocks

Science.gov (United States)

Moon, Hong S.; Abercrombie, Jason M.; Kausch, Albert P.; Stewart, C. Neal

2010-10-01

Done correctly, cellulosic bioenergy should be both environmentally and economically beneficial. Carbon sequestration and decreased fossil fuel use are both worthy goals in developing next-generation biofuels. We believe that biotechnology will be needed to significantly improve yield and digestibility of dedicated perennial herbaceous biomass feedstocks, such as switchgrass and Miscanthus, which are native to the US and China, respectively. This Forum discusses the sustainability of herbaceous feedstocks relative to the regulation of biotechnology with regards to likely genetically engineered traits. The Forum focuses on two prominent countries wishing to develop their bioeconomies: the US and China. These two countries also share a political desire and regulatory frameworks to enable the commercialization and wide release of transgenic feedstocks with appropriate and safe new genetics. In recent years, regulators in both countries perform regular inspections of transgenic field releases and seriously consider compliance issues, even though the US framework is considered to be more mature and stringent. Transgene flow continues to be a pertinent environmental and regulatory issue with regards to transgenic plants. This concern is largely driven by consumer issues and ecological uncertainties. Regulators are concerned about large-scale releases of transgenic crops that have sexually compatible crops or wild relatives that can stably harbor transgenes via hybridization and introgression. Therefore, prior to the commercialization or extensive field testing of transgenic bioenergy feedstocks, we recommend that mechanisms that ensure biocontainment of transgenes be instituted, especially for perennial grasses. A cautionary case study will be presented in which a plant’s biology and ecology conspired against regulatory constraints in a non-biomass crop perennial grass (creeping bentgrass, Agrostis stolonifera), in which biocontainment was not attained. Appropriate

A novel electrophototrophic bacterium Rhodopseudomonas palustris strain RP2, exhibits hydrocarbonoclastic potential in anaerobic environments

Directory of Open Access Journals (Sweden)

Krishnaveni Venkidusamy

2016-07-01

Full Text Available An electrophototrophic, hydrocarbonoclastic bacterium Rhodopseudomonas palustris stain RP2 was isolated from the anodic biofilms of hydrocarbon fed microbial electrochemical remediation systems (MERS. Salient properties of the strain RP2 were direct electrode respiration, dissimilatory metal oxide reduction, spore formation, anaerobic nitrate reduction, free living diazotrophy and the ability to degrade n-alkane components of petroleum hydrocarbons in anoxic, photic environments. In acetate fed microbial electrochemical cells, a maximum current density of 305±10 mA/m2 (1000Ω was generated (power density 131.65±10 mW/m2 by strain RP2 with a coulombic efficiency of 46.7 ± 1.3%. Cyclic voltammetry studies showed that anaerobically grown cells of strain RP2 is electrochemically active and likely to transfer electrons extracellularly to solid electron acceptors through membrane bound compounds, however, aerobically grown cells lacked the electrochemical activity. The ability of strain RP2 to produce current (maximum current density 21±3 mA/m2; power density 720±7 µW/m2, 1000Ω using petroleum hydrocarbon (PH as a sole energy source was also examined using an initial concentration of 800 mg l-1 of diesel range hydrocarbons (C9- C36 with a concomitant removal of 47.4 ± 2.7% hydrocarbons in MERS. Here, we also report the first study that shows an initial evidence for the existence of a hydrocarbonoclastic behavior in the strain RP2 when grown in different electron accepting and illuminated conditions (anaerobic and MERS degradation. Such observations reveal the importance of photoorganotrophic growth in the utilization of hydrocarbons from contaminated environments. Identification of such novel petrochemical hydrocarbon degrading electricigens, not only expands the knowledge on the range of bacteria known for the hydrocarbon bioremediation but also shows a biotechnological potential that goes well beyond its applications to MERS.

Kocuria palustris sp. nov. and Kocuria rhizophila sp. nov., isolated from the rhizoplane of the narrow-leaved cattail (Typha angustifolia).

Science.gov (United States)

Kovács, G; Burghardt, J; Pradella, S; Schumann, P; Stackebrandt, E; Màrialigeti, K

1999-01-01

Two Gram-positive, aerobic spherical actinobacteria were isolated from the rhizoplane of narrow-leaved cattail (Typha angustifolia) collected from a floating mat in the Soroksár tributary of the Danube river, Hungary. Sequence comparisons of the 16S rDNA indicated these isolates to be phylogenetic neighbours of members of the genus Kocuria, family Micrococcaceae, in which they represent two novel lineages. The phylogenetic distinctness of the two organisms TA68T and TAGA27T was supported by DNA-DNA similarity values of less than 55% between each other and with the type strains of Kocuria rosea, Kocuria kristinae and Kocuria varians. Chemotaxonomic properties supported the placement of the two isolates in the genus Kocuria. The diagnostic diamino acid of the cell-wall peptidoglycan is lysine, the interpeptide bridge is composed of three alanine residues. Predominant menaquinone was MK-7(H2). The fatty acid pattern represents the straight-chain saturated iso-anteiso type. Main fatty acid was anteiso-C15:0. The phospholipids are diphosphatidylglycerol, phosphatidylglycerol and an unknown component. The DNA base composition of strains TA68T and TAGA27T is 69.4 and 69.6 mol% G+C, respectively. Genotypic, morphological and physiological characteristics are used to describe two new species of Kocuria, for which we propose the names Kocuria palustris, type strain DSM 11925T and Kocuria rhizophila, type strain DSM 11926T.

High-resolution bioactivity profiling combined with HPLC-HRMS-SPE-NMR: α-Glucosidase inhibitors and acetylated ellagic acid rhamnosides from Myrcia palustris DC. (Myrtaceae).

Science.gov (United States)

Wubshet, Sileshi G; Moresco, Henrique H; Tahtah, Yousof; Brighente, Inês M C; Staerk, Dan

2015-08-01

Type 2 diabetes (T2D) is an endocrine metabolic disease with a worldwide prevalence of more than 8%, and an expected increase close to 50% in the next 15-20years. T2D is associated with severe and life-threatening complications like retinopathy, neuropathy, nephropathy, and cardiovascular diseases, and therefore improved drug leads or functional foods containing α-glucosidase inhibitors are needed for management of blood glucose. In this study, leaves of Myrcia palustris were investigated by high-resolution α-glucosidase inhibition profiling combined with HPLC-HRMS-SPE-NMR. This led to identification of casuarinin, myricetin 3-O-β-d-(6″-galloyl)galactopyranoside, kaempferol 3-O-β-d-galactopyranoside, myricetin, and quercetin as α-glucosidase inhibitors. In addition, four acetylated ellagic acid rhamnosides, i.e., 4-O-(2″,4″-O-diacetyl-α-l-rhamnopyranosyl)ellagic acid, 4-O-(2″,3″-O-diacetyl-α-l-rhamnopyranosyl)ellagic acid, 4-O-(3″,4″-O-diacetyl-α-l-rhamnopyranosyl)ellagic acid, and 4-O-(2″,3″,4″-O-triacetyl-α-l-rhamnopyranosyl)ellagic acid were identified. Copyright © 2015 Elsevier Ltd. All rights reserved.

Single-molecule spectroscopy reveals that individual low-light LH2 complexes from Rhodopseudomonas palustris 2.1.6. have a heterogeneous polypeptide composition.

Science.gov (United States)

Brotosudarmo, Tatas H P; Kunz, Ralf; Böhm, Paul; Gardiner, Alastair T; Moulisová, Vladimíra; Cogdell, Richard J; Köhler, Jürgen

2009-09-02

Rhodopseudomonas palustris belongs to the group of purple bacteria that have the ability to produce LH2 complexes with unusual absorption spectra when they are grown at low-light intensity. This ability is often related to the presence of multiple genes encoding the antenna apoproteins. Here we report, for the first time to our knowledge, direct evidence that individual low-light LH2 complexes have a heterogeneous alphabeta-apoprotein composition that modulates the site energies of Bchl a molecules, producing absorption bands at 800, 820, and 850 nm. The arrangement of the Bchl a molecules in the "tightly coupled ring" can be modeled by nine alphabeta-Bchls dimers, such that the Bchls bound to six alphabeta-pairs have B820-like site energies and the remaining Bchl a molecules have B850-like site energies. Furthermore, the experimental data can only be satisfactorily modeled when these six alphabeta-pairs with B820 Bchl a molecules are distributed such that the symmetry of the assembly is reduced to C(3). It is also clear from the measured single-molecule spectra that the energies of the electronically excited states in the mixed B820/850 ring are mainly influenced by diagonal disorder.

Differentiation of epipactis palustris (l.) crantz (orchidaceae) in habitats altered by man based on species populations within poznan city (poland)

International Nuclear Information System (INIS)

Wieloch, M.K.; Raszewska, M.W.; Drapikowska, M.

2017-01-01

The aim of the study was to compare two populations of Epipactis palustris (Orchidaceae) growing in the valley of Junikowski Stream, in the south-western part of the Poznan city (square of ATPOL BD08) and to compare current results to data on the species described in the literature. Group characteristics of both populations, such as population size, average density and congestion factor, as well as the average coefficient of dispersion, were defined. Specimen variability was determined by measuring 250 generative ramets in each population. The following plant traits were included: stem length, inflorescence length, number of flowers per inflorescence, number of leaves per stem and length and width of the largest leaf. Obtained data were subjected to statistical analyses. Descriptive statistics were calculated (arithmetic average, standard deviation, minimum and maximum). The variation coefficient (V) was established to determine the variation degree of each trait. In order to determine statistical significance of average values of traits of the samples in question, the factor variance ANOVA F-statistics was used. The significance degree was examined with Scheffe's test. Principal component analysis (PCA) enabled the examination of mutual relations between the samples in the system of two first principal components. This work confirmed previous information about low variability of marsh helleborine. Individual traits in both populations were very similar. The differences concerned the group characteristics. The plants were in good condition irrespective of occupied habitat. (author)

Genome Assembly of the Fungus Cochliobolus miyabeanus, and Transcriptome Analysis during Early Stages of Infection on American Wildrice (Zizania palustris L..

Directory of Open Access Journals (Sweden)

Claudia V Castell-Miller

Full Text Available The fungus Cochliobolus miyabeanus causes severe leaf spot disease on rice (Oryza sativa and two North American specialty crops, American wildrice (Zizania palustris and switchgrass (Panicum virgatum. Despite the importance of C. miyabeanus as a disease-causing agent in wildrice, little is known about either the mechanisms of pathogenicity or host defense responses. To start bridging these gaps, the genome of C. miyabeanus strain TG12bL2 was shotgun sequenced using Illumina technology. The genome assembly consists of 31.79 Mbp in 2,378 scaffolds with an N50 = 74,921. It contains 11,000 predicted genes of which 94.5% were annotated. Approximately 10% of total gene number is expected to be secreted. The C. miyabeanus genome is rich in carbohydrate active enzymes, and harbors 187 small secreted peptides (SSPs and some fungal effector homologs. Detoxification systems were represented by a variety of enzymes that could offer protection against plant defense compounds. The non-ribosomal peptide synthetases and polyketide synthases (PKS present were common to other Cochliobolus species. Additionally, the fungal transcriptome was analyzed at 48 hours after inoculation in planta. A total of 10,674 genes were found to be expressed, some of which are known to be involved in pathogenicity or response to host defenses including hydrophobins, cutinase, cell wall degrading enzymes, enzymes related to reactive oxygen species scavenging, PKS, detoxification systems, SSPs, and a known fungal effector. This work will facilitate future research on C. miyabeanus pathogen-associated molecular patterns and effectors, and in the identification of their corresponding wildrice defense mechanisms.

Hydrogen photo-evolution by Rhodopseudomonas palustris 6A using pre-treated olive mill wastewater and a synthetic medium containing sugars

International Nuclear Information System (INIS)

Pintucci, Cristina; Padovani, Giulia; Giovannelli, Alessio; Traversi, Maria Laura; Ena, Alba; Pushparaj, Benjamin; Carlozzi, Pietro

2015-01-01

Highlights: • Adsorbent matrices to convert fresh olive mill wastewater (OMW F ) in feedstock. • Dry-Azolla and granular active carbon for adsorbing polyphenols from OMW F . • Photofermentative processes for biohydrogen production. • Culture mixing by means of an impeller or a magnetic stir bar. • A 30% of dephenolised OMW containing medium suits the photofermentative process. - Abstract: Increasing costs of petroleum, associated with the escalating problems of global climate change, require always greater efforts in order to produce an energy carrier as bioH 2 . In this study, bioH 2 production using photofermentative process was investigated. Two culture broths were used: (a) a synthetic medium rich in sugars (glucose and fructose) and (b) a pre-treated fresh olive-mill wastewater (OMW F ) diluted with water (30%, v:v). The pre-treatment was carried out using two different vegetable matrices (dry-Azolla and granular active carbon) to decrease both the content of polyphenols and the dark colour of wastewater. Rhodopseudomonas palustris 6A isolated from soil spread with OMW was utilized for batch growth experiments, carried out indoors under continuous light (200 μE/m 2 /s). When synthetic medium was used, the culture mixing was performed using either (i) a magnetic stir bar, and (ii) an impeller equipped with five turbines. The latter system made it possible to increase the bioH 2 photo-evolution by 1.4 times. The specific hydrogen photo-evolution rate was 13.5 mL/g(dw)/h in the broth containing diluted OMW F and 11.8 mL/g(dw)/h in the synthetic medium containing sugars (glucose and fructose)

De novo transcriptome assembly analysis of weed Apera spica-venti from seven tissues and growth stages

DEFF Research Database (Denmark)

Babineau, Marielle; Mahmood, Khalid; Mathiassen, Solvejg Kopp

2017-01-01

Background Loose silky bentgrass (Apera spica-venti) is an important weed in Europe with a recent increase in herbicide resistance cases. The lack of genetic information about this noxious weed limits its biological understanding such as growth, reproduction, genetic variation, molecular ecology ...

Anaerobic p-coumarate degradation by Rhodopseudomonas palustris and identification of CouR, a MarR repressor protein that binds p-coumaroyl coenzyme A.

Science.gov (United States)

Hirakawa, Hidetada; Schaefer, Amy L; Greenberg, E Peter; Harwood, Caroline S

2012-04-01

The phenylpropanoid p-coumarate and structurally related aromatic compounds are produced in large amounts by green plants and are excellent carbon sources for many soil bacteria. Aerobic bacteria remove the acyl side chain from phenylpropanoids to leave an aromatic aldehyde, which then enters one of several possible central pathways of benzene ring degradation. We investigated the pathway for the anaerobic degradation of p-coumarate by the phototrophic bacterium Rhodopseudomonas palustris and found that it also follows this metabolic logic. We characterized enzymes for the conversion of p-coumarate to p-hydroxybenzaldehyde and acetyl coenzyme A (acetyl-CoA) encoded by the couAB operon. We also identified a MarR family transcriptional regulator that we named CouR. A couR mutant had elevated couAB expression. In addition, His-tagged CouR bound with high affinity to a DNA fragment encompassing the couAB promoter region, and binding was abrogated by the addition of nanomolar quantities of p-coumaroyl-CoA but not by p-coumarate. Footprinting demonstrated binding of CouR to an inverted repeat sequence that overlaps the -10 region of the couAB promoter. Our results provide evidence for binding of a CoA-modified aromatic compound by a MarR family member. Although the MarR family is widely distributed in bacteria and archaea and includes over 12,000 members, ligands have been identified for relatively few family members. Here we provide biochemical evidence for a new category of MarR ligand.

Characterization and phytoremediation of abandoned contaminated mining area in Portugal by INAA

International Nuclear Information System (INIS)

Canha, N.; Freitas, M.C.; Anawar, H.M.; Dionisio, I.; Dung, H.M.; Pinto-Gomes, C.

2010-01-01

This study aims to find out a vascular plant species that accumulate relatively high concentrations of arsenic (As) for its use as phytoremediator at abandoned and contaminated mining areas, such as Sao Domingos mines (Portugal). The assessment of As contamination levels in soils and plants of other similar sites in the north of the country (Castromil and Poco de Freitas) was also conducted; and the sample analyses were made by instrumental neutron activation analysis. Agrostis genera have shown higher As transfer coefficients than other studied plant species and, in particular, Agrostis curtisii has shown a reasonable ability to accumulate high concentration of this toxic element. (author)

Antifreeze proteins enable plants to survive in freezing conditions

Indian Academy of Sciences (India)

1. Acaenamagellanica. Prickly burr. Doucet et al. 2000. 2. Acer saccharoides. Maple. Doucet et al. 2000. 3. Agrostistenuis. Creeping bentgrass. Doucet et al. 2000. 4. Alliarapetiolata. Garlic mustard. Urrutia et al. 1992. 5. Ammopiptanthusmongolicus. Evergreen legume. Wang et al. 2003. 6. Aster cordifolius. Wood aster.

Stimulation of ipt overexpression as a tool to elucidate the role of cytokinins in high temperature responses of Arabidopsis thaliana

Czech Academy of Sciences Publication Activity Database

Skalák, J.; Černý, M.; Jedelský, P.; Dobrá, Jana; Ge, Eva; Novák, Jan; Hronková, Marie; Dobrev, Petre; Vaňková, Radomíra; Brzobohatý, Břetislav

2016-01-01

Roč. 67, č. 9 (2016), s. 2861-2873 ISSN 0022-0957 Institutional support: RVO:68081707 ; RVO:61389030 ; RVO:60077344 Keywords : solid-phase extraction * heat-stress * creeping bentgrass Subject RIV: BO - Biophysics; CE - Biochemistry (BC-A); EF - Botanics (UEB-Q) Impact factor: 5.830, year: 2016

Rare, threatened and relict species in flora of SNR Zasavica

Directory of Open Access Journals (Sweden)

Stanković, M.

2011-09-01

Full Text Available In group of biodiversity important plant species there are 23 taxa. 20 taxa are mentioned in „Preliminary Red List of flora of Serbia and Montenegro with IUCN 2001 Conservation Statuses“ in following categories: two as critically endangered (Aldrovanda vesiculosa L. and Hottonia palustris L., four as endangered (Hippuris vulgaris L., Lindernia palustris Hartm., Ranunculus lingua L. and Urtica kioviensis Rogow., five as vulnerable (Achillea aspleniifolia Vent., Dryopteris carthusiana (Vill. H. P. Fuchs, Leucojum aestivum L. subsp. aestivum, Stratiotes aloides L. and Thelypteris palustris (Schott subsp.palustris, while 9 are with indefinite categories (CR-VU, due to data deficient (DD. Special Nature Reserve „Zasavica“ is the only habitat in Serbia for Aldrovanda vesiculosa L., which was until 2005. considered as extinct from Serbia.

Characteristics of purple nonsulfur bacteria grown under Stevia residue extractions.

Science.gov (United States)

Xu, J; Feng, Y; Wang, Y; Lin, X

2013-11-01

As a consequence of the large-scale cultivation of Stevia plants, releases of plant residues, the byproduct after sweetener extraction, to the environment are inevitable. Stevia residue and its effluent after batching up contain large amounts of organic matters with small molecular weight, which therefore are a potential pollution source. Meanwhile, they are favourite substrates for micro-organism growths. This investigation was aimed to utilize the simulated effluent of Stevia residue to enrich the representative purple nonsulfur bacterium (PNSB), Rhodopseudomonas palustris (Rps. palustris), which has important economic values. The growth profile and quality of Rps. palustris were characterized by spectrophotometry, compared to those grown in common PNSB mineral synthetic medium. Our results revealed that the simulated effluent of Stevia residue not only stimulated Rps. palustris growth to a greater extent, but also increased its physiologically active cytochrome concentrations and excreted indole-3-acetic acid (IAA) content. This variation in phenotype of Rps. palustris could result from the shift in its genotype, further revealed by the repetitive sequence-based PCR (rep-PCR) fingerprinting analysis. Our results showed that the effluent of Stevia residue was a promising substrate for microbial growth. © 2013 The Society for Applied Microbiology.

Effect of vesicular arbuscular mycorrhizal fungus on the ...

African Journals Online (AJOL)

STORAGESEVER

2008-10-06

Oct 6, 2008 ... ... association between certain plants and microorganisms plays an important role in soil ..... an Agrostis capillaris population on a copper contaminated soil. Plant ... vesicular-arbuscular mycorrhizal fungi in Amazonian Peru.

Scheuchzeria palustris L

Czech Academy of Sciences Publication Activity Database

Šída, O.; Štěpánková, Jitka

2015-01-01

Roč. 50, č. 1 (2015), s. 100-101 ISSN 1211-5258 R&D Projects: GA ČR GB14-36079G Institutional support: RVO:67985939 Keywords : floristics * distribution * endangered species Subject RIV: EF - Botanics

In Situ Dark Adaptation Enhances the Efficiency of DNA Extraction from Mature Pin Oak (Quercus palustris Leaves, Facilitating the Identification of Partial Sequences of the 18S rRNA and Isoprene Synthase (IspS Genes

Directory of Open Access Journals (Sweden)

Csengele E. Barta

2017-10-01

Full Text Available Mature oak (Quercus spp. leaves, although abundantly available during the plants’ developmental cycle, are rarely exploited as viable sources of genomic DNA. These leaves are rich in metabolites difficult to remove during standard DNA purification, interfering with downstream molecular genetics applications. The current work assessed whether in situ dark adaptation, to deplete sugar reserves and inhibit secondary metabolite synthesis could compensate for the difficulties encountered when isolating DNA from mature leaves rich in secondary metabolites. We optimized a rapid, commercial kit based method to extract genomic DNA from dark- and light-adapted leaves. We demonstrated that in situ dark adaptation increases the yield and quality of genomic DNA obtained from mature oak leaves, yielding templates of sufficiently high quality for direct downstream applications, such as PCR amplification and gene identification. The quality of templates isolated from dark-adapted pin oak leaves particularly improved the amplification of larger fragments in our experiments. From DNA extracts prepared with our optimized method, we identified for the first time partial segments of the genes encoding 18S rRNA and isoprene synthase (IspS from pin oak (Quercus palustris, whose full genome has not yet been sequenced.

New phytotoxic diterpenoids from Vellozia gigantea (Velloziaceae), an endemic neotropical plant living in the endangered Brazilian biome Rupestrian grasslands

Science.gov (United States)

Vellozia gigantea is a rare, ancient and endemic neotropical plant present in the Brazilian Rupestrian grasslands. The dichloromethane extract of V. gigantea adventitious roots was phytotoxic against Lactuca sativa, Agrostis stolonifera and Lemna paucicostata, and showed larvicidal activity against ...

Dry psammophytic non-forest vegetation of the Třeboňsko Biosphere Reserve (Czech Republic)

Czech Academy of Sciences Publication Activity Database

Boublík, Karel; Černý, Tomáš

2006-01-01

Roč. 38, č. 2 (2006), s. 1269-1287 ISSN 0253-116X R&D Projects: GA AV ČR IAA6005202 Institutional research plan: CEZ:AV0Z60050516 Keywords : Agrostis scabra * phytosociology * Southern Bohemia Subject RIV: EF - Botanics

DEVELOPMENT OF MOLECULAR MONITORING TECHNOLOGIES TO MEASURE TRANSGENE FLOW AND INTROGRESSION IN CROP AND NON-CROP PLANT SPECIES

Science.gov (United States)

The Gene Flow Project at the US Environmental Protection Agency, Western Ecology Division is developing methodologies for ecological risk assessments of transgene flow using Agrostis and Brassica engineered with CP4 EPSPS genes that confer resistance to glyphosate herbicide. In ...

Tabanone a new phytotoxic constituent of cogongrass (Imperta culindrica)

Science.gov (United States)

Cogongrass [Imperata cylindrica (L.) Beauv.] is a troublesome invasive weedy species with reported allelopathic properties. The phytotoxicity of different constituents isolated from roots and aerial parts of this species was evaluated on Lactuca sativa and Agrostis stolonifera. No significant phytot...

City of Freeport, Florida, State Road 20 Water Main Installation, Final Environmental Assessment, Eglin Air Force Base, Florida

Science.gov (United States)

2010-07-01

If contamination, drought or natural disaster, such as a hurricane, impacted one water supply, an interconnection with neighboring municipalities...Scientific Name Sandhills Ecological Association Longleaf Pine Pinus palustris Red-cockaded Woodpecker Picoides borealis Turkey Oak Quercus laevis...canadensis Flatwoods Ecological Association Longleaf Pine Pinus palustris Wood Duck Aix sponsa Runner Oak Quercus pumila Red-winged Blackbird Agelaius

Does interspecific competition alter effects of early season ozone exposure on plants from wet grasslands? Results of a three-year experiment in open-top chambers

NARCIS (Netherlands)

Tonneijck, A.E.G.; Franzaring, J.; Brouwer, G.; Metselaar, K.; Dueck, T.A.

2004-01-01

Chronic effects of ozone on wet grassland species early in the growing season might be altered by interspecific competition. Individual plants of Holcus lanatus, Lychnis flos-cuculi, Molinia caerulea and Plantago lanceolata were grown in monocultures and in mixed cultures with Agrostis capillaris.

The effect of potassium nutrition on sup 137 Cs uptake in two upland species

Energy Technology Data Exchange (ETDEWEB)

Jones, H E; Harrison, A F; Poskitt, J M; Roberts, J D; Clint, G [Institute for Terrestrial Ecology, Grange-over-Sands (UK)

1991-01-01

Agrostis capillaris (Agrostis) and Calluna vulgaris (Calluna), two species with differing phenologies and widespread presence in upland areas of Britain where high Chernobyl fallout occurred, were grown in pot culture with varying concentrations of potassium in the rooting medium. Tissue content of potassium increased with increasing supply in both species. Roots, excised from these plants, were placed in a solution of {sup 137}Cs-labelled caesium chloride for 15 min to determine uptake potential. There were clear negative relationships between the rate of uptake of {sup 137}Cs by both species and (a) the concentration of potassium supplied and (b) plant issue potassium concentrations. With Agrotis, there was an approximately ten-fold difference in {sup 137}Cs uptake between potassium-deficient and optimum plants; with Calluna, it was approximately eight-fold. These results demonstrate the suppression of {sup 137}Cs uptake into plants by potassium supply. (author).

Influence of host and geographic locale on the distribution of Colletotrichum cereale lineages

Science.gov (United States)

Colletotrichum cereale is an ascomycete inhabitant of cool-season grasses of the Pooideae subfamily. The fungus has increased in frequency over the past decade as a destructive pathogen of Poa annua and Agrostis stolonifera cultivated as turfgrass. DNA fingerprinting has revealed two distinct C. c...

Las Haloragaceae de Cuba

Directory of Open Access Journals (Sweden)

Betancourt Gandul, Martha

1999-12-01

Full Text Available A study of the Haloragaceae in Cuba is presented. The presence of Proserpinaca palustris, P. pectinata. Myriophyllum laxum and M. pinnatum is confirmed, and the possible extinction of M. sparsiflorum is suggestedEstudio de la familia Haloragaceae en Cuba. Se confirma la existencia de Proserpinaca palustris, P. pectinata. Myriophyllum laxum y M, pinnatum, y se plantea la posible extinción de M. sparsiflorum.

Volcanic ash deposition and long-term vegetation change on Subantarctic Marion Island

NARCIS (Netherlands)

Yeloff, D.; Mauquoy, D.S.; Barber, K.; Way, S.; van Geel, B.; Turney, C.S.M.

2007-01-01

A c. 5500 year record of peatland development and vegetation change was generated from a core recovered from an Agrostis magellanica peat bog on subantarctic Marion Island, using palynomorph, plant macrofossil, and tephra analyses. Two tephra horizons (both 17 cm thick) were identified and dated to

Fort Bragg Old Post Historic District Landscape Report

Science.gov (United States)

2011-01-01

proved to be of substantial economic value (Lefler and Powell 1973). Lon- gleaf pines ( Pinus palustris) produce higher quality pine resin/crude gum than...plants that have the same characteristics as the historic varieties; na- tive plants require relatively little upkeep, are drought tolerant, and can... Pinus palustris Longleaf Pine 1933/IDG 2009 Native Quercus alba White Oak Large Evergreen Trees 1933/IDG 2009 Native Magnolia grandiflora Southern

Photosynthetic response of mountain grassland species to drought stress is affected by UV-induced accumulation of epidermal flavonols

Czech Academy of Sciences Publication Activity Database

Rapantová, Barbora; Klem, Karel; Holub, Petr; Novotná, Kateřina; Urban, Otmar

2016-01-01

Roč. 9, 1-2 (2016), s. 31-40 ISSN 1803-2451 R&D Projects: GA MŠk(CZ) LO1415 Institutional support: RVO:67179843 Keywords : Agrostis capillaris * CO2 assimilation * drought stress * flavonols * grassland * Holcus mollis * Hypericum maculatum * precipitation * Rumex obtusifolius * UV radiation Subject RIV: EH - Ecology, Behaviour

Measured and modelled leaf and stand-scale productivity across a soil moisture gradient and a severe drought.

Science.gov (United States)

Wright, J K; Williams, M; Starr, G; McGee, J; Mitchell, R J

2013-02-01

Environmental controls on carbon dynamics operate at a range of interacting scales from the leaf to landscape. The key questions of this study addressed the influence of water and nitrogen (N) availability on Pinus palustris (Mill.) physiology and primary productivity across leaf and canopy scales, linking the soil-plant-atmosphere (SPA) model to leaf and stand-scale flux and leaf trait/canopy data. We present previously unreported ecophysiological parameters (e.g. V(cmax) and J(max)) for P. palustris and the first modelled estimates of its annual gross primary productivity (GPP) across xeric and mesic sites and under extreme drought. Annual mesic site P. palustris GPP was ∼23% greater than at the xeric site. However, at the leaf level, xeric trees had higher net photosynthetic rates, and water and light use efficiency. At the canopy scale, GPP was limited by light interception (canopy level), but co-limited by nitrogen and water at the leaf level. Contrary to expectations, the impacts of an intense growing season drought were greater at the mesic site. Modelling indicated a 10% greater decrease in mesic GPP compared with the xeric site. Xeric P. palustris trees exhibited drought-tolerant behaviour that contrasted with mesic trees' drought-avoidance behaviour. © 2012 Blackwell Publishing Ltd.

A 400-year phytolith-based reconstruction of wild rice (Zizania palustris) abundance from Mud Lake core sediments, Fond du Lac Band of Lake Superior Chippewa Reservation, Minnesota, USA.

Science.gov (United States)

Munoz, R.; Caylor, E.; Yost, C. L.; Drake, C.; Ladwig, J. L.; Myrbo, A.; Howes, T.

2014-12-01

Wild rice (Zizania palustris L.) is an aquatic grass with spiritual and subsistence significance to Native people of the Great Lakes region of North America. Mud Lake (Mashkiigwaagamaag), located on the Fond du Lac Band of Lake Superior Chippewa Reservation in Carlton County, Minnesota, USA, once supported an extensive population of wild rice (manoomin). However, early 20th century attempts to ditch and drain surrounding wetlands for landuse intensification severely altered the natural hydrological system that supports wild rice. Fond du Lac Resource Management (FDLRM) technicians are currently working to increase the wild rice population in Mud Lake. As part of these efforts, this phytolith study was undertaken to better understand how wild rice abundance has fluctuated over the past 400 years, with particular emphasis on the 19th and 20th centuries. Phytoliths are microscopic opal silica plant remains that are incorporated into soils and lake sediments after the plant-parts that contain them decay. Wild rice produces phytolith morphotypes that are unequivocally diagnostic. Mud Lake core MNMN-MUD11-1C-1P-1 (46°43'38.39"N, 92°42'2.45"W) was piston cored by LacCore (National Lacustrine Core Facility) and FDLRM technicians on 24 May 2011. Initial core descriptions, multi-sensor core logging, phytolith sampling and phytolith extractions were completed during the summer of 2014 at LacCore. Wild rice phytolith identification and quantification was conducted on twelve samples using brightfield microscopy at 400x magnification. Wild rice phytolith concentration values ranged from 68 to 2,300 phytoliths/cm3. Wild rice accumulation rates ranged from 9 to 383 phytoliths/ cm2/yr, peaking in 1952 AD. Wild rice abundance in Mud Lake appears to be influenced by a complex set of variables that include anthropogenic disturbance, climatic events and aquatic plant community succession.

Ontogenesis peculiarities species of genus Rorippa Scopoli (Cruciferae in the subzone of the southern taiga

Directory of Open Access Journals (Sweden)

Svetlana Shabalkina

2014-04-01

Full Text Available Latent, pregenerative and generative periods in the ontogeny of Rorippa amphibia (L. Bess., R. palustris (L. Bess. and R. ×anceps (Wahlenb. Reichenb. were described. Skipping of a postgenerative stage, and some of ontogenetic states demonstrates the dynamic multiplicity of individual development; while the combination of seed and vegetative reproductions – multiplicity of the ways of reproduction and generation. The ontogeny of R. palustris individuals corresponds to A-type, R. amphibia and R. ×anceps – to G-type, and R. ×anceps – to D-type.

Molecular Regulation of Photosynthetic Carbon Dioxide Fixation in Nonsulfur Purple Bacteria

Energy Technology Data Exchange (ETDEWEB)

Tabita, Fred Robert [The Ohio State Univ., Columbus, OH (United States)

2015-12-01

The overall objective of this project is to determine the mechanism by which a transcriptional activator protein affects CO₂ fixation (cbb) gene expression in nonsulfur purple photosynthetic bacteria, with special emphasis to Rhodobacter sphaeroides and with comparison to Rhodopseudomonas palustris. These studies culminated in several publications which indicated that additional regulators interact with the master regulator CbbR in both R. sphaeroides and R. palustris. In addition, the interactive control of the carbon and nitrogen assimilatory pathways was studied and unique regulatory signals were discovered.

Modeling the accumulation of As, Cd, Cu, Pb and Zn in grasses (Agrotis sp. and Poa sp. and stinging nettle (Urtica dioica on selected sites taking into account soil physico-chemical properties

Directory of Open Access Journals (Sweden)

Boshoff M.C.

2014-07-01

Full Text Available The effect of soil properties on the accumulation of metals in two vegetation types was evaluated at 10 sites with a wide variation in soil physicochemical properties pH, organic carbon, clay percentage , total soil metal concentration and exchangeable soil metal content. Accumulation modeling was conducted for grasses (Agrostis sp. and Poa sp. and stinging nettle (Urtica dioica.

Modeling the accumulation of As, Cd, Cu, Pb and Zn in grasses (Agrotis sp. and Poa sp. and stinging nettle (Urtica dioica on selected sites taking into account soil physico-chemical properties

Directory of Open Access Journals (Sweden)

Boshoff M. C.

2013-04-01

Full Text Available The effect of soil properties on the accumulation of metals in two vegetation types was evaluated at 10 sites with a wide variation in soil physicochemical properties pH, organic carbon, clay percentage , total soil metal concentration and exchangeable soil metal content. Accumulation modeling was conducted for grasses (Agrostis sp. and Poa sp. and stinging nettle (Urtica dioica.

IDENTIFICATION OF ESCAPED TRANSGENIC CREEPING BENTGRASS IN OREGON

Science.gov (United States)

When transgenic plants are cultivated near wild species that are sexually compatible with the crop, gene flow between the crop and wild plants is possible. A resultant concern is that transgene flow and transgene introgression within wild populations could have unintended ecologi...

Atlantis Star – a new herbicide in cereals with efficacy against grasses and dicots

Directory of Open Access Journals (Sweden)

Kerlen, Dirk

2016-02-01

Full Text Available Atlantis Star (mesosulfuron-methyl; iodosulfuron-methyl-sodium; thiencarbazone-methyl; mefenpyr-diethyl is a new cereal herbicide to control blackgrass (Alopecurus myosuroides; sensitive and high infestation, brome grass (Bromus spec., ryegrass (Lolium spec., wild oat (Avena fatua, loose silky-bentgrass (Apera spica-venti L., annual meadow-grass (Poa annua L. and dicot weeds. Atlantis Star can be used in winter wheat, winter triticale, winter rye, winter durum wheat and spelt. The publication is based on efficacy trials from two years of spring application with Atlantis Star.

ORF Alignment: NC_005296 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available ... palustris CGA009] ... Length = 77 ... Query: 195 NRRKVYPESARQTRQQGTASLSFAIGASGEVISYKITRSTGSDALDRAIDS...MMKTARPPP 254 ... NRRKVYPESARQTRQQGTASLSFAIGASGEVISYKITRSTGSDALDRAIDSMMKTA...RPPP Sbjct: 1 ... NRRKVYPESARQTRQQGTASLSFAIGASGEVISYKITRSTGSDALDRAIDSMMKTARPPP 60 ...

Effect of dilution and L-malic acid addition on bio-hydrogen production with Rhodopseudomonas palustris from effluent of an acidogenic anaerobic reactor

International Nuclear Information System (INIS)

Azbar, N.; Tuba, F.; Dokgoz, C.

2009-01-01

In this study, H 2 was produced in a two-stage biological process: I) first stage; the dark fermentation of cheese whey wastewater, which is rich in lactose, by mixed anaerobic culture grown at thermophilic temperature in a continuously running fermentor and ii) second stage; the photo-fermentation of the residual medium by R. palustris strain (DSM 127) at 31 o C under illumination of 150 W in batch mode, respectively. In the first part of the study, the effluent from the dark fermentation reactor was used either as it is (no dilution) or after dilution with distilled water at varying ratios such as 1/2 , 1/5, 1/10 (1 volume effluent/5 volume distilled water) before used in photo-fermentation experiments. In the second part of the study, L-malic acid at varying amounts was added into the hydrogen production medium in order to have L-malic acid concentrations ranging from 0 to 4 g/l. Non-diluted and pre-diluted mediums with or without L-malic acid addition were also tested for comparison purpose (as controls). Prior to the hydrogen production experiments, all samples were subjected to pH adjustment, (pH 6.7) and sterilized by autoclave at 121 o C for 15 min. In regards to the experiments in which the effect of dilution of the effluent from dark fermentation was studied, it was observed that dilution of the effluent from dark fermentation resulted in much better hydrogen productions. Among the dilution rates used, the experiments operated with 1/5 dilution ratio produced the best hydrogen production (241 ml H 2 / g COD fed ). On the other hand, it was seen that the mixing the effluent with L-malic acid (0 - 4 g/l) at increasing ratios (studied from 0% L-malic acid up to 100% by volume in the mixture) had further positive effect and improved the hydrogen production. The bioreactors containing only L-malic acid media resulted in the best hydrogen production (438 ml H 2 / g COD fed ). It was found that, undiluted raw cheese whey wastewater effluent from dark hydrogen

ORF Alignment: NC_004757 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available ... [Rhodopseudomonas palustris CGA009] ... Length = 102 ... Query: 14 ... ...MRDGEFLVSKTTAKGVITYINEPFIRMSGFTEQELVGQAHNIIRHPDMPPEAFADFWNTL 73 ... + DG ++VSKT ... KG +TY NE F++ SGF+EQ

ORF Alignment: NC_005296 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available ... [Rhodopseudomonas palustris CGA009] ... Length = 150 ... Query: 1 ... MRIALFQPDIPQNTGTILRFCACLNVEAHIIEPAGFPTSD...RHFRRSGMDYLDQVSIVRHD 60 ... MRIALFQPDIPQNTGTILRFCACLNVEAHIIEPAGFPTSD...RHFRRSGMDYLDQVSIVRHD Sbjct: 1 ... MRIALFQPDIPQNTGTILRFCACLNVEAHIIEPAGFPTSDRHFRRSGMDYLDQVSIVRHD 60 ... Qu

Development of a Novel Escherichia coli–Kocuria Shuttle Vector Using the Cryptic pKPAL3 Plasmid from K. palustris IPUFS-1 and Its Utilization in Producing Enantiopure (S-Styrene Oxide

Directory of Open Access Journals (Sweden)

Hiroshi Toda

2017-11-01

Full Text Available The novel cryptic pKPAL3 plasmid was isolated from the Gram-positive microorganism Kocuria palustris IPUFS-1 and characterized in detail. pKPAL3 is a circular plasmid that is 4,443 bp in length. Open reading frame (ORF and homology search analyses indicated that pKPAL3 possesses four ORFs; however, there were no replication protein coding genes predicted in the plasmid. Instead, there were two nucleotide sequence regions that showed significant identities with untranslated regions of K. rhizophila DC2201 (NBRC 103217 genomic sequences, and these sequences were essential for autonomous replication of pKPAL3 in Kocuria cells. Based on these findings, we constructed the novel Escherichia coli–Kocuria shuttle vectors pKITE301 (kanamycin resistant and pKITE303 (thiostrepton resistant from pKPAL3. The copy numbers of the constructed shuttle vectors were estimated to be 20 per cell, and they exhibited low segregation stability in Kocuria transformant cells in the absence of antibiotics. Moreover, constructed vectors showed compatibility with the other K. rhizophila shuttle vector pKITE103. We successfully expressed multiple heterologous genes, including the styrene monooxygenase gene from Rhodococcus sp. ST-10 (rhsmo and alcohol dehydrogenase gene from Leifsonia sp. S749 (lsadh, in K. rhizophila DC2201 using the pKITE301P and pKITE103P vectors under the control of the glyceraldehyde 3-phosphate dehydrogenase (gapdh promotor. The RhSMO–LSADH co-expressing K. rhizophila was used as a biocatalyst in an organic solvent–water biphasic reaction system to efficiently convert styrene into (S-styrene oxide with 99% ee in the presence of 2-propanol as a hydrogen donor. The product concentration of the reaction in the organic solvent reached 235 mM after 30 h under optimum conditions. Thus, we demonstrated that this novel shuttle vector is useful for developing biocatalysts based on organic solvent-tolerant Kocuria cells.

ORF Alignment: NC_005296 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available ... palustris CGA009] ... Length = 157 ... Query: 95 ... YLQTAIDCHSRYAFARLYSSKLPVTAVHLMNNDVLPTFEAHDA...KIETVLSDNGREFCGRP 154 ... YLQTAIDCHSRYAFARLYSSKLPVTAVHLMNNDVLPTFEAHDAKIETV...LSDNGREFCGRP Sbjct: 1 ... YLQTAIDCHSRYAFARLYSSKLPVTAVHLMNNDVLPTFEAHDAKIETVLSDNGREFCGRP 60 ... Query: 215 LDDYLVGY

Vegetation and checklist of Inaccessible Island, central South Atlantic Ocean, with notes on Nightingale Island

OpenAIRE

J. P. Roux; P. G. Ryan; S. J. Milton; C. L. Moloney

1992-01-01

The physiography and climate of Inaccessible and Nightingale Islands are briefly discussed. The vegetation and the major plant associations are described. Notes are given on the ecology and distribution of each taxon. Taxa newly recorded for Inaccessible Island include Agrostis goughensis, A.holgateana, A. wacei, Calamagrostis deschampsiiformis, Carex thouarsii var.  recurvata, Conyza albida, Elaphoglossum campylolepium and  Uncinia meridensis. One species, C.  albida, is alien to the Tristan...

ORF Alignment: NC_005296 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available Query: 350 RNEMTARRIVTADHTILVSGSGYVPKGDLTVDGKDNPEAVSSAMQLVRSALLCNDAQLRP 409 ... RNEMTARRIVTADHT...ILVSGSGYVPKGDLTVDGKDNPEAVSSAMQLVRSALLCNDAQLRP Sbjct: 1 ... RNEMTARRIVTADHTILVSGSGYVPKGDL... ... cation-transporting P-type ATPase [Rhodopseudomonas ... palustris CGA009] ... Length = 203 ...

ORF Alignment: NC_005296 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available LGETGSGKDVFARRVHAESARRNKPFVPVNCAALPEGLIES 387 ... MAQLSRTVRLVEAGIPVLLLGETGSGKDVFARRVHAESARRNKPFVPVNCA...ALPEGLIES Sbjct: 1 ... MAQLSRTVRLVEAGIPVLLLGETGSGKDVFARRVHAESARRNKPFVPVNCAALPEGLIES 60 ... Query: 448 GRPVPVDFALI...domonas palustris CGA009] ... Length = 229 ... Query: 328 MAQLSRTVRLVEAGIPVLL

Mowing mitigates bioactivity of neonicotinoid insecticides in nectar of flowering lawn weeds and turfgrass guttation.

Science.gov (United States)

Larson, Jonathan L; Redmond, Carl T; Potter, Daniel A

2015-01-01

Systemic neonicotinoid insecticides are used to control turfgrass insect pests. The authors tested their transference into nectar of flowering lawn weeds or grass guttation droplets, which, if high enough, could be hazardous to bees or other insects that feed on such exudates. The authors applied imidacloprid or clothianidin to turf with white clover, followed by irrigation, and used liquid chromatography-tandem mass spectrometry (LC-MS/MS) to analyze residues in clover blooms that were directly sprayed during application or that formed after the first mowing. Imidacloprid residues in guttation fluid from field-grown creeping bentgrass were assessed similarly. The authors used Orius insidiosus, a small anthrocorid bug that is sensitive to dietary neonicotinoids, as a bioindicator of the exudates' toxicity. Nectar from directly sprayed clover blooms contained 5493 ng/g to 6588 ng/g imidacloprid or 2882 ng/g to 2992 ng/g clothianidin and was acutely toxic to Orius. Residues were 99.4% to 99.8% lower in nectar of blooms formed after mowing, and nontoxic to Orius. Imidacloprid residues in turfgrass guttation averaged 88 ng/g at 1 wk after treatment, causing some intoxication of Orius, but declined to 23 ng/g within 3 wk. Systemic transference of neonicotinoids into white clover nectar and creeping bentgrass guttation appears relatively low and transitory. The hazard to nontarget insects via nectar of flowering weeds in treated lawns can be mitigated by adhering to label precautions and mowing to remove blooms if they are inadvertently sprayed. © 2014 SETAC.

Metal uptake by native plants and revegetation potential of mining sulfide-rich waste-dumps.

Science.gov (United States)

Gomes, Patrícia; Valente, Teresa; Pamplona, Jorge; Braga, Maria Amália Sequeira; Pissarra, José; Gil, José António Grande; de la Torre, Maria Luisa

2014-01-01

Waste dumps resulting from metal exploitation create serious environmental damage, providing soil and water degradation over long distances. Phytostabilization can be used to remediate these mining sites. The present study aims to evaluate the behavior of selected plant species (Erica arborea, Ulex europaeus, Agrostis delicatula, and Cytisus multiflorus) that grow spontaneously in three sulfide-rich waste-dumps (Lapa Grande, Cerdeirinha, and Penedono, Portugal). These sites represent different geological, climatic and floristic settings. The results indicate distinctive levels and types of metal contamination: Penedono presents highest sulfate and metal contents, especially As, with low levels of Fe. In contrast, at Lapa Grande and Cerdeirinha Fe, Mn, and Zn are the dominant metals. In accordance, each waste dump develops a typical plant community, providing a specific vegetation inventory. At Penedono, Agrostis delicatula accumulates As, Pb, Cu, Mn, and Zn, showing higher bioaccumulation factors (BF) for Mn (32.1) and As (24.4). At Cerdeirinha, Ulex europaeus has the highest BF for Pb (984), while at Lapa Grande, Erica arborea presents high BF for Mn (9.8) and Pb (8.1). Regarding TF, low values were obtained for most of the metals, especially As (TF < 1). Therefore, the results obtained from representative plant species suggest appropriate behavior for phytostabilization measures.

Effect of dilution and L-malic acid addition on bio-hydrogen production with Rhodopseudomonas palustris from effluent of an acidogenic anaerobic reactor

Energy Technology Data Exchange (ETDEWEB)

Azbar, N.; Tuba, F.; Dokgoz, C. [Bioengineering Dept., Faculty of Engineering, Ege Univ., Izmir (Turkey)], E-mail: nuri.azbar@ege.edu.tr

2009-07-01

In this study, H{sub 2} was produced in a two-stage biological process: I) first stage; the dark fermentation of cheese whey wastewater, which is rich in lactose, by mixed anaerobic culture grown at thermophilic temperature in a continuously running fermentor and ii) second stage; the photo-fermentation of the residual medium by R. palustris strain (DSM 127) at 31{sup o}C under illumination of 150 W in batch mode, respectively. In the first part of the study, the effluent from the dark fermentation reactor was used either as it is (no dilution) or after dilution with distilled water at varying ratios such as 1/2 , 1/5, 1/10 (1 volume effluent/5 volume distilled water) before used in photo-fermentation experiments. In the second part of the study, L-malic acid at varying amounts was added into the hydrogen production medium in order to have L-malic acid concentrations ranging from 0 to 4 g/l. Non-diluted and pre-diluted mediums with or without L-malic acid addition were also tested for comparison purpose (as controls). Prior to the hydrogen production experiments, all samples were subjected to pH adjustment, (pH 6.7) and sterilized by autoclave at 121{sup o}C for 15 min. In regards to the experiments in which the effect of dilution of the effluent from dark fermentation was studied, it was observed that dilution of the effluent from dark fermentation resulted in much better hydrogen productions. Among the dilution rates used, the experiments operated with 1/5 dilution ratio produced the best hydrogen production (241 ml H{sub 2}/ g COD{sub fed}). On the other hand, it was seen that the mixing the effluent with L-malic acid (0 - 4 g/l) at increasing ratios (studied from 0% L-malic acid up to 100% by volume in the mixture) had further positive effect and improved the hydrogen production. The bioreactors containing only L-malic acid media resulted in the best hydrogen production (438 ml H{sub 2} / g COD{sub fed}). It was found that, undiluted raw cheese whey wastewater

Atlantis FLEX (BAY 22010 H – a new herbicide in cereals with efficacy against grasses

Directory of Open Access Journals (Sweden)

Kerlen, Dirk

2014-02-01

Full Text Available Atlantis FLEX (Mesosulfuron-methyl; Propoxycarbazone-sodium; Mefenpyr-diethyl is a new cereal herbicide to control blackgrass (Alopecurus myosuroides, ryegrass (Lolium spec., brome grass (Bromus spec., wild oat (Avena fatua, loose silky-bentgrass (Apera spica-venti L, annual meadow-grass (Poa annua L. and dicot weeds. Atlantis FLEX can be used in winter wheat, winter triticale, winter rye, winter durum wheat and spelt. The publication is based on efficacy trials from two years of spring application with Atlantis FLEX. It will be shown, that Atlantis FLEX generates a good to excellent efficacy against grass-weeds.

Methylocella silvestris sp. nov., a novel methanotroph isolated from an acidic forest cambisol.

Science.gov (United States)

Dunfield, Peter F; Khmelenina, Valentina N; Suzina, Natalia E; Trotsenko, Yuri A; Dedysh, Svetlana N

2003-09-01

Two strains of Gram-negative, aerobic, non-pigmented, non-motile, rod-shaped, methane-oxidizing bacteria were isolated from an acidic forest cambisol near Marburg, Germany, and were designated as strains BL2(T) and A1. These bacteria were morphologically and phenotypically similar to Methylocella palustris K(T). The cells possess a highly specific bipolar appearance. They lack the intracytoplasmic membranes common to all methane-oxidizing bacteria except Methylocella, but contain a vesicular membrane system connected to the cytoplasmic membrane. A soluble methane monooxygenase was present, but no particulate methane monooxygenase could be detected. These bacteria utilize the serine pathway for carbon assimilation. Strains BL2(T) and A1 are moderately acidophilic, mesophilic organisms capable of growth at pH values between 4.5 and 7 (with an optimum at pH 5.5) and at temperatures between 4 and 30 degrees C. Compared with Methylocella palustris K(T), these strains have greater tolerance of cold temperatures, dissolved salts and methanol. On the basis of 16S rRNA gene sequence identity, of species with validly published names, strain BL2(T) is most closely related to Methylocella palustris K(T) (97.3 % identity), Beijerinckia indica subsp. indica ATCC 9039(T) (97.1 %) and Methylocapsa acidiphila B2(T) (96.2 %). The DNA G+C content is 60 mol% and the major phospholipid fatty acid is 18 : 1omega7. Strain BL2(T) showed only 21-22 % DNA-DNA hybridization with Methylocella palustris K(T). The data therefore suggest that strains BL2(T) and A1 represent a novel species of Methylocella; the name Methylocella silvestris sp. nov. is proposed, with strain BL2(T) (=DSM 15510(T)=NCIMB 13906(T)) as the type strain.

Morphological and molecular data confirm the transfer of homostylous species in the typically distylous genus Galianthe (Rubiaceae), and the description of the new species Galianthe vasquezii from Peru and Colombia.

Science.gov (United States)

Florentín, Javier Elias; Cabaña Fader, Andrea Alejandra; Salas, Roberto Manuel; Janssens, Steven; Dessein, Steven; Cabral, Elsa Leonor

2017-01-01

Galianthe (Rubiaceae) is a neotropical genus comprising 50 species divided into two subgenera, Galianthe subgen. Galianthe, with 39 species and Galianthe subgen. Ebelia , with 11 species. The diagnostic features of the genus are: usually erect habit with xylopodium, distylous flowers arranged in lax thyrsoid inflorescences, bifid stigmas, 2-carpellate and longitudinally dehiscent fruits, with dehiscent valves or indehiscent mericarps, plump seeds or complanate with a wing-like strophiole, and pollen with double reticulum, rarely with a simple reticulum. This study focused on two species that were originally described under Diodia due to the occurrence of fruits indehiscent mericarps: Diodia palustris and D. spicata . In the present study, classical taxonomy is combined with molecular analyses. As a result, we propose that both Diodia species belong to Galianthe subgen. Ebelia . The molecular position within Galianthe , based on ITS and ETS sequences, has been supported by the following morphological characters: thyrsoid, spiciform or cymoidal inflorescences, bifid stigmas, pollen grains with a double reticulum, and indehiscent mericarps. However, both species, unlike the remainder of the genus Galianthe , have homostylous flowers, so the presence of this type of flower significantly modifies the generic concept. In this framework, a third homostylous species, Galianthe vasquezii , from the Andean region is also described. Until now, this species remained cryptic under specimens of Galianthe palustris It differs however from the latter by having longer calyx lobes, the presence of dispersed trichomes inside the corolla lobes (vs. glabrous), fruits that are acropetally dehiscent (vs. basipetally dehiscent), and its Andean geographical distribution (vs. Paranaense). Additionally, a lectotype has been chosen for Diodia palustris , Borreria pterophora has been placed under synonymy of Galianthe palustris , and Galianthe boliviana is reported for the first time from Peru

AFM imaging of bacteria in liquid media immobilized on gelatin coated mica surfaces

Energy Technology Data Exchange (ETDEWEB)

Doktycz, M.J.; Sullivan, C.J.; Hoyt, P.R.; Pelletier, D.A.; Wu, S.; Allison, D.P

2003-10-15

Immobilization of particulates, especially biomolecules and cells, onto surfaces is critical for imaging with the atomic force microscope (AFM). In this paper, gelatin coated mica surfaces are shown to be suitable for immobilizing and imaging both gram positive, Staphylococcus aureus, and gram negative, Escherichia coli, bacteria in both air and liquid environments. Gelatin coated surfaces are shown to be superior to poly-L-lysine coated surfaces that are commonly used for the immobilization of cells. This cell immobilization technique is being developed primarily for live cell imaging of Rhodopseudomonas palustris. The genome of R. palustris has been sequenced and the organism is the target of intensive studies aimed at understanding genome function. Images of R. palustris grown both aerobically and anaerobically in liquid media are presented. Images in liquid media show the bacteria is rod shaped and smooth while images in air show marked irregularity and folding of the surface. Significant differences in the vertical dimension are also apparent with the height of the bacteria in liquid being substantially greater than images taken in air. In air immobilized bacterial flagella are clearly seen while in liquid this structure is not visible. Additionally, significant morphological differences are observed that depend on the method of bacterial growth.

Towards understanding the biological function of hopanoids (Invited)

Science.gov (United States)

Doughty, D. M.; Hunter, R.; Summons, R. E.; Newman, D. K.

2010-12-01

Rhodopseudomonas palustris TIE-1 expresses bacterial hopanoid lipids that are structurally similar and evolutionarily related to eukaryotic sterols. The genome of R. palustris TIE-1 contains two copies of the hpnN gene (hpnN1 and hpnN2) that are orthologs of genes encoding eukaryotic sterol and lipid transporters. Hopanoid localization to the outer membrane was found to be dependent upon hpnN1. Since the cell cycle of R. palustris TIE-1 is obligately bimodal with each cell division resulting in the generation of one mother and one swarmer cell, evidence was obtained that hopanoids where specifically localized to the outer membrane of mother cells. The sequestration of hopanoids to the mother cells was also disrupted by the deletion of the hpnN1 gene. Mutants lacking the hopanoid transporters were able to grow normally at 30 °C but showed decreased growth at 38 °C. The hopanoid transporter mutant formed cellular filaments when grown at elevated temperature. Because sedimentary steranes and hopanes comprise some of the earliest evidence for the emergence of distinct bacteria and eukaryotic phyla, a better appreciation of the function of hopanoids will improve our ability to interpret the evolution of life on Earth.

Screening of 18 species for digestate phytodepuration.

Science.gov (United States)

Pavan, Francesca; Breschigliaro, Simone; Borin, Maurizio

2015-02-01

This experiment assesses the aptitude of 18 species in treating the digestate liquid fraction (DLF) in a floating wetland treatment system. The pilot system was created in NE Italy in 2010 and consists of a surface-flow system with 180 floating elements (Tech-IA®) vegetated with ten halophytes and eight other wetland species. The species were transplanted in July 2011 in basins filled with different proportions of DLF/water (DLF/w); periodic increasing of the DLF/w ratio was imposed after transplanting, reaching the worst conditions for plants in summer 2012 (highest EC value 7.3 mS cm/L and NH4-N content 225 mg/L). It emerged that only Cynodon dactylon, Typha latifolia, Elytrigia atherica, Halimione portulacoides, Salicornia fruticosa, Artemisia caerulescens, Spartina maritima and Puccinellia palustris were able to survive under the system conditions. Halophytes showed higher dry matter production than other plants. The best root development (up to 40-cm depth) was recorded for Calamagrostis epigejos, Phragmites australis, T. latifolia and Juncus maritimus. The highest nitrogen (10-15 g/m(2)) and phosphorus (1-4 g/m(2)) uptakes were obtained with P. palustris, Iris pseudacorus and Aster tripolium. In conclusion, two halophytes, P. palustris and E. atherica, present the highest potential to be used to treat DLF in floating wetlands.

Post Gliphosate treatments establishment of some grasses

OpenAIRE

Ioan ROTAR; Mariana RUSU; Fl. PRICA

1997-01-01

The sward dominated by Festuca rubra/Agrostis tenuis was treated to reduce the Nardus component and others weed by spraying with Gliphosate. Treatments were applied in the autumn of 1993. In the spring of 1994 a mixture of Phleum pratense, Fesuca rubra, Dactylis glomerata, Trifolium repens and Lotus corniculatus was oversown. Establishment of each species and botanical composition of the pasture were measured over the next three years. Nardus and weed was largely replaced by Phleum/Festuca mi...

ORF Alignment: NC_005296 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available clase ... (GGDEF) [Rhodopseudomonas palustris CGA009] ... Length = 124 ... Query: 353 PDILWHETYACGEPTIDAQHRELFDLANVILGPEI...EMLEPARLSELVELLLTRVAEHFQY 412 ... PDILWHETYACGEPTIDAQHRELFDLANVILGPEI...EMLEPARLSELVELLLTRVAEHFQY Sbjct: 1 ... PDILWHETYACGEPTIDAQHRELFDLANVILGPEIEMLEPARLSELVELLLTRVAEHFQY 60 ... Query: 473 DRRF 476 ... DRRF Sbjct: 121 DRRF 124

ORF Alignment: NC_005296 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_005296 gi|39936477 >1kmoA 7 661 92 753 2e-72 ... emb|CAE28855.1| putative hydroxamate-type ferris... ... putative hydroxamate-type ferrisiderophore receptor ... [Rhodopseudomonas palustris CGA009] ...

Bioregional Planning in Central Georgia, USA

National Research Council Canada - National Science Library

Dale, Virginia; Aldridge, Matthew; Arthur, Taryn; Baskaran, Latha; Berry, Michael; Chang, Michael; Efroymson, Rebecca; Garten, Chuck; Stewart, Catherine; Washington-Allen, Robert

2005-01-01

...% of the native longleaf pine (Pinus palustris) forest remains intact. Besides the loss of species, habitats, and ecosystem services associated with longleaf pine forests, the environmental concerns of the region include air, water, and noise pollution...

ORF Alignment: NC_005296 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_005296 gi|39933534 >1rkd0 3 296 29 346 6e-36 ... emb|CAE25901.1| possible cabohydr...ate kinases [Rhodopseudomonas palustris CGA009] ... ref|NP_945810.1| possible cabohydrate kinases ...

ORF Alignment: NC_005296 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_005296 gi|39933548 >1v7zA 10 254 14 256 2e-44 ... emb|CAE25915.1| putative creatin...e amidohydrolase [Rhodopseudomonas palustris ... CGA009] ref|NP_945824.1| putative creatine ...

Formalized classification of European fen vegetation at the alliance level

DEFF Research Database (Denmark)

Peterka, Tomáš; Hájek, Michal; Jiroušek, Martin

2017-01-01

Aims Phytosociological classification of fen vegetation (Scheuchzerio palustris-Caricetea fuscae class) differs among European countries. Here we propose a unified vegetation classification of European fens at the alliance level, provide unequivocal assignment rules for individual vegetation plot...

Comparison Of Cd2+ Biosorption And Bioaccumulation By Bacteria – A Radiometric Study

Directory of Open Access Journals (Sweden)

Machalová Linda

2015-12-01

Full Text Available In this work, bioaccumulation and biosorption characteristics of Cd2+ ions by both dead and living non-growing biomass of gram-positive bacteria Kocuria palustris and Micrococcus luteus isolated from spent nuclear fuel pools were compared. The radioindicator method with radionuclide 109Cd was used to obtain precise and reliable data characterizing Cd compartmentalization in bacterial cells. The following cellular distribution of Cd in living non-growing biomass after 4 h incubation in solutions containing different concentration of Cd2+ ions (100, 250, 500, 750 and 1000 µmol/L spiked with 109CdCl2 under aeration at 30 °C were obtained: in M. luteus almost 85 % of Cd was localized on the cell surface and 15 % in cytoplasm. Similarly, in K. palustris 83 % of Cd was localized on the cell surface and 17 % in cytoplasm. The data were obtained by gamma spectrometry of extracts and solids after sequential extraction of biomass with 5 mM Ca(NO32 and 20 mM EDTA. Biosorption of Cd by non-living bacterial biomass is a rapid process strongly affected by solution pH and as was confirmed by FTIR analysis beside carboxylate ions also other functional groups such as amino and phosphate contribute to Cd binding by bacterial cell surfaces. Maximum sorption capacities Qmax (μmol/g calculated from the Langmuir isotherm were 444 ± 15 μmol/g for M. luteus and 381 ± 1 μmol/g for K. palustris.

Variation in manuka oil lure efficacy for capturing Xyleborus glabratus (Coleoptera: Curculionidae: Scholytinae), and Cubeb oil as an alternative attractant

Science.gov (United States)

James Hanula; Brian Sullivan; David Wakarchuk

2013-01-01

Redbay ambrosia beetle, Xyleborus glabratus Eichoff, is an exotic species to North America vectoring a deadly vascular wilt disease of redbay [Persea borbonia (L.) Spreng], swampbay [P. palustris (Raf.) Sarg.], avocado (P. americana Mill.), and sassafras [Sassafras albidum (...

ORF Alignment: NC_002678 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_002678 gi|13471241 >1u07A 13 88 186 259 1e-09 ... emb|CAE28917.1| possible energy ...transducer TonB [Rhodopseudomonas palustris ... CGA009] ref|NP_948814.1| possible energy transducer ...

ORF Alignment: NC_005296 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_005296 gi|39936538 >1u07A 13 88 186 259 1e-09 ... emb|CAE28917.1| possible energy ...transducer TonB [Rhodopseudomonas palustris CGA009] ... ref|NP_948814.1| possible energy transducer T

Soil Fungi Respond More Strongly Than Fine Roots to Elevated CO2 in a Model Regenerating Longleaf Pine-Wiregrass Ecosystem

Science.gov (United States)

Increasing atmospheric CO2 will have significant effects on belowground processes which will affect forest structure and function. A model regenerating longleaf pine-wiregrass community [consisting of longleaf pine (Pinus palustris), wiregrass (Aristida stricta), sand post oak (Quescus margaretta),...

ORF Alignment: NC_002939 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_002939 gi|39995137 >1u07A 13 88 186 259 1e-09 ... emb|CAE28917.1| possible energy ...transducer TonB [Rhodopseudomonas palustris CGA009] ... ref|NP_948814.1| possible energy transducer T

ORF Alignment: NC_004463 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_004463 gi|27379019 >1u07A 13 88 186 259 1e-09 ... emb|CAE28917.1| possible energy ...transducer TonB [Rhodopseudomonas palustris CGA009] ... ref|NP_948814.1| possible energy transducer T

Appendix 1

African Journals Online (AJOL)

Blyth's Reed Warbler x Marsh Warbler hybrid Acrocephalus dumetorum x A. palustris ............1. Number of .... in May 2009 when the finding date was given as “in December. 2005” ...... worn, brown wing feathers would not be replaced until the ...

Ecosystem carbon density and allocation across a chronosequence of longleaf pine forests

Science.gov (United States)

Lisa J. Samuelson; Thomas A. Stokes; John R. Butnor; Kurt H. Johnsen; Carlos A. Gonzalez-Benecke; Timothy A. Martin; Wendell P. Cropper; Pete H. Anderson; Michael R. Ramirez; John C. Lewis

2017-01-01

Forests can partially offset greenhouse gas emissions and contribute to climate change mitigation, mainly through increases in live biomass. We quantified carbon (C) density in 20 managed longleaf pine (Pinus palustris Mill.) forests ranging in age from 5...

Typhaceae

NARCIS (Netherlands)

Backer, C.A.

1948-01-01

Perennial, palustrial or aquatic herbs with a creeping rhizome; stems erect, solid, submerged at the base. Leaves biseriate, partly radical or subradical, partly cauline, lower congested, higher remote, elongate-linear, rather thick and spongy, bluntmargined; their sheathing bases excreting slime on

WATER-USE ALONG A HYDROLOGICAL GRADIENT IN CENTRAL FLORIDA: A TALE OF TWO PINUS SPECIES

Science.gov (United States)

Although central Florida is relatively flat, the distribution of species on the landscape is controlled by subtle changes in elevation. Along a four-meter elevation gradient, xeric sandhill vegetation dominated by Pinus palustris (Longleaf pine) gives way to mesic pine flatwoods...

ORF Alignment: NC_005296 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_005296 gi|39935198 >1u07A 9 88 204 283 1e-12 ... emb|CAE27570.1| possible energy t...ransducer TonB, C-terminal region ... [Rhodopseudomonas palustris CGA009] ref|NP_947474.1| ... possible energy

ORF Alignment: NC_002939 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_002939 gi|39996799 >1u07A 9 88 204 283 1e-12 ... emb|CAE27570.1| possible energy t...ransducer TonB, C-terminal region ... [Rhodopseudomonas palustris CGA009] ref|NP_947474.1| ... possible energy

Feasibility Report and Environmental Impact Statement for Navigation Improvements at Bayou La Batre, Alabama

Science.gov (United States)

1988-09-12

and plant corn. When coastal Alabama was opened to British and American settlers; fishing, livestock and, later, resort hotels became the important...bay (Magnolia virginiana), swamp bay ( Persea palustris), water oak (Quercus nigra), and sweet gum (Liquidambar styraciflua). Bald cypress (Taxodium

Potencialidades do Pinus pinaster e Cytisus multiflorus na fitoestabilização de escombreiras na mina de ouro de Santo António (Penedono Potencialities of Pinus pinaster and Cytisus multiflorus on the phytostabilization of the Santo António (Penedono gold mine dumps

Directory of Open Access Journals (Sweden)

M.M. Abreu

2007-07-01

Full Text Available A mina de Santo António, localizada a cerca de 10 km ao norte de Penedono (Viseu, foi um importante centro mineiro, tendo-se aí principalmente explorado o ouro e outros elementos químicos, como o arsénio. Actualmente, todo o complexo mineiro está abandonado e bastante degradado. As escombreiras, cortadas por dois barrancos de grande dimensão, estão sujeitas a intensa erosão eólica e hídrica. Estas apresentam teores totais elevados para vários elementos, dos quais se destacam As, Pb, Cd e Au que atingem, respectivamente, 40 000, 653, 14 e 9,8 mg kg-1 . Estudou-se na área mineira, e em particular na envolvente das escombreiras, os solos e as plantas aí desenvolvidas (Pinus pinaster, Quercus pyrenaica, Castanea sativa, Cytisus multiflorus e uma gramínea do género Agrostis. As águas de drenagem da escombreira não vegetalizada apresentavam valores de pH de 2,58 e teores de As e Cd respectivamente de 160 e 0,05 mg/L. As águas recolhidas a jusante de escombreiras vegetalizadas com pinheiros e giestas, mostraram um decréscimo drástico de todos os elementos, em especial do As que ocorria com valores ambientalmente aceitáveis (The Santo António mine is located 10 km north of Penedono (Viseu, Portugal. This mine was in the first half of the twenty’s century an important gold and arsenic mining centre. Nowadays the mining complex is abandoned and presents high level of physical degradation. The waste dumps crossed by two large gullies are under strong water and wind erosion. The total concentrations of As, Pb, Cd e Au, in the dump material reached values as high as 40 000, 653, 14 and 9,8 mg kg-1, respectively. Soils and native plants as Pinus pinaster, Quercus pyrenaica, Castanea sativa, Cytisus multiflorus and gramineous plants (gen. Agrostis from the mining area and the waste dumps surroundings were collect and analysed. The draining waters from a no vegetated dump presented a pH value of 2.58, and As and Cd concentrations of 160

Evaluation of Fungal Deterioration in Liquidambar orientalis Mill. heartwood by FT-IR and light microscopy.

Science.gov (United States)

Nural Yilgor; Dilek Dogu; Roderquita Moore; Evren Terzi; S. Nami Kartal

2013-01-01

The chemical and morphological changes in heartwood specimens of Liquidambar orientalis Mill. caused by the white-rot fungus Trametes versicolor and the brown-rot fungi Tyromyces palustris and Gloeophyllum trabeum were studied by wet chemistry, FT-IR, GC-MS analyses, and photo-...

Disturbance from southern pine beetle, suppression, and wildfire affects vegetation composition in central Louisiana: a case study

Science.gov (United States)

T.W. Coleman; Alton Martin; J.R. Meeker

2010-01-01

We assessed plant composition and forest succession following tree mortality from infestation of southern pine beetle (Dendroctonus frontalis), associated suppression, and wildfire in two forest types, pine (Pinus spp.) with mixed hardwood and longleaf pine (P. palustris). In this case study, vegetation was...

Red-cockaded woodpecker nestling provisioning and reproduction in two different pine habitats

Science.gov (United States)

Richard R. Schaefer; Richard N. Conner; D. Craig Rudolph; Daniel Saenz

2004-01-01

We obtained nestling provisioning and rcpntductive data from 24 Red-cockaded Woodpecker (Picoides borealis) groups occupying two different pine habitats-longleaf pine (Pinus palustris) and a mixture of loblolly (P. taeda) and shortleaf pine (P. echinata)--in eastern Texas during 1990 and 1901....

ESTUDIOS CROMOSÓMICOS EN ARACHIS (LEGUMINOSAE

Directory of Open Access Journals (Sweden)

Graciela Inés Lavia

1996-01-01

Full Text Available Se presenta el número de cromosomas de 38 accesiones que representan 17 especies de cinco secciones del género Arachis. El primer conteo cromosómico informa de las siguientes ocho especies: Sect. Extranervosae: A.retusa, secc. Heteranthae: A. Giacomettii, secc. Procumbentes: A.vallsii, secc. Arachis: A.decora, A.microsperma, A.palustris, A.rinitensis y A.williamsii. En informes anteriores son confirmadas nueve especies. Todas las especies estudiadas tienen 2n = 2x = 20, con excepción de una adhesión de A.palustris, que tiene 2n = 2x = 18, que representa probablemente un nuevo número básico x = 9 para el género. Cromosomas satélites se analizan para la mayoría de las especies. "A" cromosomas se encuentran sólo en A.microsperma y A.trinitensis (Sect. Arachis

Eficiência de um composto de iodo orgânico contra fungos apodrecedores de madeiras e térmitas

Directory of Open Access Journals (Sweden)

Alexandre da Costa Florian

2003-01-01

Full Text Available The effectiveness of a low toxicity organic compound as fungicide and insecticide was studied by a accelerated laboratory bioassay according to the japanese standard. The compound was evaluated at concentrations of 0,5, 0,75 and 1,0% using ethanol as solvent. The subterraneous termites Coptotermes formosanus Shiraki and the decay fungi Coriolus versicolor (white rot and Tyromyces palustris (brown rot were used in the trials to evaluate the insecticide and fungicide action respectively. The wood specimens with dimensions of 40 x 20 x 5mm were treated by surface coating (brushing method at a rate of 110±10g/m2. The percentage weight loss of the wood blocks and the termite mortality (insecticide action and the weight loss of the wood blocks before and after the fungi attack (fungicide action were determined. The efficiency of the formulations were evaluated according to the Value of Efficiency. Results showed that the compound was of little or no efficient as insecticide against Coptotermes formosanus in the three concentrations analysed. The compound showed a good performance as fungicide against Coriolus versicolor and Tyromyces palustris with a Value of Efficiency higher than 90 in the three concentrations analysed. The best results were obtained with the product at 1,0% concentration in the treated and unleached wood specimens. Tyromyces palustris caused a larger damage in the wood blocks than Coriolus versicolor. The product showed a low capacity of fixation in the wood; therefore, it is not indicated for treating wood that will be in direct contact with the soil or under outdoor conditions.

Epigeic spiders of the pastures of northern Wielkopolska

Directory of Open Access Journals (Sweden)

Woźny, Marek

2000-10-01

Full Text Available The fauna of epigeic spiders (Araneae occurring on three different types of pastures in northern Wielkopolska was analysed. Studies were conducted from May 1992 to October 1993. The 18,995 specimens collected were classified as belonging to 137 species and 17 families. The family Linyphiidae proved the richest in species while Lycosidae was the most abundantly in terms of number of specimens. Zoocenological analysis of spider communities showed their differentiation testifying to differences in the sites studied. The dominants were: 1 Osowo Stare (Site 1: Pardosa palustris, 2 Sycyn Dolny (Site 2: Xerolycosa miniata, P. palustris, Xysticus kochi, 3 Braczewo (Site 3: Erigone dentipalpis, P. palustris. Seasonal changes of dominance of the species at each site were established. A comparison of changes of the species’ dominances in the years 1992 and 1993 disclosed similar values of the individual dominance coefficient at the sites in Osowo Stare and Braczewo. This result indicates the occurrence of the process of stabilization of these biocenoses and a tendency to equilibrium in the environment. The least stable proved to be the site at Sycyn Dolny. Analysis of the seasonal dynamics of epigeic spider communities was also made by determining the mean number of species at each site in the two years of study. The highest number of species was noted in spring. It is interesting to note the appearance of species which are rare or very rare in Poland such as: Lepthyphantes insignis, Ostearius melanopygius, Enoplognatha mordax and Enoplognatha oelandica.

Environmental Impact Study of the Northern Section of the Upper Mississippi River, St. Croix River Pool.

Science.gov (United States)

1973-11-01

Poa palustris Fowl meadow-grass P Poa pratensis Blue grass Setaria viridis Green foxtail P P P P D Setaria sp. Bristly foxtail P Spartina pectinata...Juneberry) Crataegus spp. (Thorn-Apple) Fragaria vesca (Wild Strawberry) Geum canadense (White Avens) Geum laciniatum (Avens) Geum triflorum (Three

Preliminary Feasibility Report (Stage 2), Review of Reports on Lorain Harbor, Ohio. Volume 2. Appendices. Revision

Science.gov (United States)

1981-05-01

casts for iron ore within the GL/SLS region. A recent downturn in the economic health of the domestic steel industry has probably deferred any major...emergents: Swamp rose mallow Hibiscus palustris Nettle Urtica sp. Nightshade Solanum dulcamara Hedge bindweed Convolvulus sepium Peppermint Mentha arvensis

Fungicide sensitivity in the wild rice pathogen Bipolaris oryzae

Science.gov (United States)

In recent years the occurrence of fungal brown spot, caused by Bipolaris oryzae has increased in cultivated wild rice (Zizania palustris) paddies in spite of the use of fungicides. To implement an efficient integrated disease management system, we are exploring whether field isolates have developed ...

First report of laurel wilt, caused by Raffaelea lauricola, on sassafras (Sassafras albidum) in Alabama

Science.gov (United States)

C.A. Bates; Stephen Fraedrich; T.C. Harrington; R.S. Cameron; R.D. Menard; Susan Best

2013-01-01

Laurel wilt, caused by Raffaelea lauricola, a fungal symbiont of the redbay ambrosia beetle, Xyleborus glabratus, is responsible for extensive mortality of native redbays (Persea borbonia and P. Palustris) in the coastal plains of the southeastern United States. The wilt also affect the more...

Impacts of pine species, stump removal, cultivation, and fertilization on soil properties half a century after planting

Science.gov (United States)

John R. Butnor; Kurt H. Johnsen; Felipe G Sanchez; C. Dana Nelson

2012-01-01

To better understand the long-term effects of species selection and forest management practices on soil quality and soil C retention, we analyzed soil samples from an experimental planting of loblolly (Pinus taeda L.), longleaf ((Pinus palustris Mill.), and slash ((Pinus elliottii Engelm.) pines under...

Comparative serum biochemistry of captive mugger crocodiles ...

African Journals Online (AJOL)

Standard serum biochemical parameters were determined for 28 mugger crocodiles (Crocodylus palustris) using Supra-occipital plexus technique and/or Cardiocentesis technique at the Arignar Anna Zoological Park, Vandalur, Chennai, Guindy Snake Park Trust and Amaravathy Crocodile farm, Tamilnadu, India (13° 0´ N; ...

7 CFR 457.170 - Cultivated wild rice crop insurance provisions.

Science.gov (United States)

2010-01-01

... reinsured policies: Cultivated Wild Rice Crop Provisions. 1. Definitions Approved laboratory. A testing.... Cultivated Wild Rice. A member of the grass family Zizania Palustris L., adapted for growing in man-made... for the crop year. Planted acreage. In addition to the definition contained in the Basic Provisions...

The health of loblolly pine stands at Fort Benning, GA

Science.gov (United States)

Soung-Ryoul Ryu; G. Geoff Wang; Joan L. Walker

2013-01-01

Approximately two-thirds of the red-cockaded woodpecker (Picoides borealis) (RCW) groups at Fort Benning, GA, depend on loblolly pine (Pinus taeda) stands for nesting or foraging. However, loblolly pine stands are suspected to decline. Forest managers want to replace loblolly pine with longleaf pine (P. palustris...

Silvicultural treatments for converting loblolly pine to longleaf pine dominance: Effects on planted longleaf pine seedlings

Science.gov (United States)

Huifeng Hu; G.Geoff Wang; Joan L. Walker; Benjamin O. Knapp

2012-01-01

A field study was installed to test silvicultural treatments for establishing longleaf pine (Pinus palustris Mill) in loblolly pine (P. taeda L.) stands. Harvesting was used to create seven canopy treatments, four with uniformly distributed canopies at different residual basal areas [Control (16.2 m2/ha),...

Phylogeny and biogeography of North-American wild rice (Zizania L.Poaceae)

Science.gov (United States)

The wild-rice genus Zizania includes four species disjunctly distributed in eastern Asia and North America, with three species (Z. aquatica, Z. palustris, and Z. texana) in North America and one (Z. latifolia) in eastern Asia. The phylogeny and biogeography of Zizania were explored using sequences o...

From loblolly to longleaf: fifth-year results of a longleaf pine restoration study at two ecologically distinct sites

Science.gov (United States)

Benjamin O. Knapp; G. Geoff Wang; Joan L. Walker; Huifeng Hu

2015-01-01

Historical land-use and management practices in the southeastern United States have resulted in the widespread conversion of many upland sites from dominance of longleaf pine (Pinus palustris Mill.) to loblolly pine (P. taeda L.) in the time following European settlement. Given the ecological, economic, and cultural...

Journal of Biosciences | Indian Academy of Sciences

Indian Academy of Sciences (India)

Home; Journals; Journal of Biosciences. Anurag Kumar Mishra. Articles written in Journal of Biosciences. Volume 27 Issue 3 June 2002 pp 251-259 Articles. Cloning and sequencing of complete -crystallin cDNA from embryonic lens of Crocodylus palustris · Raman Agrawal Reena Chandrashekhar Anurag Kumar Mishra ...

Comparison of arthropod prey of red-cockaded woodpeckers on the boles of long-leaf and loblolly pines

Science.gov (United States)

Scott Horn; James L. Hanula

2002-01-01

Red-cockaded woodpeckers (Picoides borealis) forage on the boles of most southern pines. Woodpeckers may select trees based on arthropod availability, yet no published studies have evaluated differences in arthropod abundance on different species of pines. We used knockdown insecticides to sample arthropods on longleaf (Pinus palustris...

Chemical compositions of essential oils from two Artemisia species used in Mongolian traditional medicine

Directory of Open Access Journals (Sweden)

Javzmaa N

2018-02-01

Full Text Available Essential oils of aromatic and medicinal plants generally have a diverse range of activities because they possess many active constituents that work through a several modes of action. Artemisia, the largest genus of the family Asteraceae, has a number of effects against human and plant diseases. The main purpose of the present study was to investigate chemical compositions of essential oils of two Artemisia species, Artemisia palustris L and Artemisia sericea Weber ex Stechm from the Mongolian steppe zone using gas chromatography and gas chromatography-mass spectrometry. The essential oil of A.palustris was characterized by the presence of monoterpene hydrocarbons such as  trans-β-ocimene (59.1%, cis-β-ocimene (11.6% and myrcene (7.1%, while the oil of A.sericea was dominated by the presence of three oxygenated monoterpenoids as 1,8-cineole (25.8%, borneol (22.5% and camphor (18.8% which are used for preparation of a fragrance and medicinal products.

Arsenic distribution in a pasture area impacted by past mining activities.

Science.gov (United States)

Abad-Valle, P; Álvarez-Ayuso, E; Murciego, A; Muñoz-Centeno, L M; Alonso-Rojo, P; Villar-Alonso, P

2018-01-01

Former mine exploitations entail a serious threat to surrounding ecosystems as after closure of mining activities their unmanaged wastes can be a continuous source of toxic trace elements. Quite often these mine sites are found within agricultural farming areas, involving serious hazards as regards product (feed/food) quality. In this work a grazing land impacted by the abandoned mine exploitation of an arsenical deposit was studied so as to evaluate the fate of arsenic (As) and other trace elements and the potential risks involved. With this aim, profile soil samples (0-50cm) and pasture plant species (Agrostis truncatula, Holcus annus and Leontodon longirostris) were collected at different distances (0-100m) from the mine waste dump and analyzed for their trace element content and distribution. Likewise, plant trace element accumulation from impacted grazing soils and plant trace element translocation were assessed. The exposure of livestock grazing animals to As was also evaluated, establishing its acceptability regarding food safety and animal health. International soil guideline values for As in grazing land soils (50mgkg -1 ) resulted greatly exceeded (up to about 20-fold) in the studied mining-affected soils. Moreover, As showed a high mobilization potential under circumstances such as phosphate application or establishment of reducing conditions. Arsenic exhibited relatively high translocation factor (TF) values (up to 0.32-0.89) in pasture plant species, reaching unsafe concentrations in their above-ground tissues (up to 32.9, 16.9 and 9.0mgkg -1 in Agrostis truncatula, Leontodon longirostris and Holcus annus, respectively). Such concentrations represent an elevated risk of As transfer to the high trophic-chain levels as established by international legislation. The limited fraction of arsenite found in plant roots should play an important role in the relatively high As root-to-shoot translocation shown by these plant species. Both soil ingestion and

Addition of biochar to simulated golf greens promotes creeping bentgrass growth

Science.gov (United States)

Organic amendments such as peat moss and various composts are typically added to sand-based root zones such as golf greens to increase water and nutrient retention. However, these attributes are generally lost as these amendments decompose in a few years. Biochar is a high carbon, extremely porous ...

Early growth of planted longleaf pine seedlings in relation to light, soil moisture, and soil temperature

Science.gov (United States)

Benjamin O. Knapp; G. Geoff Wang; Joan L. Walker

2006-01-01

Drastic reductions in longleaf pine (Pinus palustris Mill.) acreage have led to an increased focus on regeneration of the longleaf pine ecosystem. Many areas require artificial regeneration for establishment, and site preparation techniques may be implemented to increase regeneration success. The objectives of this study were to determine differences...

Restoration of the Native Plant Communities in Longleaf Pine Landscapes on the Kisatchie National Forest, Louisiana

Science.gov (United States)

James D. Haywood; Alton Martin; Finis L. Harris; Michael L. Elliott-Smith

1998-01-01

In January 1993, the Kisatchie National Forest and Southern Research Station began monitoring the effects of various management practices on overstory and midstory trees, shrubs, and understory woody and herbaceous vegetation in several longleaf pine (Pinus palustris Mill.) stands. The monitoring of these stands is part of several Ecosystem...

Planning for an uncertain future: Restoration to mitigate water scarcity and sustain carbon sequestration

Science.gov (United States)

Steven T. Brantley; James M. Vose; David N. Wear; Larry Band

2018-01-01

The desired future conditions of longleaf pine (Pinus palustris) can be described by ecosystem structural characteristics as well as by the provision of ecosystem services. Although the desired structural characteristics of restored longleaf pine ecosystems have been described at length, these characteristics deserve a brief review here because...

Korte mededeling

NARCIS (Netherlands)

Rensen-Bronkhorst, R.; Spronk, J.

1983-01-01

Ludwigia palustris (L.) Elliot weer in Noord-Brabant gevonden. Geïnspireerd door leuke plantevondsten op de ijsbaan van Schijndel werd op 17 augustus 1983 door de plantenwerkgroep van de KNNV-afdeling Eindhoven een bezoek gebracht aan de Nuenense ijsbaan. Door de zeer droge zomer was het terreintje

Analyzing the complexity of cone production in longleaf pine by multiscale entropy

Science.gov (United States)

Xiongwen Chen; Qinfeng Guo; Dale G. Brockway

2016-01-01

The longleaf pine (Pinus palustris Mill.) forests are important ecosystems in the southeastern USA because of their ecological and economic value. Since European settlement, longleaf pine ecosystems have dramatically declined in extent, to the degree that they are now listed as endangered ecosystems. Its sporadic seed production, which...

Growth and mortality of pin oak and pecan reforestation in a constructed wetland: analysis with management implications

Science.gov (United States)

D.E. Henderson; P. Botch; J. Cussimanio; D. Ryan; J. Kabrick; D. Dey

2009-01-01

Pin oak (Quercus palustris Muenchh.) and pecan (Carya illinoensis (Wangenh.) K. Koch) trees were planted on reforestation plots at Four Rivers Conservation Area in west-central Missouri. The study was conducted to determine survival and growth rates of the two species under different production methods and environmental variables....

Within tree variation of lignin, extractives, and microfibril angle coupled with the theoretical and near infrared modeling of microfibril angle

Science.gov (United States)

Brian K. Via; chi L. So; Leslie H. Groom; Todd F. Shupe; michael Stine; Jan. Wikaira

2007-01-01

A theoretical model was built predicting the relationship between microfibril angle and lignin content at the Angstrom (A) level. Both theoretical and statistical examination of experimental data supports a square root transformation of lignin to predict microfibril angle. The experimental material used came from 10 longleaf pine (Pinus palustris)...

Impacts of logging and prescribed burning in longleaf pine forests managed under uneven-aged silviculture

Science.gov (United States)

Ferhat Kara; Edward Francis Loewenstein

2015-01-01

The longleaf pine (Pinus palustris Mill.) ecosystem has historically been very important in the southeastern United States due to its extensive area and high biodiversity. Successful regeneration of longleaf pine forests requires an adequate number of well distributed seedlings. Thus, mortality of longleaf pine seedlings during logging operations...

Ecological, political and social challenges of prescribed fire restoration in east Texas pineywoods ecosystems: a case study

Science.gov (United States)

Sandra Rideout; Brian P. Oswald; Michael H. Legg

2003-01-01

The effectiveness of prescribed fire restoration of forested sites in three state parks in east Texas, USA was studied. Two sites consisted of mixed shortleaf (Pinus echinata Mill.) or loblolly pine (Pinus taeda L.) and broadleaf overstoreys. The third site was a longleaf pine (Pinus palustris Mill.)/little...

Stable Transmission of Borrelia burgdorferi Sensu Stricto on the Outer Banks of North Carolina.

Science.gov (United States)

Levine, J F; Apperson, C S; Levin, M; Kelly, T R; Kakumanu, M L; Ponnusamy, L; Sutton, H; Salger, S A; Caldwell, J M; Szempruch, A J

2017-08-01

The spirochaete (Borrelia burgdorferi) associated with Lyme disease was detected in questing ticks and rodents during a period of 18 years, 1991-2009, at five locations on the Outer Banks of North Carolina. The black-legged tick (Ixodes scapularis) was collected at varied intervals between 1991 and 2009 and examined for B. burgdorferi. The white-footed mouse (Peromyscus leucopus), house mouse (Mus musculus) marsh rice rat (Oryzomys palustris), marsh rabbit (Sylvilagus palustris), eastern cottontail (Sylvilagus floridanus) and six-lined racerunner (Cnemidophorus sexlineatus) were live-trapped, and their tissues cultured to isolate spirochaetes. Borrelia burgdorferi isolates were obtained from questing adult I. scapularis and engorged I. scapularis removed from P. leucopus, O. palustris and S. floridanus. The prevalence of B. burgdorferi infection was variable at different times and sites ranging from 7 to 14% of examined questing I. scapularis. Mitochondrial (16S) rRNA gene phylogenetic analysis from 65 adult I. scapularis identified 12 haplotypes in two major clades. Nine haplotypes were associated with northern/Midwestern I. scapularis populations and three with southern I. scapularis populations. Sixteen isolates obtained from tick hosts in 2005 were confirmed to be B. burgdorferi by amplifying and sequencing of 16S rRNA and 5S-23S intergenic spacer fragments. The sequences had 98-99% identity to B. burgdorferi sensu stricto strains B31, JD1 and M11p. Taken together, these studies indicate that B. burgdorferi sensu stricto is endemic in questing I. scapularis and mammalian tick hosts on the Outer Banks of North Carolina. © 2016 Blackwell Verlag GmbH.

The social and economic drivers of the southeastern forest landscape

Science.gov (United States)

R. Kevin McIntyre; Barrett B. McCall; David N. Wear

2018-01-01

The last quarter century has witnessed an unprecedented resurgence of interest in the management of longleaf pine (Pinus palustris) forests, a phenomenon that has been coupled with increased understanding of the ecology, management, and restoration of these ecosystems. As interest in longleaf pine becomes more mainstream among landowners and the...

75 FR 31387 - Endangered and Threatened Wildlife and Plants; Designation of Critical Habitat for Mississippi...

Science.gov (United States)

2010-06-03

...-- historically forest dominated by longleaf pine (Pinus palustris) --and isolated temporary wetland breeding... frequency and duration of severe storms and droughts (McLauglin et al. 2002, p. 6074; Golladay et al. 2004, p. 504; Seager et al. 2009, p. 5043). During a period of drought from 2004 to 2007, rainfall during...

Effects of spring prescribed fire on short-term, leaf-level photosynthesis and water use efficiency in longleaf pine

Science.gov (United States)

John K. Jackson; Dylan N. Dillaway; Michael C. Tyree; Mary Anne Sword Sayer

2015-01-01

Fire is a natural and important environmental disturbance influencing the structure, function, and composition of longleaf pine (Pinus palustris Mill.) ecosystems. However, recovery of young pines to leaf scorch may involve changes in leaf physiology, which could influence leaf water-use efficiency (WUE). This work is part of a larger seasonal...

Individual tree diameter, height, and volume functions for longleaf pine

Science.gov (United States)

Carlos A. Gonzalez-Benecke; Salvador A. Gezan; Timothy A. Martin; Wendell P. Cropper; Lisa J. Samuelson; Daniel J. Leduc

2014-01-01

Currently, little information is available to estimate individual tree attributes for longleaf pine (Pinus palustris Mill.), an important tree species of the southeastern United States. The majority of available models are local, relying on stem diameter outside bark at breast height (dbh, cm) and not including stand-level parameters. We developed...

Using existing growth models to predict RCW habitat development following site preparation: pitfalls of the process and potential growth response

Science.gov (United States)

Benjamin O. Knapp; Joan L. Walker

2013-01-01

Land managers throughout the Southeast are interested in restoring the longleaf pine (Pinus palustris Mill.) ecosystem, due in part to its value as habitat for the endangered red-cockaded woodpecker (Picoides borealis). In 2003, we established a study at Camp Lejeune, NC, to determine the effects of common site preparation...

Effects of canopy treatments on early growth of planted longleaf pine seedlings and ground vegetation in North Carolina: a preliminary study

Science.gov (United States)

Huifeng Hu; Benjamin O. Knapp; G. Geoff Wang; Joan L. Walker

2013-01-01

We installed a field experiment to support the development of protocols to restore longleaf pine (Pinus palustris Mill.) to existing mature loblolly pine (P. taeda L.) stands at Camp Lejeune, NC. Seven canopy treatments included four uniform and three gap treatments. The four uniform treatments were defined by target residual basal...

Silvicultural treatments for converting loblolly pine to longleaf pine dominance: Effects on resource availability and their relationships with planted longleaf pine seedlings

Science.gov (United States)

Huifeng Hu; G.Geoff Wang; Joan L. Walker; Benjamin O. Knapp

2012-01-01

Throughout the southeastern United States, land managers are currently interested in converting loblolly pine (Pinus taeda L.) plantations to species rich longleaf pine (Pinus palustris Mill.) ecosystems. In a 3-year study on moderately well- to well-drained soils of the Lower Coastal Plain in North Carolina, we examined the...

Fire in longleaf pine stand management: an economic analysis

Science.gov (United States)

Rodney L. Busby; Donald G. Hodges

1999-01-01

A simulation analysis of the economics of using prescribed fire as a forest management tool in the management of longleaf pine (Pinus palustris Mill.) plantations was conducted. A management regime using frequent prescribed fire was compared to management regimes involving fertilization and chemical release, chemical control, and mechanical control. Determining the...

Longleaf pine site response to repeated fertilization and forest floor removal by raking and prescribed burning

Science.gov (United States)

Kim Ludovici; Robert Eaton; Stanley Zarnoch

2018-01-01

Removal of forest floor litter by pine needle raking and prescribed burning is a common practice in longleaf pine (Pinus palustris Mill.) stands on Coastal Plain sites in the Southeastern United States. Repeated removal of litter by raking and the loss of surface organic matter from controlled burns can affect the...

Seed Bank Viability in Disturbed Longleaf Pine Sites

Science.gov (United States)

Susan Cohen; Richard Braham; Felipe Sanchez

2004-01-01

Some of the most species-rich areas and highest concentrations of threatened and endangered species in the southeastern United States are found in wet savanna and flatwood longleaf pine (Pinus palustris Mill.) communities. Where intensive forestry practices have eliminated much of the natural understory of the longleaf ecosystem, the potential for...

Assessing tolerance of longleaf pine understory herbaceous plants to herbicide applications in a container nursery

Science.gov (United States)

D. Paul Jackson; Scott A. Enebak; James West; Drew Hinnant

2015-01-01

Renewed efforts in longleaf pine (Pinus palustris Mill.) ecosystem restoration has increased interest in the commercial production of understory herbaceous species. Successful establishment of understory herbaceous species is enhanced when using quality nursery-grown plants that have a better chance of survival after outplanting. Nursery growing practices have not been...

Stand conditions and tree characteristics affect quality of longleaf pine for red-cockaded woodpecker cavity trees

Science.gov (United States)

W.G. Ross; D.L. Kulhavy; R.N. Conner

1997-01-01

We measured resin flow of longleaf (Pinus palustris Mill.) pines in red-cockaded woodpecker (Picoides borealis Vieillot) clusters in the Angelina National Forest in Texas, and the Apalachicola National Forest in Florida. Sample trees were categorized as active cavity trees, inactive cavity trees and control trees. Sample trees were further...

Carbon Dynamics of Pinus palustris Ecosystems Following Drought

Directory of Open Access Journals (Sweden)

Gregory Starr

2016-04-01

Full Text Available Drought can affect forest structure and function at various spatial and temporal scales. Forest response and recovery from drought may be a result of position within landscape. Longleaf pine forests in the United States have been observed to reduce their carbon sequestration capacity during drought. We collected eddy covariance data at the ends of an edaphic longleaf pine gradient (xeric and mesic sites over seven years; two years of normal rainfall were followed by 2.5 years of drought, then 2.5 years of normal or slightly above-average rainfall. Drought played a significant role in reducing the physiological capacity of the sites and was compounded when prescribed fire occurred during the same periods. The mesic site has a 40% greater basal area then the xeric site, which accounts for its larger sequestration capacity; however, both sites show the same range of variance in fluxes over the course of the study. Following drought, both sites became carbon sinks. However, the xeric site had a longer carry-over effect and never returned to pre-drought function. Although this study encompassed seven years, we argue that longer studies with greater spatial variance must be undertaken to develop a more comprehensive understanding of forest response to changing climate.

Adiciones a las haloragaceae de Colombia: Proserpinaca palustris

Directory of Open Access Journals (Sweden)

Schmidt Mumm Udo

2000-07-01

Full Text Available Las especies colombianas de la familia Haloragaceae se han asignado a dos subfamilias y tres géneros. Según Mora-Osejo (1984, quién comparte la opinión de Schindler (1905 en incluir el género Gunnera L. en la sub familia terrestre Gunneroideae, la sub familia Haloragoideae distingue las plantas acuáticas y semiacuáticas de tallos herbáceos, raras veces subleñosos, hojas opuestas o verticiladas e inflorescencias terminales. Inicialmente se designaron dos especies del género Myriophyllum L. a esta subfamilia y poco después se señaló también el hallazgo del género Laurembergia Berg. (Mora-Osejo et al. 1988. En la actualidad, sin embargo, se ha generalizado la tendencia a considerar el género Gunnera separadamente en la familia Gunneraceae (Cronquist 1988, L. E. Mora-Osejo, como pers., con lo cual las Haloragaceae de Colombia se encuentran representadas por tres especies de los géneros Myriophyllum y Laurembergia.

Adiciones a las haloragaceae de Colombia: Proserpinaca palustris

OpenAIRE

Schmidt Mumm Udo; Posada José Andrés

2000-01-01

Las especies colombianas de la familia Haloragaceae se han asignado a dos subfamilias y tres géneros. Según Mora-Osejo (1984), quién comparte la opinión de Schindler (1905) en incluir el género Gunnera L. en la sub familia terrestre Gunneroideae, la sub familia Haloragoideae distingue las plantas acuáticas y semiacuáticas de tallos herbáceos, raras veces subleñosos, hojas opuestas o verticiladas e inflorescencias terminales. Inicialmente se designaron dos especies del género Myriophyllum L. a...

Soil microorganisms alleviate the allelochemical effects of a thyme monoterpene on the performance of an associated grass species.

Science.gov (United States)

Ehlers, Bodil K

2011-01-01

Plant allelochemicals released into the soil can significantly impact the performance of associated plant species thereby affecting their competitive ability. Soil microbes can potentially affect the interaction between plant and plant chemicals by degrading the allelochemicals. However, most often plant-plant chemical interactions are studied using filter paper bioassays examining the pair-wise interaction between a plant and a plant chemical, not taking into account the potential role of soil microorganisms. To explore if the allelopathic effects on a grass by the common thyme monoterpene "carvacrol" are affected by soil microorganisms. Seedlings of the grass Agrostis capillaris originating from 3 different thyme sites were raised in the greenhouse. Seedlings were grown under four different soil treatments in a 2*2 fully factorial experiment. The monoterpene carvacrol was either added to standard greenhouse soil or left out, and soil was either sterilized (no soil microorganisms) or not (soil microorganisms present in soil). The presence of carvacrol in the soil strongly increased mortality of Agrostis plants, and this increase was highest on sterile soil. Plant biomass was reduced on soil amended with carvacrol, but only when the soil was also sterilized. Plants originating from sites where thyme produces essential oils containing mostly carvacrol had higher survival on soil treated with that monoterpene than plants originating from a site where thyme produced different types of terpenes, suggesting an adaptive response to the locally occurring terpene. The study shows that presence of soil microorganisms can alleviate the negative effect of a common thyme monoterpene on the performance of an associated plant species, emphasizing the role of soil microbes in modulating plant-plant chemical interactions.

Soil microorganisms alleviate the allelochemical effects of a thyme monoterpene on the performance of an associated grass species.

Directory of Open Access Journals (Sweden)

Bodil K Ehlers

Full Text Available Plant allelochemicals released into the soil can significantly impact the performance of associated plant species thereby affecting their competitive ability. Soil microbes can potentially affect the interaction between plant and plant chemicals by degrading the allelochemicals. However, most often plant-plant chemical interactions are studied using filter paper bioassays examining the pair-wise interaction between a plant and a plant chemical, not taking into account the potential role of soil microorganisms.To explore if the allelopathic effects on a grass by the common thyme monoterpene "carvacrol" are affected by soil microorganisms. Seedlings of the grass Agrostis capillaris originating from 3 different thyme sites were raised in the greenhouse. Seedlings were grown under four different soil treatments in a 2*2 fully factorial experiment. The monoterpene carvacrol was either added to standard greenhouse soil or left out, and soil was either sterilized (no soil microorganisms or not (soil microorganisms present in soil. The presence of carvacrol in the soil strongly increased mortality of Agrostis plants, and this increase was highest on sterile soil. Plant biomass was reduced on soil amended with carvacrol, but only when the soil was also sterilized. Plants originating from sites where thyme produces essential oils containing mostly carvacrol had higher survival on soil treated with that monoterpene than plants originating from a site where thyme produced different types of terpenes, suggesting an adaptive response to the locally occurring terpene.The study shows that presence of soil microorganisms can alleviate the negative effect of a common thyme monoterpene on the performance of an associated plant species, emphasizing the role of soil microbes in modulating plant-plant chemical interactions.

Soil Microorganisms Alleviate the Allelochemical Effects of a Thyme Monoterpene on the Performance of an Associated Grass Species

Science.gov (United States)

Ehlers, Bodil K.

2011-01-01

Background Plant allelochemicals released into the soil can significantly impact the performance of associated plant species thereby affecting their competitive ability. Soil microbes can potentially affect the interaction between plant and plant chemicals by degrading the allelochemicals. However, most often plant-plant chemical interactions are studied using filter paper bioassays examining the pair-wise interaction between a plant and a plant chemical, not taking into account the potential role of soil microorganisms. Methodology/Principal findings To explore if the allelopathic effects on a grass by the common thyme monoterpene “carvacrol” are affected by soil microorganisms. Seedlings of the grass Agrostis capillaris originating from 3 different thyme sites were raised in the greenhouse. Seedlings were grown under four different soil treatments in a 2*2 fully factorial experiment. The monoterpene carvacrol was either added to standard greenhouse soil or left out, and soil was either sterilized (no soil microorganisms) or not (soil microorganisms present in soil). The presence of carvacrol in the soil strongly increased mortality of Agrostis plants, and this increase was highest on sterile soil. Plant biomass was reduced on soil amended with carvacrol, but only when the soil was also sterilized. Plants originating from sites where thyme produces essential oils containing mostly carvacrol had higher survival on soil treated with that monoterpene than plants originating from a site where thyme produced different types of terpenes, suggesting an adaptive response to the locally occurring terpene. Conclusions/Significance The study shows that presence of soil microorganisms can alleviate the negative effect of a common thyme monoterpene on the performance of an associated plant species, emphasizing the role of soil microbes in modulating plant-plant chemical interactions. PMID:22125596

Structure and composition of historical longleaf pine ccosystems in Mississippi, USA

Science.gov (United States)

Brice B. Hanberry; Keith Coursey; John S. Kush

2018-01-01

Longleaf pine (Pinus palustris) historically was a widespread ecosystem composed of a simple tree canopy and grasslands ground layer. After widespread loss of this ecosystem due to logging and fire exclusion, little quantitative information exists about historical structure for restoration goals. We identified composition in De Soto National Forest and Pearl River...

The influence of canopy, sky condition, and solar angle on light quality in a longleaf pine woodland

Science.gov (United States)

Stephen D. Pecot; Stephen B. Horsley; Michael A. Battaglia; Robert J. Mitchell

2005-01-01

Light transmittance estimates under open, heterogeneous woodland canopies such as those of longleaf pine (Pinus palustris Mill.) forests report high spatial and temporal variation in the quantity of the light environment. In addition, light quality, that is, the ratio of red to far-red light (R:FR), regulates important aspects of plant...

A decision tree approach using silvics to guide planning for forest restoration

Science.gov (United States)

Sharon M. Hermann; John S. Kush; John C. Gilbert

2013-01-01

We created a decision tree based on silvics of longleaf pine (Pinus palustris) and historical descriptions to develop approaches for restoration management at Horseshoe Bend National Military Park located in central Alabama. A National Park Service goal is to promote structure and composition of a forest that likely surrounded the 1814 battlefield....

Are we over-managing longleaf pine?

Science.gov (United States)

John S. Kush; Rebecca J. Barlow; John C. Gilbert

2012-01-01

Longleaf pine (Pinus palustris Mill.) is not loblolly (Pinus taeda L.) or slash pine (Pinus elliottii L.). There is the need for a paradigmatic shift in our thinking about longleaf pine. All too often we think of longleaf as an intolerant species, slow-grower, difficult to regenerate, and yet it dominated the pre...

A whole stand growth and yield system for young longleaf pine plantations in Southwest Georgia

Science.gov (United States)

John R. Brooks; Steven B. Jack

2006-01-01

A whole stand growth and yield system for planted longleaf pine (Pinus palustris Mill.) was developed from permanent plot data collected annually over an 8 year period. The dataset consists of 12 intensively-managed longleaf pine plantations that are located in Lee, Worth, Mitchell, and Baker counties in southwest Georgia. Stand survival, dominant...

Understory fuel variation at the Carolina Sandhills National Wildlife Refuge: a description of chemical and physical properties

Science.gov (United States)

Evelyn S. Wenk; G. Geoff Wang; Joan L. Walker

2013-01-01

Upland forest in the Carolina Sandhills National Wildlife Refuge is characterized by a longleaf pine (Pinus palustris) canopy with a variable understory and ground-layer species composition. The system was historically maintained by fire and has been managed with prescribed fire in recent decades. A management goal is to reduce turkey oak (...

The quest for methods to identify longleaf pine stump relicts in Southeastern Virginia

Science.gov (United States)

Thomas L. Eberhardt; Philip M. Sheridan; Chi-Leung So; Arvind A.R. Bhuta; Karen G. Reed

2015-01-01

The discovery of lightwood and turpentine stumps in southeastern Virginia raised questions about the true historical range for longleaf pine (Pinus palustris Mill.). Several investigative studies were therefore carried out to develop a method to determine the taxa of these relicts. Chemical approaches included the use of near infrared (NIR) spectroscopy coupled with...

Protecting and restoring longleaf pine forests on the Kisatchie National Forest in Louisiana

Science.gov (United States)

James D. Haywood; Michael Elliot-Smith; Finis Harris; Alton Martin

2000-01-01

Longleaf pine (Pinus palustris Mill.) forests once constituted a major ecosystem in the Southern United States stretching from southeastern Virginia south to central Florida and west into East Texas. These forests covered a wide range of site conditions, from wet pine flatwoods to dry mountain slopes. Intensive exploitation reduced the extent of old-...

Introducing close-range photogrammetry for characterizing forest understory plant diversity and surface fuel structure at fine scales

Science.gov (United States)

Benjamin C. Bright; E. Louise Loudermilk; Scott M. Pokswinski; Andrew T. Hudak; Joseph J. O' Brien

2016-01-01

Methods characterizing fine-scale fuels and plant diversity can advance understanding of plant-fire interactions across scales and help in efforts to monitor important ecosystems such as longleaf pine (Pinus palustris Mill.) forests of the southeastern United States. Here, we evaluate the utility of close-range photogrammetry for measuring fuels and plant...

Picloram Movement in Soil Solution and Streamflow from a Coastal Plain Forest

Science.gov (United States)

Jerry L. Michael; D.G. Neary; M.J.M. Wells

1989-01-01

Picloram (4-amino-3,5,6-trichloropicolinic acid) was aerially applied to P longleaf pine (Pinus palustris L.) site in the upper constnl plain of Alabama to control kudzu [Purraria lobota (Willd.) Ohwi]. Pellets (10% a.i.) were spread at the rate of 56 kg ha-1 on loamy sand Typic Knnhspludult soils....

Fertilizer responses of longleaf pine trees within a loblolly pine plantation: separating direct effects from competition effects

Science.gov (United States)

Peter H Anderson; Kurt H. Johnsen

2009-01-01

Evidence is mixed on how well longleaf pine (Pinus palustris Mill.) responds to increased soil nitrogen via fertilization. We examined growth and physiological responses of volunteer longleaf pine trees within an intensive loblolly pine (Pinus taeda L.) fertilization experiment. Fertilizer was applied annually following thinning at age 8 years (late 1992) at rates...

Financial performance of loblolly and longleaf pine plantations

Science.gov (United States)

Steven D. Mills; Charles T. Stiff

2013-01-01

The financial performance of selected management regimes for loblolly (Pinus taeda L.) and longleaf pine (P. palustris Mill.) plantations were compared for four cases, each with low- and high-site productivity levels and each evaluated using 5 and 7 percent real discount rates. In all cases, longleaf pine was considered both with...

Longleaf and loblolly pine seedlings respond differently to soil compaction, water content, and fertilization

Science.gov (United States)

D. Andrew Scott; James A. Burger

2014-01-01

Aims Longleaf pine (Pinus palustris Mill.) is being restored across the U.S. South for a multitude of ecological and economic reasons, but our understanding of longleaf pine’s response to soil physical conditions is poor. On the contrary, our understanding of loblolly pine (Pinus taeda L.) root and...

Modeling survival, yield, volume partitioning and their response to thinning for longleaf pine plantations

Science.gov (United States)

Carlos A. Gonzalez-Benecke; Salvador A. Gezan; Daniel J. Leduc; Timothy A. Martin; Wendell P. Cropper Jr; Lisa J Samuelson

2012-01-01

Longleaf pine (Pinus palustris Mill.) is an important tree species of the southeast U.S. Currently there is no comprehensive stand-level growth and yield model for the species. The model system described here estimates site index (SI) if dominant height (Hdom) and stand age are known (inversely, the model can project H

Determination of phytoextraction potential of plant species for toxic elements in soils of abandoned sulphide-mining areas

International Nuclear Information System (INIS)

Freitas, M.C.; Anawar, H.M.; Dionisio, I.; Dung, H.M.; Canha, N.; Bettencourt, A.; Capelo, S.; Henriques, F.; Pinto-Gomes, C.J.

2009-01-01

This study has determined contamination levels in soils and plants from the Sao Domingos mining area, Portugal, by k 0 -INAA. Total concentrations of As, Sb, Cr, Hg, Cu, Zn and Fe in soils were very high, exceeding the maximum limits in Portuguese legislation. Concentrations of toxic elements like As, Sb and Zn were highest in roots of Erica andevalensis, Juncus acutus, Agrostis castellana and Nicotiana glauca. Additionally, As, Br, Cr, Fe, Sb and Zn in all organs of most plants were above toxicity levels. Those species that accumulated relatively high concentrations of toxic elements in roots (and tops) may be cultivated for phytostabilisation of similar areas. (author)

What 45 years of RLGS data has to say about longleaf pine mortality - not much

Science.gov (United States)

John S. Kush; John C. Gilbert; Rebecca J. Barlow

2015-01-01

The original longleaf pine (Pinus palustris Mill.) forest was self-perpetuating where seedlings always had to be present. It reproduced itself in openings in the overstory where dense young stands developed. These openings would range from a few tenths of an acre to large openings of several thousand acres. Regardless of the event size, longleaf...

Ecological restoration of an old-growth longleaf pine stand utilizing prescribed fire

Science.gov (United States)

J. Morgan Varner; John S. Kush; Ralph S. Meldahl

2000-01-01

Ecological restoration using prescribed fire has been underway for 3 years in an uncut, old-growth longleaf pine (Pinus palustris) stand located in south Alabama. The longleaf pine ecosystem requires frequent (once every 1-10 years) surface fire to prevent succesion to later several stages. Before this study began, this stand had not burned in >...

North American Lauraceae: terpenoid emissions, relative attraction and boring preferences of redbay ambrosia beetle, Xyleborus glabratus (Coleoptera: Curculionidae: Scolytinae).

Science.gov (United States)

Paul E. Kendra; Wayne S. Montgomery; Jerome Niogret; Grechen E. Pruett; Albert (Bud) Mayfield; Martin MacKenzie; Mark A. Deyrup; Gary R. Bauchan; Randy C. Ploetz

2014-01-01

Abstract The invasive redbay ambrosia beetle, Xyleborus glabratus, is the primary vector of Raffaelea lauricola, a symbiotic fungus and the etiologic agent of laurel wilt. This lethal disease has caused severe mortality of redbay (Persea borbonia) and swampbay (P. palustris) trees in the southeastern USA, threatens avocado (P. americana) production in Florida, and has...

On the number of genes controlling the grass stage in longleaf pine

Science.gov (United States)

C. Dana Nelson; C. Weng; Thomas L. Kubisiak; M. Stine; C.L. Brown

2003-01-01

The grass stage is an inherent and distinctive developmental trait of longleaf pine (Pinus palustris), in which height growth in the first few years after germination is suppressed. In operational forestry practice the grass stage extends for nvo to several years and often plays a role in planting failures and decisions to plant alternative species....

Insect Pollinators of Three Rare Plants in a Florida Longleaf Pine Forest

Science.gov (United States)

Theresa Pitts-Singer; James L. Hanula; Joan L. Walker

2002-01-01

As a result of human activity, longleaf pine (Pinus palustris Miller) forests in the southern United States have been lost or drastically altered. Many of the plant species that historically occupied those forests now persist only as remnants and are classified as threatened or endangered. In order to safeguard such species, a better understanding of...

Longleaf Pine: An Updated Bibliography

Science.gov (United States)

John S. Kush; Ralph S. Meldahl; William D. Boyer; Charles K. McMahon

1996-01-01

The longleaf pine (Pinus palustris Mill.) forest figured prominently in the cultural and economic development of the South. What was once one of the most extensive forest ecosystems in North America has now become critically endangered (6). At the time of European settlement, this ecosystem dominated as much as 92 million acres throughout the...

Use of weathered diesel oil as a low-cost raw material for biosurfactant production

Directory of Open Access Journals (Sweden)

A. P. Mariano

2008-06-01

Full Text Available This work aimed to investigate the capability of biosurfactant production by Staphylococcus hominis, Kocuria palustris and Pseudomonas aeruginosa LBI, using weathered diesel oil from a long-standing spillage as raw material. The effect of the culture media (Robert or Bushnell-Haas and of the carbon source (spilled diesel oil or commercial diesel oil on biosurfactant production was evaluated. Erlenmeyer flasks (250 mL containing the cell broth were agitated (240 rpm for 144 h at 27±2ºC. Biosurfactant production was monitored according to the De Nöuy ring method using a Krüss K6 tensiometer. Considering the possibility of intracellular storage of biosurfactant in the cell wall of the cultures S. hominis and K. palustris, experiments were also done applying ultrasound as a way to rupture the cells. For the conditions studied, the cultures did not indicate production of biosurfactants. Results obtained with a hydrocarbon biodegradability test based on the redox indicator 2,6-dichlorophenol indophenol showed that only the commercial diesel was biodegraded by the cultures.

Competitive responses of seedlings and understory plants in longleaf pine woodlands: separating canopy influences above and below ground

Science.gov (United States)

Stephen D. Pecot; Robert J. Mitchell; Brian J. Palik; Barry Moser; J. Kevin Hiers

2007-01-01

A trenching study was used to investigate above- and below-ground competition in a longleaf pine (Pinus palustris P. Mill.) woodland. Trenched and nontrenched plots were replicated in the woodland matrix, at gap edges, and in gap centers representing a range of overstory stocking. One-half of each plot received a herbicide treatment to remove the...

Analysis of seasonal, diurnal, and noctural growth patterns of young longleaf pine

Science.gov (United States)

John C. Gilbert; Ralph S. Meldahl; John S. Kush; William D. Boyer

2006-01-01

Forty longleaf pine (Pinus palustris Mill.) trees initially ranging from 1 to 1.5 m in height were measured on the Escambia Experimental Forest from 1969 through 1980. The trees were evenly divided between two soil types. From 1969 through 1970, height and diameter measurements were recorded one to four times weekly during the growing seasons and...

Overhead shading and growth of young longleaf pine

Science.gov (United States)

John C. Gilbert; John S. Kush; Ralph S. Meldahl; William D. Boyer; Dean H. Gjerstad

2014-01-01

A study to determine the effects of environmental conditions on the growth of longleaf pine (Pinus palustris Mill.) was initiated in 1969 on the Escambia Experimental Forest near Brewton, Alabama, USA. This study sample consisted of forty young naturally regenerated, even aged longleaf pine seedlings evenly divided between two soil types. At the beginning of the study...

Spatial analysis of longleaf pine stand dynamics after 60 years of management

Science.gov (United States)

John C. Gilbert; John S. Kush; Rebecca J. Barlow

2012-01-01

There are still many questions and misconceptions about the stand dynamics of naturally-regenerated longleaf pine (Pinus palustris Mill.). Since 1948, the “Farm Forty,” a forty-acre tract located on the USDA Forest Service Escambia Experimental Forest near Brewton, Alabama, has been managed to create high quality wood products, to successfully...

Prescribed fire effects in a longleaf pine ecosystem--are winter fires working?

Science.gov (United States)

Rebecca J. Barlow; John S. Kush; John C. Gilbert; Sharon M. Hermann

2015-01-01

Longleaf pine (Pinus palustris Mill.) ecosystems once dominated 60 to 90 million acres and supported one of the most diverse floras in North America. It is well-known that longleaf pine ecosystems must burn frequently to maintain natural structure and function. This vegetation type ranks as one of the most fire-dependent in the country and must...

Chesapeake Bay Low Freshwater Inflow Study. Biota Assessment. Phase I. Appendices.

Science.gov (United States)

1980-08-01

Resources Coastal Resources Power Plant Siting Maryland Geological Survey Maryland Environmental Health Administration university of Maryland Marine...are very common: Acorus calamus Polygonum spp. Hibiscus palustris Pontederia cordata Leersia spp. Sagittaria latifolia Nuphar leiteum Typha... Hibiscus ) penetrate to mesohaline salinities. In general, the fresh water marsh associations are limited to areas upstream of 3 - 50Xsalinity

Air lateral root pruning affects longleaf pine seedling root system morphology

Science.gov (United States)

Shi-Jean Susana Sung; Dave Haywood

2016-01-01

Longleaf pine (Pinus palustris) seedlings were cultured with air lateral root pruning (side-vented containers, VT) or without (solid-walled containers, SW). Seedling root system morphology and growth were assessed before planting and 8 and 14 months after planting. Although VT seedlings had greater root collar diameter than the SW before planting,...

Site Index Curves for Direct-Seeded Loblolly and Longleaf Pines in Louisiana

Science.gov (United States)

Quang V. Cao; V. Clark Baldwin; Richard E. Lohrey

1995-01-01

Site index equations were developed for direct-seeded loblollypine (Pinus taeda L.) and longleaf pine (Pinus palustris Mill.) based on data from 148 and 75 permanent plots, respectively. These plots varied from 0.053 to 0.119 ac in size, and were established in broadcast, row, and spot seeded stands throughout Louisiana. The Bailey and Clutter (1974) model was...

Long-term effects of biennial prescribed fires on the growth of longleaf pine

Science.gov (United States)

William D. Boyer

2000-01-01

The effects of several hardwood control treatments on understory succession and overstory growth have been followed for 22 years on a Coastal Plain site in southwest Alabama. The study began in 1973, with 12 treatment combinations in 14-year-old naturally established longleaf pine (Pinus palustris) thinned to about 1,236 stems per hectare (500 stems...

Surfing the Koehler Curve: revisiting a method for the identification of longleaf pine stumps and logs

Science.gov (United States)

Thomas L. Eberhardt; Philip M. Sheridan; Karen G. Reed

2009-01-01

Measurements of pith and second growth ring diameters were used by Koehler in 1932 to separate longleaf pine (Pinus palustris Mill.) timbers from those of several southern pines (e.g., loblolly, shortleaf). In the current study, measurements were taken from plantation-grown longleaf, loblolly and shortleaf pine trees, as well as old growth longleaf pine, lightwood, and...

Revivification of a method for identifying longleaf pine timber and its application to southern pine relicts in southeastern Virginia

Science.gov (United States)

Thomas L. Eberhardt; Philip M. Sheridan; Arvind A.R. Bhuta

2011-01-01

Abstract: Longleaf pine (Pinus palustris Mill.) cannot be distinguished from the other southern pines based on wood anatomy alone. A method that involves measuring pith and second annual ring diameters, reported by Arthur Koehler in 1932 (The Southern Lumberman, 145: 36–37), was revisited as an option for identifying longleaf pine timbers and stumps. Cross-section...

Arthropod density and biomass in longleaf pines: effects of pine age and hardwood midstory

Science.gov (United States)

Richard N. Conner; Christopher S. Collins; Daniel Saenz; Toni Trees; Richard R. Schaefer; D. Craig Rudolph

2004-01-01

During a 2-year study we examined arthropod communities (density and biomass) on longleaf pines (Pinus palustris) in eastern Texas during spring, summer, and winter on trees in 3 age classes: 40-50, 60-70, and 130-1 50 years, as a potential food source for the red-cockaded woodpecker (Picoides borealis). We also examined arthropod...

Ground-dwelling arthropod association with coarse woody debris following long-term dormant season prescribed burning in the longleaf pine flatwoods of North Carolina

Science.gov (United States)

James L Hanula; Dale Wade; Joseph O' Brien; Susan Loeb

2009-01-01

A 5-year study of long-term (40 years) study plots was conducted on the Osceola National Forest in northern Florida to determine how dormant-season fire frequency (annual, biennial, quadrennial, or unburned) affects ground-dwelling macroarthropod use of coarse woody debris in longleaf pine (Pinus palustris Mill.) forests. Pitfall traps were used to sample arthropods...

Thickness and roughness measurements for air-dried longleaf pine bark

Science.gov (United States)

Thomas L. Eberhardt

2015-01-01

Bark thicknesses for longleaf pine (Pinus palustris Mill.) were investigated using disks collected from trees harvested on a 70-year-old plantation. Maximum inner bark thickness was relatively constant along the tree bole whereas maximum outer bark thickness showed a definite decrease from the base of the tree to the top. The minimum whole bark thickness followed the...

Preliminary Guide to the Onsite Identification and Delineation of the Wetlands of the South Atlantic United States.

Science.gov (United States)

1982-05-01

shield) Ceratophyilum demersum (Coontail) Myriophyllum spp. (Watermilfoil) Nelumbo lutea ( American lotus) Nuphar luteum (Spatterdock) Nymphaea odorata...Overcup oak) Quercus palustris (Pin oak) Quercus phelios (Willow oak) Ulmus americana ( American elm) UlmuS rubra (Slippery elm) c. Atlantic White...var. biflora (Swamp black gum) Persea borbonia (Red bay) Pinus serotina (Pond pine) Smilax laurifolia (Bamboo vine) Sphagnum spp. (Sphagnum moss

Regional Guidebook for Applying the Hydrogeomorphic Approach to Assessing the Functions of Headwater Slope Wetlands on the Mississippi and Alabama Coastal Plans

Science.gov (United States)

2007-08-01

sourwood Bignonia capreolata crossvine Panicum virgatum switchgrass Callicarpa americana American beautyberry Persea borbonia redbay Calystegia sepium...sweetbay (Magnolia virginiana), loblolly-bay (Gordonia lasianthus), redbay ( Persea borbonia), and swamp bay ( Persea palustris) make up a significant...com- munity model. The Society of American Foresters (Eyre 1980) recognizes a “Sweetbay- Swamp Tupelo (Nyssa sylvatica var. biflora)-Redbay” forest

Early density management of longleaf pine reduces susceptibility to ice storm damage

Science.gov (United States)

Timothy B. Harrington; Thaddeus A. Harrington

2016-01-01

The Pax winter storm of February 2014 caused widespread damage to forest stands throughout the southeastern U.S. In a long-term study of savanna plant community restoration at the Savannah River Site, Aiken, SC, precommercial thinning (PCT) of 8- to 11-year-old plantations of longleaf pine (Pinus palustris) in 1994 reduced...

Influence of herbicides and felling, fertilization, and prescribed fire on longleaf pine growth and understory vegetation through ten growing seasons and the outcome of an ensuing wildfire

Science.gov (United States)

James D. Haywood

2011-01-01

Restoring longleaf pine (Pinus palustris Mill.) over much of its original range requires artificial regeneration. In central Louisiana, USA, two fertilization levels - No (NF) or Yes (F-36 kg/ha N and 40 kg/ha P) in combination with three vegetation treatments - Check, four prescribed fires (PF), or multi-year vegetation control by herbicidal and mechanical means (IVM...

Carbon sequestration and natural longleaf pine ecosystems

Science.gov (United States)

Ralph S. Meldahl; John S. Kush

2006-01-01

A fire-maintained longleaf pine (Pinus palustris Mill.) ecosystem may offer the best option for carbon (C) sequestration among the southern pines. Longleaf is the longest living of the southern pines, and products from longleaf pine will sequester C longer than most since they are likely to be solid wood products such as structural lumber and poles....

Modeling the effects of forest management on in situ and ex situ longleaf pine forest carbon stocks

Science.gov (United States)

C.A. Gonzalez-Benecke; L.J. Samuelson; T.A. Martin; W.P. Cropper Jr; Kurt Johnsen; T.A. Stokes; John Butnor; P.H. Anderson

2015-01-01

Assessment of forest carbon storage dynamics requires a variety of techniques including simulation models. We developed a hybrid model to assess the effects of silvicultural management systems on carbon (C) budgets in longleaf pine (Pinus palustris Mill.) plantations in the southeastern U.S. To simulate in situ C pools, the model integrates a growth and yield model...

Impact of fire in two old-growth montane longleaf pine stands

Science.gov (United States)

John S. Kush; John C. Gilbert; Crystal Lupo; Na Zhou; Becky Barlow

2013-01-01

The structure of longleaf pine (Pinus palustris Mill.) forests of the Southeastern United States Coastal Plains has been the focus of numerous studies. By comparison, the forests in the mountains of Alabama and Georgia are not well understood. Less than 1 percent of longleaf pine stands found in the montane portion of longleaf’s range are considered...

Weather effects on the success of longleaf pine cone crops

Science.gov (United States)

Daniel J. Leduc; Shi-Jean Susana Sung; Dale G. Brockway; Mary Anne Sword Sayer

2016-01-01

We used National Oceanic and Atmospheric Administration weather data and historical records of cone crops from across the South to relate weather conditions to the yield of cones in 10 longleaf pine (Pinus palustris Mill.) stands. Seed development in this species occurs over a three-year time period and weather conditions during any part of this...

Final Environmental Assessment for Aircraft Maintenance Operations Center

Science.gov (United States)

2014-06-01

lies within the Southern Mixed Forest Province that is typically characterized by forests of broadleaf deciduous and needleleaf evergreen trees ...virginiana), pin oak (Q. palustris), and southern magnolia (Magnolia grandiflora). Small tree and shrub species include the eastern red cedar, eastern ...this burden estimate or any other aspect of this collection of information, including suggestions for reducing this burden, to Washington

Cavity size and copper root pruning affect production and establishment of container-grown longleaf pine seedlings

Science.gov (United States)

Marry Anne Sword Sayer; James D. Haywood; Shi-Jean Susana Sung

2009-01-01

With six container types, we tested the effects of cavity size (i.e., 60, 93, and 170 ml) and copper root pruning on the root system development of longleaf pine (Pinus palustris Mill.) seedlings grown in a greenhouse. We then evaluated root egress during a root growth potential test and assessed seedling morphology and root system development 1 year after planting in...

Root system architecture: The invisible trait in container longleaf pine seedlings

Science.gov (United States)

Shi-Jean Susana Sung; R. Kasten Dumroese

2013-01-01

Longleaf pine (Pinus palustris Mill.) seedlings cultured in four cavity volumes (60 to 336 ml [3.7 to 20.5 cubic inches]), two root pruning treatments (with or without copper coating), and 3 nitrogen levels (low to high) were grown for 29 weeks before they were outplanted into an open area in central Louisiana. Twenty-two months after outplanting, 3 seedlings were...

Effects of container cavity size and copper coating on field performance of container-grown longleaf pine seedlings

Science.gov (United States)

Shi-Jean Susana Sung; James D. Haywood; Mary A. Sword-Sayer; Kristina F. Connor; D. Andrew Scott

2010-01-01

Longleaf pine (Pinus palustris Mill.) seedlings were grown for 27 weeks in 3 container cavity sizes [small (S), medium (M), and large (L)], and half the containers were coated with copper (Cu). In November 2004, we planted 144 seedlings from each of 6 container treatments in each of 4 replications in central LA. All plots were burned in February 2006...

Distribución geográfica de Boeckella y Neoboeckella (Calanoida: Centropagidae en el Perú

Directory of Open Access Journals (Sweden)

Iris Samanez

2014-12-01

Full Text Available El análisis de muestras de plancton colectadas en diferentes localidades a lo largo de los Andes peruanos, dieron como resultado el registro de siete especies de Boeckella (gracilis, gracilipes, calcaris, poopoensis, occidentalis, titicacae y palustris y dos de Neoboeckella (kinzeli y loffleri. Todas las especies citadas, exceptuando a las especies de Neoboeckella, fueron registradas en la cuenca del lago Titicaca (Puno. Además, B. palustris, B. gracilipes y B. calcaris fueron también reportadas en Moquegua, Apurímac y Pasco (Andes del sur y central. Boeckella titicacae parece estar restringida a la cuenca del lago Titicaca. Boeckella poopoensis ocurre en cuerpos de agua con elevada conductividad reportándose sólo en Las Salinas en Arequipa. Boeckella occidentalis fue la especie con mayor rango de distribución desde el sur en Puno hasta el norte en Cajamarca y se registra por primera vez para el país Neoboeckella loffleri. Las muestras están depositadas en la Colección de Plancton del Departamento de Limnología del Museo de Historia Natural de la Universidad Nacional Mayor de San Marcos, Lima-Perú.

Distribution of zinc-65 in Agrostis tenuis Sibth. and A. stolonifera L. tissues

Energy Technology Data Exchange (ETDEWEB)

Peterson, P J

1969-11-01

The distribution of /sup 65/Zn in zinc-tolerant and copper-tolerant plants of Agrotis spp. from toxic mine-tailings in England and Wales was compared with zinc distribution in non-tolerant plants. Isotope was applied in culture solution in which the plants were growing. No differences could be demonstrated between the plants by whole-plant radioautography, or by zinc analyses of the tops. Root/shoot ratios calculated from specific activity values varied with population, the non-tolerant plants having the lowest and the zinc-tolerant plants the highest ratio. After solvent (80% ethanol and water) extractions, the root residue of zinc-tolerant plants contained a higher percentage of /sup 65/Zn than that of non-tolerant plants. Chemical fractionation of the roots revealed that the main difference was that the amount of /sup 65/Zn in the pectate extract of the cell wall was high in zinc-tolerant plants and low in non-tolerant plants. The /sup 65/Zn distribution in the copper-tolerant plants was similar to that in the non-tolerant plants, indicating that the tolerance mechanisms for the two elements are different. Soluble protein and RNA preparations were made but they contained low levels of /sup 65/Zn. An exception was the relatively high value for RNA from zinc-tolerant A. stolonifera shoots. An anionic complex of /sup 65/Zn in the soluble fraction was investigated. This complex accounted for most of the radioactivity in A. tenuis extracts of shoots but the concentration of the complex was low in A. stolonifera shoots, and in root extracts of all plants examined. 18 references, 2 figures, 4 tables.

Fire Science Strategy: Resource Conservation and Climate Change

Science.gov (United States)

2014-09-01

are southern yellow pine ( Pinus spp.; this currently includes over 0.6 million acres of managed longleaf pine [P. palustris], Robert Larimore, pers...Prosopis spp.), pinyon ( Pinus spp.)-juniper (Juniperus spp.), and chaparral-type ecosystems, and 0.7 million acres of annual and perennial grasslands...that meet current and future military land-use and stewardship objectives. Under current conditions, the presence of insects, disease, and drought

Destroyed virgin longleaf pine stand lives-on digitally

Science.gov (United States)

John C. Gilbert; S. Kush; Rebecca J. Barlow

2015-01-01

The Flomaton Natural Area (FNA) once stood as one of the few remnant fragments of virgin, old-growth longleaf pine stands (Pinus palustris Mill.) in the Southeast. This 80-acre stand contained trees over 200 years old. A restoration effort began in 1994 to remove off-site trees and to reintroduce fire to the site after over 40 years of fire suppression. A geographic...

Application of Hyperspectal Techniques to Monitoring & Management of Invasive Plant Species Infestation

Science.gov (United States)

2008-01-09

Scirpus olnei, S. robustus, Hibiscus palustris, Eryngium virginianum. 1. Common reed (Phragmites australis) - large cane or bamboo-like grass...Index 2 760 695 R R plant stress status Zarco-Tejada (1998) PI3, Pigment Index 3 690 440 R R vegetation health , based on chlorophyll fluorescence...ratios Lichtenthaler et al. (1996) PI4, Pigment Index 4 740 440 R R vegetation health , based on chlorophyll fluorescence ratios

Demonstration and Certification of Amphibian Ecological Risk Assessment Protocol

Science.gov (United States)

2009-04-01

pools observed on site persist through the breeding season and long enough for the larvae to metamorphose, suitable amphibian breeding habitat exists in...frog (R. palustris): vocalizations • Fairy shrimp (Eubranchipus sp.): dip net • Isopoda: dip net • Unknown water beetle (Coleoptera): dip net...oxygen-lacking) conditions that favor the growth and regeneration of hydrophytic vegetation)) to amphibians. This test procedure uses larvae of the

Location and Description of Transects for Ecological Studies in Floodplain Forests of the Lower Suwannee River, Florida

Science.gov (United States)

2002-01-01

Level Datum of 1929. Horizontal datum: In this report, horizontal coordinate information is referenced to the North American Datum of 1927 (NAD27...ileopa Ilex opaca Ait. var. opaca American holly junsil Juniperus silicicola (Small) Bailey 1 southern red cedar liqsty Liquidambar styraciflua L...swamp gum nyssyl Nyssa sylvatica Marsh.1 blackgum ostvir Ostrya virginiana (Mill.) K. Koch eastern hophornbeam perpal Persea palustris (Raf.) Sarg

Vegetation in the Forsmark biotest basin, 1974-1986

International Nuclear Information System (INIS)

Renstroem, S.; Svensson, Roger; Wigren-Svensson, M.

1990-05-01

Since 1980, Forsmark Power Plants has discharged large amount of cooling water into the Biotest basin. In 1974, before the dam was constructed, and 1980 to 1986, the macrophytic algae and higher vegetation inside and around the basin has been investigated. The observed changes are mainly caused by the increased water temperature causing lack of ice cover during the winter, the embankment reducing the exposition, the heavy water stream through the basin and the reduced light transmission in the water. The macroscopic vegetation in the Biotest basin was originally distributed all over the lake, but is now mainly found in more shallow water. The deepest part, a passage from the input of the cooling water to the output, totally lack vegetation. The reason for this is a combination of the heavy stream, raised temperature and reduced light transmission. The total biomass of macroscopic vegetation in the basin has been reduced from c. 70 metric ton in 1980 to c. 27 ton in 1982 and 1986. Among the most important species, the production of Chara spp. and Potamogeton pectinatus have been strongly reduced, while Cladophora glomerata and Vaucheria sp. have increased. Especially for Vaucheria, the raised temperature has been of vital importance. Among other species, Tolypella nidifica first increased, but has now totally disappeared. Zannichellia palustris was the only phanerogam which increased all the time. It is Z. palustris var. major which stands for the increase, while Z. palustris var. repens has disappeared from the basin. The shore vegetation, mainly reeds, has expanded conspicuously. From 1974 to 1980, the shore vegetation was favoured by the reduced exposition caused by the embankment. Since then, the raised temperature and absence of ice cover have resulted in an accelerating expansion of mainly Phragmites communis. Scirpus tabernaemontani and S. maritimus were first increasing, but do not seem to be able to compete with Phragmites in the long run. (au)

The Effect of Different Type of Herbivores, Grazing Types and Grazing Intensities on Alpine Basiphillous Vegetation of the Romanian Carpathians

Science.gov (United States)

Ballová, Zuzana; Pekárik, Ladislav; Šibík, Jozef

2017-04-01

increased the most in restricted areas compared to irregularly and regularly grazed sites. When analyzing soil properties, Generalized mixed models revealed reliable results in the differences among categories of grazing types and intensity. These differences were only noticeable in calcium concentration being calcium the most decreased by medium grazing intensity and the most increased by irregular grazing. Grazing had significant effects on individual plant species occurrences and covers. Horses decreased presence of Anthoxanthum odoratum and regular grazing sites as well as fences had significantly higher occurrence of trampling tolerant species Nardus stricta compared to sites with irregular grazing. The type of grazing herbivores influenced covers of Agrostis capillaris, A. rupestris, Campanula rotundifolia, Festuca supina, Luzula multiflora, and Ranunculus pseudomontanus. The grazing types significantly altered covers of Agrostis capillaris, Alchemilla sp. div., Campanula rotundifolia, Festuca supina, Luzula multiflora, Nardus stricta, and Potentilla ternata (Potentilla aurea subsp. chrysocraspeda). The intensity of grazing had important impact on covers of Agrostis rupestris, Alchemilla sp. div., Campanula rotundifolia, Festuca supina, Luzula multiflora, Poa alpina, Potentilla ternata, and Ranunculus pseudomontanus. Key words: alpine meadows; pastures; GLMM; NMDS; (nested) PERMANOVA

Insights into the relationships of Palearctic and Nearctic lymnaeids (Mollusca : Gastropoda by rDNA ITS-2 sequencing and phylogeny of stagnicoline intermediate host species of Fasciola hepatica

Directory of Open Access Journals (Sweden)

Bargues M.D.

2003-09-01

Full Text Available Fascioliasis by Fasciola hepatica is the vector-borne disease presenting the widest latitudinal, longitudinal and altitudinal distribution known. F. hepatica shows a great adaptation power to new environmental conditions which is the consequence of its own capacities together with the adaptation and colonization abilities of its specific vector hosts, freshwater snails of the family Lymnaeidae. Several lymnaeid species only considered as secondary contributors to the liver fluke transmission have, however, played a very important role in the geographic expansion of this disease. Many of them belong to the so-called "stagnicoline" type group. Stagnicolines have, therefore, a very important applied interest in the Holarctic region, to which they are geographically restricted. The present knowledge on the genetics of stagnicolines and on their parasite-host interrelationships is, however, far from being sufficient. The present paper analyses the relationships between Palaearctic and Nearctic stagnicoline species on the base of the new light furnished by the results obtained in nuclear rDNA ITS-2 sequencing and corresponding phylogenetic studies of the lymnaeid taxa Lymnaea (Stagnicola occulta, L. (S. palustris palustris (topotype specimens and L.(S. p. turricula from Europe. Natural infections with F. hepatica have been reported in all of them. Surprisingly, ITS-2 length and G C content of L. occulta were similar and perfectly fitted within the respective ranges known in North American stagnicolines. Nucleotide differences and genetic distances were higher between L. occulta and the other European stagnicolines than between L. occulta and the North American ones. The ITS-2 sequence of L. p. turricula from Poland differed from the other genotypes known from turricula in Europe. The phylogenetic trees using the maximum-parsimony, distance and maximum-likelihood methods confirmed (i the inclusion of L. occulta in the branch of North American

Microevolution of ALS inhibitor herbicide resistance in loose silky bentgrass (Apera spica-venti)

DEFF Research Database (Denmark)

Babineau, Marielle

, the ALS resistant biotypes have a fitness advantage over the susceptible biotype in time to germination and time to flowering and seed production growth stages. This study increased the understanding of the spatial, phenotypic, genetic and ecological processes and consequences in ALS herbicide resistance......-neighborhood experiments were conducted with ALS resistant and susceptible populations with a randomized genetic background, vegetative and reproductive growth stages were compared. The results show a large variation in the response of neighboring populations to ALS herbicide. Multiple resistance is observed between ALS...... from known metabolic herbicide resistance pathways, such as cytochrome P450s, ABC-transporters, UDP-glycosyltransferase and glutathione S-transferase, are identified and quantified. Different gene families are up-regulated at different times after herbicide treatment. In low competition conditions...

Influence of copper high-tension lines on plants and soils

Energy Technology Data Exchange (ETDEWEB)

Kraal, H.; Ernst, W.

1976-09-01

The copper contents of plants and soils were determined in relation to the distance from copper high-tension lines. In the vicinity of the cables clayey and fenny soils had demonstrably higher copper contents, due to corrosion of the cables, than regions 20 m and more outside the high-tension lines. On these soils, however, copper accumulation in the plants was low in comparison with those from a sandy soil, although this soil itself showed no copper increase in relation to the cables. The contaminated plants may present a risk of poisoning for sheep within a 20 m distance on both sides of the cables. No changes in plant species composition and in the copper tolerance of Agrostis tenuis were observed.

Impacts of Flooding Regime Modification on Wildlife Habitats of Bottomland Hardwood Forests in the Lower Mississippi Valley.

Science.gov (United States)

1981-10-01

Diospyros virginiana White ash Fraxinus americana Shingle oak Quercus imbricaria Pin oak 0 palustris (Continued) Able to survive deep, prolonged...Mississippi, and found little significant dif- ference in overall capture data. Natural stands almost exclusively sup- ported mice of the genus Peromyscus...frequent wetlands but are not restricted to them. k. Although the cottonmouth is common in wetlands, water snakes of the genus Nerodia are most important in

Surface-based GPR underestimates below-stump root biomass

Science.gov (United States)

John R. Butnor; Lisa J. Samuelson; Thomas A. Stokes; Kurt H. Johnsen; Peter H. Anderson; Carlos A. Gonzalez-Benecke

2016-01-01

Aims While lateral root mass is readily detectable with ground penetrating radar (GPR), the roots beneath a tree (below-stump) and overlapping lateral roots near large trees are problematic for surface-based antennas operated in reflection mode. We sought to determine if tree size (DBH) effects GPR root detection proximal to longleaf pine (Pinus palustris Mill) and if...

Transgene flow: Facts, speculations and possible countermeasures

Science.gov (United States)

Ryffel, Gerhart U

2014-01-01

Convincing evidence has accumulated that unintended transgene escape occurs in oilseed rape, maize, cotton and creeping bentgrass. The escaped transgenes are found in variant cultivars, in wild type plants as well as in hybrids of sexually compatible species. The fact that in some cases stacked events are present that have not been planted commercially, implies unintended recombination of transgenic traits. As the consequences of this continuous transgene escape for the ecosystem cannot be reliably predicted, I propose to use more sophisticated approaches of gene technology in future. If possible GM plants should be constructed using either site-directed mutagenesis or cisgenic strategies to avoid the problem of transgene escape. In cases where a transgenic trait is needed, efficient containment should be the standard approach. Various strategies available or in development are discussed. Such a cautious approach in developing novel types of GM crops will enhance the sustainable potential of GM crops and thus increase the public trust in green gene technology. PMID:25523171

Methylocella tundrae sp. nov., a novel methanotrophic bacterium from acidic tundra peatlands.

Science.gov (United States)

Dedysh, Svetlana N; Berestovskaya, Yulia Y; Vasylieva, Lina V; Belova, Svetlana E; Khmelenina, Valentina N; Suzina, Natalia E; Trotsenko, Yuri A; Liesack, Werner; Zavarzin, George A

2004-01-01

A novel species, Methylocella tundrae, is proposed for three methanotrophic strains (T4T, TCh1 and TY1) isolated from acidic Sphagnum tundra peatlands. These strains are aerobic, Gram-negative, non-motile, dinitrogen-fixing rods that possess a soluble methane monooxygenase and utilize the serine pathway for carbon assimilation. Strains T4T, TCh1 and TY1 are moderately acidophilic organisms capable of growth between pH 4.2 and 7.5 (optimum 5.5-6.0) and between 5 and 30 degrees C (optimum 15 degrees C). The major phospholipid fatty acid is 18:1omega7c. The DNA G+C content of strain T4T is 63.3 mol%. The three strains possess almost identical 16S rRNA gene sequences and are most closely related to two previously identified species of Methylocella, Methylocella palustris (97% similarity) and Methylocella silvestris (97.5% similarity). DNA-DNA hybridization values of strain T4T with Methylocella palustris KT and Methylocella silvestris BL2T were respectively 27 and 36%. Thus, the tundra strains represent a novel species, for which the name Methylocella tundrae sp. nov. is proposed. Strain T4T (=DSM 15673T=NCIMB 13949T) is the type strain.

Contribuciones al conocimiento de la flora de navarra

Directory of Open Access Journals (Sweden)

BALDA, Angel

2002-01-01

Full Text Available Nuevos datos acerca de 58 táxones de plantas de interés, bien por su rareza en el terrirorio navarro o por la ampliación de área que suponen. De ellos, 12 se citan por primera vez para Navarra : Epilobium angustifolium, Fraxinus pennylvanica, Galinsoga quadriradiata, Gamochaeta falcata, Isatis tinctoria subsp. tinctoria, Ludwigia palustris, Lycopodeilla inundata, Pseudorchis albida, Ramonda myconi, Rynchospora alba, Rynchospora fusca y Spiranthes aestivalis

Accumulation of 226Ra, 238U and 230Th by wetland plants in a vicinity of U-mill tailings at Zirovski vrh (Slovenia)

International Nuclear Information System (INIS)

Marko Cerne; Borut Smodis; Marko Strok; Radojko Jacimovic

2010-01-01

The impact of a U-mill tailing on radionuclide accumulation by plants was assayed. In particular, a preliminary screening of 226 Ra, 238 U and 230 Th in Marsh marigold (Caltha palustris L.), soft rush (Juncus effusus L.) and Tall Moor grass (Molinia arundinacea (L.) Moench) grown in a marsh habitat is presented. Activity concentrations for the studied radionuclides and their transfer factors for the particular plants are shown and discussed. (author)

A Guide to the George Palmiter River Restoration Techniques.

Science.gov (United States)

1982-03-01

reduction. The raft is driven by a 35 h.p. ’ outboard engine, weighs 4 tons, and has 1500 lb. of flotation material under it. Additionally, the raft has a...Sycamore (Platanus occidentalis) 4. Red Maple (Acer rubrum) 5. Silver Maple (Acer saccharinum) 6. Pin Oak (Quercus palustris) 7. Red Oak (Quercus...safety goggles 5 - ear protectors 5 - flotation jackets 1, - industrial first aid kit--one that floats and is waterproof 1 - snake bite kit several

North American Lauraceae: Terpenoid Emissions, Relative Attraction and Boring Preferences of Redbay Ambrosia Beetle, Xyleborus glabratus (Coleoptera: Curculionidae: Scolytinae)

OpenAIRE

Kendra, Paul E.; Montgomery, Wayne S.; Niogret, Jerome; Pruett, Grechen E.; Mayfield, Albert E.; MacKenzie, Martin; Deyrup, Mark A.; Bauchan, Gary R.; Ploetz, Randy C.; Epsky, Nancy D.

2014-01-01

The invasive redbay ambrosia beetle, Xyleborus glabratus, is the primary vector of Raffaelea lauricola, a symbiotic fungus and the etiologic agent of laurel wilt. This lethal disease has caused severe mortality of redbay (Persea borbonia) and swampbay (P. palustris) trees in the southeastern USA, threatens avocado (P. americana) production in Florida, and has potential to impact additional New World species. To date, all North American hosts of X. glabratus and suscepts of laurel wilt are mem...

Integrating large-scale functional genomics data to dissect metabolic networks for hydrogen production

Energy Technology Data Exchange (ETDEWEB)

Harwood, Caroline S

2012-12-17

The goal of this project is to identify gene networks that are critical for efficient biohydrogen production by leveraging variation in gene content and gene expression in independently isolated Rhodopseudomonas palustris strains. Coexpression methods were applied to large data sets that we have collected to define probabilistic causal gene networks. To our knowledge this a first systems level approach that takes advantage of strain-to strain variability to computationally define networks critical for a particular bacterial phenotypic trait.

Experimental Life Cycle of Hypoderaeum conoideum (Block, 1872 Diez, 1909(Trematoda: Echinostomatidae Parasite from the North of Iran

Directory of Open Access Journals (Sweden)

Hakim AZIZI

2015-03-01

Full Text Available Background: Human Echinostomiasis is an intestinal disease caused by the members of family Echinostomatidae parasites. The aim of present research was to identify echinos­tomatidae cercariae emitted by Lymnaea palustris snails from Mazandaran province in the north of Iran based on the morphological and morphometrical charac­teristics of the different stages of experimental parasite life cycle.Methods: Echinostomatidae cercariae were collected from L. palustris (Gastropoda: Lymnaeidae of the north of Iran. To collect metacercaria, 50 healthy snails were infected with cercariae experimentally (50 cercariae for each. To obtain the adult stage, 9 laboratory animals (3 ducks, 2 rats, 2 mice and 2 quails were fed with 60 metacercaria for each. To identify parasite, the different stages of worm were exam­ined using light microscope and then the figures were draw under camera Lucida microscope and measures were determined.Results: Averagely, 15metacercaria were obtained from each snail that had been previously exposed with cercariae. Ducks presented worm eggs in feces after 10-15 days post-infection. Intestinal worms were collected and identified as Hypoderaeum conoideum on the bases of figures and measures of cephalic collar, the number of collar spine, suckers diameter ratio, testes arrangement, etc.Conclusion: H. conoideum cercariae and adult worm are described. This is the first report of the different stages of the experimental life cycle of this parasite in Iran.

Endogenous abscisic acid as a key switch for natural variation in flooding-induced shoot elongation.

Science.gov (United States)

Chen, Xin; Pierik, Ronald; Peeters, Anton J M; Poorter, Hendrik; Visser, Eric J W; Huber, Heidrun; de Kroon, Hans; Voesenek, Laurentius A C J

2010-10-01

Elongation of leaves and stem is a key trait for survival of terrestrial plants during shallow but prolonged floods that completely submerge the shoot. However, natural floods at different locations vary strongly in duration and depth, and, therefore, populations from these locations are subjected to different selection pressure, leading to intraspecific variation. Here, we identified the signal transduction component that causes response variation in shoot elongation among two accessions of the wetland plant Rumex palustris. These accessions differed 2-fold in petiole elongation rates upon submergence, with fast elongation found in a population from a river floodplain and slow elongation in plants from a lake bank. Fast petiole elongation under water consumes carbohydrates and depends on the (inter)action of the plant hormones ethylene, abscisic acid, and gibberellic acid. We found that carbohydrate levels and dynamics in shoots did not differ between the fast and slow elongating plants, but that the level of ethylene-regulated abscisic acid in petioles, and hence gibberellic acid responsiveness of these petioles explained the difference in shoot elongation upon submergence. Since this is the exact signal transduction level that also explains the variation in flooding-induced shoot elongation among plant species (namely, R. palustris and Rumex acetosa), we suggest that natural selection results in similar modification of regulatory pathways within and between species.

Post-Fire Peat Land Understory Plant in Rimba Panjang, Sumatera, Indonesia

Science.gov (United States)

Firdaus, L. N.; Nursal; Wulandari, Sri; Syafi'i, Wan; Fauziah, Yuslim

2017-12-01

The existence of understory plants during early post-fire succession is essential in term of natural post-fire ecological restoration. More than fifty percent of fire incidents in Riau, Sumatera, Indonesia occurred in shallow peat lands which have the huge impact on vegetation damage. This study aims to explore the understory plants species and diversity in post-fire peat land at Rimba Panjang, Kampar Regency, Sumatera, Indonesia. By using survey method, the observations were conducted on 150 plots which were distributed randomly over four locations based on the year after fire: 2009, 2014, 2015 and 2016. We found respectively 12, 14, 19 and 17 species at that sites with respective Shannon Wiener diversity index were 1.72, 2.00, 2.14 and 2.40. All the sites were dominated by Stenochlaena palustris (Burm.). Coverage percentage of understory vegetation were respectively 28.87%, 25.50%, 51.60% and 54.13%. Overall, we found 31 species of 17 familia. The result showed that the species composition, diversity index and coverage percentage of understory plant are likely to decrease in line with the length of time after the fire. Post peatland fires in Rimba Panjang are still having the characteristics of the peat swamp habitat which was dominated by Stenochlaena palustris (Burm.). Ecological restoration of that habitat is still possible, but it is necessary to consider technological and socio-economical aspects of local communities.

Genes essential for phototrophic growth by a purple alphaproteobacterium: Genes for phototrophic growth

Energy Technology Data Exchange (ETDEWEB)

Yang, Jianming [Key Lab of Applied Mycology, College of Life Sciences, Qingdao Agricultural University, Qingdao Shandong Province People' s Republic of China; Department of Microbiology, University of Washington, Seattle WA USA; Yin, Liang [Department of Microbiology, University of Washington, Seattle WA USA; Lessner, Faith H. [Department of Biological Sciences, University of Arkansas, Fayetteville AR USA; Nakayasu, Ernesto S. [Biological Sciences Division, Pacific Northwest National Laboratory, Richland WA USA; Payne, Samuel H. [Biological Sciences Division, Pacific Northwest National Laboratory, Richland WA USA; Fixen, Kathryn R. [Department of Microbiology, University of Washington, Seattle WA USA; Gallagher, Larry [Department of Genome Sciences, University of Washington, Seattle WA USA; Harwood, Caroline S. [Department of Microbiology, University of Washington, Seattle WA USA

2017-07-24

Anoxygenic purple phototrophic bacteria have served as important models for studies of photophosphorylation. The pigment-protein complexes responsible for converting light energy to ATP are relatively simple and these bacteria can grow heterotrophically under aerobic conditions, thus allowing for the study of mutants defective in photophosphorylation. In the past, genes responsible for anoxygenic phototrophic growth have been identified in a number of different bacterial species. Here we systematically studied the genetic basis for this metabolism by using Tn-seq to identify genes essential for the anaerobic growth of the purple bacterium Rhodopseudomonas palustris on acetate in light. We identified 171 genes required for growth in this condition, 35 of which are annotated as photosynthesis genes. Among these are a few new genes not previously shown to be essential for phototrophic growth. We verified the essentiality of many of the genes we identified by analyzing the phenotypes of mutants we generated by Tn mutagenesis that had altered pigmentation. We used directed mutagenesis to verify that the R. palustris NADH:quinone oxidoreductase complex IE is essential for phototrophic growth. As a complement to the genetic data, we carried out proteomics experiments in which we found that 429 proteins were present in significantly higher amounts in cells grown anaerobically in light compared to aerobically. Among these were proteins encoded by subset of the phototrophic growth-essential genes.

Light and electron microscopic study of Pelomyxa binucleata (Gruber, 1884) (Peloflagellatea, Pelobiontida)

OpenAIRE

Frolov, Alexander; Chystjakova, Ludmila; Goodkov, Andrew

2005-01-01

Morphology of a pelobiont Pelomyxa binucleata (Gruber, 1884) has been studied using light and electron microscopy. The organisation of P. binucleata has been shown to differ from that of P. palustris, P. prima and P. corona. The cell surface of P. binucleata is represented by the plasma membrane with a thin but distinct layer of non structured glycocalyx. The ectoplasm, containing a network of fine fibrils, is separated from the endoplasm with a boundary layer of cisterns and reticulum channe...

Recipient-Biased Competition for an Intracellularly Generated Cross-Fed Nutrient Is Required for Coexistence of Microbial Mutualists.

Science.gov (United States)

McCully, Alexandra L; LaSarre, Breah; McKinlay, James B

2017-11-28

Many mutualistic microbial relationships are based on nutrient cross-feeding. Traditionally, cross-feeding is viewed as being unidirectional, from the producer to the recipient. This is likely true when a producer's waste, such as a fermentation product, has value only for a recipient. However, in some cases the cross-fed nutrient holds value for both the producer and the recipient. In such cases, there is potential for nutrient reacquisition by producer cells in a population, leading to competition against recipients. Here, we investigated the consequences of interpartner competition for cross-fed nutrients on mutualism dynamics by using an anaerobic coculture pairing fermentative Escherichia coli and phototrophic Rhodopseudomonas palustris In this coculture, E. coli excretes waste organic acids that provide a carbon source for R. palustris In return, R. palustris cross-feeds E. coli ammonium (NH 4 + ), a compound that both species value. To explore the potential for interpartner competition, we first used a kinetic model to simulate cocultures with varied affinities for NH 4 + in each species. The model predicted that interpartner competition for NH 4 + could profoundly impact population dynamics. We then experimentally tested the predictions by culturing mutants lacking NH 4 + transporters in both NH 4 + competition assays and mutualistic cocultures. Both theoretical and experimental results indicated that the recipient must have a competitive advantage in acquiring cross-fed NH 4 + to sustain the mutualism. This recipient-biased competitive advantage is predicted to be crucial, particularly when the communally valuable nutrient is generated intracellularly. Thus, the very metabolites that form the basis for mutualistic cross-feeding can also be subject to competition between mutualistic partners. IMPORTANCE Mutualistic relationships, particularly those based on nutrient cross-feeding, promote stability of diverse ecosystems and drive global biogeochemical

Field Assessment of Gopher Tortoise Habitat at Camp Shelby, MS. Phase II: Overstory and Combined Assessments

Science.gov (United States)

2010-10-17

Magnolia virginiana 0 4.5 0 3.3 0 8.4 Nyssa sylvatica 0 6.7 0 8.8 0 2.5 Pinus echinata 0 0.2 1.8 0.7 0 0 Pinus elliotii 0 0 0.9 0 0.7 0 Pinus...palustris 93.0 53.4 71.9 38.2 88.1 73.6 Pinus taeda 0.5 5.3 0.9 8.8 0.7 1.9 Prunus serotina 0 6.7 1.4 1.1 0 0 Quercus spp. (red) 4.9 16.7 16.1 10.6

CARACTERIZAÇÃO MORFOLÓGICA DE ACESSOS DE GERMOPLASMA DE QUATRO ESPÉCIES BRASILEIRAS DE AMENDOIM-SILVESTRE MORPHOLOGICAL CHARACTERIZATION OF GERMPLASM ACESSIONS OF FOUR BRAZILIAN SPECIES OF WILD PEANUT

Directory of Open Access Journals (Sweden)

RENATO FERRAZ DE ARRUDA VEIGA

2001-01-01

Full Text Available Caracterizaram-se morfologicamente os acessos de germoplasma de espécies silvestres brasileiras de amendoim do gênero Arachis L., Sect. Arachis e analisaram-se a similaridade genética entre acessos da mesma espécie e entre as espécies. Realizou-se o experimento nos anos agrícolas de 1993 a 1996, no Núcleo Experimental de Campinas, do Instituto Agronômico (IAC. Avaliaram-se os acessos disponíveis no Banco Ativo de Germoplasma de Espécies Silvestres de Arachis, da Embrapa Recursos Genéticos e Biotecnologia (CENARGEN - Brasília, DF, das espécies A. palustris Krapov., W.C. Gregory & Valls, A. decora Krapov., W.C. Gregory & Valls, A. praecox Krapov., W.C. Gregory & Valls e A. stenosperma Krapov. & W.C. Gregory, efetuando-se anotações fenotípicas quantitativas e qualitativas, conforme lista de descritores morfológicos. Observou-se que os acessos de A. stenosperma são semelhantes, apesar da sua grande distância geográfica, e diferem das demais espécies, formando um grupo mais coeso. Caracteres como o diâmetro do eixo central e o comprimento dos frutos e das sementes serviram para distingui-la das demais espécies. Arachis decora apresentou alta variação entre acessos nos vários caracteres morfológicos estudados. A. palustris apresentou alta variação morfológica entre acessos, ainda que tenham sido analisados apenas dois, para altura da planta, largura da semente, dimensões do esporão, istmo, folíolo, raque e eixo central e quanto à presença e ausência de tricomas no folíolo. Arachis praecox, representada por um único acesso, aproximou-se mais de A. decora que das demais espécies.In this work, a morphological characterization of germplasm accessions of wild Brazilian species of peanut, section Arachis was accomplished. Also, an analysis of the genetic similarity among accessions and between species was evaluated. The experiment was undertaken from 1993 to 1996, at the Campinas Experimental Station of the Instituto

Genetic differentiation of Agrostis capillaris in a grassland system with stable heterogeneity due to terricolous ants

Czech Academy of Sciences Publication Activity Database

Rothanzl, J.; Kotoučová, M.; Hrabinová, I.; Plačková, Ivana; Herben, Tomáš

2007-01-01

Roč. 95, č. 1 (2007), s. 197-207 ISSN 0022-0477 R&D Projects: GA ČR GA206/06/0098 Institutional research plan: CEZ:AV0Z60050516 Keywords : clonal growth * functional differentiation * genetic variation * isozyme markers Subject RIV: EF - Botanics Impact factor: 4.422, year: 2007

Limited impact of arbuscular mycorrhizal fungi on clones of Agrostis capillaris with different heavy metal tolerance

Czech Academy of Sciences Publication Activity Database

Doubková, Pavla; Sudová, Radka

2016-01-01

Roč. 99, MAR 2016 (2016), s. 78-88 ISSN 0929-1393 R&D Projects: GA AV ČR(CZ) KJB600050636 Institutional support: RVO:67985939 Keywords : arbuscular mycorrhizal symbiosis * heavy metal contamination * lead, zinc, copper and cadmium Subject RIV: EH - Ecology, Behaviour Impact factor: 2.786, year: 2016

Does interspecific competition alter effects of early season ozone exposure on plants from wet grasslands? Results of a three-year experiment in open-top chambers.

Science.gov (United States)

Tonneijck, A E G; Franzaring, J; Brouwer, G; Metselaar, K; Dueck, Th A

2004-09-01

Chronic effects of ozone on wet grassland species early in the growing season might be altered by interspecific competition. Individual plants of Holcus lanatus, Lychnis flos-cuculi, Molinia caerulea and Plantago lanceolata were grown in monocultures and in mixed cultures with Agrostis capillaris. Mesocosms were exposed to charcoal-filtered air plus 25 nl l(-1) ozone (CF+25), non-filtered air (NF), non-filtered air plus 25 nl l(-1) ozone (NF+25) and non-filtered air plus 50 nl l(-1) ozone (NF+50) early in the growing seasons of 2000 through 2002. Ozone-enhanced senescence and visible foliar injury were recorded on some of the target plants in the first year only. Ozone effects on biomass production were minimal and plant response to ozone did not differ between monocultures and mixed cultures. After three years, above-ground biomass of the plants in mixed culture compared to monocultures was three times greater for H. lanatus and two to four times smaller for the other species.

Does interspecific competition alter effects of early season ozone exposure on plants from wet grasslands? Results of a three-year experiment in open-top chambers

International Nuclear Information System (INIS)

Tonneijck, A.E.G.; Franzaring, J.; Brouwer, G.; Metselaar, K.; Dueck, Th.A.

2004-01-01

Chronic effects of ozone on wet grassland species early in the growing season might be altered by interspecific competition. Individual plants of Holcus lanatus, Lychnis flos-cuculi, Molinia caerulea and Plantago lanceolata were grown in monocultures and in mixed cultures with Agrostis capillaris. Mesocosms were exposed to charcoal-filtered air plus 25 nl l -1 ozone (CF + 25), non-filtered air (NF), non-filtered air plus 25 nl l -1 ozone (NF + 25) and non-filtered air plus 50 nl l -1 ozone (NF + 50) early in the growing seasons of 2000 through 2002. Ozone-enhanced senescence and visible foliar injury were recorded on some of the target plants in the first year only. Ozone effects on biomass production were minimal and plant response to ozone did not differ between monocultures and mixed cultures. After three years, above-ground biomass of the plants in mixed culture compared to monocultures was three times greater for H. lanatus and two to four times smaller for the other species

Presence of indicator plant species as a predictor of wetland vegetation integrity

Science.gov (United States)

Stapanian, Martin A.; Adams, Jean V.; Gara, Brian

2013-01-01

We fit regression and classification tree models to vegetation data collected from Ohio (USA) wetlands to determine (1) which species best predict Ohio vegetation index of biotic integrity (OVIBI) score and (2) which species best predict high-quality wetlands (OVIBI score >75). The simplest regression tree model predicted OVIBI score based on the occurrence of three plant species: skunk-cabbage (Symplocarpus foetidus), cinnamon fern (Osmunda cinnamomea), and swamp rose (Rosa palustris). The lowest OVIBI scores were best predicted by the absence of the selected plant species rather than by the presence of other species. The simplest classification tree model predicted high-quality wetlands based on the occurrence of two plant species: skunk-cabbage and marsh-fern (Thelypteris palustris). The overall misclassification rate from this tree was 13 %. Again, low-quality wetlands were better predicted than high-quality wetlands by the absence of selected species rather than the presence of other species using the classification tree model. Our results suggest that a species’ wetland status classification and coefficient of conservatism are of little use in predicting wetland quality. A simple, statistically derived species checklist such as the one created in this study could be used by field biologists to quickly and efficiently identify wetland sites likely to be regulated as high-quality, and requiring more intensive field assessments. Alternatively, it can be used for advanced determinations of low-quality wetlands. Agencies can save considerable money by screening wetlands for the presence/absence of such “indicator” species before issuing permits.

Multilocus phylogeography and systematic revision of North American water shrews (genus: Sorex)

Science.gov (United States)

Hope, Andrew G.; Panter, Nicholas; Cook, Joseph A.; Talbot, Sandra L.; Nagorsen, David W.

2014-01-01

North American water shrews, which have traditionally included Sorex alaskanus, S. bendirii, and S. palustris, are widely distributed through Nearctic boreal forests and adapted for life in semiaquatic environments. Molecular mitochondrial signatures for these species have recorded an evolutionary history with variable levels of regional divergence, suggesting a strong role of Quaternary environmental change in speciation processes. We expanded molecular analyses, including more-comprehensive rangewide sampling of specimens representing North American water shrew taxa, except S. alaskanus, and sequencing of 4 independent loci from the nuclear and mitochondrial genomes. We investigated relative divergence of insular populations along the North Pacific Coast, and newly recognized diversity from southwestern montane locations, potentially representing refugial isolates. Congruent independent genealogies, lack of definitive evidence for contemporary gene flow, and high support from coalescent species trees indicated differentiation of 4 major geographic lineages over multiple glacial cycles of the late Quaternary, similar to a growing number of boreal taxa. Limited divergence of insular populations suggested colonization following the last glacial. Characterization of southwestern montane diversity will require further sampling but divergence over multiple loci is indicative of a relictual sky-island fauna. We have reviewed and revised North American water shrew taxonomy including the recognition of 3 species within what was previously known as S. palustris. The possibility of gene flow between most distantly related North American water shrew lineages coupled with unresolved early diversification of this group and other sibling species reflects a complex but potentially productive system for investigating speciation processes.

Anatomía foliar y caulinar en especies de Stemodia (Scrophulariaceae Foliar and caulinar anatomy in species of Stemodia (Scrophulariaceae

Directory of Open Access Journals (Sweden)

Maria De Las Mercedes Sosa

2005-07-01

Full Text Available Se describe la estructura anatómica foliar y caulinar en el género Stemodia. Son consideradas siete especies: S. ericifolia (Kuntze K. Schum., S. hyptoides Cham. & Schltdl., S. lanceolata Benth., S. lobelioides Lehm., S. palustris A. St.-Hil., S. stricta Cham. & Schltdl. y S. verticillata (Mill. Hassl. Se hallaron diferencias en la epidermis foliar, donde hay variación en el tipo de estomas y de tricomas, y en la forma de las papilas epidérmicas; también en la estructura del mesofilo. Se describen e ilustran cuatro tipos de tricomas considerando si son o no glandulares y el número de células que lo conforman. El estudio de la anatomía caulinar mostró diferencias en cuanto a la presencia de aerénquima cortical y de laguna medular, y el porcentaje de espacios en el aerénquima cortical.Comparative anatomical studies of the leaves and stems on the genus Stemodia are presented. Seven species are considered: S. ericifolia (Kuntze K. Schum., S. hyptoides Cham. & Schltdl., S. lanceolata Benth., S. lobelioides Lehm., S. palustris A. St.-Hil., S. stricta Cham. & Schltdl. and S. verticillata (Mill. Hassl. There are variation in the stomatal and trichome types, form of the papillae and mesophyll structure. Four trichome types are described and illustrated considering if they are glandular or non-glandular and the number of cells. The stems present a quite homogeneous anatomical structure. Some differences in the amount and distribution of the aerenchyma and the size of the intercellular spaces are observed.

Identification and growth conditions of purple non-sulfur photosynthetic bacteria isolated from palm oil mill effluent

International Nuclear Information System (INIS)

Radziah Ariffin

2004-01-01

An indigenous strain of the purple non-sulphur photosynthetic bacterium, isolated from palm oil mill effluent was presumably identified as species of Rhodopseudomonas palustris. Cultivation in synthetic medium under different conditions indicated that it gave maximum carotenoid and bacteriophyll synthesis under anaerobic conditions in the light with values of 12.6 and 108.1 mg/g dry cell weight respectively. These values were significantly higher than the pigment content obtained from aerobic cultivation. The specific growth rates in anaerobic was twice those in aerobic conditions in the light. Growth was not occurred in anaerobic or aerobic conditions in the dark. (Author)

Effects of a copper tolerant grass (Agrostis capillaris) on the ecosystem of a copper-contaminated arable soil

NARCIS (Netherlands)

Boon, G.T.; Bouwman, L.A.; Bloem, J.; Römkens, P.F.A.M.

1998-01-01

To test how a dysfunctioning ecosystem of a severely metal-polluted soil responds to renewed plant growth, a pot experiment was conducted with soil from an experimental arable field with pH and copper gradients imposed 13 years ago. In this experimentfour pH/copper combinations from this field were

Effects of inoculation with Glomus intraradices on lead uptake by Zea mays L. and Agrostis capillaris L

Czech Academy of Sciences Publication Activity Database

Malcová, Radka; Vosátka, Miroslav; Gryndler, Milan

2003-01-01

Roč. 23, - (2003), s. 55-67 ISSN 0929-1393 R&D Projects: GA AV ČR KSK6005114; GA ČR GA526/02/0293 Institutional research plan: CEZ:AV0Z5020903; CEZ:AV0Z6005908 Keywords : arbuscular mycorrhizal fungi * soil contamination * heavy metals Subject RIV: EF - Botanics Impact factor: 1.483, year: 2003

Methylocapsa acidiphila gen. nov., sp. nov., a novel methane-oxidizing and dinitrogen-fixing acidophilic bacterium from Sphagnum bog.

Science.gov (United States)

Dedysh, Svetlana N; Khmelenina, Valentina N; Suzina, Natalia E; Trotsenko, Yuri A; Semrau, Jeremy D; Liesack, Werner; Tiedje, James M

2002-01-01

A novel genus and species, Methylocapsa acidiphila gen. nov., sp. nov., are proposed for a methane-oxidizing bacterium isolated from an acidic Sphagnum peat bog. This bacterium, designated strain B2T, represents aerobic, gram-negative, colourless, non-motile, curved coccoids that form conglomerates covered by an extracellular polysaccharide matrix. The cells use methane and methanol as sole sources of carbon and energy and utilize the serine pathway for carbon assimilation. Strain B2T is a moderately acidophilic organism with growth between pH 4.2 and 7.2 and at temperatures from 10 to 30 degrees C. The cells possess a well-developed system of intracytoplasmic membranes (ICM) packed in parallel on only one side of the cell membrane. This type of ICM structure represents a novel arrangement, which was termed type III. The resting cells are Azotobacter-type cysts. Strain B2T is capable of atmospheric nitrogen fixation; it possesses particulate methane monooxygenase and does not express soluble methane monooxygenase. The major phospholipid fatty acid is 18:1omega7c and the major phospholipids are phosphatidylglycerols. The G+C content of the DNA is 63.1 mol%. This bacterium belongs to the alpha-subclass of the Proteobacteria and is most closely related to the acidophilic methanotroph Methylocella palustris KT (97.3% 16S rDNA sequence similarity). However, the DNA-DNA hybridization value between strain B2T and Methylocella palustris K(T) is only 7%. Thus, strain B2T is proposed to comprise a novel genus and species, Methylocapsa acidiphila gen. nov., sp. nov. Strain B2T (= DSM 13967T = NCIMB 13765T) is the type strain.

Macrophytes of the Grlište reservoir (Serbia: Fifteen years after its establishment

Directory of Open Access Journals (Sweden)

Stanković Ž.

2009-01-01

Full Text Available A large number of macrophytes, often in dense populations, have developed on the Grlište Reservoir, Serbia over a period of 15 years. Fast development of vegetation is a consequence of anthropogenic impact in lake management. The methodology used in this research covered 100% of the water body, including all areas with or without aquatic plants. The results indicate that plant communities are still in the early phase of development. This leaves space for future development of competitor macrophyte species (Najas marina, Eleocharis palustris, Typha latifolia, Typha angustifolia, Phragmites australis, etc. capable of endangering stability of the lake, which will tend toward eutrophication.

Influence of unreasoned economic activity on the condition of macrophytes of the Bol’shoye Goluboye Lake

Science.gov (United States)

Palagushkina, O. V.; Zaripova, N. R.; Mingazova, N. M.; Yarutkin, T. O.

2018-01-01

The ecosystem of Lake Bolshoye Goluboe had undergone a strong anthropogenic impact in 2013 as a result of the implementation of the dam reconstruction project. Studies in 2014 have shown that the implementation of the project for the reconstruction of the Bolshoye Goluboe dam has negatively affected on the species richness of macrophytes. The total species composition of the lake and species richness of the water core decreased twofold, Hippuris vulgaris L., Zannichellia palustris L, Ceratophyllum demersum L., and the species listed in the Red Book of the Republic of Tatarstan - Batrachium circinatum (Sibth.) Spach disappeared from the species composition. The area occupied by macrophyte communities has decreased by 55%.

Plant-specific responses to zinc contamination in a semi-field lysimeter and on hydroponics

International Nuclear Information System (INIS)

Bernhard, Roland; Verkleij, Jos A.C.; Nelissen, Hans J.M.; Vink, Jos P.M.

2005-01-01

The species Agrostis stolonifera, Brassica napus and Trifolium repens representing different ecological strategies, were selected to study the effect of Zn contamination on Zn tolerance, uptake and accumulation patterns. Parallel tests were carried out with increasing concentrations of Zn in a semi-field lysimeter and hydroponics in the climate chamber. A significant reduction in biomass production or root length and an increase in shoot Zn concentration was observed for all species at increasing external Zn concentrations. However, shoot biomass production, Zn tolerance and Zn accumulation differed significantly among the tested species. The results in both experimental set-ups were quite similar concerning Zn tolerance and accumulation and improved the validity of the findings. The rather specific responses of the different plant species to Zn contamination interfere with the more generic approach used in risk assessment studies. Maximum amounts of Zn in shoot are not likely to cause a risk to herbivores. - Effects of Zn contamination showed different responses in uptake and accumulation patterns of site-specific plant species, which were similar in a semi-field experiment and under controlled conditions

Plant-specific responses to zinc contamination in a semi-field lysimeter and on hydroponics

Energy Technology Data Exchange (ETDEWEB)

Bernhard, Roland [Department of Ecology and Physiology of Plants, Vrije Universiteit, De Boelelaan 1085, NL-1081 HV Amsterdam (Netherlands); Verkleij, Jos A.C. [Department of Ecology and Physiology of Plants, Vrije Universiteit, De Boelelaan 1085, NL-1081 HV Amsterdam (Netherlands)]. E-mail: jos.verkleij@falw.vu.nl; Nelissen, Hans J.M. [Department of Ecology and Physiology of Plants, Vrije Universiteit, De Boelelaan 1085, NL-1081 HV Amsterdam (Netherlands); Vink, Jos P.M. [Department of Chemistry and Ecotoxicology, RIZA, PO Box 17, NL-8200 AA Lelystad (Netherlands)

2005-11-15

The species Agrostis stolonifera, Brassica napus and Trifolium repens representing different ecological strategies, were selected to study the effect of Zn contamination on Zn tolerance, uptake and accumulation patterns. Parallel tests were carried out with increasing concentrations of Zn in a semi-field lysimeter and hydroponics in the climate chamber. A significant reduction in biomass production or root length and an increase in shoot Zn concentration was observed for all species at increasing external Zn concentrations. However, shoot biomass production, Zn tolerance and Zn accumulation differed significantly among the tested species. The results in both experimental set-ups were quite similar concerning Zn tolerance and accumulation and improved the validity of the findings. The rather specific responses of the different plant species to Zn contamination interfere with the more generic approach used in risk assessment studies. Maximum amounts of Zn in shoot are not likely to cause a risk to herbivores. - Effects of Zn contamination showed different responses in uptake and accumulation patterns of site-specific plant species, which were similar in a semi-field experiment and under controlled conditions.

Vegetation and checklist of Inaccessible Island, central South Atlantic Ocean, with notes on Nightingale Island

Directory of Open Access Journals (Sweden)

J. P. Roux

1992-10-01

Full Text Available The physiography and climate of Inaccessible and Nightingale Islands are briefly discussed. The vegetation and the major plant associations are described. Notes are given on the ecology and distribution of each taxon. Taxa newly recorded for Inaccessible Island include Agrostis goughensis, A.holgateana, A. wacei, Calamagrostis deschampsiiformis, Carex thouarsii var.  recurvata, Conyza albida, Elaphoglossum campylolepium and  Uncinia meridensis. One species, C.  albida, is alien to the Tristan group. Two native ferns Asplenium platybasis var.  subnudum and Blechnum australe were found on Nightingale Island for the first time, and the presence of introduced Malus domestica orchards was recorded. Two unidentified taxa were found that may represent new species:  Elaphoglossum sp. at Inaccessible Island and Apium sp. at both Inaccessible and Nightingale Islands. The total number of vascular plant species recorded at Inaccessible and Nightingale Islands now stands at 98 and 43, respectively, of which 26 (28% and seven (16% are introduced species. Only Airiplex plebeja and two species of Cotula occur at Nightingale Island but are absent from Inaccessible Island.

Evaluation of cyclonic ash, commercial Na-silicates, lime and phosphoric acid for metal immobilisation purposes in contaminated soils in Flanders (Belgium)

International Nuclear Information System (INIS)

Geebelen, Wouter; Sappin-Didier, Valerie; Ruttens, Ann; Carleer, Robert; Yperman, Jan; Bongue-Boma, Kwele; Mench, Michel; Lelie, Niels van der; Vangronsveld, Jaco

2006-01-01

In order to reduce the health risks associated with historically enriched metal smelting sites in Flanders (Belgium), the capacities of a non-beringite cyclonic ash and commercial Na-silicates to fix metals and create conditions to restore vegetation cover were evaluated and compared to lime and H 3 PO 4 . All tested amendments reduced Ca(NO 3 ) 2 -extractable soil metal concentrations and reduced metal uptake in Agrostis capillaris seedlings. Sodium released by Na-silicates was possibly toxic to bean plants while an isotopic dilution technique revealed that metals were only weakly sorbed by silicates (i.e. reversible sorption). Cyclonic ash appeared more efficient than lime in both reducing oxidative stress in beans and Zn, Cu and Pb uptake in grasses. The metal fixing mechanism for both amendments appeared similar (i.e. irreversible fixation at constant pH), in contrast to H 3 PO 4 where at least part of the immobilised Cd was irreversibly fixed across a range of pH. - Metal immobilising capacities of Na-silicates are weak, while the active mechanism of cyclonic ash is the same as lime

Does interspecific competition alter effects of early season ozone exposure on plants from wet grasslands? Results of a three-year experiment in open-top chambers

Energy Technology Data Exchange (ETDEWEB)

Tonneijck, A.E.G.; Franzaring, J.; Brouwer, G.; Metselaar, K.; Dueck, Th.A

2004-09-01

Chronic effects of ozone on wet grassland species early in the growing season might be altered by interspecific competition. Individual plants of Holcus lanatus, Lychnis flos-cuculi, Molinia caerulea and Plantago lanceolata were grown in monocultures and in mixed cultures with Agrostis capillaris. Mesocosms were exposed to charcoal-filtered air plus 25 nl l{sup -1} ozone (CF + 25), non-filtered air (NF), non-filtered air plus 25 nl l{sup -1} ozone (NF + 25) and non-filtered air plus 50 nl l{sup -1} ozone (NF + 50) early in the growing seasons of 2000 through 2002. Ozone-enhanced senescence and visible foliar injury were recorded on some of the target plants in the first year only. Ozone effects on biomass production were minimal and plant response to ozone did not differ between monocultures and mixed cultures. After three years, above-ground biomass of the plants in mixed culture compared to monocultures was three times greater for H. lanatus and two to four times smaller for the other species.

[Methanotrophic bacteria of acid sphagnum bogs].

Science.gov (United States)

Dedysh, S N

2002-01-01

Acid sphagnum bogs cover a considerable part of the territory of Russia and are an important natural source of biogenic methane, which is formed in their anaerobic layers. A considerable portion of this methane is consumed in the aerobic part of the bog profile by acidophilic methanotrophic bacteria, which comprise the methane filter of sphagnum bogs and decrease CH4 emission to the atmosphere. For a long time, these bacteria escaped isolation, which became possible only after the elucidation of the optimal conditions of their functioning in situ: pH 4.5 to 5.5; temperature, from 15 to 20 degrees C; and low salt concentration in the solution. Reproduction of these conditions and rejection of earlier used media with a high content of biogenic elements allowed methanotrophic bacteria of two new genera and species--Methylocella palustris and Methylocapsa acidophila--to be isolated from the peat of sphagnum bogs of the northern part of European Russia and West Siberia. These bacteria are well adapted to the conditions in cold, acid, oligotrophic sphagnum bogs. They grow in a pH range of 4.2-7.5 with an optimum at 5.0-5.5, prefer moderate temperatures (15-25 degrees C) and media with a low content of mineral salts (200-500 mg/l), and are capable of active nitrogen fixation. Design of fluorescently labeled 16S rRNA-targeted oligonucleotide probes for the detection of Methylocella palustris and Methylocapsa acidophila and their application to the analysis of sphagnum peat samples showed that these bacteria represent dominant populations of methanotrophs with a density of 10(5)-10(6) cells/g peat. In addition to Methylocella and Methylocapsa populations, one more abundant population of methanotrophs was revealed (10(6) cells/g peat), which were phylogenetically close to the genus Methylocystis.

[Construction and Characterization of B850-Only LH2 Energy Transfer System in Purple Bacteria].

Science.gov (United States)

Li, Kai; Zhao, Chun-gui; Yue, Hui-ying; Yang, Su-ping; Qu, Yin-bo; Jiao, Nian-zhi

2015-04-01

To seek microscopic molecular mechanism of energy transfer and complex reconstitution in the photosynthesis, the conditions for construction of B850-only peripheral light-harvesting complex (LH2) and their properties were investigated using absorption, fluorescence spectroscopy, molecular sieve chromatography, ultrafiltration and sodium dodecylsulfate polyacrylamide gel electrophoresis (SDS-PAGE) from the purple bacteria. The results indicated that bacteriochlorophylls (BChl) of B800 incubated in 10 mmo · L(-1) Tris-HCl (pH 8.0) buffer are selectively released from their binding sites of LH2 of Rhodobacter azotoformans (A-LH2) by 0.08% (W/V) SDS. B850-only A-LH2 was constructed after removing free BChl mixing with 10% methyl alcohol by ultrafiltration. B850 BChl was released after A-LH2 was incubated for 240 min in dark at room temperature (RT). While BChl of B800 incubated in pH 1.9 buffer were selectively released from their binding sites of LH2 of Rhodopseudomonas palustris (P-LH2). The authors acquired two components using molecular sieve chromatography. Free BChl of one component was not removed and self-assembled to P-LH2. The other removed free BChl and B850-only P-LH2 was constructed. B850 unchanged after P-LH2 was incubated. P-LH2 α and β subunits have different molecular weights, but those of A-LH2 are in the contrary. It is concluded that B850-only P-LH2 is more stable than A-LH2. The enigmatic split of the B800 absorption band was not observed in these LH2, but we acquired two kinds of B800-released LH2 from Rhodopseudomonas palustris. The authors' results may provide a new light to separate homogeneous Apoprotein LH2.

Distribution of cobalt 60 in a mollusc, a crustacean and a freshwater teleost: variations as a function of the source of pollution and during elimination

International Nuclear Information System (INIS)

Amiard, J.C.; Amiard-Triquet, C.

1979-01-01

57 Co, 58 Co and 60 Co are present in nuclear test debris as well as in effluents of the non-military nuclear industry. The stable isotope, which is a constituent of vitamin B 12 , has very important biological functions. For each species, three experiments were carried out: (1) starved animals were immersed in 60 Co-contaminated water; (2) animals were immersed in contaminated water and received radioactive food and (3) animals were placed in fresh water without any pollutant but received contaminated food. Radiation doses were calculated for contamination via both food and water. When 60 Co is taken up directly from water, the most contaminated organs are external ones, especially the shell of the snail Lymnaea palustris and the exoskeleton and feeding appendages of the crayfish Astacus leptodactylus. Contamination via food is responsible for a relatively greater accumulation of radiocobalt in internal organs. The cobalt content of muscles - that is to say the edible parts of crayfish and common carp Cyprinus carpio -is very low. The highest concentrations recorded are in the visceral mass of the snail, the digestive gland of the crayfish and the kidneys of the carp. Internal doses for these organs are considerably higher than those for entire animals. Therefore, as a result of 60 Co distribution, they are critical organs for the freshwater species. Except for the carp, external radiation is very weak compared with internal radiation. A strong retention of 60 Co is observed for the shell of L. palustris while the desorption of radiocobalt from the exoskeleton of A. leptodactylus is easier. In carp, the 60 Co taken up by the gut from food, as well as from water, is rapidly eliminated. (author)

Ethylene, nitric oxide and haemoglobins in plant tolerance to flooding

DEFF Research Database (Denmark)

Mur, Luis A J; Gupta, Kapuganti J; Chakraborty, U

2015-01-01

-tolerant species Rumex palustris and the model plant Arabidopsis thaliana have been extensively exploited to reveal some key molecular events. Our groups have recently demonstrated that nitric oxide (NO) triggers the biosynthesis of ethylene during stress and that NO plays key roles in PCD and the hyponastic......As much as 12% of the world's soils may suffer excess water so that flooding is a major limiting factor on crop production in many areas. Plants attempt to deal with submergence by forming root aerenchyma to facilitate oxygen diffusion from the shoot to the root, initiating a hyponastic response....... This chapter will detail our understanding of the roles of ethylene, NO and haemoglobin in flooding stress....

Response of the Invasive Grass Imperata cylindrica to Disturbance in the Southeastern Forests, USA

Directory of Open Access Journals (Sweden)

Shibu Jose

2012-09-01

Full Text Available Imperata cylindrica is an invasive plant species that threatens diversity and forest productivity in southeastern ecosystems. We examined the effects of disturbance events, particularly fire and hurricane/salvage harvesting, to determine the effects on I. cylindrica abundance in longleaf pine (Pinus palustris forests in the Florida panhandle. Areas that were burned or had greater biomass removal following a hurricane had a greater number of I. cylindrica patches and larger patch size. These results highlight the importance of disturbance events on expanding invasive species populations in this region and are likely applicable for other invasive species as well. Monitoring and treatment should follow disturbance events to ensure that invasive species populations do not exceed unmanageable levels.

Northeast regional and state trends in anuran occupancy from calling survey data (2001-2011) from the North American Amphibian Monitoring Program

Science.gov (United States)

Weir, Linda A.; Royle, Andy; Gazenski, Kimberly D.; Villena Carpio, Oswaldo

2014-01-01

We present the first regional trends in anuran occupancy from North American Amphibian Monitoring Program (NAAMP) data from 11 northeastern states using an 11 years of data. NAAMP is a long-term monitoring program where observers collect data at assigned random roadside routes using a calling survey technique. We assessed occupancy trends for 17 species. Eight species had statistically significant regional trends, of these seven were negative (Anaxyrus fowleri, Acris crepitans, Pseudacris brachyphona, Pseudacris feriarum-kalmi complex, Lithobates palustris, Lithobates pipiens, and Lithobates sphenocephalus) and one was positive (Hyla versicolor-chrysoscelis complex). We also assessed state level trends for 101 species/state combinations, of these 29 showed a significant decline and nine showed a significant increase in occupancy.

Factors Affecting the Distribution of Wild Rice (Zizania palustris) and the Surrounding Macrophyte Community.

Science.gov (United States)

Pillsbury, R. W.; McGuire, M.

2005-05-01

A recent decline in wild rice wetlands is cause for concern due to its importance as a food source, refuge for wildlife, and cultural significance. Sixty wetlands in Wisconsin and Minnesota (USA) were sampled, with approximately equal numbers displaying dense, moderate and sparse wild rice production. Chemical, physical, and watershed parameters were measured as well as macrophyte densities. Data were analyzed using multivariate statistics (CCA). Moderate levels of phosphorus appear beneficial to the overall success of wild rice, while free-floating macrophytes show an overwhelming positive response to higher levels of P. The distribution of macrophytes bordering wild rice beds is correlated to pH,with Potamogeton robbinsii and filamentous green algae responding most strongly to its increase. Healthy stands of wild rice exhibit a narrow circum-neutral range of pH (6.1-8.0)which is significantly different from the greater range exhibited by sparse wild rice wetlands (6.5-8.5). This pattern was paralleled when considering depth which suggests that deeper wetlands may be more susceptible to wild rice loss. Management of existing wild rice wetlands should focus monitoring on pH, depth, phosphorus concentrations and shore development. We are currently using this data base to locate the best reintroduction sites for wild rice.

Spatial and Temporal Analyses of Environmental Affects on Zizania Palustris and Its Natural Cycles

Science.gov (United States)

Rickman, Douglas L.; Greensky, Wayne; Al-Hamdan, M. Z.; Estes, M. G.; Crosson, W. L.; Estes, Sue M.

2017-01-01

As part of a joint education and research effort funded by NASA, research studies were initiated involving students associated with the Ojibwe and researchers at Marshall Space Flight Center. Topics were chosen that satisfied the nature of the work proposed and were tractable, given the student's constraints (abilities, interests, and time). One of the studies, which spanned two summers, examined some potential environmental effects on northern wild rice in northern Wisconsin. The rice of interest is naturally occurring ('wild' wild rice), as opposed to cultivated wild rice ('paddy' wild rice).

Tularemia in Alaska, 1938 - 2010

Directory of Open Access Journals (Sweden)

Hansen Cristina M

2011-11-01

Full Text Available Abstract Tularemia is a serious, potentially life threatening zoonotic disease. The causative agent, Francisella tularensis, is ubiquitous in the Northern hemisphere, including Alaska, where it was first isolated from a rabbit tick (Haemophysalis leporis-palustris in 1938. Since then, F. tularensis has been isolated from wildlife and humans throughout the state. Serologic surveys have found measurable antibodies with prevalence ranging from F. tularensis isolates from Alaska were analyzed using canonical SNPs and a multi-locus variable-number tandem repeats (VNTR analysis (MLVA system. The results show that both F. t. tularensis and F. t. holarctica are present in Alaska and that subtype A.I, the most virulent type, is responsible for most recently reported human clinical cases in the state.

Larval trematode infections in freshwater gastropods from the Albufera Natural Park in Spain.

Science.gov (United States)

Toledo, R; Muñoz-Antolí, C; Pérez, M; Esteban, J G

1998-03-01

Malacological samplings were made from January 1994 to December 1996 in the Albufera Natural Park (Valencia, Spain) to trace the dynamics of molluscan populations and the prevalence and intensity of infection by larval trematodes. A total of 10,533 freshwater gastropods belonging to seven species (Lymnaea auricularia, L. truncatula, L. palustris, L. peregra, Bithynia tentaculata, Physa acuta and Gyraulus chinensis) was examined, and 110 (1.04%) were found to harbour some of the nine distinguishable types of cercariae, namely four echinostome cercariae (Hypoderaeum conoideum, Echinoparyphium recurvatum, Euparyphium albuferensis, and Echinostoma sp.), four furcocercous cercariae, and one xiphidiocercous cercaria. This study shows that the composition of the snail and trematode communities may be determined by the particular environmental conditions present and the human intervention in the area.

Efficacy of different fungicides against Rhizoctonia brown patch and Pythium blight on turfgrass in Italy.

Science.gov (United States)

Mocioni, M; Titone, P; Garibaldi, A; Gullino, M L

2003-01-01

Brown patch, incited by Rhizoctonia solani Kuhn, and Pythium blight, caused by Pythium spp. are two of the diseases most frequently observed on turfgrass in high maintenance stands, as on golf courses. In such conditions the control strategies, based on chemicals, are particularly difficult due to the scarcity of fungicides registered for turf in Italy. The results obtained in experimental trials carried out to evaluate the efficacy of chemical and biological products against brown patch and Pythium blight are reported. On mature turfgrass, maintained under fairway conditions, azoxystrobin, and trifoxystrobin, not yet registered on turf, were very effective against brown patch. Tebuconazole, applied in three different formulations, was very effective against R. solani, while Trichoderma spp. and azadiractine did not control the pathogen. In greenhouse conditions on Agrostis stolonifera, in the presence of severe disease incidence, due to artificial inoculation, benalaxyl-M satisfactorily controlled Pythium blight; Trichoderma spp. as well as a commercial formulation of T. harzianum, applied one week before the inoculation, were not effective. Among the fungicides not yet registered for use on turfgrass in Italy, metalaxyl-M + mancozeb was effective against Pythium blight.

Determination of metallic elements in soils and plants in industrial and urban sites

Energy Technology Data Exchange (ETDEWEB)

Delearte, E; Nangniot, P; Impens, R

1973-01-01

The first phase of a program to study metals in soils and plants in industrial and urban sites is reported. The metals analyzed were copper, cobalt, nickel, zinc, lead, and cadmium. The soil samples were taken at increasing distances from potential emission sources with respect to dominant wind directions. Ubiquitous plants, such as Tussilago farfara L., Plantago major L., Mercurialis annua L., and Agrostis velgaris With. were used as samples for differential oscillopolarographic analyses. Soil samples taken around a zinc ore roasting plant showed very high zinc contents, and irregular distribution of cadmium and copper. Plant samples taken at different distances from the plant revealed rapid reduction of the copper, zinc, and cadmium levels with increasing distance. Very high concentrations of copper were found in plants around a petroleum refinery. Leaves of Aeer platanoides variety Schwedlerii in a town contained an average of 14.1 ppM copper, 0.7 ppM cobalt, 5.4 ppM nickel, 160 ppM zinc, 145 ppM lead, and 0.08 ppM cadmium, relative to the dry weight. The findings indicate that samples should be obtained over a period of sufficient length.

Photosynthetic consequences of phenotypic plasticity in response to submergence: Rumex palustris as a case study

NARCIS (Netherlands)

Mommer, L.; Pons, T.L.; Visser, E.J.W.

2006-01-01

Survival and growth of terrestrial plants is negatively affected by complete submergence. This is mainly the result of hampered gas exchange between plants and their environment, since gas diffusion is severely reduced in water compared with air, resulting in O2 deficits which limit aerobic

Resprouting after disturbance in the short-lived herb Rorippa palustris (Brassicaceae): an experiment with juveniles

Czech Academy of Sciences Publication Activity Database

Martínková, Jana; Kočvarová, Marie; Klimešová, Jitka

2004-01-01

Roč. 25, č. 3 (2004), s. 143-150 ISSN 1146-609X R&D Projects: GA AV ČR KSK6005114; GA ČR GD206/03/H034; GA ČR GA206/01/1039 Institutional research plan: CEZ:AV0Z6005908 Keywords : root-sprouting * bud bank * disturbance Subject RIV: EF - Botanics Impact factor: 1.034, year: 2004

The ecological classification of coastal wet longleaf pine (pinus palustris) of Florida from reference conditions

Science.gov (United States)

George L. McCaskill; Jose. Shibu

2012-01-01

Tropical storms, fire, and urbanization have produced a heavily fragmented forested landscape along Florida’s Gulf coast. The longleaf pine forest, one of the most threatened ecosystems in the US, makes up a major part of this fragmented landscape. These three disturbance regimes have produced a mosaic of differently-aged pine patches of single or two cohort structures...

Mineralogical composition changes of postagrogenic soils under different plant communities.

Science.gov (United States)

Churilin, Nikita; Chizhikova, Natalia; Varlamov, Evgheni; Churilina, Alexandra

2017-04-01

Plant communities play the leading role in transformation of soil. The need of studying former arable lands increases due to large number of abandoned lands in Russia. It is necessary to study mineralogical composition of soils involved into natural processes to understand the trends of their development after agricultural activities in the past. The aim of the study is to identify changes in mineralogical composition of soils under the influence of different plant communities. Soils were sampled in the south of Arkhangelsk region, Ustyansky district, near Akichkin Pochinok village. Soils are formed on clay moraine of Moscow glaciation. Soil profiles were dug on interfluve. We selected 4 plant communities on different stages of succession: upland meadow with domination of sod grasses (Phleum pratense, Agrostis tenuis), 16-year-old birch forest where dominants are herbaceous plants such as Poa sp., Chamerion angustiflium, Agrostis tenuis, 16-year-old spruce forest with no herbaceous vegetation and 70-year-old bilberry spruce forest with domination of Vaccinium myrtillus and Vaccinium vitis-idaea. To separate soil fractions mineral content. We noticed a clear differentiation of studied soils both in the content of fraction and composition of minerals. Mineralogical composition and major mineral phases correlation of profiles under 70 years and 16 years of spruce forests are different. Mineralogical content in upper part of profile under the young spruce is more differentiated than in old spruce forest: the amount of quartz and kaolinite increases in upper horizon, although in this case the overall pattern of profile formation of clay material during podzolization remains unchanged. There is more substantial desilting under the birch forest, compared with profile under the spruce of same age within top 50 cm. Under the meadow vegetation we've discovered differentiation in mineral composition. Upper horizons contain smectite phase and differ from the underlying

Acidobacteria form a coherent but highly diverse group within the bacterial domain: evidence from environmental genomics

DEFF Research Database (Denmark)

Quaiser, Achim; Ochsenreiter, Torsten; Lanz, Christa

2003-01-01

fragments differed between 2.3% and 19.9% and were placed into two different subgroups of Acidobacteria (groups III and V). Although partial co-linearity was found between genomic fragments, the gene content around the rRNA operons was generally not conserved. Phylogenetic reconstructions with orthologues......Acidobacteria have been established as a novel phylum of Bacteria that is consistently detected in many different habitats around the globe by 16S rDNA-based molecular surveys. The phylogenetic diversity, ubiquity and abundance of this group, particularly in soil habitats, suggest an important...... palustris and Bradyrhizobium japonicum, including a conserved two-component system. Phylogenetic analysis of the putative response regulator confirmed that this similarity between Rhizobiales and Acidobacteria might be due to a horizontal gene transfer. In total, our data give first insight into the genome...

The direction of carbon and nitrogen fluxes between ramets in Agrostis stolonifera changes during ontogeny under simulated competition for light

Czech Academy of Sciences Publication Activity Database

Duchoslavová, J.; Jansa, Jan

2018-01-01

Roč. 69, č. 8 (2018), s. 2149-2158 ISSN 0022-0957 Institutional support: RVO:61388971 Keywords : Carbon * clonal plant * nitrogen Subject RIV: EE - Microbiology, Virology OBOR OECD: Microbiology Impact factor: 5.830, year: 2016

Genes Required for the Anti-Fungal Activity of a Bacterial Endophyte Isolated from a Corn Landrace Grown Continuously by Subsistence Farmers Since 1000 BC

Directory of Open Access Journals (Sweden)

Hanan R Shehata

2016-10-01

Full Text Available Endophytes are microbes that inhabit internal plant tissues without causing disease. Some endophytes are known to combat pathogens. The corn (maize landrace Chapalote has been grown continuously by subsistence farmers in the Americas since 1000 BC, without the use of fungicides, and the crop remains highly valued by farmers, in part for its natural tolerance to pests. We hypothesized that the pathogen tolerance of Chapalote may, in part, be due to assistance from its endophytes. We previously identified a bacterial endophyte from Chapalote seeds, Burkholderia gladioli strain 3A12, for its ability to combat a diversity of crop pathogens, including Sclerotinia homoeocarpa, the most important fungal disease of creeping bentgrass, a relative of maize used here as a model system. Strain 3A12 represents a unique opportunity to understand the anti-fungal activities of an endophyte associated with a crop variety grown by subsistence farmers since ancient times. Here, microscopy combined with Tn5-mutagenesis demonstrates that the anti-fungal mode of action of 3A12 involves flagella-dependent swarming towards its pathogen target, attachment and biofilm-mediated microcolony formation. The mutant screen revealed that YajQ, a receptor for the secondary messenger c-di-GMP, is a critical signaling system that mediates this endophytic mobility-based defence for its host. Microbes from the traditional seeds of farmers may represent a new frontier in elucidating host-microbe mutualistic interactions.

Growth responses of maritime sand dune plant species to arbuscular mycorrhizal fungi

Directory of Open Access Journals (Sweden)

Mariusz Tadych

2014-08-01

Full Text Available In a pot experiment conducted in a greenhouse, the response of 6 plant species dominating in the succession of vegetation of a deflation hollow of the Łeba Bar to inoculation with arbuscular mycorrhizal fungi (AMF was investigated. The inoculum was a mixture of soil, roots and spores of 5 species of AMF with the dominant species Glomus aggregatum. Except for Corynephorus canescens and Festuca rubra subsp. arenaria, both the growth and the dry matter of above-ground parts of plants of Agrostis stolonifera, Ammophila arenaria, Corynephorus canescens, Juncus articulatus and J. balticus inoculated with AMF were higher than those growing in soils lacking infection propagules of these fungi. Inoculation with AMF decreased the dry matter of root: shoot ratios in 5 plant species. This property was not determined in Festuca rubra subsp. arenaria due to the death of all control plants. The level of mycorrhizal infection was low and did not correlate with the growth responses found. The high growth reaction of Juncus spp. to AMF found in this study suggests that the opinion of non-mycotrophy or low dependence of plants of Juncaceae on AMF was based on results of investigations of plants growing in wet sites known to inhibit the formation of mycorrhizae.

High plant uptake of radiocesium from organic soils due to Cs mobility and low soil K content

International Nuclear Information System (INIS)

Sanchez, A.L.; Wright, S.M.; Naylor, C.; Kennedy, V.H.; Dodd, B.A.; Singleton, D.L.; Barnett, C.L.; Stevens, P.A.

1999-01-01

Post-Chernobyl experience has demonstrated that persistently high plant transfer of 137 Cs occurs from organic soils in upland and seminatural ecosystems. The soil properties influencing this transfer have been known for some time but have not been quantified. A pot experiment was conducted using 23 soils collected from selected areas of Great Britain, which were spiked with 134 Cs, and Agrostis capillaris grown for 19--45 days. The plant-to-soil 134 Cs concentration ratio (CR) varied from 0.06 to 44; log CR positively correlated to soil organic matter content (R 2 = 0.84), and CR values were highest for soils with low distribution coefficients (K d ) of 134 Cs. Soils with high organic matter contents and high concentrations of NH 4 + in solution showed high 134 Cs mobility (low K d ). The plant-to-soil solution 134 Cs ratio decreased sharply with increasing soil solution K + . A two parameter linear model, used to predict log CR from soil solution K + and K d , explained 94% of the variability in CR values. In conclusion, the high transfer of 134 Cs in organic soils is related to both the high 134 Cs mobility (low clay content and high NH 4 + concentrations) and low K availability

Effects of sulphuric acid and acidifying ammonium deposition on water quality and vegetation of simulated soft water ecosystem

Energy Technology Data Exchange (ETDEWEB)

Schuurkes, J.A.A.R.; Heck, I.C.C; Hesen, P.L.G.M.; Leuven, R.S.E.W.; Roelofs, J.G.M.

1986-11-01

In a greenhouse, seven identical mini-ecosystems, simulating soft water ponds, were exposed to different types of artificial rain water. The effects of rain water containing H/sub 2/SO/sub 4/ and nitrate, and rain water containing ammonium sulphate on water quality and vegetation were studied and compared. Causal relations were established between rain water quality, water chemistry and changes in floristic composition. Ammonium sulphate deposition, particularly, strongly affected water quality and vegetation development. Although ammonium sulphate deposition was only slightly acid, due to nitrification it acted as an important acid source, causing acidification to pH 3.8. Under acidified conditions, ammonium sulphate deposition led to a luxuriant growth of Juncus bulbosus and Agrostis canina. In the mini-ecosystems, H/sub 2/SO/sub 4/ deposition with a pH of 3.5 only decreased the pH of the water to 5.1 within 1 yr, the acidification of water appeared to be coupled with changes in alkalinity, sulphate, Al, Cd, Ca, Mg, K and inorganic-N. It is concluded that in NH/sub 3/-affected regions in The Netherlands, the high atmospheric deposition of ammonium sulphate probably contributes to a large extent in the acidification, eutrophication and floristic changes of oligotrophic soft waters. 10 references.

Effects of sulphuric acid and acidifying ammonium deposition on water quality and vegetation of simulated soft water ecosystems

Energy Technology Data Exchange (ETDEWEB)

Schuurkes, J.A.; Heck, I.C.; Hesen, P.L.; Leuven, R.S.; Roelofs, J.G.

1986-11-01

In a greenhouse, seven identical mini-ecosystems, simulating soft water ponds, were exposed to different types of artificial rain water. The effects of rain water containing H/sub 2/SO/sub 4/ and nitrate, and rain water containing ammonium sulfate on water quality and vegetation were studied and compared. Causal relations were established between rain water quality, water chemistry and changes in floristic composition. Ammonium sulfate deposition, particularly, strongly affected water quality and vegetation development. Although ammonium sulfate deposition was only slightly acid, due to nitrification it acted as an important acid source, causing acidification to pH = 3.8. Under acidified conditions, ammonium sulfate deposition lead to a luxuriant growth of Juncus bulbosus and Agrostis canina. In the mini-ecosystems, H/sub 2/SO/sub 4/ deposition with a pH of 3.5 only decreased the pH of the water to 5.1 within 1 yr. The acidification of water appeared to be coupled with changes in alkalinity, sulfate, Al, Cd, Ca, Mg, K and inorganic-N. It is concluded that in NH/sub 3/-affected regions in The Netherlands, the high atmospheric deposition of ammonium sulfate probably contributes to a large extent in the acidification, eutrophication and floristic changes of oligotrophic soft waters. 10 refs.

Heavy metal and nutrient uptake in plants colonizing post-flotation copper tailings.

Science.gov (United States)

Kasowska, Dorota; Gediga, Krzysztof; Spiak, Zofia

2018-01-01

Copper ore mining and processing release hazardous post-flotation wastes that are difficult for remediation. The studied tailings were extremely rich in Cu (1800 mg kg -1 ) and contaminated with Co and Mn, and contained very little available forms of P, Fe, and Zn. The plants growing in tailings were distinctly enriched in Cu, Cd, Co, Ni, and Pb, and the concentration of copper achived the critical toxicity level in shoots of Cerastium arvense and Polygonum aviculare. The redundancy analysis demonstrated significant relationship between the concentration of available forms of studied elements in substrate and the chemical composition of plant shoots. Results of the principal component analysis enabled to distinguish groups of plants which significantly differed in the pattern of element accumulation. The grass species Agrostis stolonifera and Calamagrostis epigejos growing in the tailings accumulated significantly lower amounts of Cu, but they also had the lowest levels of P, Fe, and Zn in comparison to dicotyledonous. A. stolonifera occurred to be the most suitable species for phytostabilization of the tailings with regard to its low shoot Cu content and more efficient acquisition of limiting nutrients in relation to C. epigejos. The amendments improving texture, phosphorus fertilization, and the introduction of native leguminous species were recommended for application in the phytoremediation process of the tailings.

New Pesticidal Diterpenoids from Vellozia gigantea (Velloziaceae, an Endemic Neotropical Plant Living in the Endangered Brazilian Biome Rupestrian Grasslands

Directory of Open Access Journals (Sweden)

Mariana C. Ferreira

2017-01-01

Full Text Available Vellozia gigantea is a rare, ancient, and endemic neotropical plant present in the Brazilian Rupestrian grasslands. The dichloromethane extract of V. gigantea adventitious roots was phytotoxic against Lactuca sativa, Agrostis stolonifera, and Lemna paucicostata, and showed larvicidal activity against Aedes aegypti. Phytotoxicity bioassay-directed fractionation of the extract revealed one new isopimaradiene, 8(9,15-isopimaradien-1,3,7,11-tetraone, and three new cleistanthane diterpenoids, 7-oxo-8,11,13-cleistanthatrien-3-ol, 3,20-epoxy-7-oxo-8,11,13-cleistanthatrien-3-ol, and 20-nor-3,7-dioxo-1,8,11,13-cleistanthatetraen-10-ol. These new structures are proposed based on interpretation of 1H, 13C, COSY, NOESY, HSQC, and HMBC NMR data. 8(9,15-isopimaradien-1,3,7,11-tetraone was especially phytotoxic with an IC50 value (30 μM comparable to those of commercial herbicides clomazone, EPTC, and naptalam. In addition, 7-oxo-8,11,13-cleistanthatrien-3-ol provided 100% mortality at a concentration of 125 ppm against one-day-old Ae. aegypti larvae. Our results show that ancient and unique plants, like the endangered narrowly endemic neotropical species V. gigantea present in the Rupestrian grasslands, should also be protected because they can be sources of new bioactive compounds.

OSMUNDACEAE EN ARGENTINA, PARAGUAY Y URUGUAY

Directory of Open Access Journals (Sweden)

Marcelo D. Arana

2015-01-01

Full Text Available En este estudio se actualiza la taxonomía y distribución de las Osmundaceae, familia de helechos que habitan bosques y humedales subtropicales de la Argentina, Paraguay y Uruguay. Actualmente la familia comprende cuatro géneros, dos de ellos, con una especie cada uno, estan presentes en la región estudiada. Se acepta Osmunda spectabilis como una especie válida, diferente de O. regalis , la que no se encuentra presente en el área de estudio. Se reconoce a nivel de género a Osmundastrum con una única especie O. cinnamomeum var. cinnamomeum . Se incluyen una clave para los géneros, descripciones, la sinonimia relevante para América del Sur, distribuciones e ilustraciones de las especies. Se lectotipifica a Osmunda imbricata, Osmunda palustris y Osmunda spectabilis var. brasiliensis .

Macrozoobenthic recolonization of the littoral and the soft bottom after an oil spill

International Nuclear Information System (INIS)

Lax, H.J.; Vainio, T.

1988-01-01

Two years after the Eira oil spill the oil concentration in the water had returned to its background level (0.5 ug/l) in the open sea areas. On the polluted shores (depth 0.1- 0.5 m) higher concentrations (2.3 ug/l) occurred occasionaly. No clear effects related to the oil spill were noticed on the dominating soft bottom species (Macoma baltica, Pontoporeia affinis). Among the other soft bottom species the crustacean Corophium volutator showed its lowest density immediately after the spill, becoming more and more abundant during the following two years. The effect of the oil spill on the littoral fauna could still be noticed two years after the spill. The crustacean Gammarus duebeni avoided its natural habitat (uppermost littoral zone). Lymnaea palustris showed and increased mortality immediately after the oil spill but recolonized the polluted shores a normal distribution

Scaling of phloem structure and optimality of photoassimilate transport in conifer needles

DEFF Research Database (Denmark)

Ronellenfitsch, Henrik; Liesche, Johannes; Jensen, Kaare Hartvig

2015-01-01

The phloem vascular system facilitates transport of energy-rich sugar and signalling molecules in plants, thus permitting long-range communication within the organism and growth of non-photosynthesizing organs such as roots and fruits. The flow is driven by osmotic pressure, generated...... by differences in sugar concentration between distal parts of the plant. The phloem is an intricate distribution system, and many questions about its regulation and structural diversity remain unanswered. Here, we investigate the phloem structure in the simplest possible geometry: a linear leaf, found......, for example, in the needles of conifer trees. We measure the phloem structure in four tree species representing a diverse set of habitats and needle sizes, from 1 (Picea omorika) to 35 cm (Pinus palustris). We show that the phloem shares common traits across these four species and find that the size of its...

Time series analysis of forest carbon dynamics: recovery of Pinus palustris physiology following a prescribed fire

Science.gov (United States)

G. Starr; C. L. Staudhammer; H. W. Loescher; R. Mitchell; A. Whelan; J. K. Hiers; J. J. O’Brien

2015-01-01

Frequency and intensity of fire determines the structure and regulates the function of savanna ecosystems worldwide, yet our understanding of prescribed fire impacts on carbon in these systems is rudimentary. We combined eddy covariance (EC) techniques and fuel consumption plots to examine the short-term response of longleaf pine forest carbon dynamics to one...

Imputation of individual longleaf pine (Pinus palustris Mill.) tree attributes from field and LiDAR data

Science.gov (United States)

Carlos A. Silva; Andrew T. Hudak; Lee A. Vierling; E. Louise Loudermilk; Joseph J. O' Brien; J. Kevin Hiers; Steve B. Jack; Carlos Gonzalez-Benecke; Heezin Lee; Michael J. Falkowski; Anahita Khosravipour

2016-01-01

Light Detection and Ranging (LiDAR) has demonstrated potential for forest inventory at the individual-tree level. The aim in this study was to predict individual-tree height (Ht; m), basal area (BA; m2), and stem volume (V; m3...

Moulting and wintering grounds of Marsh Warblers Acrocephalus palustris: evidence from stable isotopes and ring recoveries

Czech Academy of Sciences Publication Activity Database

Procházka, Petr; Kralj, J.; Pearson, D. J.; Yohannes, E.

2014-01-01

Roč. 49, č. 2 (2014), s. 193-200 ISSN 0001-6454 R&D Projects: GA ČR GA13-06451S Institutional support: RVO:68081766 Keywords : bird migration * feather stable isotopes * ring recoveries * stopover * migratory connectivity * δ13C * δ15N Subject RIV: EG - Zoology Impact factor: 0.745, year: 2014

Spatial patterns of longleaf pine (Pinus palustris) seedling eastablishment on the croatan national forest, North Carolina

Science.gov (United States)

Chadwick R. Avery; Susan Cohen; Kathleen C. Parker; John S. Kush

2004-01-01

Ecological research aimed at determining optimal conditions for longleaf pine regeneration has become increasingly important in efforts @ restore the longleaf pine ecosystem. Numerous authors have concluded that a negative relationship exists between the occurrence of seedlings and the occurrence of mature trees; however, observed field conditions in several North...

Differences in mycorrhizal communities between Epipactis palustris, E. helleborine and its presumed sister species E. neerlandica

OpenAIRE

Jacquemyn, Hans; Waud, Michael; Lievens, Bart; Brys, Rein

2016-01-01

Background and Aims In orchid species that have populations occurring in strongly contrasting habitats, mycorrhizal divergence and other habitat-specific adaptations may lead to the formation of reproductively isolated taxa and ultimately to species formation. However, little is known about the mycorrhizal communities associated with recently diverged sister taxa that occupy different habitats.

Check-list of the pentastomid parasites crocodilians and freshwater chelonians.

Science.gov (United States)

Junker, K; Boomker, J

2006-03-01

Based on published records and own data a summary is given of the geographical distribution of the currently known species of pentastomid parasites infecting crocodiles and alligators, as well as freshwater chelonians. A brief generic diagnosis is provided for each genus. Fourteen out of the currently 23 living crocodilian species have been recorded as being host to one or more pentastomes. Out of the 32 pentastome species six are considered species inquirendae. Presently, six genera of crocodilian pentastomes, Agema, Alofia, Leiperia, Sebekia, Selfia and Subtriquetra are recognized. African crocodiles harbour eight pentastome species, six of which have been recorded from the Nile crocodile, Crocodylus niloticus. Three species belong to the genus Sebekia, Alofia being represented by two and Leiperia by only one species. Two species, Alofia parva and Agema silvae-palustris, occur in the dwarf crocodile, Osteolaemus tetraspis, and the slender-snouted crocodile, Crocodylus cataphractus, exclusively, but a single Sebekia species is shared with the Nile crocodile. The genus Agema is endemic to the African region. Infective stages of the pentastome Subtriquetra rileyi, thought to utilize Nile crocodiles as final hosts, have been recovered only from fishes. The largest number of pentastome species is found in the Australasian region. Of these, the Indo-Pacific crocodile, Crocodylus porosus, harbours seven, representing the genera Alofia, Sebekia, Leiperia and Selfia. Selfia is exclusive to the latter host. The genus Subtriquetra has been reported from "Indian crocodiles", a term possibly referring to either Crocodylus palustris, Crocodylus porosus or Gavialis gangeticus. Ten species of pentastomes parasitizing the crocodilian genera Alligator, Caiman, Crocodylus and Melanosuchus have been recorded from the Neotropical region including the southern states of the North American continent. The two most wide-spread pentastome genera, Alofia and Sebekia, have been recorded

Rice field flora and vegetation in the provinces of Valencia and Tarragona

Directory of Open Access Journals (Sweden)

Carretero, J. L.

1988-01-01

Full Text Available Twenty nine emergent and twenty floating or submerged taxa , were found in the rice fields in Valencia and Tarragona provinces. Eleven of the se taxa, all them emergent, are alien Of introduced ones. Echinochloa oryzoides and E. oryzicola are the most important in both areas, together with Cyperus difformis and Echinochloa hispidula in Valencia. The remaining thirty eight taxa belong to the native flora. There are predominantly the emergent Scirpus maritimus, Alisma plantago-aquatica. Echinochloa crus-galli and Paspalum distichum; the floating Lemna minor and L. gibba; the submersed Potamogeton nodosus; Zannichellia palustris and Najas minor; and the macroscopical algae Chara vulgaris, Cladophora glomerata, Oedogonium capilliforme, Spirogyra spp., Pithophora oedogania and Hydrodictyon reticulatum. The flora evolution during the last years is analyzed and the present weed communities are studied. The contribution of the different phytosociological classes to the rice field weed flora is presented.

De los 49 táxones registrados (29 emergentes y 20 flotantes o sumergidos 11 son exóticos introducidos, de los cuales los más importantes son Echinochloa oryzoides y E. oryzicolaen ambas zonas, además de Cyperus difformis y Echinochloa hispidula en Valencia, y el resto propios de la flora autóctona, predominando Scirpus maritimus, Alisma plantago-aquatica. Echinochloa crus-galli y Paspalum distichum como emergentes, Lemna minor y L. gibba como flotantes, Potamogeton nodosus, Zannichellia palustris y Najas minor como sumergidos y Chara vulgaris, Cladophora glomerata, Oedogonium capilliforme. Spirogyra spp., Pirhophora oedogonia e Hydrodictyon reticulatum como algas macroscópicas. Se analiza la evolución experimentada por la flora en los últimos años, además de estudiar las

The effect of flooding and injury on vegetative regeneration from roots: a case study with Rorippa palustris

Czech Academy of Sciences Publication Activity Database

Sosnová, Monika; Klimešová, Jitka

2013-01-01

Roč. 214, č. 8 (2013), 999-1006 ISSN 1385-0237 R&D Projects: GA ČR GA526/09/0963 Institutional support: RVO:67985939 Keywords : root buds * submergence * disturbance Subject RIV: EH - Ecology, Behaviour Impact factor: 1.640, year: 2013

Life-history variation in the short-lived herb Rorippa palustris: effects of germination date and injury timing

Czech Academy of Sciences Publication Activity Database

Klimešová, Jitka; Sosnová, Monika; Martínková, Jana

2007-01-01

Roč. 189, - (2007), s. 237-246 ISSN 1385-0237 R&D Projects: GA ČR GD206/03/H034 Institutional research plan: CEZ:AV0Z60050516 Keywords : Bud bank * Cohorts * Life history Subject RIV: EF - Botanics Impact factor: 1.236, year: 2007

No evidence for memory interference across sessions in food hoarding marsh tits Poecile palustris under laboratory conditions.

Science.gov (United States)

Urhan, A Utku; Brodin, Anders

2015-05-01

Scatter hoarding birds are known for their accurate spatial memory. In a previous experiment, we tested the retrieval accuracy in marsh tits in a typical laboratory set-up for this species. We also tested the performance of humans in this experimental set-up. Somewhat unexpectedly, humans performed much better than marsh tits. In the first five attempts, humans relocated almost 90 % of the caches they had hidden 5 h earlier. Marsh tits only relocated 25 % in the first five attempts and just above 40 % in the first ten attempts. Typically, in this type of experiment, the birds will be caching and retrieving many times in the same sites in the same experimental room. This is very different from the conditions in nature where hoarding parids only cache once in a caching site. Hence, it is possible that memories from previous sessions will disturb the formation of new memories. If there is such proactive interference, the prediction is that success should decay over sessions. Here, we have designed an experiment to investigate whether there is such memory interference in this type of experiment. We allowed marsh tits and humans to cache and retrieve in three repeated sessions without prior experience of the arena. The performance did not change over sessions, and on average, marsh tits correctly visited around 25 % of the caches in the first five attempts. The corresponding success in humans was constant across sessions, and it was around 90 % on average. We conclude that the somewhat poor performance of the marsh tits did not depend on proactive memory interference. We also discuss other possible reasons for why marsh tits in general do not perform better in laboratory experiments.

Field-scale study of the influence of differing remediation strategies on trace metal geochemistry in metal mine tailings from the Irish Midlands.

Science.gov (United States)

Perkins, William T; Bird, Graham; Jacobs, Suzanne R; Devoy, Cora

2016-03-01

Mine tailings represent a globally significant source of potentially harmful elements (PHEs) to the environment. The management of large volumes of mine tailings represents a major challenge to the mining industry and environmental managers. This field-scale study evaluates the impact of two highly contrasting remediation approaches to the management and stabilisation of mine tailings. The geochemistry of the tailings, overlying amendment layers and vegetation are examined in the light of the different management approaches. Pseudo-total As, Cd and Pb concentrations and solid-state partitioning (speciation), determined via sequential extraction, were established for two Tailings Management Facilities (TMFs) in Ireland subjected to the following: (1) a 'walk-away' approach (Silvermines) and (2) application of an amendment layer (Galmoy). PHE concentrations in roots and herbage of grasses growing on the TMFs were also determined. Results identify very different PHE concentration profiles with depth through the TMFs and the impact of remediation approach on concentrations and their potential bioavailability in the rooting zone of grass species. Data also highlight the importance of choice of grass species in remediation approaches and the benefits of relatively shallow-rooting Agrostis capillaris and Festuca rubra varieties. In addition, data from the Galmoy TMF indicate the importance of regional soil geochemistry for interpreting the influence of the PHE geochemistry of capping and amendment layers applied to mine tailings.

The impact of nitrogen deposition on acid grasslands in the Atlantic region of Europe

Energy Technology Data Exchange (ETDEWEB)

Stevens, Carly J., E-mail: c.j.stevens@open.ac.uk [Department of Life Sciences, The Open University, Walton Hall, Milton Keynes MK7 6AA (United Kingdom); Lancaster Environment Centre, Lancaster University, Lancaster LA1 4YQ (United Kingdom); Dupre, Cecilia [Institute of Ecology, FB 2, University of Bremen, Leobener Str., DE-28359 Bremen (Germany); Dorland, Edu [Ecology and Biodiversity Group, Department of Biology, Institute of Environmental Biology, Utrecht University, PO Box 80.058, 3508 TB Utrecht (Netherlands); Gaudnik, Cassandre [University of Bordeaux 1, UMR INRA 1202 Biodiversity, Genes and Communities, Equipe Ecologie des Communautes, Batiment B8 - Avenue des Facultes, F-33405 Talence (France); Gowing, David J.G. [Department of Life Sciences, The Open University, Walton Hall, Milton Keynes MK7 6AA (United Kingdom); Bleeker, Albert [Department of Air Quality and Climate Change, Energy Research Centre of the Netherlands, PO Box 1, 1755 ZG Petten (Netherlands); Diekmann, Martin [Institute of Ecology, FB 2, University of Bremen, Leobener Str., DE-28359 Bremen (Germany); Alard, Didier [University of Bordeaux 1, UMR INRA 1202 Biodiversity, Genes and Communities, Equipe Ecologie des Communautes, Batiment B8 - Avenue des Facultes, F-33405 Talence (France); Bobbink, Roland [B-WARE Research Centre, Radboud University, PO Box 9010, 6525 ED Nijmegen (Netherlands); Fowler, David [NERC Centre for Ecology and Hydrology, Bush Estate, Penicuik, Midlothian EH26 0QB (United Kingdom); Corcket, Emmanuel [University of Bordeaux 1, UMR INRA 1202 Biodiversity, Genes and Communities, Equipe Ecologie des Communautes, Batiment B8 - Avenue des Facultes, F-33405 Talence (France); Mountford, J. Owen [NERC Centre for Ecology and Hydrology, MacLean Building, Benson Lane, Crowmarsh Gifford, Wallingford, Oxfordshire OX10 8BB (United Kingdom); Vandvik, Vigdis [Department of Biology, University of Bergen, Box 7800, N-5020 Bergen (Norway)

2011-10-15

A survey of 153 acid grasslands from the Atlantic biogeographic region of Europe indicates that chronic nitrogen deposition is changing plant species composition and soil and plant-tissue chemistry. Across the deposition gradient (2-44 kg N ha{sup -1} yr{sup -1}) grass richness as a proportion of total species richness increased whereas forb richness decreased. Soil C:N ratio increased, but soil extractable nitrate and ammonium concentrations did not show any relationship with nitrogen deposition. The above-ground tissue nitrogen contents of three plant species were examined: Agrostis capillaris (grass), Galium saxatile (forb) and Rhytidiadelphus squarrosus (bryophyte). The tissue nitrogen content of neither vascular plant species showed any relationship with nitrogen deposition, but there was a weak positive relationship between R. squarrosus nitrogen content and nitrogen deposition. None of the species showed strong relationships between above-ground tissue N:P or C:N and nitrogen deposition, indicating that they are not good indicators of deposition rate. - Highlights: > N deposition is negatively correlated with forb richness as a proportion of species richness. > Soil C:N ratio increased with increasing N deposition. > Soil extractable nitrate and ammonium were not related to nitrogen deposition. > Plant-tissue N content was not a good indicator of N deposition. - Atmospheric nitrogen deposition affects soils, plant-tissue chemistry and plant species composition in acid grasslands in the Atlantic biogeographic region of Europe.

The impact of nitrogen deposition on acid grasslands in the Atlantic region of Europe

International Nuclear Information System (INIS)

Stevens, Carly J.; Dupre, Cecilia; Dorland, Edu; Gaudnik, Cassandre; Gowing, David J.G.; Bleeker, Albert; Diekmann, Martin; Alard, Didier; Bobbink, Roland; Fowler, David; Corcket, Emmanuel; Mountford, J. Owen; Vandvik, Vigdis

2011-01-01

A survey of 153 acid grasslands from the Atlantic biogeographic region of Europe indicates that chronic nitrogen deposition is changing plant species composition and soil and plant-tissue chemistry. Across the deposition gradient (2-44 kg N ha -1 yr -1 ) grass richness as a proportion of total species richness increased whereas forb richness decreased. Soil C:N ratio increased, but soil extractable nitrate and ammonium concentrations did not show any relationship with nitrogen deposition. The above-ground tissue nitrogen contents of three plant species were examined: Agrostis capillaris (grass), Galium saxatile (forb) and Rhytidiadelphus squarrosus (bryophyte). The tissue nitrogen content of neither vascular plant species showed any relationship with nitrogen deposition, but there was a weak positive relationship between R. squarrosus nitrogen content and nitrogen deposition. None of the species showed strong relationships between above-ground tissue N:P or C:N and nitrogen deposition, indicating that they are not good indicators of deposition rate. - Highlights: → N deposition is negatively correlated with forb richness as a proportion of species richness. → Soil C:N ratio increased with increasing N deposition. → Soil extractable nitrate and ammonium were not related to nitrogen deposition. → Plant-tissue N content was not a good indicator of N deposition. - Atmospheric nitrogen deposition affects soils, plant-tissue chemistry and plant species composition in acid grasslands in the Atlantic biogeographic region of Europe.

Aided phytostabilisation reduces metal toxicity, improves soil fertility and enhances microbial activity in Cu-rich mine tailings.

Science.gov (United States)

Touceda-González, M; Álvarez-López, V; Prieto-Fernández, Á; Rodríguez-Garrido, B; Trasar-Cepeda, C; Mench, M; Puschenreiter, M; Quintela-Sabarís, C; Macías-García, F; Kidd, P S

2017-01-15

(Aided) phytostabilisation has been proposed as a suitable technique to decrease the environmental risks associated with metal(loid)-enriched mine tailings. Field scale evaluations are needed for demonstrating their effectiveness in the medium- to long-term. A field trial was implemented in spring 2011 in Cu-rich mine tailings in the NW of Spain. The tailings were amended with composted municipal solid wastes and planted with Salix spp., Populus nigra L. or Agrostis capillaris L. cv. Highland. Plant growth, nutritive status and metal accumulation, and soil physico- and bio-chemical properties, were monitored over three years (four years for plant growth). The total bacterial community, α- and β-Proteobacteria, Actinobacteria and Streptomycetaceae were studied by DGGE of 16s rDNA fragments. Compost amendment improved soil properties such as pH, CEC and fertility, and decreased soil Cu availability, leading to the establishment of a healthy vegetation cover. Both compost-amendment and plant root activity stimulated soil enzyme activities and induced important shifts in the bacterial community structure over time. The woody plant, S. viminalis, and the grassy species, A. capillaris, showed the best results in terms of plant growth and biomass production. The beneficial effects of the phytostabilisation process were maintained at least three years after treatment. Copyright © 2016 Elsevier Ltd. All rights reserved.

The age, palaeoclimate, palaeovegetation, coal seam architecture/mire types, paleodepositional environments and thermal maturity of syn-collision paralic coal from Mukah, Sarawak, Malaysia

Science.gov (United States)

Sia, Say-Gee; Abdullah, Wan Hasiah; Konjing, Zainey; Koraini, Ahmad Munif

2014-02-01

The Mukah coal accumulated in the Balingian Formation where the time-stratigraphic position is poorly defined by fauna, though a probable Late Miocene age has always been assigned to this formation. Samples collected in the present study that yielded an abundance of Casuarina pollen associated with occurrences of Dacrydium, Stenochlaena palustris, Florschuetzia levipoli and also Stenochlaena areolaris spores, compare closely to zone PR9 of the palynological zonation of the Malay Basin, and can be tied to depositional sequences of Malay Basin Seismic sequences I2000/I3000, indicating an Early Miocene age for the studied coal. The Early Miocene age shows that the Mukah coal was formed during the collision between Luconia Block-Dangerous Grounds with the Borneo that lasted from Late Eocene to late Early Miocene. The rapid increase of deposition base-level caused by the collision is clearly reflected by the architecture of the Mukah coal seams that were generally thin, and also by the reverse order of the paleo-peat bodies.

Kocuria polaris sp. nov., an orange-pigmented psychrophilic bacterium isolated from an Antarctic cyanobacterial mat sample.

Science.gov (United States)

Reddy, Gundlapally S N; Prakash, Jogadhenu S S; Prabahar, Vadivel; Matsumoto, Genki I; Stackebrandt, Erko; Shivaji, Sisinthy

2003-01-01

Strain CMS 76orT, an orange-pigmented bacterium, was isolated from a cyanobacterial mat sample from a pond located in McMurdo Dry Valley, Antarctica. On the basis of chemotaxonomic and phylogenetic properties, strain CMS 76orT was identified as a member of the genus Kocuria. It exhibited a 16S rDNA similarity of 99.8% and DNA-DNA similarity of 71% with Kocuria rosea (ATCC 186T). Phenotypic traits confirmed that strain CMS 78orT and K. rosea were well differentiated. Furthermore, strain CMS 76orT could be differentiated from the other reported species of Kocuria, namely Kocuria kristinae (ATCC 27570T), Kocuria varians (ATCC 15306T), Kocuria rhizophila (DSM 11926T) and Kocuria palustris (DSM 11025T), on the basis of a number of phenotypic features. Therefore, it is proposed that strain CMS 76orT (= MTCC 3702T = DSM 14382T) be assigned to a novel species of the genus Kocuria, as Kocuria polaris.

Electron uptake by iron-oxidizing phototrophic bacteria

Energy Technology Data Exchange (ETDEWEB)

Bose, A; Gardel, EJ; Vidoudez, C; Parra, EA; Girguis, PR

2014-02-26

Oxidation-reduction reactions underlie energy generation in nearly all life forms. Although most organisms use soluble oxidants and reductants, some microbes can access solid-phase materials as electron-acceptors or -donors via extracellular electron transfer. Many studies have focused on the reduction of solid-phase oxidants. Far less is known about electron uptake via microbial extracellular electron transfer, and almost nothing is known about the associated mechanisms. Here we show that the iron-oxidizing photoautotroph Rhodopseudomonas palustris TIE-1 accepts electrons from a poised electrode, with carbon dioxide as the sole carbon source/electron acceptor. Both electron uptake and ruBisCo form I expression are stimulated by light. Electron uptake also occurs in the dark, uncoupled from photosynthesis. Notably, the pioABC operon, which encodes a protein system essential for photoautotrophic growth by ferrous iron oxidation, influences electron uptake. These data reveal a previously unknown metabolic versatility of photoferrotrophs to use extracellular electron transfer for electron uptake.

The vertebrate fauna of Ichauway, Baker County, GA

Science.gov (United States)

Smith, L.L.; Steen, D.A.; Stober, J.M.; Freeman, Mary C.; Golladay, S.W.; Conner, L.M.; Cochrane, J.

2006-01-01

Less than 4% of the once extensive Pinus palustris (longleaf pine) ecosystem remains today. Although longleaf pine habitats are recognized for their high species diversity, few published accounts document the vertebrate faunas of remaining tracts. Here we report on the vertebrate species richness of lchauway, an 11,300-ha property in Baker County, GA. The property includes ca. 7300 ha of longleaf pine with native ground cover, along with more than 30 seasonal wetlands and ca. 45 km of riparian habitat associated with Ichawaynochaway Creek, Big Cypress Creek, and the Flint River. The fauna includes 61 species of fish, 31 amphibians, 53 reptiles, 191 birds, and 41 mammals. Despite the relative isolation of the property from other natural ecosystems, the vertebrate fauna of lchauway is remarkably diverse and may offer an example of reference conditions to guide restoration of longleaf pine forests, associated seasonal wetlands, and riparian areas elsewhere in the southeastern U S.

210Pb content in phytocoenoses with cranberry

International Nuclear Information System (INIS)

Dushanskene-Duzh, R.F.; Butkus, V.F.

1983-01-01

The purpose of the paper is to study 210 Pb concentration levels in different biotopes of cranberry growing (Oxycoccus palustris Pers.), to determine concentration distribution of this radionuclide over the organs of this plant and to reveal the effect of ecological conditions on concentration levels. Material is collected in southern Lithua in five biotopes in the form of certain belts of plant communities: reed brushwood (mesotrophic place of groWth), lake mire (mesotrophic place of growing), grassy-forest belt (oligotropic bog), forest belt (low slope of the upper ologotrophic bog), head mire (central part of oligotrophic bog). It is stated that levels and distribution of 210 Pb concentration in cranberry organs growing in oligotrophic and mesotrophic biotopes are approximately equal. Its largest part is concentrated in roots, then come shoots with leaves and only negligible part falls on fruits. Direct correlation exists between 210 Pb concentration in roots and shoots with leaves, and back correlation exists between shoots with leaves and fruits

[Host plants of Aphis gossypii (Aphididae), vector of virus of Cucumis melo melon (Cucurbitaceae) in Costa Rica].

Science.gov (United States)

Sánchez, M V; Agüero, R; Rivera, C

2001-03-01

Plant species associated with commercial melon crops and surrounding areas were examined to identity the natural host plants of Aphis gossypii Glover. The study was conducted in two farms located in different melon production areas and plant life zones of Costa Rica. Plant species diversity, percent coverage and distribution over time were recorded during one year. Differences between locations were observed. A total of 86 plant species (49 families) and 72 plant species (40 families) were identified associated to the crop in farms A and B, respectively. In both farms a total of 24 species plants (16 families) were colonized by A. gossypii and 16 (10 families) are new reports of host plant species for this aphid. The new reports are: Justicia comata, Tetramerium nervosum, Alternanthera pubiflora, Cassia massoni, C. reticulata, Cleome viscosa, C. spinosa, Croton argenteus, Caperonia palustris, Chamaesyce gyssopilopia, Phyllantus amarus, Sida decumbens, Ludwigia erecta, Passiflora foetida, Guazuma ulmifolia and Corchorus orinocensis.

Current distribution of Pilularia globulifera L. in Poland – changes of geographical range and habitat preferences

Directory of Open Access Journals (Sweden)

Ewa Szczęśniak

2012-10-01

Full Text Available Pilularia globulifera is a subatlantic European fern threatened with extinction. In Poland, it reaches the eastern border of its continuous range. Up to the end of the 20th century, it was observed here in 21 stands; only 2 of them existed by the second half of the century, so the species was categorized as critically endangered. Five new locations have been found in western and northwestern Poland during the last 10 years. Abundant and permanent populations grow in 3 locations, while 2 stands were ephemeral. All the current stands are situated in anthropogenic habitats with spontaneous vegetation, in oligotrophic to eutrophic waters. One of the new localities is about 280 km distant from the eastern range of the limit known previously. Pilularia forms its own plant community Pilularietum globuliferae, enters plots of Ranunculo-Juncetum bulbosi and occurs in mesotrophic to eutrophic rushes of Eleocharis palustris, Phragmites australis, Typha angustifolia and Equisetum fluviatile. Specimens are vigorous and regularly produce sporocarps.

Asymmetries in commitment in an avian communication network

Science.gov (United States)

Randler, Christoph; Vollmer, Christian

2013-02-01

Mobbing of predators occurs within a conspecific and heterospecific context but has not been quantified within the framework of a communication network and analysed with respect to heterospecific reciprocity. Here, we used playbacks of mobbing calls to show that mobbing is unequally distributed within a community of deciduous forest birds. Five species (great tit Parus major, blue tit Cyanistes caeruleus, marsh tit Poecile palustris, nuthatch Sitta europaea and chaffinch Fringilla coelebs) responded to each other's playbacks of mobbing calls. Commitment to mob was measured by minimum distance, response latency and uttering of calls. Commitment was higher when conspecific calls were broadcast. Yet, responses to heterospecific calls were significantly different between the five species. Chaffinches had the lowest commitment, and blue tits tended to have the highest. The communication network is asymmetric. Some species invest more than they receive from other species. As mobbing might incur costs, these are unequally distributed across the community.

Modeling the relationship between water level, wild rice abundance, and waterfowl abundance at a central North American wetland

Science.gov (United States)

Aagaard, Kevin; Eash, Josh D.; Ford, Walt; Heglund, Patricia J.; McDowell, Michelle; Thogmartin, Wayne E.

2018-01-01

Recent evidence suggests wild rice (Zizania palustris), an important resource for migrating waterfowl, is declining in parts of central North America, providing motivation to rigorously quantify the relationship between waterfowl and wild rice. A hierarchical mixed-effects model was applied to data on waterfowl abundance for 16 species, wild rice stem density, and two measures of water depth (true water depth at vegetation sampling locations and water surface elevation). Results provide evidence for an effect of true water depth (TWD) on wild rice abundance (posterior mean estimate for TWD coefficient, β TWD = 0.92, 95% confidence interval = 0.11—1.74), but not for an effect of wild rice stem density or water surface elevation on local waterfowl abundance (posterior mean values for relevant parameters overlapped 0). Refined protocols for sampling design and more consistent sampling frequency to increase data quality should be pursued to overcome issues that may have obfuscated relationships evaluated here.

Evaluating the effectiveness of phosphate fertilizers in some Venezuelan soils

International Nuclear Information System (INIS)

Casanova, E.; Salas, A.M.; Toro, M.

2002-01-01

In Venezuela, 70% of the soils are acid with low natural fertility where phosphorus is the most limiting element together with nitrogen and potassium for plant growth. The efficiency of phosphate fertilization is low. Greenhouse and field experiments were conducted to evaluate the efficiency of natural and modified rock phosphate using conventional and isotopic techniques. An incubation experiment was done to measure changes in available P on application of different phosphate fertilizers at a constant rate of 100 mg P/kg in ten acid soils of agricultural importance in Venezuela. In the greenhouse, two experiments were conducted to relate P fixation to soil P availability and the response of an index plant (Agrostis sp.). A high variability in P fixing capacity of the soils (r1/Ro = 0.02-0.76) was observed with the same level of available P. This fixation index is defined as the proportion of the added radioactivity ( 32 P) remaining in the soil solution after 1 min of exchange and a low fixing capacity is indicated by the values close to 1. The proportion of the total soil P that can possibly enter the soil solution and therefore is potentially available for plant uptake was measured using the traditional method (Bray I) and the isotopic method (E value). The high variability was also apparent in available P extracted by Bray I showing a range of 10 to 88% of the total P removed by the extracting solution. The incubation studies showed that the effectiveness of the P source for available P in the soil solution was related to their reactivity and the soil P fixing properties. The increase in the fixing capacity of the soils used caused a significant reduction in the E value, independent of the source of P used. A high positive and significant correlation between Bray I extracted P and the E value (r = 0.95) obtained from the different treatments, showed the relationship of the extractant for some forms of available P in soils where rock phosphate was applied. In

Distribution of grasses along an altitudinal gradient in a Venezuelan paramo Distribución de gramíneas a lo largo de un gradiente altitudinal en un páramo de Venezuela

Directory of Open Access Journals (Sweden)

EDJULY J. MÁRQUEZ

2004-12-01

Full Text Available In Venezuelan paramos grasses, after Asteraceae, are the second family in numerical importance. We studied their distribution in an altitudinal gradient located in Venezuela, Sierra de La Culata, between 2,500 and 4,200 m of altitude. Twenty one 32 m parallel line transects every 50 m were placed along the gradient, perpendicular to the main slope. Each line was divided into contiguous 50 x 50 cm sampling units. Grass species occurrence inside each sample unit was considered to determine their frequency in each line or altitude. The peak and altitudinal amplitude was determined through the weighted averaging method. A total of 47 grass species were found along the gradient. Agrostis was the best-represented genus in the gradient. Considering the distribution ranges, we assume that there are different biotic and abiotic processes determining the distribution patterns. The species occurring at the highest altitudes were temperate elements, while those in the lowest areas were tropical and subtropical elements. Seven species in the gradient are endemic to the Venezuelan paramos. Grass distribution patterns in the paramo may be related to phytogeographical origin. In order to better understand the plant altitudinal distribution pattern is necessary to consider the plant responses to low temperatures, high incoming radiation, water stress and slope aspectEn los páramos de Venezuela las gramíneas son la segunda familia numéricamente más importante, después de las Asteraceae. Nosotros estudiamos su distribución en un gradiente altitudinal ubicado en Venezuela, Sierra de La Culata, entre 2.500 y 4.200 m de altitud. Para esto colocamos 21 transectas de 32 m de longitud a lo largo del gradiente, ubicados de manera perpendicular a la pendiente, cada 50 m en altitud. Cada transecta estaba dividida en unidades de muestreo contiguas de 50 x 50 cm. Para estimar la frecuencia de las especies en cada transecta o altitud, consideramos la ocurrencia de las

Fire Frequency Effects on Longleaf Pine (Pinus palustris P. Miller) Vegetation in South Carolina and Northeast Florida, USA

Science.gov (United States)

Jeff S. Glitzenstein; Donna R. Streng; Dale D. Wade

2003-01-01

Southeastern United States habitats dominated by longleaf pine (Pinus pulutris P. Miller) have declined precipitously in area and extent. Conservation of diverse ground-layer vegetation in these endangered habitats depends on prescribed fire. While the need for prescribed fire is now generally accepted, there is disagreement concerning the most...

Study of Feasibility Integrated Agroindustry Development Unit Black Grass Jelly Powder (Mesona palustris in Province of East Java

Directory of Open Access Journals (Sweden)

Irvan Adhin Cholilie

2017-01-01

Full Text Available Potential of black grass jelly plant in Indonesia is very prospective. These plants grow in areas such as Malang East Java, Pacitan, Magetan and Ponorogo. In 2010 the production of dried black grass jelly of 568 tons with a total productivity of 8.6 tons / year.  Location selection of the plant with a score weighting method produces the highest value of 4,16 for the city of Surabaya, so the establishment of the plant will be held in Surabaya. Therefore, it is necessary the application of a suitable drying models for this factory that is tunnel dryer based on the results of research and with the highest value is 4,281. To ensure the availability of black grass jelly dried leaves as raw materials of black grass jelly powder it is necessary to establish a partnership between farmers and companies. The partnership pattern that works best for black grass jelly powder factory is a partnership “inti plasma”. It is based on research with the results of the assessment and weighting by using pairwise comparison and rating scale, the value of the highest weight in the “inti plasma” partnership with a value of 4,893. By implementing this partnership will allow the factory to obtain raw materials easily and is more economical and can always be available throughout the year for partnering with farmers.    Keywords: black grass jelly powder, drying method, financial feasibility analysis, partnership patterns

Off-site transport of fungicides with runoff: A comparison of flutolanil and pentachloronitrobeneze applied to creeping bentgrass managed as a golf course fairway

Science.gov (United States)

Flutolanil and pentachloronitrobenzene (PCNB) are fungicides used to control or suppress foliar and soil borne diseases in turf and ornamental crops. On golf courses, sports fields, sod farms and commercial lawns these fungicides are used as preventive treatments to combat snow mold, brown patch an...

Off-site transport of fungicides with runoff: A comparison of flutolanil and pentachloronitrobeneze applied to creeping bentgrass managed as a golf course fairway.

Science.gov (United States)

Rice, Pamela J; Horgan, Brian P; Hamlin, Jennifer L

2018-08-15

Flutolanil and pentachloronitrobenzene (PCNB) are fungicides used to control or suppress foliar and soil borne diseases in turf and ornamental crops. On golf courses, sports fields, sod farms and commercial lawns these fungicides are used as preventive treatments to combat snow mold, brown patch and fairy ring. Depending on the aquatic organism, flultolanil and PCNB are considered to be moderately to highly toxic. Therefore runoff or drift from treated areas may be hazardous to organisms in adjacent aquatic sites. This research compared the transport of flutolanil and PCNB with runoff from turfgrass managed as a golf course fairway. The quantity of fungicide transported with runoff and observations reported with the chemographs followed trends in agreement with the chemical properties of the compounds. Overall, we observed the rate of transport for flutolanil was greater than PCNB, which contributed to the more than 12 times larger load (µg/m 2 ) of flutolanil transported off-site at the conclusion of the simulated storm runoff. A better understanding of the off-site transport of pesticides with runoff is needed to make informed decisions on management practices to reduce potential adverse effects on non-target organisms, as well as maintain control of targeted pests in the area of application. In addition, data obtained with this research can be used in model simulations to predict nonpoint source pollution potentials beyond experimental conditions. Copyright © 2018. Published by Elsevier Inc.

Assessing the potential of brachiaria decumbens as remediation agent for soil contaminated wit oil sludge

International Nuclear Information System (INIS)

Latiffah Norddin; Ahmad Nazrul Abd Wahid; Hazlina Abdullah; Abdul Razak Ruslan

2005-01-01

Bioremediation is a method of treatment of soil or water contaminated with toxic materials, involving the use of living organisms. Oil or petroleum sludge is a waste product of the petroleum refining industry, and is now accumulating at a fast rate at petroleum refinery sites in the country. Common components of oil sludge are mud and sand, containing toxic materials from hydrocarbons, heavy metals and radioactive elements from the seabed. In the present study, the oil sludge samples were obtained from barrels of the materials stored at the Radioactive Waste Treatment Centre, MINT. The samples were analysed of their compounds, elemental and radioactive contents. Trials on microbial degradation of the sludge materials were ongoing. This paper discusses the potential of a grass to remediate soils contaminated with petroleum sludge. Remediation of soils contaminated with organic compounds and heavy metals using plants, including grasses, including Vetiver, Lolium and Agrostis have been carried out in many countries. A greenhouse pot trial was conducted to assess the suitability of the pasture grass Brachiaria decumbens Stapf. and its mutant Brachiaria decumbens KLUANG Comel as a remediation agent for oil sludge contaminated soil. Samples of grasses and soils before planting, during growth stage and at end of experiment were analysed for the different toxicity. Although the grasses were promoted for use in pasture, and KLUANG Comel has good potential as an ornamental plant, too, their other potentials, including as phytoremediation agents need to be explored. (Author)

Synthesis, characterization, spectroscopic properties and DFT study of a new pyridazinone family

Science.gov (United States)

Arrue, Lily; Rey, Marina; Rubilar-Hernandez, Carlos; Correa, Sebastian; Molins, Elies; Norambuena, Lorena; Zarate, Ximena; Schott, Eduardo

2017-11-01

Nitrogen compounds are widely investigated due to their pharmacological properties such as antihypertensive, antinociceptive, antibacterial, antifungal, analgesic, anticancer and inhibition activities and lately even as pesticide. In this context, we present the synthesis of new compounds: (E)-6-(3,4-dimethoxyphenyl)-3-(3-(3,4-dimethoxyphenyl)acryloyl)-1-(4-R-phenyl)- 5,6-dihydropyridazin-4(1H)-one (with R = sbnd H(1), -Cl(2), -Br(3), sbnd I(4) and sbnd COOH(5)) that was carried out by reaction of (1E, 6E)-1,7-bis(3,4-dimethoxyphenyl)hepta-1,6-diene-3,5-dione with a substituted phenylamine with general formula p-R-C6H4sbnd NH2 (R = sbnd H (1), sbnd Cl (2), -Br(3), sbnd I(4) and sbnd COOH(5)). This is the first synthesis report of a pyridazinone using as precursors a curcuminoid derivative and a diazonium salt formed in situ. All compounds were characterized by EA, FT-IR, UV-Vis, Emission,1H- and13C-NMR spectroscopy and the crystalline and molecular structure of 4 was solved by X-rays diffraction method. DFT and TD-DFT quantum chemical calculations were also employed to characterize the compounds and provide a rational explanation to the spectroscopic properties. To assess the biological activity of the systems, we focused on pesticide tests on compound 2, which showed an inhibitory effect in plant growth of Agrostis tenuis Higland.

Soil fertilization leads to a decline in between-samples variability of microbial community δ13C profiles in a grassland fertilization experiment.

Directory of Open Access Journals (Sweden)

Stavros D Veresoglou

Full Text Available Gas chromatography combustion isotope ratio mass spectrometry (GC-C-IRMS was used to measure the (13C/(12C ratios of PLFAs at natural abundance levels from a temperate grassland nitrogen (N and phosphorus (P factorial fertilization experiment in northern Greece. In each plot two rhizosphere samples were derived centred around individual Agrostis capillaris and Prunella vulgaris plants. It was hypothesized that the isotopic signal of microbes that preferentially feed on recalcitrant litter such as fungi would be modified by fertilization more strongly than that of opportunistic microbes using labile C. Microbial community δ(13C was affected by both P and N fertilization regime and plant species identity. However, we have been unable to detect significant nutrient effects on individual groups of microbes when analyzed separately in contrast to our original hypothesis. Intra-treatment variability, as evaluated from Hartley's F(max tests in the five first PCA components axes as well as the size of the convex hulls in PCA scoreplots and Mahalanobis distances, was considerably higher in the non-fertilized controls. Moreover, a significant relationship was established between the change in PLFA abundances and their respective changes in δ(13C for the aggregate of samples and those simultaneously fertilized with N and P. We conclude that use of compound specific isotope analysis in the absence of labelling represents a valuable and overlooked tool in obtaining an insight of microbial community functioning.

Flora of the Mediterranean Rivers in Bulgaria

Directory of Open Access Journals (Sweden)

Yordanka G. Hristeva

2015-06-01

Full Text Available Species composition and distribution of aquatic bryophytes and vascular plants assemblages in Mediteranean Rivers in Bulgaria are presented in this work. Aquatic macrophytes were studied at thirteen rivers in South Bulgaria during 2014, together with abiotic factors (flow velocity, shading, and substrate type, mean depth and altitude. In total, 73 species were registered, of them 13 bryophytes and 60 vascular plants were identified. Aquatic bryophytes included 10 mosses and 3 liverworts. The recorded bryophytes species refer to 7 families and 12 genera. The most frequently distributed species was Leptodictyum riparium (Hedw. Warnst., followed by Cratoneuron filicinum (Hedw. Spruce and Platyhypnidium riparioides (Hedw. Dixon, Brachythecium rivulare Schimp. and Hygroamblystegium tenax (Hedw. Jenn. The recorded 60 species of vascular plants refer to 25 families and 43 genera. The most common hydrophyte species was Lemna minor L., followed by Ranunculus trichophyllus Chaix, Myriophyllum spicatum L. and Potamogeton nodosus Poir. The most abundant species from the group of helophytes and amphiphytes was Mentha aquatica L., followed by Agrostis stolonifera L. Mentha spicata L., Berula erecta (Huds. Coville, Juncus effusus L., Lycopus europaeus L., Lythrum salicaria L., Phalaris arundinacea L., Ranunculus repens L., Sparganium erectum L., Typha latifolia L., and Veronica anagalis-aquatica L. The majority of studied rivers sites were sunny, with moderate velocity, stony bottom, average depth up to 0.3 m and altitude between 100 and 500 m a.s.l.

Earthworms drive succession of both plant and Collembola communities in post-mining sites

Science.gov (United States)

Mudrák, Ondřej; Uteseny, Karoline; Frouz, Jan

2016-04-01

Previous field observations indicated that earthworms promote late-successional plant species and reduce collembolan numbers at post-mining sites in the Sokolov coal mining district (Czech Republic). Here, we established a laboratory pot experiment to test the effect of earthworms (Aporrectodea caliginosa Savigny and Lumbricus rubellus Hoffm.) and litter of low, medium, and high quality (the grass Calamagrostis epigejos, the willow Salix caprea, and the alder Alnus glutinosa, respectively) on late successional plants (grasses Arrhenatherum elatius and Agrostis capillaris, legumes Lotus corniculatus and Trifolium medium, and non-leguminous dicots Centaurea jacea and Plantago lanceolata) in spoil substrate originating from Sokolov post-mining sites and naturally inhabited by abundant numbers of Collembola. The earthworms increased plant biomass, especially that of the large-seeded A. elatius, but reduced the number of plant individuals, mainly that of the small-seeded A. capillaris and both legumes. Litter quality affected plant biomass, which was highest with S. caprea litter, but did not change the number of plant individuals. Litter quality did not modify the effect of earthworms on plants; the effect of litter quality and earthworms was only additive. Species composition of Collembola community was altered by litter quality, but earthworms reduced the number of individuals, increased the number of species, and increased species evenness consistently across the litter qualities. Because the results of this experiment were consistent with the field observations, we conclude that earthworms help drive succession of both plant and Collembola communities on post-mining sites.

Aerobic methanotrophic bacteria of cold ecosystems.

Science.gov (United States)

Trotsenko, Yuri A; Khmelenina, Valentina N

2005-06-01

This review summarizes the recent advances in understanding the ecophysiological role and structure-function features of methanotrophic bacteria living in various cold ecosystems. The occurrence of methanotrophs in a majority of psychrosphere sites was verified by direct measurement of their methane-utilizing activity, by electron microscopy and immunofluorescent observations, and analyses of specific signatures in cellular phospholipids and total DNAs extracted from environmental samples. Surprisingly, the phenotypic and genotypic markers of virtually all extant methanotrophs were detected in various cold habitats, such as underground waters, Northern taiga and tundra soils, polar lakes and permafrost sediments. Also, recent findings indicated that even after long-term storage in permafrost, some methanotrophs can oxidize and assimilate methane not only at positive but also at subzero temperatures. Pure cultures of psychrophilic and psychrotolerant methanotrophs were isolated and characterized as new genera and species: Methylobacter psychrophilus, Methylosphaera hansonii, Methylocella palustris, Methylocella silvestris, Methylocella tundrae, Methylocapsa acidiphila and Methylomonas scandinavica. However, our knowledge about their adaptive mechanisms and survival in cold ecosystems remains limited and needs to be established using both traditional and molecular microbiological methods.

Characterization of methanotrophic bacteria on the basis of intact phospholipid profiles.

Science.gov (United States)

Fang, J; Barcelona, M J; Semrau, J D

2000-08-01

The intact phospholipid profiles (IPPs) of seven species of methanotrophs from all three physiological groups, type I, II and X, were determined using liquid chromatography/electrospray ionization/mass spectrometry. In these methanotrophs, two major classes of phospholipids were found, phosphatidylglycerol (PG) and phosphatidylethanolamine (PE) as well as its derivatives phosphatidylmethylethanolamine (PME) and phosphatidyldimethylethanolamine (PDME). Specifically, the type I methanotrophs, Methylomonas methanica, Methylomonas rubra and Methylomicrobium album BG8 were characterized by PE and PG phospholipids with predominantly C16:1 fatty acids. The type II methanotrophs, Methylosinus trichosporium OB3b and CSC1 were characterized by phospholipids of PG, PME and PDME with predominantly C18:1 fatty acids. Methylococcus capsulatus Bath, a representative of type X methanotrophs, contained mostly PE (89% of the total phospholipids). Finally, the IPPs of a recently isolated acidophilic methanotroph, Methylocella palustris, showed it had a preponderance of PME phospholipids with 18:1 fatty acids (94% of total). Principal component analysis showed these methanotrophs could be clearly distinguished based on phospholipid profiles. Results from this study suggest that IPP can be very useful in bacterial chemotaxonomy.

Mercury and selenium contamination in waterbird eggs and risk to avian reproduction at Great Salt Lake, Utah

Science.gov (United States)

Ackerman, Joshua T.; Herzog, Mark P.; Hartman, Christopher A.; Isanhart, John P.; Herring, Garth; Vaughn, Sharon; Cavitt, John F.; Eagles-Smith, Collin A.; Browers, Howard; Cline, Chris; Vest, Josh

2015-01-01

The wetlands of the Great Salt Lake ecosystem are recognized regionally, nationally, and hemispherically for their importance as breeding, wintering, and migratory habitat for diverse groups of waterbirds. Bear River Migratory Bird Refuge is the largest freshwater component of the Great Salt Lake ecosystem and provides critical breeding habitat for more than 60 bird species. However, the Great Salt Lake ecosystem also has a history of both mercury and selenium contamination, and this pollution could reduce the health and reproductive success of waterbirds. The overall objective of this study was to evaluate the risk of mercury and selenium contamination to birds breeding within Great Salt Lake, especially at Bear River Migratory Bird Refuge, and to identify the waterbird species and areas at greatest risk to contamination. We sampled eggs from 33 species of birds breeding within wetlands of Great Salt Lake during 2010 ̶ 2012 and focused on American avocets (Recurvirostra americana), black-necked stilts (Himantopus mexicanus), Forster’s terns (Sterna forsteri), white-faced ibis (Plegadis chihi), and marsh wrens (Cistothorus palustris) for additional studies of the effects of contaminants on reproduction.

A pilot-scale study of biohydrogen production from distillery effluent using defined bacterial co-culture

Energy Technology Data Exchange (ETDEWEB)

Vatsala, T.M.; Raj, S. Mohan; Manimaran, A. (Shri AMM Murugappa Chettiar Research Centre, Photosynthesis and Energy Division, Tharamani, Chennai, India, 600)

2008-10-15

We evaluated the feasibility of improving the scale of hydrogen (H{sub 2}) production from sugar cane distillery effluent using co-cultures of Citrobacter freundii 01, Enterobacter aerogenes E10 and Rhodopseudomonas palustris P2 at 100 m{sup 3} scale. The culture conditions at 100 ml and 2 L scales were optimized in minimal medium and we observed that the co-culture of the above three strains enhanced H{sub 2} productivity significantly. Results at the 100 m{sup 3} scale revealed a maximum of 21.38 kg of H{sub 2}, corresponding to 10692.6 mol, which was obtained through batch method at 40 h from reducing sugar (3862.3 mol) as glucose. The average yield of H{sub 2} was 2.76 mol mol{sup -1} glucose, and the rate of H{sub 2} production was estimated as 0.53 kg/100 m{sup 3}/h. Our results demonstrate the utility of distillery effluent as a source of clean alternative energy and provide insights into treatment for industrial exploitation. (author)

Magnetic Microbead Affinity Selection Screening (MagMass) of Botanical Extracts for Inhibitors of 15-Lipoxygenase

Science.gov (United States)

Rush, Michael D.; Walker, Elisabeth M.; Burton, Tristesse; van Breemen, Richard B.

2016-01-01

To expedite the identification of active natural products in complex mixtures such as botanical extracts, a Magnetic Microbead Affinity Selection Screening (MagMASS) procedure was developed. This technique utilizes target proteins immobilized on magnetic beads for rapid bioaffinity isolation of ligands from complex mixtures. A MagMASS method was developed and validated for 15-lipoxygenase. As a proof of concept, several North American prairie plants used medicinally by Native Americans were extracted with MeOH and screened. A hit from an extract of Proserpinaca palustris, also known as mermaid weed, was flagged for further characterization using high-resolution tandem mass spectrometry, dereplication, and identification using XCMS online. Through the application of high-resolution product ion tandem mass spectrometry, comparison with natural product databases and confirmation using standards, the hit was identified as quercitrin, which is a known inhibitor of 15-lipoxygenase. The overall workflow of MagMASS is faster and more amendable to automation than alternative methods designed for screening botanical extracts or complex mixtures of combinatorial libraries. PMID:27802026

Evaluation of the antifungal effects of bio-oil prepared with lignocellulosic biomass using fast pyrolysis technology.

Science.gov (United States)

Kim, Kwang Ho; Jeong, Han Seob; Kim, Jae-Young; Han, Gyu Seong; Choi, In-Gyu; Choi, Joon Weon

2012-10-01

This study was performed to investigate the utility of bio-oil, produced via a fast pyrolysis process, as an antifungal agent against wood-rot fungi. Bio-oil solutions (25-100 wt.%) were prepared by diluting the bio-oil with EtOH. Wood block samples (yellow poplar and pitch pine) were treated with diluted bio-oil solutions and then subjected to a leaching process under hot water (70°C) for 72 h. After the wood block samples were thoroughly dried, they were subjected to a soil block test using Tyromyces palustris and Trametes versicolor. The antifungal effect of the 75% and 100% bio-oil solutions was the highest for both wood blocks. Scanning electron microscopy analysis indicated that some chemical components in the bio-oil solution could agglomerate together to form clusters in the inner part of the wood during the drying process, which could act as a wood preservative against fungal growth. According to GC/MS analysis, the components of the agglomerate were mainly phenolic compounds derived from lignin polymers. Copyright © 2012 Elsevier Ltd. All rights reserved.

Arsenic biotransformation and volatilization in transgenic rice

Science.gov (United States)

Meng, Xiang-Yan; Qin, Jie; Wang, Li-Hong; Duan, Gui-Lan; Sun, Guo-Xin; Wu, Hui-Lan; Chu, Cheng-Cai; Ling, Hong-Qing; Rosen, Barry P.; Zhu, Yong-Guan

2011-01-01

Summary Biotransformation of arsenic includes oxidation, reduction, methylation and conversion to more complex organic arsenicals. Members of the class of arsenite [As(III)] S-adenosylmethyltransferase enzymes catalyze As(III) methylation to a variety of mono-, di- and trimethylated species, some of which are less toxic than As(III) itself. However, no methyltransferase gene has been identified in plants. Here, an arsM gene from the soil bacterium Rhodopseudomonas palustris was expressed in Japonica rice (Oryza sativa L.) cultivar Nipponbare, and the transgenic rice produced methylated arsenic species, which were measured by inductively coupled plasma mass spectrometry (ICP-MS) and high performance liquid chromatography-inductively coupled plasma-mass spectrometry (HPLC-ICP-MS). Both monomethylarsenate [MAs(V)] and dimethylarsenate [DMAs(V)] were detected in the root and shoot of transgenic rice. After 12-d exposure to As(III), the transgenic rice gave off 10-fold more volatile arsenicals. The present study demonstrates that expression of an arsM gene in rice induces arsenic methylation and volatilization, providing a potential stratagem for phytoremediation theoretically. PMID:21517874

Marine environment status assessment based on macrophytobenthic plants as bio-indicators of heavy metals pollution.

Science.gov (United States)

Zalewska, Tamara; Danowska, Beata

2017-05-15

The main aim of study was to develop the environmental quality standards (EQS MP ) for selected heavy metals: Pb, Cd, Hg and Ni bioaccumulated in the tissues of marine macrophytobenthic plants: Chara baltica, Cladophora spp., Coccotylus truncatus, Furcellaria lumbricalis, Polysiphonia fucoides, Stuckenia pectinata and Zanichellia palustris, collected in designated areas of the southern Baltic Sea in period 2008-2015. The calculated concentration ratios (CR), which attained very high values: 10 4 Lkg -1 for lead, 10 3 Lkg -1 for nickel and mercury and even 10 5 Lkg -1 for cadmium formed the basis for the determination of EQS MP values. The EQS MP values were: 26mgkg -1 d.w. for Pb, 33mgkg -1 d.w. for Cd, 32mgkg -1 d.w. for Ni and 0.4mgkg -1 d.w. for Hg. The application of macrophytobenthic plants as bioindicators in marine environment status assessment of certain areas of the Baltic Sea is also described in the paper. Copyright © 2017 Elsevier Ltd. All rights reserved.

Vegetation Structure of Ebony Leaf Monkey (Trachypithecus auratus) Habitat in Kecubung Ulolanang Nature Preservation Central Java-Indonesia

Science.gov (United States)

Ervina, Rahmawati; Wasiq, Hidayat Jafron

2018-02-01

Kecubung Ulolanang Nature Preservation is ebony leaf monkey's habitats in Central Java Indonesia. Continuously degradation of their population is caused by illegal hunting and habitat degradation that made this species being vulnerable. Habitat conservation is one of important aspects to prevent them from extinction. The purpose of this research was to analyze the vegetation's structure and composition, which was potentially, becomes habitat and food source for the monkeys. Data collected using purposive sampling with line transect method of four different level of vegetation. Data analysis used Important Value Index and Diversity Index. There were 43 species of vegetation at seedling stage, 18 species at sapling stage, 8 species at poles stage and 27 species at trees stage. Species that had the highest important value index at seedling was Stenochlaena palustri , at the sapling was Gnetum gnemon, at pole was Swietenia mahagoni and at tree was Tectona grandis . Species of trees those were potentially to become habitat (food source) for ebony leaf monkey were T. grandis, Dipterocarpus gracilis, Quercus sundaica and Ficus superba. The highest diversity index was at seedling gwoth stage.

Effect of light-dark cycles on hydrogen and poly-β-hydroxybutyrate production by a photoheterotrophic culture and Rhodobacter capsulatus using a dark fermentation effluent as substrate.

Science.gov (United States)

Montiel Corona, Virginia; Le Borgne, Sylvie; Revah, Sergio; Morales, Marcia

2017-02-01

A Rhodobacter capsulatus strain and a photoheterotrophic culture (IZT) were cultivated to produce hydrogen under different light-dark cycles. A dark fermentation effluent (DFE) was used as substrate. It was found that IZT culture had an average cumulative hydrogen production (Paccum H 2 ) of 1300±43mLH 2 L -1 under continuous illumination and light-dark cycles of 30 or 60min. In contrast, R. capsulatus reduced its Paccum H 2 by 20% under 30:30min light-dark cycles, but tripled its poly-β-hydroxybutyrate (PHB) content (308±2mgPHB gdw -1 ) compared to continuous illumination. The highest PHB content by IZT culture was 178±10mgPHB gdw -1 under 15:15min light-dark cycles. PCR-DGGE analysis revealed that the IZT culture was mainly composed of Rhodopseudomonas palustris identified with high nucleotide similarity (99%). The evaluated cultures might be used for hydrogen and PHB production. They might provide energy savings by using light-dark cycles and DFE valorization. Copyright © 2016 Elsevier Ltd. All rights reserved.

Performance, carotenoids yield and microbial population dynamics in a photobioreactor system treating acidic wastewater: Effect of hydraulic retention time (HRT) and organic loading rate (OLR).

Science.gov (United States)

Liu, Shuli; Zhang, Guangming; Zhang, Jie; Li, Xiangkun; Li, Jianzheng

2016-01-01

Effects of hydraulic retention time (HRT) and influent organic loading rate (OLR) were investigated in a photobioreactor containing PNSB (Rhodopseudomonas palustris)-chemoheterotrophic bacteria to treat volatile fatty acid wastewater. Pollutants removal, biomass production and carotenoids yield in different phases were investigated in together with functional microbial population dynamics. The results indicated that properly decreasing HRT and increasing OLR improved the nutrient removal performance as well as the biomass and carotenoids productions. 85.7% COD, 89.9% TN and 91.8% TP removals were achieved under the optimal HRT of 48h and OLR of 2.51g/L/d. Meanwhile, the highest biomass production and carotenoids yield were 2719.3mg/L and 3.91mg/g-biomass respectively. In addition, HRT and OLR have obvious impacts on PNSB and total bacteria dynamics. Statistical analyses indicated that the COD removal exhibited a positive relationship with OLR, biomass and carotenoids production. PNSB/total bacteria ratio had a positive correlation with the carotenoids yield. Copyright © 2015 Elsevier Ltd. All rights reserved.

Estudo das condições técnicas de utilização das águas da ETAR da Praia da Vitória Assessment of technical conditions for use of wastewater from the Praia da Vitória treatment plant

Directory of Open Access Journals (Sweden)

A. Azevedo

2007-07-01

Full Text Available Este estudo teve como objectivo o estudo das condições técnicas de utilização das águas da ETAR da Praia da Vitória para a rega de espaços. A ETAR da Praia da Vitória produz volumes de águas muito apreciáveis os quais são presentemente lançados no oceano através de um emissário submarino. No entanto é provável que esta água, que agora se perde, possa vir a ser utilizada para a rega de espaços verdes numa perspectiva integrada de gestão sustentável do recurso. Para tal, numa primeira fase avaliaram-se os volumes e caudais das águas residuais gerados e a sua sazonalidade e colheram-se amostras para a sua caracterização físico-química. Instalou-se também um ensaio biológico em vasos, com dois solos de carácter ândico classificados ambos como Vitric Hapludands (SSS, 1999, aos quais se aplicaram três tratamentos distintos sendo estes: água de abastecimento público, efluente da ETAR e uma solução nutritiva preparada em laboratório, com o objectivo de comparar o efeito destes tratamentos na produção de uma gramínea de relvado (Agrostis stolonifera. Os resultados analíticos deixaram clara a importância do valor nutritivo das águas residuais, com teores elevados dos macronutrientes azoto, fósforo, cálcio e magnésio, e evidenciado com base no ensaio biológico onde ocorreu um efeito geral positivo das águas residuais no crescimento das plantas em dois solos que, embora do mesmo tipo, apresentavam um nível de fertilidade diferente, mormente em relação aos macronutrientes fósforo, potássio e cálcio solúveis. O efeito residual no solo resultante da aplicação do efluente da ETAR foi verificado apenas em relação ao magnésio.De main goal of this work is to study the technical conditions of utilization of the treated waters of the wastewater treatment plant of Praia da Vitória to lawn and garden irrigation. The WTP of Praia da Vitória treats significant volumes of water which are presently discarded to

LONG-TERM TRENDS IN GROWTH OF PINUS PALUSTRIS AND PINUS ELLIOTTII GROWING ALONG A HYDROLOGICAL GRADIENT IN CENTRAL FLORIDA

Science.gov (United States)

Land-use change and urbanization has led to changes in the hydrologic regime in wet central Florida, with a trend toward lowered water table levels. These hydrologic changes are having environmental consequences in wetlands, where shifts in species composition and fire frequency...

Comparison of Red-Cockaded Woodpecker (Piciodes borealis) Nestling Diet in Old-Growth and Old-Field Longleaf Pine (Pinus palustris)

Energy Technology Data Exchange (ETDEWEB)

Hanula, J.L.; Engstrom, R.T.

1999-10-01

Automatic cameras were used to record adult woodpecker diets in old-growth and old-field longleaf pine in the South. Roaches were the number one prey for the woodpeckers based on either biomass or numbers. The latter ranged from 37% to 57% of the prey numbers and 55%-73% of the biomass. Morisita's index of similarity between old-field and old growth varied from 0.89 to 0.95. The authors conclude that the prey base is similar in both conditions and that old-growth provides similar foraging habitat.

INAA of microelements in plant species from the Danube floodplain

Energy Technology Data Exchange (ETDEWEB)

Pantelica, A; Salagean, M; Scarlat, A [Department of Applie Physics, Horia Hulubei National Institute for Physics and Nuclear Engineering, PO Box MG-6, RO-76900 Magurele-Bucharest (Romania); Iordache, V [Department of Ecology, University of Bucharest, Bucharest (Romania)

1999-07-01

A research was developed and implemented in the Danube floodplain, as a part of a program dealing with biogeochemistry of metals, to assess the possibility of using the ubiquitous plant species in the soil pollution monitoring activity. The Danube River is heavily polluted by the input from a catchment, which includes 12 countries. Even if the concentrations in the Danube water and sediments reach acute values only in some hot spots, due to the dilution effect, they could have negative consequences by phenomena of bioaccumulation and bioconcentration. The content of Al, Ag, As, Au, Ba, Br, Ca, Cl, Ce, Co, Cr, Cs, Cu, Eu, Fe, Hg, Hf, K, La, Mg, Mn, Na, Ni, Rb, Sc, Se, Sm, Sr, Th, V and Zn in Bidens tripartita, Rubus caesius, Stachys palustris and Xanthium strumarium ubiquitous plant species, collected from two areas located on different regularly flooded islands of the Danube river was investigated by instrumental neutron activation analysis method at WWR-S reactor in Bucharest. From the statistical point of view, three groups of elements present highly correlated concentrations in the investigated plant samples (p(0.05))//. The first one includes Al, As, Ce, Cs, Eu, Fe, Hf, La, Sc, Sm, Th and V, the second one Au, Ca, Cu and Sr, and the third one Br, Cr, Na and Mn. For the elements of the first group, the elemental concentrations are found to be in similar ratios in the species investigated, namely: Xanthium s. < Rubus c. < Bidens t. < Stachys p. as well as for the third group: Bidens t. < Rubus c. < Stachys p. < Xanthium s, suggesting that physiological features of the species could be responsible for the observed patterns of distribution. The soil and dominating plant species were analysed for Cr, Cu, Fe, Mn, Ni, Pb, Zn and Zr by the X-ray fluorescence method at the Institute for Geological Explorations, Bucharest. The elemental content in soil is reflected in the analysed plants for Cr, Cu, Fe, Ni, Pb and Zn, but not for Mn. This could be explained by the redox

INAA of microelements in plant species from the Danube floodplain

International Nuclear Information System (INIS)

Pantelica, A.; Salagean, M.; Scarlat, A.; Iordache, V.

1999-01-01

A research was developed and implemented in the Danube floodplain, as a part of a program dealing with biogeochemistry of metals, to assess the possibility of using the ubiquitous plant species in the soil pollution monitoring activity. The Danube River is heavily polluted by the input from a catchment, which includes 12 countries. Even if the concentrations in the Danube water and sediments reach acute values only in some hot spots, due to the dilution effect, they could have negative consequences by phenomena of bioaccumulation and bioconcentration. The content of Al, Ag, As, Au, Ba, Br, Ca, Cl, Ce, Co, Cr, Cs, Cu, Eu, Fe, Hg, Hf, K, La, Mg, Mn, Na, Ni, Rb, Sc, Se, Sm, Sr, Th, V and Zn in Bidens tripartita, Rubus caesius, Stachys palustris and Xanthium strumarium ubiquitous plant species, collected from two areas located on different regularly flooded islands of the Danube river was investigated by instrumental neutron activation analysis method at WWR-S reactor in Bucharest. From the statistical point of view, three groups of elements present highly correlated concentrations in the investigated plant samples (p(0.05))//. The first one includes Al, As, Ce, Cs, Eu, Fe, Hf, La, Sc, Sm, Th and V, the second one Au, Ca, Cu and Sr, and the third one Br, Cr, Na and Mn. For the elements of the first group, the elemental concentrations are found to be in similar ratios in the species investigated, namely: Xanthium s. < Rubus c. < Bidens t. < Stachys p. as well as for the third group: Bidens t. < Rubus c. < Stachys p. < Xanthium s, suggesting that physiological features of the species could be responsible for the observed patterns of distribution. The soil and dominating plant species were analysed for Cr, Cu, Fe, Mn, Ni, Pb, Zn and Zr by the X-ray fluorescence method at the Institute for Geological Explorations, Bucharest. The elemental content in soil is reflected in the analysed plants for Cr, Cu, Fe, Ni, Pb and Zn, but not for Mn. This could be explained by the redox

Effect of Glomus intraradices isolated from Pb-contaninated soil on Pb uptake by Agrostis capillaris is changed by its cultivation i a metal-free substrate

Czech Academy of Sciences Publication Activity Database

Rydlová, Jana; Vosátka, Miroslav

2003-01-01

Roč. 38, - (2003), s. 155-165 ISSN 0015-5551 R&D Projects: GA AV ČR KSK6005114; GA MŠk OC 838.10; GA ČR GA526/99/P032; GA ČR GA526/99/0895 Institutional research plan: CEZ:AV0Z6005908 Keywords : arbuscular mycorrhizal fungi * heavy metal tolerance * lead contamination Subject RIV: EF - Botanics Impact factor: 1.057, year: 2003

Introducing capnophilic lactic fermentation in a combined dark-photo fermentation process: a route to unparalleled H2 yields.

Science.gov (United States)

Dipasquale, L; Adessi, A; d'Ippolito, G; Rossi, F; Fontana, A; De Philippis, R

2015-01-01

Two-stage process based on photofermentation of dark fermentation effluents is widely recognized as the most effective method for biological production of hydrogen from organic substrates. Recently, it was described an alternative mechanism, named capnophilic lactic fermentation, for sugar fermentation by the hyperthermophilic bacterium Thermotoga neapolitana in CO2-rich atmosphere. Here, we report the first application of this novel process to two-stage biological production of hydrogen. The microbial system based on T. neapolitana DSM 4359(T) and Rhodopseudomonas palustris 42OL gave 9.4 mol of hydrogen per mole of glucose consumed during the anaerobic process, which is the best production yield so far reported for conventional two-stage batch cultivations. The improvement of hydrogen yield correlates with the increase in lactic production during capnophilic lactic fermentation and takes also advantage of the introduction of original conditions for culturing both microorganisms in minimal media based on diluted sea water. The use of CO2 during the first step of the combined process establishes a novel strategy for biohydrogen technology. Moreover, this study opens the way to cost reduction and use of salt-rich waste as feedstock.

Change in microbial communities in acetate- and glucose-fed microbial fuel cells in the presence of light

KAUST Repository

Xing, Defeng

2009-09-01

Power densities produced by microbial fuel cells (MFCs) in natural systems are changed by exposure to light through the enrichment of photosynthetic microorganisms. When MFCs with brush anodes were exposed to light (4000 lx), power densities increased by 8-10% for glucose-fed reactors, and 34% for acetate-fed reactors. Denaturing gradient gel electrophoresis (DGGE) profiles based on the 16S rRNA gene showed that exposure to high light levels changed the microbial communities on the anodes. Based on 16S rRNA gene clone libraries of light-exposed systems the anode communities using glucose were also significantly different than those fed acetate. Dominant bacteria that are known exoelectrogens were identified in the anode biofilm, including a purple nonsulfur (PNS) photosynthetic bacterium, Rhodopseudomonas palustris, and a dissimilatory iron-reducing bacterium, Geobacter sulfurreducens. Pure culture tests confirmed that PNS photosynthetic bacteria increased power production when exposed to high light intensities (4000 lx). These results demonstrate that power production and community composition are affected by light conditions as well as electron donors in single-chamber air-cathode MFCs. © 2009 Elsevier B.V. All rights reserved.

First phylogenetic analysis of Ehrlichia canis in dogs and ticks from Mexico. Preliminary study

Directory of Open Access Journals (Sweden)

Carolina G. Sosa-Gutiérrez

2016-09-01

Full Text Available Objective. Phylogenetic characterization of Ehrlichia canis in dogs naturally infected and ticks, diagnosed by PCR and sequencing of 16SrRNA gene; compare different isolates found in American countries. Materials and methods. Were collected Blood samples from 139 dogs with suggestive clinical manifestations of this disease and they were infested with ticks; part of 16SrRNA gene was sequenced and aligned, with 17 sequences reported in American countries. Two phylogenetic trees were constructed using the Maximum likelihood method, and Maximum parsimony. Results. They were positive to E. canis 25/139 (18.0% dogs and 29/139 (20.9% ticks. The clinical manifestations presented were fever, fatigue, depression and vomiting. Rhipicephalus sanguineus Dermacentor variabilis and Haemaphysalis leporis-palustris ticks were positive for E. canis. Phylogenetic analysis showed that the sequences of dogs and ticks in Mexico form a third group diverging of sequences from South America and USA. Conclusions. This is the first phylogenetic analysis of E. canis in Mexico. There are differences in the sequences of Mexico with those reported in South America and USA. This research lays the foundation for further study of genetic variability.

Reptile assemblage response to restoration of fire-suppressed longleaf pine sandhills.

Science.gov (United States)

Steen, David A; Smith, Lora L; Conner, L M; Litt, Andrea R; Provencher, Louis; Hiers, J Kevin; Pokswinski, Scott; Guyer, Craig

2013-01-01

Measuring the effects of ecological restoration on wildlife assemblages requires study on broad temporal and spatial scales. Longleaf pine (Pinus palustris) forests are imperiled due to fire suppression and subsequent invasion by hardwood trees. We employed a landscape-scale, randomized-block design to identify how reptile assemblages initially responded to restoration treatments including removal of hardwood trees via mechanical methods (felling and girdling), application of herbicides, or prescribed burning alone. Then, we examined reptile assemblages after all sites experienced more than a decade of prescribed burning at two- to thee-year return intervals. Data were collected concurrently at reference sites chosen to represent target conditions for restoration. Reptile assemblages changed most rapidly in response to prescribed burning, but reptile assemblages at all sites, including reference sites, were generally indistinguishable by the end of the study. Thus, we suggest that prescribed burning in longleaf pine forests over long time periods is an effective strategy for restoring reptile assemblages to the reference condition. Application of herbicides or mechanical removal of hardwood trees provided no apparent benefit to reptiles beyond what was achieved by prescribed fire alone.

Bioaugmentation for Electricity Generation from Corn Stover Biomass Using Microbial Fuel Cells

KAUST Repository

Wang, Xin

2009-08-01

Corn stover is usually treated by an energy-intensive or expensive process to extract sugars for bioenergy production. However, it is possible to directly generate electricity from corn stover in microbial fuel cells (MFCs) through the addition of microbial consortia specifically acclimated for biomass breakdown. A mixed culture that was developed to have a high saccharification rate with corn stover was added to singlechamber, air-cathode MFCs acclimated for power production using glucose. The MFC produced a maximum power of 331 mW/ m 2 with the bioaugmented mixed culture and corn stover, compared to 510 mW/m2 using glucose. Denaturing gradient gel electrophoresis (DGGE) showed the communities continued to evolve on both the anode and corn stover biomass over 60 days, with several bacteria identified including Rhodopseudomonas palustris. The use of residual solids from the steam exploded corn stover produced 8% more power (406 mW/m2) than the raw corn stover. These results show that it is possible to directly generate electricity from waste corn stover in MFCs through bioaugmentation using naturally occurring bacteria. © 2009 American Chemical Society.

Mobbing call experiment suggests the enhancement of forest bird movement by tree cover in urban landscapes across seasons

Directory of Open Access Journals (Sweden)

Atsushi Shimazaki

2017-06-01

Full Text Available Local scale movement behavior is an important basis to predict large-scale bird movements in heterogeneous landscapes. Here we conducted playback experiments using mobbing calls to estimate the probability that forest birds would cross a 50-m urban area during three seasons (breeding, dispersal, and wintering seasons with varying amounts of tree cover, building area, and electric wire density. We examined the responses of four forest resident species: Marsh Tit (Poecile palustris, Varied Tit (Sittiparus varius, Japanese Tit (P. minor, and Eurasian Nuthatch (Sitta europaea in central Hokkaido, northern Japan. We carried out and analyzed 250 playback experiments that attracted 618 individuals. Our results showed that tree cover increased the crossing probability of three species other than Varied Tit. Building area and electric wire density had no detectable effect on crossing probability for four species. Seasonal difference in the crossing probability was found only for Varied Tit, and the probability was the highest in the breeding season. These results suggest that the positive effect of tree cover on the crossing probability would be consistent across seasons. We therefore conclude that planting trees would be an effective way to promote forest bird movement within an urban landscape.

Some Orchid Species Fungi Isolated by Different Methods

Directory of Open Access Journals (Sweden)

Arzu ÇIĞ

2014-03-01

Full Text Available Due to their very small seeds that do not contain endosperm, many terrestrial orchid species require the presence of fungi in order to germinate and maintain their lives; and symbiotic culture studies are being carried out on this topic. For the purpose of determining the orchid species on which the fungus to be used as inoculants in the symbiotic culture will be effective, fungi isolated through several isolation methods are cultured with orchid species. In this study a total of four different isolation methods were applied as one on the tubers and rhizomes and three on the soil of eleven orchid species from the Anacamptis, Cephalanthera, Dactylorhiza and Orchis genera. Three different culture media were used in the methods. At the end of the study Alternaria, Aspergillus, Fusarium, Macrophomina, Rhizoctonia, Trichoderma and Verticillium fungi were isolated. In the study that was conducted with the aimed to isolate particularly Rhizoctania spp. fungi, the fungi was isolated from the tubers of Dactylorhiza umbrosa and Orchis palustris species and the soil of the Orchis simia species. Fusarium and Aspergillus species were isolated the most in all implemented methods and from all species.

Change in microbial communities in acetate- and glucose-fed microbial fuel cells in the presence of light

KAUST Repository

Xing, Defeng; Cheng, Shaoan; Regan, John M.; Logan, Bruce E.

2009-01-01

Power densities produced by microbial fuel cells (MFCs) in natural systems are changed by exposure to light through the enrichment of photosynthetic microorganisms. When MFCs with brush anodes were exposed to light (4000 lx), power densities increased by 8-10% for glucose-fed reactors, and 34% for acetate-fed reactors. Denaturing gradient gel electrophoresis (DGGE) profiles based on the 16S rRNA gene showed that exposure to high light levels changed the microbial communities on the anodes. Based on 16S rRNA gene clone libraries of light-exposed systems the anode communities using glucose were also significantly different than those fed acetate. Dominant bacteria that are known exoelectrogens were identified in the anode biofilm, including a purple nonsulfur (PNS) photosynthetic bacterium, Rhodopseudomonas palustris, and a dissimilatory iron-reducing bacterium, Geobacter sulfurreducens. Pure culture tests confirmed that PNS photosynthetic bacteria increased power production when exposed to high light intensities (4000 lx). These results demonstrate that power production and community composition are affected by light conditions as well as electron donors in single-chamber air-cathode MFCs. © 2009 Elsevier B.V. All rights reserved.

Genomics and ecophysiology of heterotrophic nitrogen fixing bacteria isolated from estuarine surface water

DEFF Research Database (Denmark)

Bentzon-Tilia, Mikkel; Severin, Ina; Hansen, Lars H.

2015-01-01

The ability to reduce atmospheric nitrogen (N2) to ammonia, known as N2 fixation, is a widely distributed trait among prokaryotes that accounts for an essential input of new N to a multitude of environments. Nitrogenase reductase gene (nifH) composition suggests that putative N2-fixing heterotrop......The ability to reduce atmospheric nitrogen (N2) to ammonia, known as N2 fixation, is a widely distributed trait among prokaryotes that accounts for an essential input of new N to a multitude of environments. Nitrogenase reductase gene (nifH) composition suggests that putative N2-fixing...... heterotrophic organisms are widespread in marine bacterioplankton, but their autecology and ecological significance are unknown. Here, we report genomic and ecophysiology data in relation to N2 fixation by three environmentally relevant heterotrophic bacteria isolated from Baltic Sea surface water: Pseudomonas...... liter-1, presumably accommodated through aggregate formation. Glucose stimulated N2 fixation in general, and reactive N repressed N2 fixation, except that ammonium (NH4 ) stimulated N2 fixation in R. palustris BAL398, indicating the use of nitrogenase as an electron sink. The lack of correlations...

Diversity of pigmented Gram-positive bacteria associated with marine macroalgae from Antarctica.

Science.gov (United States)

Leiva, Sergio; Alvarado, Pamela; Huang, Ying; Wang, Jian; Garrido, Ignacio

2015-12-01

Little is known about the diversity and roles of Gram-positive and pigmented bacteria in Antarctic environments, especially those associated with marine macroorganisms. This work is the first study about the diversity and antimicrobial activity of culturable pigmented Gram-positive bacteria associated with marine Antarctic macroalgae. A total of 31 pigmented Gram-positive strains were isolated from the surface of six species of macroalgae collected in the King George Island, South Shetland Islands. On the basis of 16S rRNA gene sequence similarities ≥99%, 18 phylotypes were defined, which were clustered into 11 genera of Actinobacteria (Agrococcus, Arthrobacter, Brachybacterium, Citricoccus, Kocuria, Labedella, Microbacterium, Micrococcus, Rhodococcus, Salinibacterium and Sanguibacter) and one genus of the Firmicutes (Staphylococcus). It was found that five isolates displayed antimicrobial activity against a set of macroalgae-associated bacteria. The active isolates were phylogenetically related to Agrococcus baldri, Brachybacterium rhamnosum, Citricoccus zhacaiensis and Kocuria palustris. The results indicate that a diverse community of pigmented Gram-positive bacteria is associated with Antartic macroalgae and suggest its potential as a promising source of antimicrobial and pigmented natural compounds. © FEMS 2015. All rights reserved. For permissions, please e-mail: journals.permissions@oup.com.

Molecular identification of Indian crocodile species: PCR-RFLP method for forensic authentication*.

Science.gov (United States)

Meganathan, P R; Dubey, Bhawna; Haque, Ikramul

2009-09-01

South East Asian countries are known for illegal poaching and trade of crocodiles clandestinely, to be used in skin, medicinal, and cosmetic industries. Besides crocodiles being listed in the Convention on International Trade in Endangered Species of Wild Fauna and Flora, India has its Wildlife Protection Act, 1972 for conservation of crocodile species. Hitherto, lack of any rapid and reliable technique for examinations of crocodile-based crime exhibits such as skin, bones, etc. has been a major problem for an effective promulgation of law on illegal trade. DNA-based identification of species using PCR-RFLP technique for an apt identification of all the three Indian crocodile species namely, Crocodylus porosus, Crocodylus palustris and Gavialis gangeticus is presented here. A 628 bp segment of cytochrome b gene was amplified using novel primers followed by restriction digestion with three enzymes i.e., HaeIII, MboI, and MwoI, separately and in combination. The technique has produced a species-specific pattern for identifying the three crocodile species individually, which fulfills the requirement for its forensic application. It is expected that the technique will prove handy in identification of all the three Indian crocodile species and strengthen conservation efforts.

Vegetation Structure of Ebony Leaf Monkey (Trachypithecus auratus Habitat in Kecubung Ulolanang Nature Preservation Central Java-Indonesia

Directory of Open Access Journals (Sweden)

Ervina Rahmawati

2018-01-01

Full Text Available Kecubung Ulolanang Nature Preservation is ebony leaf monkey’s habitats in Central Java Indonesia. Continuously degradation of their population is caused by illegal hunting and habitat degradation that made this species being vulnerable. Habitat conservation is one of important aspects to prevent them from extinction. The purpose of this research was to analyze the vegetation’s structure and composition, which was potentially, becomes habitat and food source for the monkeys. Data collected using purposive sampling with line transect method of four different level of vegetation. Data analysis used Important Value Index and Diversity Index. There were 43 species of vegetation at seedling stage, 18 species at sapling stage, 8 species at poles stage and 27 species at trees stage. Species that had the highest important value index at seedling was Stenochlaena palustri , at the sapling was Gnetum gnemon, at pole was Swietenia mahagoni and at tree was Tectona grandis . Species of trees those were potentially to become habitat (food source for ebony leaf monkey were T. grandis, Dipterocarpus gracilis, Quercus sundaica and Ficus superba. The highest diversity index was at seedling gwoth stage.

A comparison of stable caesium uptake by six grass species of contrasting growth strategy

International Nuclear Information System (INIS)

Willey, N.J.; Martin, M.H.

1997-01-01

Six plants in the family Gramineae were used to investigate the relationship between Cs uptake, nutrient regime and plant growth strategy sensu Grime (1979: Plant Growth Strategies and Vegetation Processes, John Wiley). The roots of 66 day old Elymus repens (L.) Gould., Bromus sterilis L., Agrostis stolonifera L., Anthoxanthum odoratum L., Festuca ovina L. and Nardus stricta L. plants grown in acid-washed sand at high and low nutrient levels were exposed to a 96 h pulse of stable Cs at 0.05 mM, 0.15 mM, 0.3 mM, 1.0 mM and 3.0 mM concentrations. Different nutrient regimes induced large differences in dry wt in E. repens, B. sterilis and A. stolonifera plants but only small differences in N. stricta and F. ovina plants. At high nutrient concentrations, A. stolonifera, A. odoratum, F. ovina and N. stricta shoots showed significantly greater increases in internal Cs concentration with rising external Cs concentrations than did E. repens and B. sterilis shoots. The relationship between increases in shoot and external Cs concentrations was statistically indistinguishable between species in plants grown at the low nutrient concentration. These patterns of Cs uptake ensured that with long-term high K concentrations the more competitive plants (E. repens and B. sterilis) accumulated higher concentrations of Cs from low external concentrations than did non-competitive plants or competitive plants grown at low nutrient levels. It is suggested that the relationship between plant growth strategy sensu Grime (1979) and Cs accumulation patterns may help to explain the different concentrations to which species accumulate radiocaesium from the soil. (author)

Weeds that can do both tricks: vegetative versus generative regeneration of short-lived root-sprouting herbs Rorippa palustris and Barbarea vulgaris

Czech Academy of Sciences Publication Activity Database

Klimešová, Jitka; Kociánová, Alena; Martínková, Jana

2008-01-01

Roč. 48, č. 2 (2008), s. 131-135 ISSN 0043-1737 R&D Projects: GA ČR GD206/03/H034 Institutional research plan: CEZ:AV0Z60050516 Keywords : Adventitious sprouting * disturbance * Brassicaceae Subject RIV: EF - Botanics Impact factor: 1.793, year: 2008

Restoring a disappearing ecosystem: the Longleaf Pine Savanna.

Energy Technology Data Exchange (ETDEWEB)

Harrington, Timothy B. [USFS; Miller, Karl V. [University of Georgia; Park, Noreen

2013-05-01

Longleaf pine (Pinus palustris) savannas of the southeastern United States contain some of the worlds most diverse plant communities, along with a unique complement of wildlife. Their traditionally open canopy structure and rich understory of grasses and herbs were critical to their vigor. However, a long history of land-use practices such as logging, farming, and fire exclusion have reduced this once-widespread ecosystem to only 3 percent of its original range. At six longleaf pine plantations in South Carolina, Tim Harrington with the Pacific Northwest Research Station and collaborators with the Southern Research Station used various treatments (including prescribed burns, tree thinning, and herbicide applications) to alter the forest structure and tracked how successful each one was in advancing savanna restoration over a 14-year period. They found that typical planting densities for wood production in plantations create dense understory shade that excludes many native herbaceous species important to savannas and associated wildlife. The scientists found that although tree thinning alone did not result in sustained gains, a combination of controlled burning, thinning, and herbicide treatments to reduce woody plants was an effective strategy for recovering the savanna ecosystem. The scientists also found that these efforts must be repeated periodically for enduring benefits.

The progress of the periodontal syndrome in the rice rat

International Nuclear Information System (INIS)

Gotcher, J.E.; Jee, W.S.S.

1981-01-01

Several morphometric and cellular parameters were studied in the rice rat (Oryzomys palustris). When fed a soft, high carbohydrate diet, a severe periodontal disease occurred, with significant alterations in the morphometric and cellular endpoints observed. Weaned animals were placed on a high carbohydrate diet for periods of 6, 12 or 18 weeks. There was a linear rapid loss of bone by 18 weeks, approaching a 75% loss of original bone. Vascular spaces decreased as the remaining connective tissue became fibrotic in character. The percentage of the interdental test site which was destroyed by periodontal disease increased dramatically over the time of the experiment. The numbers of fibroblasts per mm of bone surface increased slightly at the 18 week period; osteoblasts were unchanged at any period. The numbers of osteoclast nuclei rose dramatically by 12 weeks, and these cell nuclei remained at increased levels at 18 weeks. Also, the numbers of inflammatory cells residing at the bone surface increased greatly by 18 weeks time. Finally, the numbers of 3 H-TdR labeled periodontal ligament (PDL) fibroblasts increased significantly at both 12 and 18 weeks time. These cellular changes and their relation to the bone loss due to periodontal disease are discussed. (author)

[Methanotrophs of the psychrophilic microbial community of the Russian Arctic tundra].

Science.gov (United States)

Berestovskaia, Iu Iu; Vasil'eva, L V; Chestnykh, O V; Zavarzin, G A

2002-01-01

In tundra, at a low temperature, there exists a slowly developing methanotrophic community. Methane-oxidizing bacteria are associated with plants growing at high humidity, such as sedge and sphagnum; no methonotrophs were found in polytrichous and aulacomnious mosses and lichens, typical of more arid areas. The methanotrophic bacterial community inhabits definite soil horizons, from moss dust to peat formed from it. Potential ability of the methanotrophic community to oxidize methane at 5 degrees C enhances with the depth of the soil profile in spite of the decreasing soil temperature. The methanotrophic community was found to gradually adapt to various temperatures due to the presence of different methane-oxidizing bacteria in its composition. Depending on the temperature and pH, different methanotrophs occupy different econiches. Within a temperature range from 5 to 15 degrees C, three morphologically distinct groups of methanotrophs could be distinguished. At pH 5-7 and 5-15 degrees C, forms morphologically similar to Methylobacter psychrophilus predominated, whereas at the acidic pH 4-6 and 10-15 degrees C, bipolar cells typical of Methylocella palustris were mostly found. The third group of methanotrophic bacteria growing at pH 5-7 and 5-10 degrees C was represented by a novel methanotroph whole large coccoid cells had a thick mucous capsule.

RETARDATION OF LOW PEATLANDS HABITAT CONDITIONS TRANSFORMATION IN THE VALLEY OF SUPRAŚL RIVER IN THE PERIOD OF 1987-2011

Directory of Open Access Journals (Sweden)

Aleksander Kiryluk

2014-10-01

Full Text Available In this paper, there were shown the physico-chemical properties of post-boggy soil in the result of conducted melioration in the meadow object of Suraśl Górna. The researches were done in the period of 1987-2001 in two habitats: moist soil-moisture complex (PSMC-B and drying moist soil-moisture complex (PSMC-C. In the moist habitat, the level of ground water was in the depth of 30-98 cm from the land surface and fed the root layer of soil. In the drying moist habitat, the ground water was below the depth of 100 cm in the vegetation season and was periodically inaccessible for the meadow plants. Unfavourable water conditions in drying moist habitat have caused the condensation of peat mass and the decrease of water capacity of soil. In time, the progressive changes of physical and water properties effected negatively the natural values in post-boggy ecosystems. The changes of water properties caused the disappearance of many flora species, often classified as rare or protected species for example Epipatis palustris (L. Crantz. The retardation of unfavourable changes can be achieved by the depth regulation of ground water laying and proper (especially medium intensive meadow exploitation of these ecosystems.

Gnezdilke Parka Škocjanske jame (Kras, JZ Slovenija/ The breeding birds of Škocjan Caves Park (Kras, SW Slovenia

Directory of Open Access Journals (Sweden)

Figelj Jernej

2014-12-01

Full Text Available The aim of the study done in 2011 and 2012 was to identify the number of breeding bird species, to provide population estimates as well as to evaluate the conservational importance of Škocjan Caves Park for birds. Common bird species were surveyed using the territory mapping method. Rare species and nocturnally active species were surveyed using species-specific methods: observation, the playback method and the line transect method. 81 species were registered, 49 of which bred within the boundaries of the Park. The most abundant breeding species were Blackcap Sylvia atricapilla (260-320 breeding pairs, Robin Erithacus rubecula (250-310 breeding pairs, Blackbird Turdus merula (230-280 breeding pairs, Chaffinch Fringilla coelebs (230-280 breeding pairs and Marsh Tit Poecile palustris (200-240 breeding pairs. Qualifying species for the Special Protected Area (SPA Kras (SI5000023 also bred within the Park: Peregrine Falcon Falco peregrinus, Nightjar Caprimulgus europaeus, Scops Owl Otus scops and Woodlark Lululla arborea. Eagle Owl Bubo bubo was also registered, but breeding attempts during the study period were unsuccessful due to the negative influence of several factors. One of the largest colonies of Alpine Swifts Apus melba, a rare and localized species in Slovenia, is also of conservation concern.

Reflections on a systematic nomenclature for antimicrobial peptides from the skins of frogs of the family Ranidae.

Science.gov (United States)

Conlon, J Michael

2008-10-01

Frogs belonging to the extensive family Ranidae represent a valuable source of antimicrobial peptides with therapeutic potential but there is currently no consistent system of nomenclature to describe these peptides. Terminology based solely on species name does not reflect the evolutionary relationships existing between peptides encoded by orthologous and paralogous genes. On the basis of limited structural similarity, at least 14 well-established peptide families have been identified (brevinin-1, brevinin-2, esculentin-1, esculentin-2, japonicin-1, japonicin-2, nigrocin-2, palustrin-1, palustrin-2, ranacyclin, ranalexin, ranatuerin-1, ranatuerin-2, temporin). It is proposed that terms that are synonymous with these names should no longer be used. Orthologous peptides from different species may be characterized by the initial letter of that species, set in upper case, with paralogs belonging to the same peptide family being assigned letters set in lower case, e.g. brevinin-1Pa, brevinin-1Pb, etc. When two species begin with the same initial letter, two letters may be used, e.g. P for pipiens and PL for palustris. Species names and assignments to genera may be obtained from Amphibian Species of the World Electronic Database, accessible at http://research.amnh.org/herpetology/amphibia/index.php. American Museum of Natural History, New York, USA.

Development of bacteria-based bioassays for arsenic detection in natural waters.

Science.gov (United States)

Diesel, Elizabeth; Schreiber, Madeline; van der Meer, Jan Roelof

2009-06-01

Arsenic contamination of natural waters is a worldwide concern, as the drinking water supplies for large populations can have high concentrations of arsenic. Traditional techniques to detect arsenic in natural water samples can be costly and time-consuming; therefore, robust and inexpensive methods to detect arsenic in water are highly desirable. Additionally, methods for detecting arsenic in the field have been greatly sought after. This article focuses on the use of bacteria-based assays as an emerging method that is both robust and inexpensive for the detection of arsenic in groundwater both in the field and in the laboratory. The arsenic detection elements in bacteria-based bioassays are biosensor-reporter strains; genetically modified strains of, e.g., Escherichia coli, Bacillus subtilis, Staphylococcus aureus, and Rhodopseudomonas palustris. In response to the presence of arsenic, such bacteria produce a reporter protein, the amount or activity of which is measured in the bioassay. Some of these bacterial biosensor-reporters have been successfully utilized for comparative in-field analyses through the use of simple solution-based assays, but future methods may concentrate on miniaturization using fiberoptics or microfluidics platforms. Additionally, there are other potential emerging bioassays for the detection of arsenic in natural waters including nematodes and clams.

Preliminary evaluation of fungicidal and termiticidal activities of filtrates from biomass slurry fuel production

Energy Technology Data Exchange (ETDEWEB)

Kartal, S.N. [Istanbul University (Turkey). Forestry Faculty; Imamura, Y. [Kyoto University (Japan). Wood Research Institute; Tsuchiya, F.; Ohsato, K. [JGC Corporation, Yokohama (Japan)

2004-10-01

Biomass slurry fuel (BSF) production has recently been developed as a natural energy for the conversion of solid biomass into fuel. In addition to using fuel, filtrates from BSF production may also serve a chemical source with several organic compounds. There is an increasing interest in the research and application of biomass-based filtrates. In this study, fungicidal and termiticidal properties of filtrates from BSF production using sugi (Cryptomeria japonica) and acacia (Acacia mangium) wood were evaluated in laboratory decay and termite resistance tests. Wood blocks treated with the filtrates showed increased resistance against brown-rot fungus, Formitopsis palustris. However the filtrates from sugi wood processed at 270{sup o}C which contained less phenolic compounds than the other filtrates were effective against white-rot fungus, Trametes versicolor. Phenolic compounds of filtrates seemed to play a role in the decay resistance tests however the filtrates did not increase the durability of the wood blocks against subterranean termites Coptotermes formosanus. Despite high acetic and lactic acid content of the filtrates, vanillin content of the filtrates may have served as an additional food source and promoted termite attack. It can be concluded that filtrates with phenolic compounds from lignin degradation during BSF production can be considered for targeted inhibition of brown-rot. (author)

Effects of probiotics on the growth performance and intestinal micro flora of broiler chickens.

Science.gov (United States)

Li, Yin-bo; Xu, Qian-qian; Yang, Cun-jin; Yang, Xin; Lv, Le; Yin, Chun-hua; Liu, Xiao-lu; Yan, Hai

2014-05-01

Antibiotics have been used in poultry industry for decades to promote growth and protect animals from diseases, followed by various side effects. In efforts of searching for a better alternative, probiotic is of extensive attention. We investigated the effects of Bacillus subtitles, Rhodopseudomonas palustris, Candida utilis and Lactobacillus acidophilus as 0.1% (W/W) feed additives on broiler growth performance and intestinal microflora. The results showed the probiotics treatments significantly improved growth of broilers. Broilers supplemented with B. subtilis and L. acidophilus weighed 18.4% and 10.1% more than birds in control group at 42 days of age. Furthermore the feed conversion ratios of the birds in the two groups were also improved, decreasing 9.1% and 12.9%, respectively. Further study indicated a significant increase of cecal Lactobacilli concentration in briolers supplemented with probiotics, expecially in L. acidophilus treatment group. Meanwhile, the count of cecal Actinomyces in birds treated with probiotics was significantly lower compared with the control group. In conclusion, probiotics such as B. subtitles and L. acidophilus are good alternatives to antibiotics in promoting growth resulting from a beneficial modulation of the intestinal micro flora, which leads to increased efficiency of intestinal digestion in the host animal.

Development of bacteria-based bioassays for arsenic detection in natural waters

Energy Technology Data Exchange (ETDEWEB)

Diesel, Elizabeth; Schreiber, Madeline [Virginia Tech, Department of Geosciences, Blacksburg, VA (United States); Meer, Jan Roelof van der [University of Lausanne, Department of Fundamental Microbiology, Lausanne (Switzerland)

2009-06-15

Arsenic contamination of natural waters is a worldwide concern, as the drinking water supplies for large populations can have high concentrations of arsenic. Traditional techniques to detect arsenic in natural water samples can be costly and time-consuming; therefore, robust and inexpensive methods to detect arsenic in water are highly desirable. Additionally, methods for detecting arsenic in the field have been greatly sought after. This article focuses on the use of bacteria-based assays as an emerging method that is both robust and inexpensive for the detection of arsenic in groundwater both in the field and in the laboratory. The arsenic detection elements in bacteria-based bioassays are biosensor-reporter strains; genetically modified strains of, e.g., Escherichia coli, Bacillus subtilis, Staphylococcus aureus, and Rhodopseudomonas palustris. In response to the presence of arsenic, such bacteria produce a reporter protein, the amount or activity of which is measured in the bioassay. Some of these bacterial biosensor-reporters have been successfully utilized for comparative in-field analyses through the use of simple solution-based assays, but future methods may concentrate on miniaturization using fiberoptics or microfluidics platforms. Additionally, there are other potential emerging bioassays for the detection of arsenic in natural waters including nematodes and clams. (orig.)

Geology and geomorphology of the Carolina Sandhills, Chesterfield County, South Carolina

Science.gov (United States)

Swezey, Christopher; Fitzwater, Bradley A.; Whittecar, G. Richard

2016-01-01

This two-day field trip focuses on the geology and geomorphology of the Carolina Sandhills in Chesterfield County, South Carolina. This area is located in the updip portion of the U.S. Atlantic Coastal Plain province, supports an ecosystem of longleaf pine (Pinus palustris) and wiregrass (Aristida stricta), and contains three major geologic map units: (1) An ~60–120-m-thick unit of weakly consolidated sand, sandstone, mud, and gravel is mapped as the Upper Cretaceous Middendorf Formation and is interpreted as a fluvial deposit. This unit is capped by an unconformity, and displays reticulate mottling, plinthite, and other paleosol features at the unconformity. The Middendorf Formation is the largest aquifer in South Carolina. (2) A 0.3–10-m-thick unit of unconsolidated sand is mapped as the Quaternary Pinehurst Formation and is interpreted as deposits of eolian sand sheets and dunes derived via remobilization of sand from the underlying Cretaceous strata. This unit displays argillic horizons and abundant evidence of bioturbation by vegetation. (3) A geomorphologic feature in the study area is a north-trending escarpment (incised by headwater streams) that forms a markedly asymmetric drainage divide. This drainage divide, as well as the Quaternary terraces deposits, are interpreted as evidence of landscape disequilibrium (possibly geomorphic responses to Quaternary climate changes).

Scaling of phloem structure and optimality of photoassimilate transport in conifer needles.

Science.gov (United States)

Ronellenfitsch, Henrik; Liesche, Johannes; Jensen, Kaare H; Holbrook, N Michele; Schulz, Alexander; Katifori, Eleni

2015-02-22

The phloem vascular system facilitates transport of energy-rich sugar and signalling molecules in plants, thus permitting long-range communication within the organism and growth of non-photosynthesizing organs such as roots and fruits. The flow is driven by osmotic pressure, generated by differences in sugar concentration between distal parts of the plant. The phloem is an intricate distribution system, and many questions about its regulation and structural diversity remain unanswered. Here, we investigate the phloem structure in the simplest possible geometry: a linear leaf, found, for example, in the needles of conifer trees. We measure the phloem structure in four tree species representing a diverse set of habitats and needle sizes, from 1 (Picea omorika) to 35 cm (Pinus palustris). We show that the phloem shares common traits across these four species and find that the size of its conductive elements obeys a power law. We present a minimal model that accounts for these common traits and takes into account the transport strategy and natural constraints. This minimal model predicts a power law phloem distribution consistent with transport energy minimization, suggesting that energetics are more important than translocation speed at the leaf level. © 2015 The Author(s) Published by the Royal Society. All rights reserved.

Repeated Raking of Pine Plantations Alters Soil Arthropod Communities

Directory of Open Access Journals (Sweden)

Holly K. Ober

2014-04-01

Full Text Available Terrestrial arthropods in forests are engaged in vital ecosystem functions that ultimately help maintain soil productivity. Repeated disturbance can cause abrupt and irreversible changes in arthropod community composition and thereby alter trophic interactions among soil fauna. An increasingly popular means of generating income from pine plantations in the Southeastern U.S. is annual raking to collect pine litter. We raked litter once per year for three consecutive years in the pine plantations of three different species (loblolly, Pinus taeda; longleaf, P. palustris; and slash, P. elliottii. We sampled arthropods quarterly for three years in raked and un-raked pine stands to assess temporal shifts in abundance among dominant orders of arthropods. Effects varied greatly among orders of arthropods, among timber types, and among years. Distinct trends over time were apparent among orders that occupied both high trophic positions (predators and low trophic positions (fungivores, detritivores. Multivariate analyses demonstrated that raking caused stronger shifts in arthropod community composition in longleaf and loblolly than slash pine stands. Results highlight the role of pine litter in shaping terrestrial arthropod communities, and imply that repeated removal of pine straw during consecutive years is likely to have unintended consequences on arthropod communities that exacerbate over time.

Insecticidal Activity of Isolated Bacteria from Hyphantria cunea (Drury (Lepidoptera: Arctiidae

Directory of Open Access Journals (Sweden)

Nurcan Albayrak İskender

2017-04-01

Full Text Available The fall webworm (Hyphantria cunea is a polyphagous pest with numerous host plants. In the present study, the bacterial flora of H.cunea was investigated to identify new organisms that can be used as microbial control agent against the pest. Six bacteria were isolated and cultured from H. cunea. Some morphological, biochemical and other phenotypic characteristics (with API 20E, API 50 CH, API Staph and API Coryne kits of bacterial isolates were determined. In addition, 16S rRNA gene region was sequenced. As a result of the studies conducted, bacterial isolates were identified as Lysinibacillus sphaericus (Abk1, Bacillus amyloliquefaciens (Abk2, Staphylococcus sciuri (Abk4, Kocuria palustris (Abk6, Arthrobacter arilaitensis (Abk7 and Microbacterium oxydans (Abk8. All bacterial isolates were tested for 12 days against third-fourth instar larvae of H. cunea. The highest insecticidal activity was obtained from L. sphaericus (Abk1 with 30% after application (p<0.05. These results indicate that L. sphaericus (Abk1 can be taken into account in the microbial pest control of H. cunea. In the future, further studies will be conducted by using pathogenicity enrichment strategies of L. sphaericus (Abk1 (ex. combining with other entomopathogens or insecticides in order to increase the effectiveness on H. cunea.

Muscle Aging and Oxidative Stress in Wild-Caught Shrews

Science.gov (United States)

Hindle, Allyson G.; Lawler, John M.; Campbell, Kevin L.; Horning, Markus

2010-01-01

Red-toothed shrews (Soricidae, subfamily Soricinae) are an intriguing model system to examine the free radical theory of aging in wild mammals, given their short (<18 month) lifespan and high mass-specific metabolic rates. As muscle performance underlies both foraging ability and predator avoidance, any age-related decline should be detrimental to fitness and survival. Muscle samples of water shrews (Sorex palustris) and sympatrically distributed short-tailed shrews (Blarina brevicauda) were therefore assessed for oxidative stress markers, protective antioxidant enzymes and apoptosis. Activity levels of catalase and glutathione peroxidase increased with age in both species. Similarly, Cu,Zn-superoxide dismutase isoform content was elevated significantly in older animals of both species (increases of 60% in the water shrew, 25% in the short-tailed shrew). Only one oxidative stress marker (lipid peroxidation) was age-elevated; the others were stable or declined (4-hydroxynonenal adducts and dihydroethidium oxidation). Glutathione peroxidase activity was significantly higher in the short-tailed shrew, while catalase activity was 2× higher in water shrews. Oxidative stress indicators were on average higher in short-tailed shrews. Apoptosis occurred in <1% of myocytes examined, and did not increase with age. Within the constraints of the sample size we found evidence of protection against elevated oxidative stress in wild-caught shrews. PMID:20109576

Ichthyophonus-like infection in wild amphibians from Québec, Canada.

Science.gov (United States)

Mikaelian, I; Ouellet, M; Pauli, B; Rodrigue, J; Harshbarger, J C; Green, D M

2000-04-20

Myositis associated with infection by Ichthyophonus-like organisms was diagnosed in 35 of 260 (13%) wild amphibians collected in Quebec, Canada, from 1959 to 1964 (n = 30), and 1992 to 1999 (n = 230). Infection was diagnosed in 17 green frogs Rana clamitans, 9 wood frogs R. sylvatica, 4 red-spotted newts Notophthalmus viridescens, 3 bullfrogs R. catesbeiana, 1 spring peeper Pseudacris crucifer, and 1 pickerel frog R. palustris. The spring peeper and one of the bullfrogs were collected in 1964 from the Mont Saint-Hilaire Biosphere Reserve, indicating long-term presence of the organism. Spores of the organisms invaded striated muscle fibers and were associated with variable degrees of granulomatous and eosinophilic inflammation. Infection was considered fatal in 2 green frogs, 1 wood frog, and 1 red-spotted newt. It was considered potentially significant in 3 additional green frogs in which up to 100% of the fibers of some muscles were replaced by spores associated with a severe granulomatous reaction. Ultrastructural features of Ichthyophonus-like spores included a thick trilaminated wall, a paramural cytoplasm, multiple nuclei, oval mitochondria with short tubulo-vesicular cristae and numerous ribosomes. This report represents 4 new host records and shows that ichthyophonosis is enzootic in amphibians from Quebec.

Above- and belowground competition from longleaf pine plantations limits performance of reintroduced herbaceous species.

Energy Technology Data Exchange (ETDEWEB)

T.B. Harrington; C.M. Dagley; M.B. Edwards.

2003-10-01

Although overstory trees limit the abundance and species richness of herbaceous vegetation in longleaf pine (Pinus palustris Mill.) plantations, the responsible mechanisms are poorly understood because of confounding among limiting factors. In fall 1998, research was initiated to determine the separate effects of above- and belowground competition and needlefall from overstory pines on understory plant performance. Three 13- to 15-yr-old plantations near Aiken, SC, were thinned to 0, 25, 50, or 100% of nonthinned basal area (19.5 m2 ha-1). Combinations of trenching (to eliminate root competition) and needlefall were applied to areas within each plot, and containerized seedlings of 14 perennial herbaceous species and longleaf pine were planted within each. Overstory crown closure ranged from 0 to 81%, and soil water and available nitrogen varied consistently with pine stocking, trenching, or their combination. Cover of planted species decreased an average of 16.5 and 14.1% as a result of above- and below-ground competition, respectively. Depending on species, needlefall effects were positive, negative, or negligible. Results indicate that understory restoration will be most successful when herbaceous species are established within canopy openings (0.1-0.2 ha) managed to minimize negative effects from above- and belowground competition and needlefall.

Effects of dormant and growing season burning on surface fuels and potential fire behavior in northern Florida longleaf pine (Pinus palustris) flatwoods

Science.gov (United States)

James B. Cronan; Clinton S. Wright; Maria Petrova

2015-01-01

Prescribed fire is widely used to manage fuels in high-frequency, low-severity fire regimes including pine flatwoods of the southeastern USA where prescribed burning during the growing season (the frost-free period during the calendar year) has become more common in recent decades. Growing season prescribed fires address ecological management objectives that focus on...

Effect of nitrogen fertilization, grass species and cultivar on sod production on Valkeasuo peat bog - a case study

Directory of Open Access Journals (Sweden)

Perttu Virkajärvi

1997-09-01

Full Text Available As part of a research project concerning the agricultural utilization of cut-away peat bogs, a sod production experiment was conducted at Valkeasuo, Tohmajärvi, in 1990-1993. The aim of the experiment was to study the effect of nitrogen and choice of cultivar on sod production and sod quality on peat bogs. The N fertilization rates were 50, 100 and 150kg ha-1. The Poa pratensis cultivars were ‘Conni’, ‘Cynthia’, ‘Haga’ and ‘Julia’, the Festuca rubra cultivars were ‘Center’, ‘Juliska’, ‘Koket’ and ‘Näpsä’ and the Agrostis capillaris cultivar was ‘Rasti’. Two mixtures of P. pratensis/F. rubra and one of A. capillaris/F. rubra imitated commercial sod products. Increasing of N fertilization from 50 kg up to 150 kg ha-1 a had positive effect on general the quality of sod as well as on the green cover before and after transplanting. It increased the thatch formation. The positive effect of N on the number of tillers and green cover in the year following transplanting was dependent on the species and the cultivar. Species and cultivar affected all measured variables excluding thatch formation. Generally, the P. pratensis cultivars tested suited better for sod production than cultivars of F. rubra, but there were clear differences between cultivars within species as well. Although the soil was infertile, the contents of Ca, K, Mg, P, Cu, Fe, Mn, Mo and Zn in the herbage samples were within normal range. The botanical purity was high, which supports the hypothesis that the absence of seed bank of weeds on peat bogs immediately after harvesting the peat can be utilized.

Impact of Soil Warming on the Plant Metabolome of Icelandic Grasslands

Science.gov (United States)

Gargallo-Garriga, Albert; Ayala-Roque, Marta; Granda, Victor; Sigurdsson, Bjarni D.; Leblans, Niki I. W.; Oravec, Michal; Urban, Otmar; Janssens, Ivan A.

2017-01-01

Climate change is stronger at high than at temperate and tropical latitudes. The natural geothermal conditions in southern Iceland provide an opportunity to study the impact of warming on plants, because of the geothermal bedrock channels that induce stable gradients of soil temperature. We studied two valleys, one where such gradients have been present for centuries (long-term treatment), and another where new gradients were created in 2008 after a shallow crustal earthquake (short-term treatment). We studied the impact of soil warming (0 to +15 °C) on the foliar metabolomes of two common plant species of high northern latitudes: Agrostis capillaris, a monocotyledon grass; and Ranunculus acris, a dicotyledonous herb, and evaluated the dependence of shifts in their metabolomes on the length of the warming treatment. The two species responded differently to warming, depending on the length of exposure. The grass metabolome clearly shifted at the site of long-term warming, but the herb metabolome did not. The main up-regulated compounds at the highest temperatures at the long-term site were saccharides and amino acids, both involved in heat-shock metabolic pathways. Moreover, some secondary metabolites, such as phenolic acids and terpenes, associated with a wide array of stresses, were also up-regulated. Most current climatic models predict an increase in annual average temperature between 2–8 °C over land masses in the Arctic towards the end of this century. The metabolomes of A. capillaris and R. acris shifted abruptly and nonlinearly to soil warming >5 °C above the control temperature for the coming decades. These results thus suggest that a slight warming increase may not imply substantial changes in plant function, but if the temperature rises more than 5 °C, warming may end up triggering metabolic pathways associated with heat stress in some plant species currently dominant in this region. PMID:28832555

Unravelling the bioherbicide potential of Eucalyptus globulus Labill: Biochemistry and effects of its aqueous extract

Science.gov (United States)

Reigosa, Manuel J.; Valentão, Patrícia; Andrade, Paula B.

2018-01-01

In the worldwide search for new strategies in sustainable weed management, the use of plant species able to produce and release phytotoxic compounds into the environment could be an effective alternative to synthetic herbicides. Eucalyptus globulus Labill. is known to be a source of biologically active compounds responsible for its phytotoxic and allelopathic properties. Our previous results demonstrated the bioherbicide potential of eucalyptus leaves incorporated into the soil as a green manure, probably through the release of phytotoxins into the soil solution. Thus, the aims of this study were to understand the phytotoxicity of the eucalyptus leaves aqueous extract applied in pre- and post-emergence, and to identify and quantify its potentially phytotoxic water-soluble compounds. The effects were tested on the germination and early growth of the model target species Lactuca sativa and Agrostis stolonifera, and on physiological parameters of L. sativa adult plants after watering or spraying application. Dose-response curves and ED50 and ED80 values for eucalyptus aqueous extracts revealed pre-emergence inhibitory effects on both target species, effects being comparable to the herbicide metolachlor. While spraying treatment reduced the aerial and root biomass and increased the dry weight/fresh weight ratio of lettuce adult plants, watering application reduced protein contents and chlorophyll concentrations with respect to control, reflecting different modes of action depending on the site of phytotoxin entry. Via HPLC analyses, a total of 8 phenolic compounds (chlorogenic, two ρ-coumaric derivatives, ellagic, hyperoside, rutin, quercitrin, and kaempferol 3-O-glucoside) and other 5 low weight organic acids (citric, malic, shikimic, succinic and fumaric acids) were obtained from aqueous extract, the latter being identified for the first time in E. globulus. Despite some phytotoxic effects were found on lettuce adult plants, the use of eucalyptus aqueous extract

Unravelling the bioherbicide potential of Eucalyptus globulus Labill: Biochemistry and effects of its aqueous extract.

Science.gov (United States)

Puig, Carolina G; Reigosa, Manuel J; Valentão, Patrícia; Andrade, Paula B; Pedrol, Nuria

2018-01-01

In the worldwide search for new strategies in sustainable weed management, the use of plant species able to produce and release phytotoxic compounds into the environment could be an effective alternative to synthetic herbicides. Eucalyptus globulus Labill. is known to be a source of biologically active compounds responsible for its phytotoxic and allelopathic properties. Our previous results demonstrated the bioherbicide potential of eucalyptus leaves incorporated into the soil as a green manure, probably through the release of phytotoxins into the soil solution. Thus, the aims of this study were to understand the phytotoxicity of the eucalyptus leaves aqueous extract applied in pre- and post-emergence, and to identify and quantify its potentially phytotoxic water-soluble compounds. The effects were tested on the germination and early growth of the model target species Lactuca sativa and Agrostis stolonifera, and on physiological parameters of L. sativa adult plants after watering or spraying application. Dose-response curves and ED50 and ED80 values for eucalyptus aqueous extracts revealed pre-emergence inhibitory effects on both target species, effects being comparable to the herbicide metolachlor. While spraying treatment reduced the aerial and root biomass and increased the dry weight/fresh weight ratio of lettuce adult plants, watering application reduced protein contents and chlorophyll concentrations with respect to control, reflecting different modes of action depending on the site of phytotoxin entry. Via HPLC analyses, a total of 8 phenolic compounds (chlorogenic, two ρ-coumaric derivatives, ellagic, hyperoside, rutin, quercitrin, and kaempferol 3-O-glucoside) and other 5 low weight organic acids (citric, malic, shikimic, succinic and fumaric acids) were obtained from aqueous extract, the latter being identified for the first time in E. globulus. Despite some phytotoxic effects were found on lettuce adult plants, the use of eucalyptus aqueous extract

Genetic resources of perennial forage grasses in Serbia: Current state, broadening and evaluation

Directory of Open Access Journals (Sweden)

Sokolović Dejan

2017-01-01

Full Text Available Due to historical background of vegetation development, geographical position, climate and relief, Serbia represents one of the 158 world biodiversity centres, based upon the number of plant species and territory size (biodiversity index 0.72. Large areas in Serbia are under natural grasslands and pastures, composed of forage grass species, and important as source of natural plant genetic diversity and germplasm for breeding. These eco-systems represent basic prerequisites for sustainable forage production, but very low potential of them is utilized and genetic resources are not protected. Family Poaceae is present in Serbia flora with 70 genera and among them from the aspect of forage production and quality, the most important are perennial Festuca, Lolium, Dactylis, Phleum, Bromus, Arrhenatherum, Poa and Agrostis species. Most of these grasses have been bred in Serbia and lot of cultivars were released. These cultivars contain autochthonous Serbian material and represent great and important resource of genetic variability. Therefore, collecting of new samples which are acclimatised to local eco-geographical conditions and including them in plant ex situ gene bank is of exceptional importance for further utilization in different plant breeding programmes as well as genetic resources protection. These autochthonous populations have natural variability and very often have satisfactory yielding performance in comparison with introduced cultivars, which referred them for direct phenotypic selection for cultivars release. Broadening of forage grasses genotypes collection is permanent objective of Serbian scientists. Collected accessions are being characterized and evaluated for important phenological, morphological and agronomical traits. In this paper genetic resources of forage grass species, their diversity and potentials, state of the grasses gene banks, as well as possibility for breeding of new cultivars has been analysed.

The herbaceous landlord: integrating the effects of symbiont consortia within a single host

Directory of Open Access Journals (Sweden)

Roo Vandegrift

2015-11-01

Full Text Available Plants are typically infected by a consortium of internal fungal associates, including endophytes in their leaves, as well as arbuscular mycorrhizal fungi (AMF and dark septate endophytes (DSE in their roots. It is logical that these organisms will interact with each other and the abiotic environment in addition to their host, but there has been little work to date examining the interactions of multiple symbionts within single plant hosts, or how the relationships among symbionts and their host change across environmental conditions. We examined the grass Agrostis capillaris in the context of a climate manipulation experiment in prairies in the Pacific Northwest, USA. Each plant was tested for presence of foliar endophytes in the genus Epichloë, and we measured percent root length colonized (PRLC by AMF and DSE. We hypothesized that the symbionts in our system would be in competition for host resources, that the outcome of that competition could be driven by the benefit to the host, and that the host plants would be able to allocate carbon to the symbionts in such a way as to maximize fitness benefit within a particular environmental context. We found a correlation between DSE and AMF PRLC across climatic conditions; we also found a fitness cost to increasing DSE colonization, which was negated by presence of Epichloë endophytes. These results suggest that selective pressure on the host is likely to favor host/symbiont relationships that structure the community of symbionts in the most beneficial way possible for the host, not necessarily favoring the individual symbiont that is most beneficial to the host in isolation. These results highlight the need for a more integrative, systems approach to the study of host/symbiont consortia.

Plantas hospederas de Aphis gossypii (Aphididae, vector de virus del melón Cucumis melo (Cucurbitaceae en Costa Rica

Directory of Open Access Journals (Sweden)

M.V. Sánchez

2001-03-01

palustris, Chamaesyce gyssopilopia, Phyllantus amarus, Sida decumbens, Ludwigia erecta, Passiflora foetida, Guazuma ulmifolia y Corchorus orinocensis.Plant species associated with commercial melon crops and surrounding areas were examined to identity the natural host plants of Aphis gossypii Glover. The study was conducted in two farms located in different melon production areas and plant life zones of Costa Rica. Plant species diversity, percent coverage and distribution over time were recorded during one year. Differences between locations were observed. A total of 86 plant species (49 families and 72 plant species (40 families were identified associated to the crop in farms A and B, respectively. In both farms a total of 24 species plants (16 families were colonized by A. gossypii and 16 (10 families are new reports of host plant species for this aphid. The new reports are: Justicia comata, Tetramerium nervosum, Alternanthera pubiflora, Cassia massoni, C. reticulata, Cleome viscosa, C. spinosa, Croton argenteus, Caperonia palustris, Chamaesyce gyssopilopia, Phyllantus amarus, Sida decumbens, Ludwigia erecta, Passiflora foetida, Guazuma ulmifolia and Corchorus orinocensis.

Soil nitrogen availability and in situ nitrogen uptake by Acer rubrum L. and Pinus palustris Mill. in the southeastern U.S. Coastal Plain

Science.gov (United States)

Plant uptake of soil organic N in addition to inorganic N could play an important role in ecosystem N cycling as well as plant nutrition. We measured in situ plant uptake of organic and inorganic N by the dominant canopy species in two contrasting temperate forest ecosystems (bottomland floodplain ...

Bacteriohopanepolyol signatures as markers for methanotrophic bacteria in peat moss

Science.gov (United States)

van Winden, Julia F.; Talbot, Helen M.; Kip, Nardy; Reichart, Gert-Jan; Pol, Arjan; McNamara, Niall P.; Jetten, Mike S. M.; Op den Camp, Huub J. M.; Sinninghe Damsté, Jaap S.

2012-01-01

Bacteriohopanepolyols (BHPs) are bacterial biomarkers with a likely potential to identify present and past methanotrophic communities. To unravel the methanotrophic community in peat bogs, we report the BHP signatures of type I and type II methanotrophs isolated from Sphagnum mosses and of an extreme acidophilic verrucomicrobial methanotroph. A type I Methylovulum-like strain (M200) contains a remarkable combination of BHPs, including a complete suite of mono-unsaturated aminobacteriohopanepentol, -tetrol and -triol. The Methylomonas-like strain (M5) mainly produces aminobacteriohopanepentol, characteristic for type I methanotrophs, and the Methylosinus-like strain (29) contains both aminobacteriohopanetetrol and aminobacteriohopanetriol, typical for a type II methanotroph. The type II methanotroph Methylocella palustris and the verrucomicrobial Methylacidiphilum fumariolicum strain SolV primarily produce aminotriol, which is also produced by many other bacteria. In Sphagnum mosses and underlying peat from a peat bog from Moorhouse, UK, the only detectable BHPs indicative of methanotrophs are aminobacteriohopanepentol (aminopentol) and aminobacteriohopanetetrol (aminotetrol), although both are relatively low in abundance compared to other BHPs. Aminopentol serves as a marker for type I methanotrophs, while aminotetrol may reflect the presence of both type I and type II methanotrophs. The similar quantities of aminotetrol and aminopentol indicate that the methanotrophic community in Sphagnum peat probably consist of a combination of both type I and type II methanotrophs, which is in line with previously published pmoA-based micro-array results.

Genomic characterisation of Arachis porphyrocalyx (Valls & C.E. Simpson, 2005) (Leguminosae): multiple origin of Arachis species with x = 9

Science.gov (United States)

Celeste, Silvestri María; Ortiz, Alejandra Marcela; Robledo, Germán Ariel; Valls, José Francisco Montenegro; Lavia, Graciela Inés

2017-01-01

Abstract The genus Arachis Linnaeus, 1753 comprises four species with x = 9, three belong to the section Arachis: Arachis praecox (Krapov. W.C. Greg. & Valls, 1994), Arachis palustris (Krapov. W.C. Greg. & Valls, 1994) and Arachis decora (Krapov. W.C. Greg. & Valls, 1994) and only one belongs to the section Erectoides: Arachis porphyrocalyx (Valls & C.E. Simpson, 2005). Recently, the x = 9 species of section Arachis have been assigned to G genome, the latest described so far. The genomic relationship of Arachis porphyrocalyx with these species is controversial. In the present work, we carried out a karyotypic characterisation of Arachis porphyrocalyx to evaluate its genomic structure and analyse the origin of all x = 9 Arachis species. Arachis porphyrocalyx showed a karyotype formula of 14m+4st, one pair of A chromosomes, satellited chromosomes type 8, one pair of 45S rDNA sites in the SAT chromosomes, one pair of 5S rDNA sites and pericentromeric C-DAPI+ bands in all chromosomes. Karyotype structure indicates that Arachis porphyrocalyx does not share the same genome type with the other three x = 9 species and neither with the remaining Erectoides species. Taking into account the geographic distribution, morphological and cytogenetic features, the origin of species with x = 9 of the genus Arachis cannot be unique; instead, they originated at least twice in the evolutionary history of the genus. PMID:28919947

Minimal domain of bacterial phytochrome required for chromophore binding and fluorescence

Science.gov (United States)

Rumyantsev, Konstantin A.; Shcherbakova, Daria M.; Zakharova, Natalia I.; Emelyanov, Alexander V.; Turoverov, Konstantin K.; Verkhusha, Vladislav V.

2015-12-01

Fluorescent proteins (FP) are used to study various biological processes. Recently, a series of near-infrared (NIR) FPs based on bacterial phytochromes was developed. Finding ways to improve NIR FPs is becoming progressively important. By applying rational design and molecular evolution we have engineered R. palustris bacterial phytochrome into a single-domain NIR FP of 19.6 kDa, termed GAF-FP, which is 2-fold and 1.4-fold smaller than bacterial phytochrome-based NIR FPs and GFP-like proteins, respectively. Engineering of GAF-FP involved a substitution of 15% of its amino acids and a deletion of the knot structure. GAF-FP covalently binds two tetrapyrrole chromophores, biliverdin (BV) and phycocyanobilin (PCB). With the BV chromophore GAF-FP absorbs at 635 nm and fluoresces at 670 nm. With the PCB chromophore GAF-FP becomes blue-shifted and absorbs at 625 nm and fluoresces at 657 nm. The GAF-FP structure has a high tolerance to small peptide insertions. The small size of GAF-FP and its additional absorbance band in the violet range has allowed for designing a chimeric protein with Renilla luciferase. The chimera exhibits efficient non-radiative energy transfer from luciferase to GAF-FP, resulting in NIR bioluminescence. This study opens the way for engineering of small NIR FPs and NIR luciferases from bacterial phytochromes.

Domination and Composition Structure Change at Hemic Peat Natural Regeneration Following Burning; A Case Study in Pelalawan, Riau Province

Directory of Open Access Journals (Sweden)

BAMBANG HERO SAHARJO

2006-04-01

Full Text Available Biomass burning is the burning of the world’s living and dead vegetation, including grasslands, forests and agricultural lands following the harvest for land clearing and land-use change. One of the important information needed following this biomass burning is how long the burnt forest or land can be recovered, and how worst the changing occurred. Repeated burning occurred at the same place trend to clean the vegetation which leads to have the land with lower number and quality of species left. The research objective is to understand the vegetation changing following peat fires in the sapric peat type at the land preparation using belong to the local community located in the Pelalawan district, Riau province, Indonesia during the dry season in the year 2001. Before burning, logging, slashing, drying and burning the site was dominated by Uncaria glabrata at seedling stage, Ficus sundaica at sapling stage, Ficus sundaica at pole stage and Stenochlaena palustris at understorey. After logging, slashing and followed by 4 weeks drying then continued by burning with high flame temperature range from 900-1100oC, it had been found that 3-months following burning the site was dominated by Uncaria glabrata at seedling stage and Nephrolepis flaccigera at understorey while 6-months following burning the site was dominated by Parastemon uruphyllus at seedling stage and Erechites valeriantifolia at understorey stage.

Phylogenetic diversity of hpnP, the hopanoid methylase, and its implications for 2-methylhopanoids as biomarkers

Science.gov (United States)

Ricci, J. N.; Coleman, M. L.; Osburn, M. R.; Sessions, A. L.; Spear, J. R.; Newman, D. K.

2011-12-01

Hopanoids are a class of sterols produced by bacteria. Their hydrocarbon skeletons are resistant to degradation making their diagenetic products, hopanes, attractive biomarkers. Particular attention has been paid to 2-methylhopanes, which have been found at discrete times and locations in Earth history as far back as 2,500 Myr. Previously, they were inferred to be markers of oxygenic photosynthesis in cyanobacteria, but the discovery of an anoxygenic phototroph, Rhodopseudomonas palustris TIE-1, capable of producing significant quantities of 2-methylbacteriohopanetetrol, the parent molecule of the fossil 2-methylhopane, challenged this interpretation. In this study, we sought to determine the diversity and origin of the enzyme responsible for methylating hopanoids, HpnP. To accomplish this task, we surveyed a diversity of Yellowstone hot springs using degenerate PCR primers and searched publically available metagenomic databases for hpnP-like sequences. The Yellowstone hot spring samples were dominated by cyanobacterial-like hpnP sequences, while the metagenomic data contained many hpnP-like sequences from a diversity of environments that grouped with all known hpnP-containing phyla. With these additional hpnP sequences, we will report updated phylogenetic trees that attempt to determine the origin of hpnP. Understanding the distribution of 2-methylhopanoid production throughout the tree of life and its origin is important to be able to use 2-methylhopanes as biomarkers for any particular taxonomic group.

Marine environment status assessment based on macrophytobenthic plants as bio-indicators of heavy metals pollution

International Nuclear Information System (INIS)

Zalewska, Tamara; Danowska, Beata

2017-01-01

The main aim of study was to develop the environmental quality standards (EQS MP ) for selected heavy metals: Pb, Cd, Hg and Ni bioaccumulated in the tissues of marine macrophytobenthic plants: Chara baltica, Cladophora spp., Coccotylus truncatus, Furcellaria lumbricalis, Polysiphonia fucoides, Stuckenia pectinata and Zanichellia palustris, collected in designated areas of the southern Baltic Sea in period 2008–2015. The calculated concentration ratios (CR), which attained very high values: 10 4 L kg −1 for lead, 10 3 L kg −1 for nickel and mercury and even 10 5 L kg −1 for cadmium formed the basis for the determination of EQS MP values. The EQS MP values were: 26 mg kg −1 d.w. for Pb, 33 mg kg −1 d.w. for Cd, 32 mg kg −1 d.w. for Ni and 0.4 mg kg −1 d.w. for Hg. The application of macrophytobenthic plants as bioindicators in marine environment status assessment of certain areas of the Baltic Sea is also described in the paper. - Highlights: • Macrophytobenthic plants were applied as a bioindicators for heavy metals pollution assessment. • The environmental quality standards for Pb, Cd, Ni, Hg in macrophytobenthic plants were evaluated. • The marine environment status assessment method based on bioindicators was proposed.

Biomass chemicals: improvement in quality and quantity with physiological regulators

Energy Technology Data Exchange (ETDEWEB)

Kossuth, S.V.

1984-01-01

The search for alternative biomass energy forms has centered on two approaches: (1) production of cellulose fiber in biomass of low net energy value per unit weight, such as wood and bagasse, and (2) hydrocarbons of high net energy value per unit weight for use as chemical feedstocks and substitutes for petroleum. Major plant chemical products include oleoresin from pine (Pinus elliottii Engelm., P. palustris Mill.) rubber from the rubber tree (Hevea brasiliensis Muell.), and guayule shrub (Parthenium argentatum Gray) and sugar from sugarcane (Saccharum species). Ethylene may be a unifying natural bioregulator that can increase deposition of biomass chemicals in all four of these systems. Examples of bioregulators include the use of paraquat, diquat, and 2-chloroethylphosphonic acid (CEPA) for stimulating the synthesis of oleoresin, CEPA for prolonging the flow of rubber and increasing rubber synthesis in the rubber tree, and triethylamines of chlorinated phenoxy compounds for stimulating rubber production in guayule. In sugarcane, gibberellic acid (GA3) increases internodal elongation. Glyphosate, CEPA and other regulators increase the deposition of sucrose, diquat and CEPA inhibit flowering, and paraquat desiccates leaves to facilitate leaf removal or burning just prior to harvest. The cellular compartmentalization for the synthesis of these plant chemicals is unique for each species, and dictates cultural and harvest techniques. The mode of action and pathways for the success of these physiological regulators are discussed. 42 references.

Micromorphological study (ultrastructure of lamina surface, seeds, ultrasculpture of pollen grains of Gladiolus L. species (Iridaceae Juss. of Ukrainian flora

Directory of Open Access Journals (Sweden)

Zhygalova Svitlana L.

2014-12-01

Full Text Available Micro-morphological characteristics of the four Gladiolus L. species of the Ukrainian flora (G. imbricatus L., G. italicus Mill., G. palustris Gaudin and G. tenuis M. Bieb. as regards leaves, seeds and pollens are presented with this investigation in a detailed way. An examination of the surface structure of the leaves, seeds and pollen grains of the Gladiolus species indicates that the characteristics of the ultrastructure of leaves and of pollen grains are not diagnostic for distinguishing species, but they could be important at genus level (leaves: features such as being amphistomatic, having the same quantity of immersed stomata on both surfaces and having a high stomata index, the presence and localisation of papillae, the shape of epidermal cells; pollen grains: monosulcate type with two operculums. However, the type of surface ultrastructure of the seed coat is a diagnostic feature as at genus level so for species. It can be mentioned that propose the use of features such as the shape and position of the cicatricle, the type of cuticle, the shape and boundaries of cells of testa, and the anticlinal cell walls as diagnostic features at genera level. The shape of seeds, the presence and disposition of wing, the level of the periclinal cell walls of the seed coat and types of relief are additional diagnostic features for distinguishing of Gladiolus species.

On the Evolutionary History of Uleiella chilensis, a Smut Fungus Parasite of Araucaria araucana in South America: Uleiellales ord. nov. in Ustilaginomycetes.

Directory of Open Access Journals (Sweden)

Kai Riess

Full Text Available The evolutionary history, divergence times and phylogenetic relationships of Uleiella chilensis (Ustilaginomycotina, smut fungi associated with Araucaria araucana were analysed. DNA sequences from multiple gene regions and morphology were analysed and compared to other members of the Basidiomycota to determine the phylogenetic placement of smut fungi on gymnosperms. Divergence time estimates indicate that the majority of smut fungal orders diversified during the Triassic-Jurassic period. However, the origin and relationships of several orders remain uncertain. The most recent common ancestor between Uleiella chilensis and Violaceomyces palustris has been dated to the Lower Cretaceous. Comparisons of divergence time estimates between smut fungi and host plants lead to the hypothesis that the early Ustilaginomycotina had a saprobic lifestyle. As there are only two extant species of Araucaria in South America, each hosting a unique Uleiella species, we suggest that either coevolution or a host shift followed by allopatric speciation are the most likely explanations for the current geographic restriction of Uleiella and its low diversity. Phylogenetic and age estimation analyses, ecology, the unusual life-cycle and the peculiar combination of septal and haustorial characteristics support Uleiella chilensis as a distinct lineage among the Ustilaginomycotina. Here, we describe a new ustilaginomycetous order, the Uleiellales to accommodate Uleiella. Within the Ustilaginomycetes, Uleiellales are sister taxon to the Violaceomycetales.

LOL2 and LOL5 loci control latex production by laticifer cells in Euphorbia lathyris.

Science.gov (United States)

Castelblanque, Lourdes; Balaguer, Begoña; Marti, Cristina; Orozco, Marianela; Vera, Pablo

2018-06-07

Laticifers are specialized plant cells capable of indefinite elongation that ramify extensively and are responsible for latex biosynthesis and accumulation. However, the mechanisms underlying laticifer cell differentiation, growth and production of latex remain largely unknown. In a search for mutants showing enhanced accumulation of latex we identified two LOT OF LATEX (LOL) loci in Euphorbia lathyris. lol2 and lol5 mutants show enhanced production of latex contained within laticifer cells. The recessive lol2 mutant carries increased biosynthesis of the plant hormone jasmonoyl-isoleucine (JA-Ile) and therefore establishes a genetic link between jasmonic acid (JA) signaling and latex production in laticifers. Instead, heightened production of latex in lol5 plants obeys to enhanced proliferation of laticifer cells. Phylogenetic analysis of laticifer-expressed genes in E. lathyris and in two other latex-bearing species, Euphorbia corallioides and Euphorbia palustris, allowed the identification of canonical JA responsive elements present in the gene promoter regions of laticifer marker genes. Moreover, we identified that the hormone JA functions not as a morphogen for laticifer differentiation but as a trigger for the fill out of laticifers with latex and the associated triterpenoids. The identification of LOL loci represents a further step towards the understanding of mechanisms controlling latex production in laticifer cells. No claim to original US Government works New Phytologist © 2018 New Phytologist Trust.

Comparing Avocado, Swamp Bay, and Camphortree as Hosts of Raffaelea lauricola Using a Green Fluorescent Protein (GFP)-Labeled Strain of the Pathogen.

Science.gov (United States)

Campbell, A S; Ploetz, R C; Rollins, J A

2017-01-01

Raffaelea lauricola, a fungal symbiont of the ambrosia beetle Xyleborus glabratus, causes laurel wilt in members of the Lauraceae plant family. North American species in the family, such as avocado (Persea americana) and swamp bay (P. palustris), are particularly susceptible to laurel wilt, whereas the Asian camphortree (Cinnamomum camphora) is relatively tolerant. To determine whether susceptibility is related to pathogen colonization, a green fluorescent protein-labeled strain of R. lauricola was generated and used to inoculate avocado, swamp bay, and camphortree. Trees were harvested 3, 10, and 30 days after inoculation (DAI), and disease severity was rated on a 1-to-10 scale. By 30 DAI, avocado and swamp bay developed significantly more severe disease than camphortree (mean severities of 6.8 and 5.5 versus 1.6, P < 0.003). The extent of xylem colonization was recorded as the percentage of lumena that were colonized by the pathogen. More xylem was colonized in avocado than camphortree (0.9% versus 0.1%, P < 0.03) but colonization in swamp bay (0.4%) did not differ significantly from either host. Although there were significant correlations between xylem colonization and laurel wilt severity in avocado (r = 0.74), swamp bay (r = 0.82), and camphortree (r = 0.87), even severely affected trees of all species were scarcely colonized by the pathogen.

Beneficial effects of Ectothiorhodospira shaposhnikovii WF on larval cultivation of Litopenaeus vannamei.

Science.gov (United States)

Wen, C Q; Xue, M; Liang, H F; Wu, Y; Li, X

2015-01-01

To develop high quality probiotics for shrimp larviculture, the effects of a photosynthetic purple sulphur bacterium WF identified as Ectothiorhodospira shaposhnikovii on survival and development of Litopenaeus vannamei larvae were evaluated in vivo. The larvae exhibited a better survival rate after administration of strain WF compared to the probiotic Rhodopseudomonas palustris. To investigate the effect of dose and dosing frequency, strain WF was added to larvae, stages nauplius 6 to zoea 3, at three different doses and dosing frequencies. Larval treatment with strain WF twice at 10(6) cfu/ml exhibited significantly higher survival compared to the other doses and dosing frequencies as well as the control. The effect on water quality was assessed by applying strain WF to larvae, stages nauplius 6 to postlarvae 1, under conditions of zero water exchange and one-third water exchange. The larvae exhibited higher survival and faster growth when treated under conditions of zero water exchange. No significant difference was detected in the levels of three water quality parameters and in vibrio counts between these two conditions. Therefore, E. shaposhnikovii WF acts both as a bioremediation agent and nutrient source and can benefit shrimp larvae if given at an appropriate dose and dosing frequency. Strain WF, a moderate halophile, shows great promise as a water additive in improving water quality and providing nutrition for shrimp larviculture.

Interaction of arbuscular mycorrhizal symbionts with arsenic and other potentially toxic elements

International Nuclear Information System (INIS)

Khairuddin Abdul Rahim

2000-01-01

The response of arbuscular mycorrhizal (AM) symbionts to arsenic, and arsenic interactions with phosphorus and potentially toxic elements (PTEs) in soils from a former arsenic mine, the Devon Great Consols, were investigated. The objective was to determine whether AM associations ameliorate arsenic toxicity in Plantago lanceolata and Agrostis capillaris, plants commonly found at abandoned mines. An exploratory investigation indicated the richness in biodiversity of AMF that colonised plants growing at the site. Arsenic was found at high concentrations and was strongly associated with copper and iron. P. lanceolata was always colonised by AMF, while colonisation of A. capillaris was variable. There was no evidence in the field of soil pH or PTEs influencing AMF colonisation and spore density. There was no strong correlation between arsenic content in plant and available arsenic, obtained through various extraction methods. Spore germination and infectivity in the mine soils were strongly influenced by the AMF genotype and to a lesser extent by the soil environment. P. lanceolata and A. capillaris root growth was inhibited at arsenic concentrations of ≥50 μg g -1 in agar. Bioavailability experiments using mine soils and Terra-Green TM (calcined attapulgite) spiked with sodium arsenate gave no evidence that AMF-colonised plants translocated less arsenic to the shoots. Plants accumulated more arsenic in their roots than in their shoots, whether they were colonised by AMF or not. The A. capillaris genotype used in the present study translocated less of both arsenic and phosphorus to its shoots than P. lanceolata. High available phosphorus in Terra-Green TM protected plants against arsenic toxicity, at -1 As. There was evidence for inhibition by arsenic in AMF colonisation of roots. For quantifying AMF extra radical hyphae contribution to arsenic transportation from growth medium to plant using a compartmented pot system, the use of low phosphorus medium and a longer

Unravelling the bioherbicide potential of Eucalyptus globulus Labill: Biochemistry and effects of its aqueous extract.

Directory of Open Access Journals (Sweden)

Carolina G Puig

Full Text Available In the worldwide search for new strategies in sustainable weed management, the use of plant species able to produce and release phytotoxic compounds into the environment could be an effective alternative to synthetic herbicides. Eucalyptus globulus Labill. is known to be a source of biologically active compounds responsible for its phytotoxic and allelopathic properties. Our previous results demonstrated the bioherbicide potential of eucalyptus leaves incorporated into the soil as a green manure, probably through the release of phytotoxins into the soil solution. Thus, the aims of this study were to understand the phytotoxicity of the eucalyptus leaves aqueous extract applied in pre- and post-emergence, and to identify and quantify its potentially phytotoxic water-soluble compounds. The effects were tested on the germination and early growth of the model target species Lactuca sativa and Agrostis stolonifera, and on physiological parameters of L. sativa adult plants after watering or spraying application. Dose-response curves and ED50 and ED80 values for eucalyptus aqueous extracts revealed pre-emergence inhibitory effects on both target species, effects being comparable to the herbicide metolachlor. While spraying treatment reduced the aerial and root biomass and increased the dry weight/fresh weight ratio of lettuce adult plants, watering application reduced protein contents and chlorophyll concentrations with respect to control, reflecting different modes of action depending on the site of phytotoxin entry. Via HPLC analyses, a total of 8 phenolic compounds (chlorogenic, two ρ-coumaric derivatives, ellagic, hyperoside, rutin, quercitrin, and kaempferol 3-O-glucoside and other 5 low weight organic acids (citric, malic, shikimic, succinic and fumaric acids were obtained from aqueous extract, the latter being identified for the first time in E. globulus. Despite some phytotoxic effects were found on lettuce adult plants, the use of eucalyptus

Re-vegetation of block-cut and milled peatlands: an Estonian example

Directory of Open Access Journals (Sweden)

T. Triisberg

2011-06-01

Full Text Available The re-vegetation of mined peatlands after abandonment is often a long-lasting process. The aim of this study was to clarify the factors influencing the re-vegetation of abandoned block-cut, milled and fertilised peat areas in Estonia by investigating and comparing their present vegetation. The analysis is based on 285 quadrat samples where plant species composition and cover were assessed, and the pH and electrical conductivity of bog water were measured. Whereas re-vegetation in the block-cut area was quite fast and progressive, in milled peat areas it was slow and irregular because of the absence of viable propagules and the unfavourable conditions for plant growth. The course of re-vegetation depends considerably upon the peat extraction method, the area and surface microtopography of the mined area, the pH and electrical conductivity of the bog water, and the density at which trees have established on the cutover surface. Plant species richness was most affected by the density of tree saplings, litter cover, former treatment and microtopography. A single application of fertiliser ca 25 years ago did not have a long-term effect on the total number of plant species, but did increase plant cover and the mean number of species per quadrat. On milled peatlands, neither the sowing of Oxycoccus palustris seeds nor the planting of Rubus chamaemorus had the desired effect unless growth conditions for the plants were improved.

Presence and absence of bats across habitat scales in the Upper Coastal Plain of South Carolina.

Energy Technology Data Exchange (ETDEWEB)

Ford, W.Mark; Menzel, Jennifer M.; Menzel, Michael A.: Edwards, John W.; Kilgo, John C.

2006-10-01

Abstract During 2001, we used active acoustical sampling (Anabat II) to survey foraging habitat relationships of bats on the Savannah River Site (SRS) in the upper Coastal Plain of South Carolina. Using an a priori information-theoretic approach, we conducted logistic regression analysis to examine presence of individual bat species relative to a suite of microhabitat, stand, and landscape-level features such as forest structural metrics, forest type, proximity to riparian zones and Carolina bay wetlands, insect abundance, and weather. There was considerable empirical support to suggest that the majority of the activity of bats across most of the 6 species occurred at smaller, stand-level habitat scales that combine measures of habitat clutter (e.g., declining forest canopy cover and basal area), proximity to riparian zones, and insect abundance. Accordingly, we hypothesized that most foraging habitat relationships were more local than landscape across this relatively large area for generalist species of bats. The southeastern myotis (Myotis austroriparius) was the partial exception, as its presence was linked to proximity of Carolina bays (best approximating model) and bottomland hardwood communities (other models with empirical support). Efforts at SRS to promote open longleaf pine (Pinus palustris) and loblolly pine (P. taeda) savanna conditions and to actively restore degraded Carolina bay wetlands will be beneficial to bats. Accordingly, our results should provide managers better insight for crafting guidelines for bat habitat conservation that could be linked to widely accepted land management and environmental restoration practices for the region.

Communities of larger fungi of ombrotrophic bogs in West Siberia

Directory of Open Access Journals (Sweden)

N.V. Filippova

2014-11-01

Full Text Available Bogs are common ecosystems in the Taiga of West Siberia. Little is known about mycological diversity in these important ecosystems. This article summarises the results of a two-year study of the macrofungi in two bogs near the town of Khanty-Mansiysk. Sporocarps were collected in 20 plots (about 300 m2 established in Mukhrino Bog as well as during random walks in Mukhrino Bog and Chistoe Bog in the late summer–autumn of 2012 and 2013. The plots were established in two common bog habitats representing the Ledo-Sphagnetum fusci (LS and Scheuchzerio palustris-Sphagnetum cuspidati (SS plant community associations. A total of 59 distinct fungal taxa were collected from the two bogs, with the LS association having a higher species richness and diversity than the SS association (50 taxa vs. 16 taxa and 30–40 taxa per 1000 m2 vs. 6–10 taxa per 1000 m2, respectively. Each of the two plant community associations has its own characteristic fungal taxa, with the LS association having 13 characteristic taxa and the SS association having five. Nearly two thirds of the fungal taxa are saprotrophic, mainly of Sphagnum spp., while others are mycorrhizal, mainly with Pinus spp. Most taxa were collected fewer than ten times during the study period and, hence, are considered rare and may need to be recognised for conservation programmes in this region.

Energy transfer and clustering of photosynthetic light-harvesting complexes in reconstituted lipid membranes

International Nuclear Information System (INIS)

Dewa, Takehisa; Sumino, Ayumi; Watanabe, Natsuko; Noji, Tomoyasu; Nango, Mamoru

2013-01-01

Highlights: ► Photosynthetic light-harvesting complexes were reconstituted into lipid membranes. ► Energy transfers between light-harvesting complexes were examined. ► Atomic force microscopy indicated cluster formation of light-harvesting complexes. ► Efficient energy transfer was observed for the clustered complexes in the membranes. - Abstract: In purple photosynthetic bacteria, light-harvesting complex 2 (LH2) and light harvesting/reaction centre core complex (LH1-RC) play the key roles of capturing and transferring light energy and subsequent charge separation. These photosynthetic apparatuses form a supramolecular assembly; however, how the assembly influences the efficiency of energy conversion is not yet clear. We addressed this issue by evaluating the energy transfer in reconstituted photosynthetic protein complexes LH2 and LH1-RC and studying the structures and the membrane environment of the LH2/LH1-RC assemblies, which had been embedded into various lipid bilayers. Thus, LH2 and LH1-RC from Rhodopseudomonas palustris 2.1.6 were reconstituted in phosphatidylglycerol (PG), phosphatidylcholine (PC), and phosphatidylethanolamine (PE)/PG/cardiolipin (CL). Efficient energy transfer from LH2 to LH1-RC was observed in the PC and PE/PG/CL membranes. Atomic force microscopy revealed that LH2 and LH1-RC were heterogeneously distributed to form clusters in the PC and PE/PG/CL membranes. The results indicated that the phospholipid species influenced the cluster formation of LH2 and LH1-RC as well as the energy transfer efficiency

Energy transfer and clustering of photosynthetic light-harvesting complexes in reconstituted lipid membranes

Energy Technology Data Exchange (ETDEWEB)

Dewa, Takehisa, E-mail: takedewa@nitech.ac.jp [Department of Frontier Materials, Graduate School of Engineering, Nagoya Institute of Technology, Gokiso-cho, Showa-ku, Nagoya 466-8555 (Japan); Japan Science and Technology, PRESTO, 4-1-8 Honcho Kawaguchi, Saitama 332-0012 (Japan); Sumino, Ayumi; Watanabe, Natsuko; Noji, Tomoyasu [Department of Frontier Materials, Graduate School of Engineering, Nagoya Institute of Technology, Gokiso-cho, Showa-ku, Nagoya 466-8555 (Japan); Nango, Mamoru, E-mail: nango@nitech.ac.jp [Department of Frontier Materials, Graduate School of Engineering, Nagoya Institute of Technology, Gokiso-cho, Showa-ku, Nagoya 466-8555 (Japan)

2013-06-20

Highlights: ► Photosynthetic light-harvesting complexes were reconstituted into lipid membranes. ► Energy transfers between light-harvesting complexes were examined. ► Atomic force microscopy indicated cluster formation of light-harvesting complexes. ► Efficient energy transfer was observed for the clustered complexes in the membranes. - Abstract: In purple photosynthetic bacteria, light-harvesting complex 2 (LH2) and light harvesting/reaction centre core complex (LH1-RC) play the key roles of capturing and transferring light energy and subsequent charge separation. These photosynthetic apparatuses form a supramolecular assembly; however, how the assembly influences the efficiency of energy conversion is not yet clear. We addressed this issue by evaluating the energy transfer in reconstituted photosynthetic protein complexes LH2 and LH1-RC and studying the structures and the membrane environment of the LH2/LH1-RC assemblies, which had been embedded into various lipid bilayers. Thus, LH2 and LH1-RC from Rhodopseudomonas palustris 2.1.6 were reconstituted in phosphatidylglycerol (PG), phosphatidylcholine (PC), and phosphatidylethanolamine (PE)/PG/cardiolipin (CL). Efficient energy transfer from LH2 to LH1-RC was observed in the PC and PE/PG/CL membranes. Atomic force microscopy revealed that LH2 and LH1-RC were heterogeneously distributed to form clusters in the PC and PE/PG/CL membranes. The results indicated that the phospholipid species influenced the cluster formation of LH2 and LH1-RC as well as the energy transfer efficiency.

Structural characterization of core-bradavidin in complex with biotin

Science.gov (United States)

Agrawal, Nitin; Määttä, Juha A. E.; Kulomaa, Markku S.; Hytönen, Vesa P.; Johnson, Mark S.; Airenne, Tomi T.

2017-01-01

Bradavidin is a tetrameric biotin-binding protein similar to chicken avidin and bacterial streptavidin, and was originally cloned from the nitrogen-fixing bacteria Bradyrhizobium diazoefficiens. We have previously reported the crystal structure of the full-length, wild-type (wt) bradavidin with 138 amino acids, where the C-terminal residues Gly129-Lys138 (“Brad-tag”) act as an intrinsic ligand (i.e. Gly129-Lys138 bind into the biotin-binding site of an adjacent subunit within the same tetramer) and has potential as an affinity tag for biotechnological purposes. Here, the X-ray structure of core-bradavidin lacking the C-terminal residues Gly114-Lys138, and hence missing the Brad-tag, was crystallized in complex with biotin at 1.60 Å resolution [PDB:4BBO]. We also report a homology model of rhodavidin, an avidin-like protein from Rhodopseudomonas palustris, and of an avidin-like protein from Bradyrhizobium sp. Ai1a-2, both of which have the Brad-tag sequence at their C-terminus. Moreover, core-bradavidin V1, an engineered variant of the original core-bradavidin, was also expressed at high levels in E. coli, as well as a double mutant (Cys39Ala and Cys69Ala) of core-bradavidin (CC mutant). Our data help us to further engineer the core-bradavidin–Brad-tag pair for biotechnological assays and chemical biology applications, and provide deeper insight into the biotin-binding mode of bradavidin. PMID:28426764

What controls stemflow? A LiDAR-based investigation of individual tree canopy structure, neighborhood conditions, and meteorological factors

Science.gov (United States)

Yankine, S. A.; Van Stan, J. T., II; Mesta, D. C.; Côté, J. F.; Hildebrandt, A.; Friesen, J.; Maldonado, G.

2017-12-01

Stemflow is a pointed hydrologic flux at the base of tree stems that has been linked to a host of biogeochemical processes in vegetated landscapes. Much work has been done to examine controls over stemflow water yield, finding three major factors: individual tree canopy structure, meteorological variables, and neighborhood conditions. However, the authors are unaware of any study to directly quantify all factors using a combination of terrestrial LiDAR and micrometeorological monitoring methods. This study directly quantifies individual Pinus palustris tree canopy characteristics (trunk volume and angle, branch volume and angle from 1st-to-3rd order, bark roughness, and height), 10-m radius neighborhood properties (number of trees, mean diameter and height, mean distance from study tree, and canopy overlap), and above-canopy storm conditions (magnitude, intensity, mean/max wind speed, and vapor pressure deficit) directly at the site. Stemflow production was 1% of rainfall, ranging from 0.3-59 L per storm from individual trees. Preliminary findings from storms (5-176 mm in magnitude) indicate that all individual tree characteristics, besides bark roughness, have little influence on stemflow generation. Bark roughness altered stemflow generation by affecting trunk water storage (0.1-0.7 mm) and wet trunk evaporation rates (0.005-0.03 mm/h). The strongest influence over stemflow generation from individual trees was the interaction between neighborhood characteristics and meteorological conditions (primarily rainfall amount and, secondarily, rainfall intensity).

Characterizations of purple non-sulfur bacteria isolated from paddy fields, and identification of strains with potential for plant growth-promotion, greenhouse gas mitigation and heavy metal bioremediation.

Science.gov (United States)

Sakpirom, Jakkapan; Kantachote, Duangporn; Nunkaew, Tomorn; Khan, Eakalak

2017-04-01

This study was aimed at selecting purple non-sulfur bacteria (PNSB) isolated from various paddy fields, including Cd- and Zn-contaminated paddy fields, based on their biofertilizer properties. Among 235 PNSB isolates, strain TN110 was most effective in plant growth-promoting substance (PGPS) production, releasing 3.2 mg/L of [Formula: see text] , 4.11 mg/L of 5-aminolevulinic acid (ALA) and 3.62 mg/L of indole-3-acetic acid (IAA), and reducing methane emission up to 80%. This strain had nifH, vnfG and anfG, which are the Mo, V and Fe nitrogenase genes encoded for key enzymes in nitrogen fixation under different conditions. This strain provided 84% and 55% removal of Cd and Zn, respectively. Another isolate, TN414, not only produced PGPS (1.30 mg/L of [Formula: see text] , 0.94 mg/L of ALA and 0.65 mg/L of IAA), but was also efficient in removing both Cd and Zn at 72% and 74%, respectively. Based on 16S rDNA sequencing, strain TN110 was identified as Rhodopseudomonas palustris, while strain TN414 was Rubrivivax gelatinosus. A combination of TN110 and TN414 could potentially provide a biofertilizer, which is a greener alternative to commercial/chemical fertilizers and an agent for bioremediation of heavy metals and greenhouse gas mitigation in paddy fields. Copyright © 2016 Institut Pasteur. All rights reserved.

Mine-drainage treatment wetland as habitat for herptofaunal wildlife

Science.gov (United States)

Lacki, Michael J.; Hummer, Joseph W.; Webster, Harold J.

1992-07-01

Land reclamation techniques that incorporate habitat features for herptofaunal wildlife have received little attention. We assessed the suitability of a wetland, constructed for the treatment of mine-water drainage, for supporting herptofaunal wildlife from 1988 through 1990 using diurnal and nocturnal surveys. Natural wetlands within the surrounding watershed were also monitored for comparison. The treatment wetland supported the greatest abundance and species richness of herptofauna among the sites surveyed. Abundance was a function of the frog density, particularly green frogs ( Rana clamitans) and pickerel frogs ( R. palustris), while species richness was due to the number of snake species found. The rich mix of snake species present at the treatment wetland was believed due to a combination of an abundant frog prey base and an amply supply of den sites in rock debris left behind from earlier surface-mining activities. Nocturnal surveys of breeding male frogs demonstrated highest breeding activity at the treatment wetland, particularly for spring peepers ( Hyla crucifer). Whole-body assays of green frog and bullfrog ( R. catesbeiana) tissues showed no differences among sites in uptake of iron, aluminum, and zinc; managanese levels in samples from the treatment wetland were significantly lower than those from natural wetlands. These results suggest that wetlands established for water quality improvement can provide habitat for reptiles and amphibians, with the species composition dependent on the construction design, the proximity to source populations, and the degree of acidity and heavy-metal concentrations in drainage waters.

Structural characterization of core-bradavidin in complex with biotin.

Directory of Open Access Journals (Sweden)

Nitin Agrawal

Full Text Available Bradavidin is a tetrameric biotin-binding protein similar to chicken avidin and bacterial streptavidin, and was originally cloned from the nitrogen-fixing bacteria Bradyrhizobium diazoefficiens. We have previously reported the crystal structure of the full-length, wild-type (wt bradavidin with 138 amino acids, where the C-terminal residues Gly129-Lys138 ("Brad-tag" act as an intrinsic ligand (i.e. Gly129-Lys138 bind into the biotin-binding site of an adjacent subunit within the same tetramer and has potential as an affinity tag for biotechnological purposes. Here, the X-ray structure of core-bradavidin lacking the C-terminal residues Gly114-Lys138, and hence missing the Brad-tag, was crystallized in complex with biotin at 1.60 Å resolution [PDB:4BBO]. We also report a homology model of rhodavidin, an avidin-like protein from Rhodopseudomonas palustris, and of an avidin-like protein from Bradyrhizobium sp. Ai1a-2, both of which have the Brad-tag sequence at their C-terminus. Moreover, core-bradavidin V1, an engineered variant of the original core-bradavidin, was also expressed at high levels in E. coli, as well as a double mutant (Cys39Ala and Cys69Ala of core-bradavidin (CC mutant. Our data help us to further engineer the core-bradavidin-Brad-tag pair for biotechnological assays and chemical biology applications, and provide deeper insight into the biotin-binding mode of bradavidin.

State of weed infestation and features of sugar beet protection in Belarus

Directory of Open Access Journals (Sweden)

Soroka Sergey Vladimirovich

2006-01-01

Full Text Available The changes of phytosanitary situation recently taking place in sugar beet crops in the Republic of Belarus are shown. It is noticed that in the crop agrocoenosises there is a high infestation level caused by Japanese barnyard millet (Echinochloa crus-galli (L Pal. Beauv, field sowthistle (Sonchus arvensis L, chickweed (Stellaria media (L Vill, quick grass (Agropyron repens (L Pal Beauv, matricary (Matricaria perforate Merat, creeping thistle (Circium arvense (L scop, marsh woundwort (Stachus palustris L wild buckwheat (Polygonum convolvulus L, bristle stem hemp nettle (Galeopsis tetrahit L, common horsetail (Equisetum arvense L, field forget-me-not (Myosotis arvensis (L Hill, shepherd's purse (Capsella bursa-pastoris (L Med etc. Due to non-observance of preventive and separate agrotechnical techniques especially in spring-summer period, such weeds as bedstraw (Galium aparine L, white campion (Melandrium album (Mill Garcke, green amaranthus (Amaranthus retroflexus L started to appear in the crops. To protect sugar beet effectively, two variants of herbicides application are proposed. The first one - a combined, one stipulating soil action herbicides application before planting or before sugar beet seedlings emergence and on seedlings - to carry out two treatment by post-emergence preparations. The second variant, a split post- -emergence herbicide application (two-three times spraying on growing weeds at small application rates. In the next 5-6 years, a combined method will be of a primary importance in the conditions of the Republic.

Laboratory study on the bioremediation of diesel oil contaminated soil from a petrol station Estudo laboratorial da biorremediação de solo de posto de combustíveis contaminado com óleo diesel

Directory of Open Access Journals (Sweden)

Adriano Pinto Mariano

2007-06-01

Full Text Available The purpose of the present study was to investigate possible methods to enhance the rate of aerobic biodegradation of hydrocarbons (ex-situ treatments. In this work, the bioremediation processes were applied to a sandy soil with a high level of contamination originated from the leakage of a diesel oil underground storage tank at a petrol station. Laboratory scale experiments (Bartha biometer flasks were used to evaluate the biodegradation of the diesel oil. Enhancement of biodegradation was carried out through biostimulation (addition of nitrogen and phosphorus solutions or Tween 80 surfactant and bioaugmentation (bacterial consortium isolated from a landfarming system. To investigate interactions between optimizing factors, and to find the right combination of these agents, the study was based on full factorial experimental design. Efficiency of biodegradation was simultaneously measured by two methods: respirometric (microbial CO2 production and gas chromatography. Acute toxicity tests with Daphnia similis were applied for examination of the efficiency of the processes in terms of the generation of less toxic products. Results showed that all bioremediation strategies enhanced the natural bioremediation of the contaminated soil and the best results were obtained when treatments had nutritional amendment. Respirometric data indicated a maximum hydrocarbon mineralization of 19.8%, obtained through the combination of the three agents, with a total petroleum hydrocarbons (TPH removal of 45.5% in 55 days of treatment. At the end of the experiments, two predominant bacteria species were isolated and identified (Staphylococcus hominis and Kocuria palustris.O objetivo do presente estudo foi investigar possíveis métodos para aumentar a taxa de biodegradação aeróbia de hidrocarbonetos (tratamentos ex-situ. Neste trabalho, processos de biorremediação foram aplicados a um solo arenoso com alto nível de contaminação ocasionada por um vazamento de

Biodegradability of commercial and weathered diesel oils Biodegradabilidade de óleos diesel comercial e intemperizado

Directory of Open Access Journals (Sweden)

Adriano Pinto Mariano

2008-03-01

Full Text Available This work aimed to evaluate the capability of different microorganisms to degrade commercial diesel oil in comparison to a weathered diesel oil collected from the groundwater at a petrol station. Two microbiological methods were used for the biodegradability assessment: the technique based on the redox indicator 2,6 - dichlorophenol indophenol (DCPIP and soil respirometric experiments using biometer flasks. In the former we tested the bacterial cultures Staphylococcus hominis, Kocuria palustris, Pseudomonas aeruginosa LBI, Ochrobactrum anthropi and Bacillus cereus, a commercial inoculum, consortia obtained from soil and groundwater contaminated with hydrocarbons and a consortium from an uncontaminated area. In the respirometric experiments it was evaluated the capability of the native microorganisms present in the soil from a petrol station to biodegrade the diesel oils. The redox indicator experiments showed that only the consortia, even that from an uncontaminated area, were able to biodegrade the weathered diesel. In 48 days, the removal of the total petroleum hydrocarbons (TPH in the respirometric experiments was approximately 2.5 times greater when the commercial diesel oil was used. This difference was caused by the consumption of labile hydrocarbons, present in greater quantities in the commercial diesel oil, as demonstrated by gas chromatographic analyses. Thus, results indicate that biodegradability studies that do not consider the weathering effect of the pollutants may over estimate biodegradation rates and when the bioaugmentation is necessary, the best strategy would be that one based on injection of consortia, because even cultures with recognised capability of biodegrading hydrocarbons may fail when applied isolated.Este trabalho objetivou avaliar a capacidade de diferentes microrganismos em degradar óleo diesel comercial em comparação com um óleo diesel intemperizado coletado da água subterrânea em um posto de combust

Long-term changes in the flora and vegetation of Lake Mikołajskie (Poland as a result of its eutrophication

Directory of Open Access Journals (Sweden)

Barbara Solińska-Górnicka

2014-01-01

Full Text Available Changes in littoral flora as well as aquatic and swamp vegetation were analysed with increasing eutrophication of the mesotrophic Lake Mikołajskie. Over 30 years the habitat conditions of the lake deteriorated and the phy-tolittoral was reduced from a zone 6 metres wide to one of only 2 metres. In addition, the number of submerged macrophyte species decreased by 50% and the frequency of most of the remaining species declined severalfold. No new species were encountered. Species retreating from the lake littoral included all Chara species, Potamogeton obtusifolius, P. natans and Hydrocharis morsus-ranae. A significant lowering of the phytosociological diversity and species richness of aquatic and swamp communities was observed. By 1994, six of the 12 associations identified in 1964 and representing the submerged and floating-leaved vegetation (e.g. Nitellopsidetum ubtusae, Charetum asperae and Potamogetonetum compressi were no longer present. In turn, 6 swamp communities from among the original 14 identified in the lake were lacking (e.g. Typhetum angustifoliae, Sugittario-Sparganietum emersi and Eleocharitetum palustris. At the same time, two new aquatic and swamp communities appeared (Ranunculetum circinuti, Myriophylletum spicati, Caricetum acutiformis and Caricetum distichae. In contrast there was an increase in the species richness of reedswamp communities due to an influx of marshland species. While the 1990s witnessed a distinct decrease in concentrations of nutrients in Lake Mikołajskie, the consequent increase in water transparency was not associated with an increase in the area of submerged macrophytes, or the species richness of aquatic vegetation.

The Evolution of Sulfide in Shallow Aquatic Ecosystem Sediments: An Analysis of the Roles of Sulfate, Organic Carbon, and Iron and Feedback Constraints Using Structural Equation Modeling

Science.gov (United States)

Pollman, C. D.; Swain, E. B.; Bael, D.; Myrbo, A.; Monson, P.; Shore, M. D.

2017-11-01

The generation of elevated concentrations of sulfide in sediment pore waters that are toxic to rooted macrophytes is problematic in both marine and freshwaters. In marine waters, biogeochemical conditions that lead to toxic levels of sulfide generally relate to factors that affect oxygen dynamics or the sediment iron concentration. In freshwaters, increases in surface water sulfate have been implicated in decline of Zizania palustris (wild rice), which is important in wetlands across the Great Lakes region of North America. We developed a structural equation (SE) model to elucidate key variables that govern the evolution of sulfide in pore waters in shallow aquatic habitats that are potentially capable of supporting wild rice. The conceptual basis for the model is the hypothesis that dissimilatory sulfate reduction is limited by the availability of both sulfate and total organic carbon (TOC) in the sediment. The conceptual model also assumes that pore water sulfide concentrations are constrained by the availability of pore water iron and that sediment iron supports the supply of dissolved iron to the pore water. A key result from the SE model is that variations in three external variables (sulfate, sediment TOC, and sediment iron) contribute nearly equally to the observed variations in pore water sulfide. As a result, management efforts to mitigate against the toxic effects of pore water sulfide on macrophytes such as wild rice should approach defining a protective sulfate threshold as an exercise tailored to the geochemistry of each site that quantitatively considers the effects of ambient concentrations of sediment Fe and TOC.

Bioremediation of trace cobalt from simulated spent decontamination solutions of nuclear power reactors using E. coli expressing NiCoT genes

International Nuclear Information System (INIS)

Raghu, G.; Maruthi Mohan, P.; Balaji, V.; Venkateswaran, G.; Rodrigue, A.; Lyon 1 Univ., 69

2008-01-01

Removal of radioactive cobalt at trace levels (∼nM) in the presence of large excess (10 6 -fold) of corrosion product ions of complexed Fe, Cr, and Ni in spent chemical decontamination formulations (simulated effluent) of nuclear reactors is currently done by using synthetic organic ion exchangers. A large volume of solid waste is generated due to the nonspecific nature of ion sorption. Our earlier work using various fungi and bacteria, with the aim of nuclear waste volume reduction, realized up to 30% of Co removal with specific capacities calculated up to 1 μg/g in 6-24 h. In the present study using engineered Escherichia coli expressing NiCoT genes from Rhodopseudomonas palustris CGA009 (RP) and Novosphingobium aromaticivorans F-199 (NA), we report a significant increase in the specific capacity for Co removal (12 μg/g) in 1-h exposure to simulated effluent. About 85% of Co removal was achieved in a two-cycle treatment with the cloned bacteria. Expression of NiCoT genes in the E. coli knockout mutant of NiCoT efflux gene (rcnA) was more efficient as compared to expression in wild-type E. coli MC4100, JM109 and BL21 (DE3) hosts. The viability of the E. coli strains in the formulation as well as at different doses of gamma rays exposure and the effect of gamma dose on their cobalt removal capacity are determined. The potential application scheme of the above process of bioremediation of cobalt from nuclear power reactor chemical decontamination effluents is discussed. (orig.)

Energy transfer in purple bacterial photosynthetic units from cells grown in various light intensities.

Science.gov (United States)

Niedzwiedzki, Dariusz M; Gardiner, Alastair T; Blankenship, Robert E; Cogdell, Richard J

2018-05-03

Three photosynthetic membranes, called intra-cytoplasmic membranes (ICMs), from wild-type and the ∆pucBA abce mutant of the purple phototrophic bacterium Rps. palustris were investigated using optical spectroscopy. The ICMs contain identical light-harvesting complex 1-reaction centers (LH1-RC) but have various spectral forms of light-harvesting complex 2 (LH2). Spectroscopic studies involving steady-state absorption, fluorescence, and femtosecond time-resolved absorption at room temperature and at 77 K focused on inter-protein excitation energy transfer. The studies investigated how energy transfer is affected by altered spectral features of the LH2 complexes as those develop under growth at different light conditions. The study shows that LH1 → LH2 excitation energy transfer is strongly affected if the LH2 complex alters its spectroscopic signature. The LH1 → LH2 excitation energy transfer rate modeled with the Förster mechanism and kinetic simulations of transient absorption of the ICMs demonstrated that the transfer rate will be 2-3 times larger for ICMs accumulating LH2 complexes with the classical B800-850 spectral signature (grown in high light) compared to the ICMs from the same strain grown in low light. For the ICMs from the ∆pucBA abce mutant, in which the B850 band of the LH2 complex is blue-shifted and almost degenerate with the B800 band, the LH1 → LH2 excitation energy transfer was not observed nor predicted by calculations.

Diversity and distribution of rush communities from the phragmito-magno-caricetea class in pamir alai mountains (middle asia: tajikistan)

International Nuclear Information System (INIS)

Nowaki, A.; Nowaki, S.

2014-01-01

The study presents results of geobotanical investigations conducted in rush vegetation from the Phragmito-Magno- Caricetea class in the central Pamir-Alai Mts (Tajikistan, Middle Asia). Studies were carried out mainly within the Syr- Daria, Pyandzh, Zeravshan, Kafirnighan, Khanaka and Surkhandaria river valleys in the years 2008, 2012. The research was focused on the classification of rush plant communities developing within this poorly-investigated area. Habitat conditions were checked for all vegetation plots, including pH reaction, water depth, inclination and altitude. Altogether 231 phytosociological releves using the Braun-Blanquet method were sampled. The analyses classified the vegetation into 28 plant communities, including 26 associations. Eight new plant associations were proposed: Scirpetum hippolytii, Mentho asiaticae-Nasturtietum microphyllae, Juncetum brachytepali, Sparganietum stoloniferi, Eleocharitetum argyrolepis, Eleocharitetum mitracarpae, Caricetum songoricae and Rorippo palustris-Alismatetum graminei. The main discrimination factor for the data set is the floristic structure of the associations. Rush vegetation from the Phragmito- Magno-Caricetea class is spread throughout all river valleys of the research areas in montane and subalpine as well as in alpine zones. The vegetation patches occur mainly along the shores of water bodies and in ditches. Only sporadically have rush communities been noted within rice fields, where communities of the class Oryzetea sativae prevail. The study shows that riverside habitats with rush vegetation can harbour a relatively rich flora. Almost 200 species were found in vegetation plots, including some which are rare and have not been recorded until now in this part of Middle Asia. (author)

Engineering strategies for the enhanced photo-H{sub 2} production using effluents of dark fermentation processes as substrate

Energy Technology Data Exchange (ETDEWEB)

Chen, Chun-Yen; Chang, Jo-Shu [Department of Chemical Engineering, National Cheng Kung University, Tainan (China); Sustainable Environment Research Center, National Cheng Kung University, Tainan (China); Yeh, Kuei-Ling; Lo, Yung-Chung [Department of Chemical Engineering, National Cheng Kung University, Tainan (China); Wang, Hui-Min [Department of Fragrance and Cosmetic Science, Kaohsiung Medical University, Kaohsiung (China)

2010-12-15

The major obstacle of combining dark and photo fermentation for high-yield biohydrogen production is substrate inhibition while using dark fermentation effluent as the sole substrate. To solve this problem, the dark fermentation broth was diluted with different dilution ratio to improve photo-H{sub 2} production performance of an indigenous purple nonsulfur bacterium Rhodopseudomonas palustris WP3-5. The best photo-H{sub 2} production performance occurred at a dilution ratio of 1:2, giving a highest overall H{sub 2} production rate of 10.72 ml/l/h and a higher overall H{sub 2} yield of 6.14 mol H{sub 2}/mol sucrose. The maximum H{sub 2} content was about 88.1% during the dilution ratio of 1:2. The photo-H{sub 2} production performance was further improved by supplying yeast extract and glutamic acid as the nutrient. The results indicate that the overall H{sub 2} production rate and H{sub 2} yield increased to 17.02 ml/l/h and 10.25 mol H{sub 2}/mol sucrose, respectively. Using a novel solar-energy-excited optical fiber photobioreactor (SEEOFP) with supplementing tungsten filament lamp (TL) irradiation, the overall H{sub 2} production rate was improved to 17.86 ml/l/h. Meanwhile, the power consumption by combining SEEOFP and TL was about 37.1% lower than using TL alone. This study demonstrates that using optimal light sources and proper dilution of dark fermentation effluent, the performance of photo-H{sub 2} production can be markedly enhanced along with a reduction of power consumption. (author)

Study on improvement of continuous hydrogen production by photosynthetic biofilm in interior illuminant reactor.

Science.gov (United States)

Liu, Wenhui; Yuan, Linjiang; Wei, Bo

2016-09-01

In the present study, a new type of interior optical fiber illuminating reactor was developed for H2 production to solve the problem of luminous intensity attenuation at the center portion of a reactor, and an immobilization technique was used to enhance the stability of a continuous hydrogen production process with attached photosynthetic bacteria, using glucose as a sole carbon substrate for the indigenous photosynthetic bacteria (PSB) Rhodopseudomonas palustris SP-6. Results of the experiments showed that the interior optical fiber illuminating reactor produces H2 more efficiently and productively than the exterior light source reactor, with the cumulative H2 production, the maximum H2 production rate and H2 yield increased by 813ml, 11.3ml l-1 h-1 and 22.3%, respectively. The stability of the product of continuous hydrogen was realized by immobilizing PSB on the surface of powder active carbon(PAC). After adding the dosage of 2.0g l-1 PAC, the continuous steady operation of H2 production gave a high H2 yield of 1.398 mol H2 mol-1 glucose and an average H2 production rate of 35.1ml l-1 h-1 illuminating with a single interior optical fiber light source. Meanwhile, a higher H2 yield of 1.495 mol H2 mol-1 glucose and an average H2 production rate of 38.7ml l-1 h-1 were attained illuminating with a compound lamp in the continuous H2 production for 20 days.

Thirteen-year hardwood tree performance on a Midwest surface mine

International Nuclear Information System (INIS)

Ashby, W.C.; Kolar, C.A.

1998-01-01

Black walnut (Juglans nigra L.), sweetgum (Liquidambar styraciflua L.), tuliptree (Liriodendron tulipifera L.), white oak (Quercus alba L.), bur oak (Q. macrocarpa Michx.), and pin oak (Q. palustris Muenchh.) seedlings were planted both fall 1980 and spring 1981 on mixed overburden strip-mining banks (ungraded), mixed overburden graded to approximate original contour (AOC) (graded), mixed overburden graded to AOC wit h 60 cm of replaced pre-mining surface soil materials (topsoil), and on old fields near the strip-mine (unmined). Black walnut and pin oak were also planted as seed, with a total of 6000 seedlings/seed spots in the study. Initial species field viability ranged from 86 to 100%. With one exception, after 3 growing seasons oak seedlings had 50% or greater survival. Survival was mostly lower after 3 years with some additional mortality by years 8 and 13. Height and diameter breast height were measured after 13 years. Survival and growth of trees planted fall or spring was similar overall with variable performance by species. Seedlings of several species on the ungraded site had over 50% survival after 13 years, with fewer trees where planted as seed. Mean height of all species combined was significantly greater on the ungraded than on any other site and was lowest on the topsoil site. The unmined sites had high variability in species survival and height. Better reclamation with trees resulted from a deep, well-drained rooting medium with minimal compaction and a mineral-rich surface soil including coarse fragments over 2 mm in size for long-term productivity

Apo-bacteriophytochromes modulate bacterial photosynthesis in response to low light.

Science.gov (United States)

Fixen, Kathryn R; Baker, Anna W; Stojkovic, Emina A; Beatty, J Thomas; Harwood, Caroline S

2014-01-14

Bacteriophytochromes (BphPs) are light-sensing regulatory proteins encoded by photosynthetic and nonphotosynthetic bacteria. This protein class has been characterized structurally, but its biological activities remain relatively unexplored. Two BphPs in the anoxygenic photosynthetic bacterium Rhodopseudomonas palustris, designated regulatory proteins RpBphP2 and RpBphP3, are configured as light-regulated histidine kinases, which initiate a signal transduction system that controls expression of genes for the low light harvesting 4 (LH4) antenna complex. In vitro, RpBphP2 and RpBphP3 respond to light quality by reversible photoconversion, a property that requires the light-absorbing chromophore biliverdin. In vivo, RpBphP2 and RpBphP3 are both required for the expression of the LH4 antenna complex under anaerobic conditions, but biliverdin requires oxygen for its synthesis by heme oxygenase. On further investigation, we found that the apo-bacteriophytochrome forms of RpBphP2 and RpBphP3 are necessary and sufficient to control LH4 expression in response to light intensity in conjunction with other signal transduction proteins. One possibility is that the system senses a reduced quinone pool generated when light energy is absorbed by bacteriochlorophyll. The biliverdin-bound forms of the BphPs have the additional property of being able to fine-tune LH4 expression in response to light quality. These observations support the concept that some bacteriophytochromes can function with or without a chromophore and may be involved in regulating physiological processes not directly related to light sensing.

Effects of Precommercial Thinning and Midstory Control on Avian and Small Mammal Communities during Longleaf Pine Savanna Restoration.

Energy Technology Data Exchange (ETDEWEB)

Lane, Vanessa R [Abraham Baldwin Agricultural College; Kilgo, John C [USDA Forest Service, Southern Research Station

2015-01-01

Abstract - Restoring longleaf pine (Pinus palustris Mill.) savanna is a goal of many southern land managers, and longleaf plantations may provide a mechanism for savanna restoration. However, the effects of silvicultural treatments used in the management of longleaf pine plantations on wildlife communities are relatively unknown. Beginning in 1994, we examined effects of longleaf pine restoration with plantation silviculture on avian and small mammal communities using four treatments in four 8- to 11- year-old plantations within the Savannah River Site in South Carolina. Treatments included prescribed burning every 3 to 5 years, plus: (1) no additional treatment (burn-only control); (2) precommercial thinning; (3) non-pine woody control with herbicides; and (4) combined thinning and woody control. We surveyed birds (1996-2003) using 50-m point counts and small mammals with removal trapping. Thinning and woody control alone had short-lived effects on avian communities, and the combination treatment increased avian parameters over the burn-only control in all years. Small mammal abundance showed similar trends as avian abundance for all three treatments when compared with the burn-only control, but only for 2 years post-treatment. Both avian and small mammal communities were temporarily enhanced by controlling woody vegetation with chemicals in addition to prescribed fire and thinning. Therefore, precommercial thinning in longleaf plantations, particularly when combined with woody control and prescribed fire, may benefit early-successional avian and small mammal communities by developing stand conditions more typical of natural longleaf stands maintained by periodic fire.

Plant colonization, succession and ecosystem development on Surtsey with reference to neighbouring islands

Science.gov (United States)

Magnússon, B.; Magnússon, S. H.; Ólafsson, E.; Sigurdsson, B. D.

2014-10-01

Plant colonization and succession on the volcanic island of Surtsey, formed in 1963, have been closely followed. In 2013, a total of 69 vascular plant species had been discovered on the island; of these, 59 were present and 39 had established viable populations. Surtsey had more than twice the species of any of the comparable neighbouring islands, and all of their common species had established on Surtsey. The first colonizers were dispersed by sea, but, after 1985, bird dispersal became the principal pathway with the formation of a seagull colony on the island and consequent site amelioration. This allowed wind-dispersed species to establish after 1990. Since 2007, there has been a net loss of species on the island. A study of plant succession, soil formation and invertebrate communities in permanent plots on Surtsey and on two older neighbouring islands (plants and soil) has revealed that seabirds, through their transfer of nutrients from sea to land, are major drivers of development of these ecosystems. In the area impacted by seagulls, dense grassland swards have developed and plant cover, species richness, diversity, plant biomass and soil carbon become significantly higher than in low-impact areas, which remained relatively barren. A similar difference was found for the invertebrate fauna. After 2000, the vegetation of the oldest part of the seagull colony became increasingly dominated by long-lived, rhizomatous grasses (Festuca, Poa, Leymus) with a decline in species richness and diversity. Old grasslands of the neighbouring islands Elliđaey (puffin colony, high nutrient input) and Heimaey (no seabirds, low nutrient input) contrasted sharply. The puffin grassland of Elliđaey was very dense and species-poor. It was dominated by Festuca and Poa, and very similar to the seagull grassland developing on Surtsey. The Heimaey grassland was significantly higher in species richness and diversity, and had a more even cover of dominants (Festuca/Agrostis

Enhanced start-up of anaerobic facultatively autotrophic biocathodes in bioelectrochemical systems

KAUST Repository

Zaybak, Zehra

2013-12-01

Biocathodes in bioelectrochemical systems (BESs) can be used to convert CO2 into diverse organic compounds through a process called microbial electrosynthesis. Unfortunately, start-up of anaerobic biocathodes in BESs is a difficult and time consuming process. Here, a pre-enrichment method was developed to improve start-up of anaerobic facultatively autotrophic biocathodes capable of using cathodes as the electron donor (electrotrophs) and CO2 as the electron acceptor. Anaerobic enrichment of bacteria from freshwater bog sediment samples was first performed in batch cultures fed with glucose and then used to inoculate BES cathode chambers set at -0.4V (versus a standard hydrogen electrode; SHE). After two weeks of heterotrophic operation of BESs, CO2 was provided as the sole electron acceptor and carbon source. Consumption of electrons from cathodes increased gradually and was sustained for about two months in concert with a significant decrease in cathode chamber headspace CO2. The maximum current density consumed was -34±4mA/m2. Biosynthesis resulted in organic compounds that included butanol, ethanol, acetate, propionate, butyrate, and hydrogen gas. Bacterial community analyses based on 16S rRNA gene clone libraries revealed Trichococcus palustris DSM 9172 (99% sequence identity) as the prevailing species in biocathode communities, followed by Oscillibacter sp. and Clostridium sp. Isolates from autotrophic cultivation were most closely related to Clostridium propionicum (99% sequence identity; ZZ16), Clostridium celerecrescens (98-99%; ZZ22, ZZ23), Desulfotomaculum sp. (97%; ZZ21), and Tissierella sp. (98%; ZZ25). This pre-enrichment procedure enables simplified start-up of anaerobic biocathodes for applications such as electrofuel production by facultatively autotrophic electrotrophs. © 2013 Elsevier B.V.

Record of environmental and climatic changes in middle Pleistocene sediments from Łuków (eastern Poland on the basis of plant macroremains analysis

Directory of Open Access Journals (Sweden)

Stachowicz-Rybka Renata

2015-06-01

Full Text Available Lacustrine sediments at the Łuków site bear a record of the Ferdynandovian interglacial, correlated with Marine Isotope Stage (MIS 13-15, including two warm periods of interglacial rank (climatostratigraphic units Ferdynandovian 1 and 2 separated by cooling/glaciation (Ferdynandovian 1/2. On the basis of plant macroremains analysis, the type of local vegetation in the lake and its surroundings as well as changes in climate, trophic conditions and water level were reconstructed in detail. Ferdynandovian 1 was a time of development of tall sedge swamps. The presence of Najas marina and N. minor also suggests high levels of eutrophication, particularly in the younger part of the climatic optimum. The occurrence of Zannichellia palustris indicates habitats of variable water level and high salt content. In the terminocratic phase of Ferdynandovian 1, the communities showed the reoccurrence of Betula nana, B. humilis and Larix sp., the disappearance of thermophilous trees, and the intensification of succession processes linked to climate cooling. In the cool Ferdynandovian 1/2, Betula nana and Cenococcum geophilum increased their frequencies, most likely due to enhanced supply of mineral matter to the basin. During Ferdynandovian 2, the next climate warming of interglacial rank, communities of aquatic vegetation with the highest share of thermophilous taxa included the extinct Aldrowanda borysthenica, Brasenia borysthenica, and Scirpus atroviroides, as well as Cyperus glomeratus, a species not presently found in the flora of Poland. Another cooling in the Sanian 2 (Elsterian 2 glaciation is indicated by the development of peat communities, with numerous Carex sp., Menyanthes trifoliata, Eriophorum vaginatum, and Andromeda polifolia, accompanied by the extinct Carex paucifloroides, Caulinia macrosperma, and Potamogeton praemaackianus.