WorldWideScience

Sample records for beauveria bassiana sobre

  1. Plant extracts on Hypothenemus hampei (Coleoptera: Curculionidae and Beauveria bassianaExtratos vegetais sobre Hypothenemus hampei (Coleoptera: Curculionidae e Beauveria bassiana

    Directory of Open Access Journals (Sweden)

    Janaina Zorzetti

    2012-12-01

    Full Text Available Looking for alternatives to pesticides for Hypothenemus hampei control, the objective of this study was to evaluate the potential of aqueous and ethanolic plant extracts of Moringa oleifera (Moringa and Tephrosia purpurea (tephrosia (seeds, leaves and roots and Melia azedarach (cinnamon, Nerium oleander (oleander and Azadirachta indica (neem (leaves only, on mortality and repellency of H. hampei and its compatibility with Beauveria bassiana, an important natural enemy of this pest. To assess the mortality, coffee leaves (Coffea arabica L were treated by immersion in a solution of endosulfan and plant extracts at a concentration of 10% and then offered to adults of H. hampei. The repellency was evaluated in multiple-choice tests and in no-choice tests among coffee fruit treated and untreated The compatibility between extracts and Beauveria bassiana (CG 452 was analyzed by quantifying germination, colony forming units, growth and yield / productivity of conidia. The highest mortalities were observed when leaves were treated with ethanolic extract of T. purpurea (leaves which did not differ from endosulfan, and aqueous and ethanolic extracts from M. oleifera seeds . In free-choice tests, all the ethanolic extracts showed repellent action, being higher for M. oleifera (root and T. purpurea (seed. The aqueous extracts of M. oleifera (leaves and seeds and N. oleander (leaves showed the highest repellency. In no-choice tests the highest repellency level was for coffee fruits treated with A. indica (leaves. The ethanolic extract of M. oleifera leaves negatively affected B. bassiana germination. These studies showed the potential of these plant extracts for use in the field as an alternative to chemical control, once they are also selective for B. bassiana. Visando alternativas ao uso de agrotóxicos no controle de Hypothenemus hampei, o objetivo deste trabalho foi avaliar o potencial de extratos vegetais aquosos e etanólicos de Moringa oleifera

  2. Patogenicidade do fungo entomopatogênico Beauveria bassiana sobre o percevejo Collaria scenica (Hemiptera: Miridae / Pathogenicity of entomopathogenic fungus Beauveria bassiana against the grass bug Collaria scenica (Hemiptera: Miridae

    Directory of Open Access Journals (Sweden)

    Marcos Roberto Barboza

    2011-12-01

    Full Text Available O percevejo Collaria scenica (Hemiptera: Miridae é uma praga de cereais cultivados e pastagens, e o controle microbiano é uma alternativa para manter estas populações abaixo do nível de dano econômico. O presente trabalho teve como objetivo avaliar a patogenicidade do isolado CG 460 de Beauveria bassiana sobre este percevejo. Insetos adultos foram inoculados em laboratório com cinco concentrações de conídios (1,0x105; 1,0x106; 1,0x107; 1,0x108 e 1,0x109 conídios.mL-1 e alimentados com folhas de trigo. A mortalidade total e confirmada (conidiogênese sobre os insetos mortos foram avaliadas durante seis dias consecutivos. O isolado apresentou alta capacidade infectiva sobre o mirideo, com mortalidade total variando de 40 a 90%. A mortalidade confirmada apresentou uma correlação linear positiva com a concentração de conídios. A taxa de conidiogênese nas concentrações mais baixas do inoculo foi em torno de 26%, sendo que nas concentrações maiores os valores chegaram a 70%. O tempo letal 50 para a concentração 109 foi de 4,3 dias.AbstractThe grass bug, Collaria scenica (Hemiptera: Miridae, is a pest of cereal crops and pastures, and the microbial control is an alternative to maintain the pest population below economic injury level. The present work had the objective to assess the pathogenicity isolate CG460 of Beauveria bassiana against this grass bug. Adult insects had been inoculated in laboratory with five conidia concentrations (1.0x105, 1.0x106, 1.0x107, 1.0x108, 1.0x109 conidia.mL-1, and fed with wheat leaves. Total and confirmed mortality (sporulation on the dead insects had been assessed during six consecutive days. CG460 showed high virulency on the grass bug, with the total mortality ranged from 40 to 90%. Confirmed mortality presented positive and linear correlation with the conidia concentrations. The conidiogenesis rates in the lowest concentrations of inoculum were around 26%, being that in the highest

  3. Virulencia de Beauveria bassiana y Metarhizium anisopliae sobre picudo del nopal Metarnasius spinolae

    OpenAIRE

    Orduño Cruz, Nuvia

    2012-01-01

    El picudo del nopal (Metamasius spinolae), es uno de los principales factores limitantes de la producción comercial de nopal en Tlalnepantla Morelos. El control de plagas se basa en insecticidas y el uso de nuevas alternativas como los hongos entomopatógenos ha sido poco estudiada. Con el objeto de seleccionar aislamientos de las especies B. bassiana y M. anisopliae para el control del picudo del nopal se evaluaron seis aislamientos de B. bassiana y dos de M. anisopliae en...

  4. Production of extracellular proteolytic enzymes by Beauveria bassiana

    OpenAIRE

    Józefa Chrzanowska; Maria Kołaczkowska

    2014-01-01

    The production of proteolytic enzymes by two strains of Beauveria bassiana 278, B. bassiana 446 and one strain of Ascosphera apis 496 was analysed. It was demonstrated that the strain of B. bassiana 278 proved to be the best producer of basic and acid proteases. The influence of different environmental factors such as nitrogen and carbon sources on the production of extracellular hydrolytic enzymes was assessed. In addition the acid protease from B. bassiana was partially characterized.

  5. Production of extracellular proteolytic enzymes by Beauveria bassiana

    Directory of Open Access Journals (Sweden)

    Józefa Chrzanowska

    2014-08-01

    Full Text Available The production of proteolytic enzymes by two strains of Beauveria bassiana 278, B. bassiana 446 and one strain of Ascosphera apis 496 was analysed. It was demonstrated that the strain of B. bassiana 278 proved to be the best producer of basic and acid proteases. The influence of different environmental factors such as nitrogen and carbon sources on the production of extracellular hydrolytic enzymes was assessed. In addition the acid protease from B. bassiana was partially characterized.

  6. Beauveria bassiana: quercetinase production and genetic diversity

    Directory of Open Access Journals (Sweden)

    Eula Maria de M. B Costa

    2011-03-01

    Full Text Available Beauveria bassiana genetic diversity and ability to synthesize quercetin 2,3-dioxygenase (quercetinase were analyzed. B. bassiana isolates, obtained from Brazilian soil samples, produced quercetinase after induction using 0.5 g/L quercetin. B. bassiana ATCC 7159 (29.6 nmol/mL/min and isolate IP 11 (27.5 nmol/ml/min showed the best performances and IP 3a (9.5 nmol/mL/min presented the lowest level of quercetinase activity in the culture supernatant. A high level of polymorphism was detected by random amplified polymorphic DNA (RAPD analysis. The use of internal-transcribed-spacer ribosomal region restriction fragment length polymorphism (ITS-RFLP did not reveal characteristic markers to differentiate isolates. However, the ITS1-5.8S-ITS2 region sequence analysis provided more information on polymorphism among the isolates, allowing them to be clustered by relative similarity into three large groups. Correlation was tested according to the Person's correlation. Data of our studies showed, that lower associations among groups, level of quercetinase production, or geographical origin could be observed. This study presents the production of a novel biocatalyst by B. bassiana and suggests the possible industrial application of this fungal species in large-scale biotechnological manufacture of quercetinase.

  7. Beauveria bassiana: endophytic colonization and plant disease control.

    Science.gov (United States)

    Ownley, Bonnie H; Griffin, Mary R; Klingeman, William E; Gwinn, Kimberly D; Moulton, J Kevin; Pereira, Roberto M

    2008-07-01

    Seed application of Beauveria bassiana 11-98 resulted in endophytic colonization of tomato and cotton seedlings and protection against plant pathogenic Rhizoctonia solani and Pythium myriotylum. Both pathogens cause damping off of seedlings and root rot of older plants. The degree of disease control achieved depended upon the population density of B. bassiana conidia on seed. Using standard plating techniques onto selective medium, endophytic 11-98 was recovered from surface-sterilized roots, stems, and leaves of tomato, cotton, and snap bean seedlings grown from seed treated with B. bassiana 11-98. As the rate of conidia applied to seed increased, the proportion of plant tissues from which B. bassiana 11-98 was recovered increased. For rapid detection of B. bassiana 11-98 in cotton tissues, we developed new ITS primers that produce a PCR product for B. bassiana 11-98, but not for cotton. In cotton samples containing DNA from B. bassiana11-98, the fungus was detected at DNA ratios of 1:1000; B. bassiana 11-98 was detected also in seedlings grown from seed treated with B. bassiana 11-98. Using SEM, hyphae of B. bassiana11-98 were observed penetrating epithelial cells of cotton and ramifying through palisade parenchyma and mesophyll leaf tissues. B. bassiana11-98 induced systemic resistance in cotton against Xanthomonas axonopodis pv. malvacearum (bacterial blight). In parasitism assays, hyphae of B. bassiana 11-98 were observed coiling around hyphae of Pythium myriotylum. PMID:18442830

  8. Safety of Beauveria bassiana (Bals. Vuill. to Gallus domesticus L.

    Directory of Open Access Journals (Sweden)

    Jucelaine Haas-Costa

    2010-04-01

    Full Text Available Beauveria bassiana, an important insect pathogen was used to evaluate its effect on the feeding, behavior, histology of the digestory system and anatomy of Gallus domesticus. The fungus (strain Unioeste 4 was administrated orally treated with chicken food. Chicken feces were collected, and the birds observed for 28 days. Also, were evaluated the weight of the birds, as well as any sign of intoxication or pathological modification. Tissue samples were withdrawn to test lesions with the optic microscope. There was 100% of survival of the birds, and no behavior alteration or external lesion was found. The test group presented the highest weight gain (1383.9±54.4g. Viable conidia were observed in the feces until 24 h after feeding the fungus, indicating that there was no germination inside the digestory system. No tissue lesion was observed, providing overwhelming evidence for the safety of B. bassiana to non-target organism G. domesticus.Beauveria bassiana é um importe entomopatógeno, sendo avaliado seu efeito sobre a alimentação, comportamento e histologia do sistema digestório de Gallus domesticus. O fungo (isolado Unioeste 4 foi administrado oralmente às aves, misturado à ração. Estas foram observadas por 28 dias e as fezes coletadas diariamente para análise. Também foi avaliado o peso das aves, bem como sinais de intoxicação ou modificação patológica. Amostras teciduais foram retiradas para verificar lesões com o microscópico óptico. Houve sobrevivência de 100% das aves avaliadas e nenhuma alteração comportamental ou lesão externa durante o experimento. O grupo teste apresentou o maior ganho de peso (1383,9±54,4g, sendo mais acentuado a partir da segunda semana. Observou-se a presença de conídios viáveis nas fezes somente até 24 horas após a ingestão do fungo, indicando que não houve germinação nas aves. Nenhuma lesão tecidual foi verificada, de forma que B. bassiana mostrou-se seguro para o organismo n

  9. Desenvolvimento dos fungos Metarhizium anisopliae (Metschnikoff, 1879 Sorokin, 1883 E Beauveria bassiana (Balsamo Vuillemin, 1912 sobre Ctenocephalides felis felis (Bouché, 1835 Development of the fungi Metarhizium anisopliae (Metschnikoff, 1879 Sorokin, 1883 and Beauveria bassiana (Balsamo Vuillemin, 1912 on the Ctenophephalides felis felis (Bouché, 1835

    Directory of Open Access Journals (Sweden)

    Denise R. De Melo

    2007-09-01

    Full Text Available A pulga Ctenocephalides felis felis é um parasita causador dermatites alérgicas e também pode transmitir diversos agentes etiológicos aos animais domésticos e aos homens. O objetivo deste trabalho foi verificar o desenvolvimento do fungo sobre a cutícula da pulga, através da microscopia eletrônica de varredura. Os isolados fúngicos testados foram o Metarhizium anisopliae 959 e Beauveria bassiana 986, ambos na concentração 10(8 conídios/ml. Após a exposição dos isolados fúngicos no período de duas, 15, 26 e 96 horas , o material foi processado para a microscopia eletrônica de varredura. Com a obtenção das micrografias, pode-se observar que com 2 horas após exposição aos fungos, os conídios estavam aderidos por toda a cutícula, situando-se preferencialmente nas membranas intersegmentais do abdome. Com 15 horas observou-se a formação do tubo de germinação e a cabeça do apressório e após 26 horas foi possível observar as ramificações e o engrossamento das hifas sobre a cutícula das pulgas. Os resultados indicam que os fungos testados foram capazes de se desenvolver sobre a cutícula de C. f. felis.The flea Ctenocephalides felis felis is a parasite that causes allergic dermatitis and also may transmit etiologic agents to domestic animals and humans. This study investigated by scanning electron microscopy the development of entomopathogenic fungi on flea cuticle. Fleas were exposed to conidia (10(8 ml-1 of Metarhizium anisopliae (isolate 959 or Beauveria bassiana (isolate 986. Following standard protocols for electron microscopy, the specimens were prepared 2, 15, 26 and 96 h after infection. The micrography revealed that 2 h after fungus exposure, conidia attachments encompassed the entire flea cuticle, especially on abdominal intersegmental membranes. The emergence of germ tubes and appressoria formation occurred at 15 h, thickening and branching of hyphae on the flea cuticle was noted at 26 h. Therefore, both of

  10. Molecular Genetics of Beauveria bassiana Infection of Insects.

    Science.gov (United States)

    Ortiz-Urquiza, A; Keyhani, N O

    2016-01-01

    Research on the insect pathogenic filamentous fungus, Beauveria bassiana has witnessed significant growth in recent years from mainly physiological studies related to its insect biological control potential, to addressing fundamental questions regarding the underlying molecular mechanisms of fungal development and virulence. This has been in part due to a confluence of robust genetic tools and genomic resources for the fungus, and recognition of expanded ecological interactions with which the fungus engages. Beauveria bassiana is a broad host range insect pathogen that has the ability to form intimate symbiotic relationships with plants. Indeed, there is an increasing realization that the latter may be the predominant environmental interaction in which the fungus participates, and that insect parasitism may be an opportunist lifestyle evolved due to the carbon- and nitrogen-rich resources present in insect bodies. Here, we will review progress on the molecular genetics of B. bassiana, which has largely been directed toward identifying genetic pathways involved in stress response and virulence assumed to have practical applications in improving the insect control potential of the fungus. Important strides have also been made in understanding aspects of B. bassiana development. Finally, although increasingly apparent in a number of studies, there is a need for progressing beyond phenotypic mutant characterization to sufficiently investigate the molecular mechanisms underlying B. bassiana's unique and diverse lifestyles as saprophyte, insect pathogen, and plant mutualist. PMID:27131326

  11. Entomopathogenic fungus \\kur{Beauveria bassiana }- biological characteristics

    OpenAIRE

    PAVLÍČEK, Pavel

    2012-01-01

    This literature compilation focuses on current knowledge in the biological characteristics of the entomopathogenic fungi Beauveria bassiana, with emphasis on the influence of abiotic factors on the development and its effectiveness in selected species of harmful insects. Knowledge of abiotic factors is important for a successful outcome to protect plants against harmful agents this entomopathogen. There are also set out the specifics, benefits and examples of using the aforementioned entomopa...

  12. Ação do fungo Beauveria bassiana, isolado 986, sobre o ciclo biológico do cascudinho Alphitobius diaperinus em laboratório Action of the fungus Beauveria bassiana, strain 986, over the biologic cycle of the Alphitobius diaperinus beetle in laboratory

    Directory of Open Access Journals (Sweden)

    Aleksandro Schafer da Silva

    2006-12-01

    Full Text Available O presente trabalho foi realizado para verificar a eficácia do fungo Beauveria bassiana em todas as etapas de desenvolvimento de Alphitobius diaperinus e assim saber em que fase ele é mais susceptível ao controle biológico. O fungo B. bassiana, isolado 986, foi testado em duas concentrações (3,4 X 10(6 e 3,4 X 10(8 conídios ml-1 mais um grupo controle. Foram realizadas duas leituras, uma sete e outra quatorze dias após a aplicação dos fungos. Na concentração 3,4 X 10(6, 54% dos ovos tratados estavam inférteis, ocorrendo 54% de mortalidade de larvas tratadas nos estádios I, II e III, 22,5% nos estádios IV, V e VI, 9,5% nos estádios VII e VIII e 24,5% de mortalidade das pupas. Na concentração 3,4 X 10(8, 66,8% dos ovos tratados estavam inviáveis, ocorrendo mortalidade de 56% das larvas tratadas nos estádios I, II e III, 34% nos estádios IV, V e VI, 24,5% nos estádios VII e VIII e 49,5% das pupas. Já no grupo controle, 13,3% dos ovos estavam inviáveis, ocorrendo mortalidade de 10% das larvas nos estádios I, II e III, 4% nos estádios IV, V e VI e 0% de mortalidade nos estádios VII, VIII e em pupas. Sobre o cascudinho adulto, o fungo não teve efeito nocivo em nenhum grupo analisado. Com base nesses resultados, observou-se que o fungo nas concentrações testadas apresentou efeito nocivo às fases do ciclo biológico do cascudinho, com exceção do inseto adulto.The present research was carried out to verify the Beauveria bassiana fungus efficacy in all development phases of Alphitobius diaperinus and to know in which phase it is more susceptible for biologic control. The B. bassiana, 986-isolated fungus, was tested in two different concentrations (3.4 x 10(6 and 3.4 x 10(8 conidium ml-1 and a control group. Two readings were realized, one after 7 days of fungus application and the other after 14 days. At concentration of 3.4 x 10(6 conidium ml-1, 54% of treated eggs were infertile, with larva death of 54% at I, II and III

  13. Spore production of Beauveria bassiana from agro-industrial residues

    OpenAIRE

    Herta Stutz Dalla Santa; Osmar Roberto Dalla Santa; Débora Brand; Luciana Porto de Souza Vandenberghe; Carlos Ricardo Soccol

    2005-01-01

    The purpose of this work was to produce Beauveria bassiana by Solid-State Fermentation using agro-industrial residues and optimizing the cultivation conditions. Refused potatoes, coffee husks and sugar-cane bagasse were tested. The blend of refused potatoes and sugar-cane bagasse (60-40%) with particle size in the range of 0.8-2 mm was used in the fermentation experiments. In Erlenmeyer flasks the best spore production was achieved with the following conditions: incubation temperature 26º C; ...

  14. Genetic diversity among brazilian isolates of beauveria bassiana: comparisons with non-brazilian isolates and other beauveria species

    Science.gov (United States)

    Fernandes, E.K.K.; Moraes, A.M.L.; Pacheco, R.S.; Rangel, D.E.N.; Miller, M.P.; Bittencourt, V.R.E.P.; Roberts, D.W.

    2009-01-01

    Aims: The genetic diversity of Beauveria bassiana was investigated by comparing isolates of this species to each other (49 from different geographical regions of Brazil and 4 from USA) and to other Beauveria spp. Methods and Results: The isolates were examined by multilocus enzyme electrophoresis (MLEE), amplified fragment length polymorphism (AFLP), and rDNA sequencing. MLEE and AFLP revealed considerable genetic variability among B. bassiana isolates. Several isolates from South and Southeast Brazil had high similarity coefficients, providing evidence of at least one population with clonal structure. There were clear genomic differences between most Brazilian and USA B. bassiana isolates. A Mantel test using data generated by AFLP provided evidence that greater geographical distances were associated with higher genetic distances. AFLP and rDNA sequencing demonstrated notable genotypic variation between B. bassiana and other Beauveria spp. Conclusion: Geographical distance between populations apparently is an important factor influencing genotypic variability among B. bassiana populations in Brazil. Significance and Impact of the Study: This study characterized many B. bassiana isolates. The results indicate that certain Brazilian isolates are considerably different from others and possibly should be regarded as separate species from B. bassiana sensu latu. The information on genetic variation among the Brazilian isolates, therefore, will be important to comprehending the population structure of B. bassiana in Brazil. ?? 2009 The Society for Applied Microbiology.

  15. The use of aggregation pheromone to enhance dissemination of Beauveria bassiana for the control of the banana weevil in Uganda

    NARCIS (Netherlands)

    Tinzaara, W.; Gold, C.S.; Dicke, M.; Huis, van A.; Nankinga, C.M.; Kagezi, G.H.; Ragama, P.E.

    2007-01-01

    Candidate strains of Beauveria bassiana were identified for use in integrated pest management of the banana weevil Cosmopolites sordidus. Horizontal field transmission of B. bassiana between banana weevils using different delivery systems, including aggregation pheromones, was investigated. We obser

  16. Cordyceps bassiana and production of stromata in vitro showing Beauveria anamorph in Korea

    Science.gov (United States)

    A Cordyceps species was found with Beauveria anamorph state on larval insect cadavers on Obong Mountsin in Gangwon Pronvince, Republic of Korea. Cultures from discharged ascospores formed an anamorph identifiable as Beauveria bassiana. This teleomorph-anamorph connection was also confirmed by the in...

  17. Efeito de Beauveria bassiana (Bals. Vuill. e Metarhizium anisopliae (Metsch. Sorok. sobre características biológicas de Diatraea saccharalis F. (Lepidoptera: Crambidae - DOI: 10.4025/actascibiolsci.v30i2.3627 Effect of Beauveria bassiana (Bals. Vuill. and Metarhizium anisopliae (Metsch. Sorok. on Biological Characteristics of Diatraea saccharalis F. (Lepidoptera: Crambidae - DOI: 10.4025/actascibiolsci.v30i2.3627

    Directory of Open Access Journals (Sweden)

    Valéria Wanderley Teixeira

    2008-05-01

    Full Text Available A broca da cana-de-açúcar Diatraea saccharalis F. é considerada uma das principais pragas nas Américas. Entre os métodos de controle, o uso de fungos entomopatogênicos tem sido amplamente recomendado no manejo das pragas da cana-de-açúcar, incluindo outras lepidobrocas. Assim sendo, este estudo investigou os efeitos de diferentes concentrações de Beauveria bassiana (Bals. Vuill. e Metarhizium anisopliae (Metsch. Sorok. sobre parâmetros biológicos da broca da cana-de-açúcar. Larvas de terceiro instar de D. saccharalis foram tratadas com os fungos usando as concentrações de 103, 104 e 105 conídios mL-1. Larvas tratadas com 105 conídios mL-1 de B. bassiana tiveram menor sobrevivência (56,6%, comparadas com lagartas não-tratadas (90%. Adultos originados de larvas tratadas colocaram menor número de ovos, com menor viabilidade, e viveram menos, comparados com adultos originados de larvas não-tratadas. Larvas tratadas com M. anisopliae na concentração de 105 conídios mL-1 e adultos originados destas larvas também exibiram redução no desempenho, comparados aos insetos não-tratados. Os resultados indicam que B. bassiana e M. anisopliae, além de patogênicos às larvas de D. saccharalis, também interferem negativamente na sua biologia, mostrando potencial de uso contra esta praga.The sugarcane borer Diatraea saccharalis F. is considered one of the major sugarcane pests in the American continent. Among control methods, the use of entomopathogenic fungi has been broadly recommended to manage sugarcane pests, including other sugarcane borers. Therefore, this study investigated the effects of different concentrations of Beauveria bassiana (Bals. Vuill and Metarhizium anisopliae (Metch. Sorok on biological characteristics of the sugarcane borer. Third-instar larvae of D. saccharalis were fungi-treated using the concentrations of 103, 104 and 105 conidia mL-1. Larvae treated with 105 conidia mL-1 of B. bassiana showed lower

  18. Genes involved in virulence of the entomopathogenic fungus Beauveria bassiana.

    Science.gov (United States)

    Valero-Jiménez, Claudio A; Wiegers, Harm; Zwaan, Bas J; Koenraadt, Constantianus J M; van Kan, Jan A L

    2016-01-01

    Pest insects cause severe damage to global crop production and pose a threat to human health by transmitting diseases. Traditionally, chemical pesticides (insecticides) have been used to control such pests and have proven to be effective only for a limited amount of time because of the rapid spread of genetic insecticide resistance. The basis of this resistance is mostly caused by (co)dominant mutations in single genes, which explains why insecticide use alone is an unsustainable solution. Therefore, robust solutions for insect pest control need to be sought in alternative methods such as biological control agents for which single-gene resistance is less likely to evolve. The entomopathogenic fungus Beauveria bassiana has shown potential as a biological control agent of insects, and insight into the mechanisms of virulence is essential to show the robustness of its use. With the recent availability of the whole genome sequence of B. bassiana, progress in understanding the genetics that constitute virulence toward insects can be made more quickly. In this review we divide the infection process into distinct steps and provide an overview of what is currently known about genes and mechanisms influencing virulence in B. bassiana. We also discuss the need for novel strategies and experimental methods to better understand the infection mechanisms deployed by entomopathogenic fungi. Such knowledge can help improve biocontrol agents, not only by selecting the most virulent genotypes, but also by selecting the genotypes that use combinations of virulence mechanisms for which resistance in the insect host is least likely to develop. PMID:26628209

  19. Efeitos de Beauveria bassiana (Bals Vuill e Metarhizium anisopliae (Metsc Sorok sobre fêmeas ingurgitadas de Amblyomma cajennense (Fabricius, 1787 em condições de laboratório Effects of Beauveria bassiana (Bals Vuill and Metarhizium anisopliae (Metsc Sorok on engorged females of Amblyomma cajennense (Fabricius, 1787 in laboratory conditions

    Directory of Open Access Journals (Sweden)

    R.C.S. Reis

    2004-12-01

    Full Text Available The in vitro susceptibility of Amblyomma cajennense engorged females to some isolated of the fungus Beauveria bassiana and Metarhizium anisopliae was verified and lethal concentrations (LC 50 and LC 90 were calculated. The females were dived in conidia suspensions for five minutes, and kept in climatically controlled chambers BOD under 27° C and 80% relative humidity. Each bioassay had four treatments in concentrations of 10(5,10(6,10(7e10(8 conidia/ml. A control group was also used. The following characteristics were evaluated: weight and period of oviposition, indexes of reproductive and nutritional efficiency and percentage of microbiological control. A dose dependent negative effect was observed in ticks treated with the suspension. All isolates tested cause a negative effect on in vitro tests of engorged females of A. cajennense, suggesting its potential for microbiological control of tick's species.

  20. Spore production of Beauveria bassiana from agro-industrial residues

    Directory of Open Access Journals (Sweden)

    Herta Stutz Dalla Santa

    2005-06-01

    Full Text Available The purpose of this work was to produce Beauveria bassiana by Solid-State Fermentation using agro-industrial residues and optimizing the cultivation conditions. Refused potatoes, coffee husks and sugar-cane bagasse were tested. The blend of refused potatoes and sugar-cane bagasse (60-40% with particle size in the range of 0.8-2 mm was used in the fermentation experiments. In Erlenmeyer flasks the best spore production was achieved with the following conditions: incubation temperature 26º C; initial pH 6.0; inoculum concentration 10(7 spores.g-1.dw and initial moisture 75%. In the column type reactor using forced aeration under the optimized conditions, the maximum production (1.07x10(10spores.g-1.dw was obtained at the 10th day of fermentation. The respirometric analyses of the fermentation showed a strong correlation between fungal growth and spore production.O objetivo deste trabalho foi produzir Beauveria bassiana por fermentação no estado sólido em resíduos agro-industriais e otimizar as condições de cultivo. Batata-refugo, polpa de café e bagaço de cana de açúcar foram testados. A mistura de batata-refugo e de bagaço de cana de açúcar (60:40%, com granulometria de 2 a 0,8 mm foi escolhida como melhor substrato/suporte. Em frascos de Erlenmeyer a produção de esporos foi maior com as seguintes condições: pH 6,0; temperatura de incubação de 26º C; taxa de inóculo de 10(7 esporos.g-1 de matéria seca; e umidade inicial de 75%. Em bioreator do tipo coluna com aeração forçada, as condições otimizadas possibilitaram uma produção máxima de esporos no 10º dia de fermentação, obtendo-se 1,07x10(10 esporos.g-1 de matéria seca. A análise respirométrica desta fermentação permitiu correlacionar o desenvolvimento do fungo com a produção de esporos.

  1. Preservation of Beauveria bassiana (Balsam Vuillemin (moniliales: moniliaceae pathogenicityagainst the coffee borer in different systems

    Directory of Open Access Journals (Sweden)

    T. Bahamón

    2011-12-01

    Full Text Available The objective of this study is to find preservation techniques of Beauveria bassiana pathogenicity in the laboratory. Long term storage of B. bassiana cultures is very important to prepare industrial products. Preservation techniques for pathogenicity would replace the need to pass B. bassiana spores frequently in the target insect. Studies on B. bassiana pathogenicity are almost nonexistent. Viability of B. bassiana was evaluated in comparison with pathogenicity when subjected to different preservation temperatures with various protectors. The most succesful procedures were silica gel and mineral oil in refrigeration; glicerol and dimethilsulfoxide in liquid nitrogen; liophilization with skim milk at 10% and 20% and skim milk with inositol at 5%. The tests were carried our during 24 weeks at 6 weeks intervals. A monosporic B. bassiana culture (Bb. 9620 isolated by Cenicafé research center was used for the study. The mean value for the preservation of pathogenicity was influenced by the protectors used.

  2. Existence of entomopathogen fungi, Beauveria bassiana as an endophyte in cacao seedlings

    Directory of Open Access Journals (Sweden)

    Endang Sulistyowati

    2015-12-01

    Full Text Available Beauveria bassiana is one of the entomopathogen fungi which is known as biological control agent of cocoa pod borer and cocoa mirids (Helopeltis spp.. Because of its effectiveness in the fields is still not consistent, so we conduct a research with the objective to know the possibility of Beauveria bassiana to be established as a endophyte. Various fungal entomopathogens have already been reported as endophytes and the various methods used to inoculate the plants with B. bassiana were partially effective. The research has been conducted in laboratory of Plant Protection, Indonesian Coffee and Cocoa Research Institute by inoculating of cocoa seeds and cocoa nursery with B. bassiana suspension.  The trial was arranged  by randomized complete block design with a factorial arrangement. The factor were spore concentration of B. bassiana (0; 2; and 4 g/ 10 l and cocoa varieties (family of ICS 60, TSH858, and hybrid. The trial were use  four replications. The results showed that the fungal entomopathogen B. bassiana was established as an endophyte in cocoa seedling, both from cocoa seeds and nursery application. Percentage of existence of B. bassiana colonies as endophytes one month after seeds application were ICS 60 amounted to 93.3 % both on concentration treatments, while the families of TSH 858 by 80 % and 86.67 % respectively in 2 g and 4 g per 10 l of B. bassiana spores concentration treament.. The lowest percentage was in hybrids, which amounted to 66.67% and 50%. B. bassiana colonies was exixtence as an endophyte in culture from root, stem and leaves of cocoa seedling up to 5 months post inoculation. While the application on nursery by soil drenshing, leaf spraying, and stem injection , it was known that B. bassiana colonies were found in the tissues of leaves, stems, and roots until two months after application. Colonies of B. bassiana as endophytes still exsist until six weeks after nursery was planted in the field. 

  3. Production of conidia of Beauveria bassiana in solid-state culture: current status and future perspectives.

    Science.gov (United States)

    Lopez-Perez, M; Rodriguez-Gomez, D; Loera, O

    2015-01-01

    Beauveria bassiana is an important entomopathogenic fungus widely commercialized in the world. Recent progress and achievements on conidia production have focused on a yield goal of 10(9) to 10(10) conidia per gram of dry substrate. Due to cost-competitive perspectives, these yields should be associated with better production rates or productivities. This study presents a review of relevant studies of B. bassiana conidia production on solid-state cultures and the parameters that should be taken into account to maintain constant quality in the product to be commercialized. Conditions for maximizing production and infectivity of B. bassiana conidia are also analysed. PMID:24494702

  4. The Existence of Beauveria bassiana in the Third Generation of Corn Seddling

    OpenAIRE

    Diana Daud, Itji; Widiayani, Nuniek

    2015-01-01

    Abstract The fungus Beauveria bassiana can be endophytic in maize. The fungus was recovered in culture from stems, leaves and roots after a month planting. This phenomenon was shown until the third generation of the corn. The result from laboratory shows that B.bassiana appear in F1, F2 and F3 in order 70, 80 and 90% in the roots, 80% in the stems in all generation, 90, 80 and 70% in leaves. In CFU???s ml-1 of B. bassiana in corn seed, show F1 was 8.9 x 106, F2 was 8.1 x 106 a...

  5. Molecular characterization of a novel amalgavirus from the entomopathogenic fungus Beauveria bassiana

    Czech Academy of Sciences Publication Activity Database

    Koloniuk, Igor; Hrabáková, Lenka; Petrzik, Karel

    2015-01-01

    Roč. 160, č. 6 (2015), s. 1585-1588. ISSN 0304-8608 R&D Projects: GA MŠk LH13136; GA MŠk(CZ) EE2.3.30.0032 Institutional support: RVO:60077344 Keywords : Monopartite DsRNA Virus * Beauveria bassiana * amalgaviruses infecting fungi Subject RIV: EE - Microbiology, Virology Impact factor: 2.390, year: 2014

  6. EICOSANOIDS MEDIATE MANDUCA SEXTA CELLULAR RESPONSE TO BEAUVERIA BASSIANA: A ROLE FOR THE LIPOXYGENASE PATHWAY

    Science.gov (United States)

    Many studies have documented the involvement of eicosanoids in insect cellular immune responses to bacteria. The use of Beauveria bassiana as a nodulation elicitor, with inhibition of phospholipase A2 by dexamethasone extends the principal to fungi. This study also provides the first evidence of i...

  7. Comparative impact of artificial selection for fungicide resistance on Beauveria bassiana and Metarhizium brunncum

    Science.gov (United States)

    Hypocreales fungi such as Beauveria bassiana and Metarhizium anisopliae can be negatively affected by fungicides thereby reducing their biocontrol potential. The overall goal of this study was to investigate the impact of artificial selection for fungicide resistance on two commercial entomopathoge...

  8. Improved shelf life of dried Beauveria bassiana blastospores using convective drying and active packaging processes

    Science.gov (United States)

    The yeast form (blastospore) of the dimorphic insect-pathogenic fungus Beauveria bassiana can be rapidly produced using liquid fermentation methods but is generally unable to survive rapid dehydration processes or storage under non-refrigerated conditions. In this study, we evaluated the influence o...

  9. Anopheline and culicine mosquitoes are not repelled by surfaces treated with the entomopathogenic fungi Metarhizium anisopliae and Beauveria bassiana

    NARCIS (Netherlands)

    Mnyone, L.L.; Koenraadt, C.J.M.; Lyimo, I.N.; Mpingwa, M.W.; Takken, W.; Russell, T.L.

    2010-01-01

    Background - Entomopathogenic fungi, Metarhizium anisopliae and Beauveria bassiana, are promising bio-pesticides for application against adult malaria mosquito vectors. An understanding of the behavioural responses of mosquitoes towards these fungi is necessary to guide development of fungi beyond t

  10. Evaluation of Metarhizium anisopliae, Beauveria bassiana and Paecilomyces fumosoroseus as entomopathogens of the cactus moth, Cactoblastis cactorum (Lepidoptera:Pyralidae)

    Science.gov (United States)

    The fungal pathogens Metarhizium anisopliae (Metchnikoff) Sorokin (Hypocreales: Clavicipitaceae), Paecilomyces fumosoroseus (Wize) Brown & Smith (Deuteromycotina: Hyphomycetes), and Beauveria bassiana (Bals.-Criv.) Vuill. (Hypocreales: Clavicipitaceae) were evaluated as potential biological control ...

  11. Isolation and Assessment of Stability of Six Formulations of Entomopathogenic Beauveria bassiana.

    Science.gov (United States)

    Mwamburi, Lizzy A

    2016-01-01

    Beauveria bassiana is the most widely studied and exploited entomopathogen. The development of a suitable formulation for B. bassiana is a critical component in aiding the entomopathogen germinate and infect the host. In addition to being economical to produce, having high residual activity, it is also important that the formulation is easy to handle, stable during storage, and convenient to mix and apply and be consistently effective in controlling the target pest.In this chapter we describe preparation of experimental formulations of conidia of B. bassiana. The formulations are prepared with barley, rice, wheat bran, clay, kaolin, and peat. The protocol for assessing the stability of the formulations of B. bassiana is also described. PMID:27565494

  12. Discovery and demonstration of the teleomorph of Beauve-ria bassiana (Bals.) Vuill. , an important entomogenous fun-gus

    Institute of Scientific and Technical Information of China (English)

    2001-01-01

    A Cordyceps specimen was collected in Anhui, China, a strain of Beauveria bassiana, an important entomopathogenic fungus for biological pest control, was isolated and their relationship was demonstrated by microcycle conidiation. The teleomorph is an undescribed species and is named Cordyceps bassiana.

  13. Screening of liquid media and fermentation of an endophytic Beauveria bassiana strain in a bioreactor

    OpenAIRE

    Lohse, Rieke; Jakobs-Schönwandt, Desiree; Patel, Anant V

    2014-01-01

    A novel approach for biological control of insect pests could be the use of the endophytic entomopathogenic Beauveria bassiana isolate ATP-02. For the utilization of the endophyte as a commercial biocontrol agent, the fungus has to be mass-produced. B. bassiana was raised in shake flask cultures to produce high concentrations of total spores (TS), which include blastospores (BS) and submerged conidiospores (SCS). The highest concentration of 1.33×109 TS/mL and the highest yield of 5.32×1010 T...

  14. EFEITO ANTAGÔNICO DE Trichoderma sp. NO DESENVOLVIMENTO DE Beauveria bassiana (Bals. Vuill. e Metarhizium anisopliae (Metsch. Sorok ANTAGONISTIC EFFECT OF Trichoderma sp. ON THE DEVELOPMENT OF Beauveria bassiana (Bals. Vuill. AND Metarhizium anisopliae (Metsch. SOROK

    Directory of Open Access Journals (Sweden)

    Alcides Moino Jr.

    1999-01-01

    Full Text Available Este trabalho teve por objetivo avaliar o efeito de Trichoderma sp. no desenvolvimento de Beauveria bassiana e Metarhizium anisopliae. Trichoderma sp., B. bassiana (isolado 634 e M. anisopliae (isolado E-9 foram inoculados em meio BDA, com intervalos de 0, 48, 120 e 168 horas entre a inoculação de Trichoderma sp. e dos entomopatógenos. Avaliou-se o crescimento radial das colônias nos períodos de 48 e 120 horas após a inoculação de Trichoderma sp., sendo que este afetou o desenvolvimento dos entomopatógenos quando inoculado simultaneamente ou após 48 horas. B. bassiana e M. anisopliae desenvolveram-se normalmente quando inoculados 168 horas antes de Trichoderma sp.. Também foi avaliado o efeito de um extrato de Trichoderma sp. sobre os entomopatógenos, com a adição de 0,1; 0,5; 1,0 e 5,0 ml de extrato/100,0 ml de meio, onde foram inoculados os entomopatógenos. Foram medidos os diâmetros de colônias e o número de conídios produzidos por B. bassiana e M. anisopliae na presença do extrato. A concentração de 5,0 ml de extrato/100,0 ml de meio alterou o crescimento e a conidiogênese de B. bassiana. O fungo M. anisopliae foi afetado a partir da adição de 1,0 ml de extrato/100,0 ml de meio.The objective of this work was to evaluate the effect of Trichoderma sp. on the development of Beauveria bassiana and Metarhizium anisopliae. The fungus Trichoderma sp. was inoculated on PDA culture medium, 0, 48, 120 and 168 hours after inoculation of the same plates with either B. bassiana (isolate 634 or M. anisopliae (isolate E-9. The radial growth of fungal colonies was measured 48 and 120 hours after Trichoderma sp. inoculation. Trichoderma sp. affected the development of both entomopathogenic fungi when inoculated simultaneously or 48 hours later. B. bassiana and M. anisopliae had normal development when inoculated 168 hours before Trichoderma sp. The effect of a toxic extract from Trichoderma sp. on the entomopathogenic fungi was also

  15. PATOGENICIDADE DE BEAUVERIA BASSIANA (BALS.) VUILL. AO ÁCARO Tetranychus urticae KOCH PATHOGENICITY OF BEAUVERIA BASSIANA (BALS.) VUILL. AGAINST Tetranychus urticae KOCH

    OpenAIRE

    Marco Antonio Tamai; Sérgio Batista Alves; Pedro Janeiro Neves

    1999-01-01

    O estudo da patogenicidade de Beauveria bassiana (Bals.) Vuill. ao ácaro Tetranychus urticae Koch foi desenvolvido a 25 ± 2°C, 70 ± 5% UR e 12 horas de fotofase, utilizando-se fêmeas recém-emergidas. Os ácaros foram mantidos durante seis dias em discos de folha de Canavalia ensiformis (L.) DC. inoculadas com B. bassiana, isolado 447, nas concentrações: 5x106, 1x107, 5x107, 1x108, 5x108 e 1x109 conídios/ml. Este isolado mostrou-se patogênico a T. urticae, apresentando aumento nos valores das m...

  16. Use of Beauveria bassiana and Metarhizium anisopliae for fruit fly control: a novel approach

    International Nuclear Information System (INIS)

    The potential of two species of entomopathogenic fungi, Beauveria bassiana (Bals.) and Metarhizium anisopliae (Met.) Sorokin, as practical fruit fly biocontrol agents is studied. These natural inhabitants of soil are found infecting a wide range of insect species that spend at least one stage of their life cycle in the soil. Sterile flies are used as vectors of the infection. A summary of results from different laboratory and field cage experiments is presented. (MAC)

  17. Optimization of Solid-State Fermentation for Improved Conidia Production of Beauveria bassiana as a Mycoinsecticide

    OpenAIRE

    Pham, Tuan Anh; Kim, Jeong Jun; Kim, Keun

    2010-01-01

    The production of conidia of entomopathogenic Beauveria bassiana by solid-state fermentation was studied for the development of a biocontrol agent against aphid Myzus persicae. The optimal conditions for conidia production on polished white rice were 40% moisture content, 25℃ culture temperature, 2-day-old seeding culture grown in 3% corn meal, 2% rice bran, 2% corn steep powder medium, initial conidia concentration of 107 conidia/g in the wet rice, 10% inoculum size, and use of a polyethylen...

  18. Efficacy of Molasses and Beauveria bassiana (Balsamo) Vuill on the Control of Cosmopolites sorditus Germar, 1824

    OpenAIRE

    Flávia Queiroz de Oliveira; José Bruno Malaquias; Luiz Leonardo Ferreira; Thiago de Souza Ribeiro; Alexandre Igor de Azevedo Pereira

    2010-01-01

    This research sought to study the compatibility between the molasses and the entomopathogenic fungi Beauveria bassiana (Balsamo) Vuill on the control of Cosmopolites sorditus Germar, 1824. The study was conducted on the Site Pitiá in a banana plantation of approximately 250 m2, located in the municipality of Areia, state of Paraiba, Brazil. The results showed that the constancy of C. sorditus was significantly higher in traps consisting of molasses+fungi (P

  19. The characteristics of keratomycosis by Beauveria bassiana and its successful treatment with antimycotic agents

    OpenAIRE

    Sonoyama, Hiroko; Araki-Sasaki, Kaoru; Kazama, Shigeyasu; Kawasaki, Tsutomu; Ideta, Hidenao; Sunada, Atsuko; Asari, Seishi; Inoue, Yoshitsugu; Hayashi, Kozaburo

    2008-01-01

    Clinical findings and treatment of keratomycosis caused by Beauveria bassiana, an entomopathogenic filamentous fungus, are described for an 80-year-old woman, who was referred to the hospital for ocular pain and redness on the 9th day after an ocular injury caused by the frame of her glasses. She had a long history of recurrent diabetic iritis and continuously used topical antibiotics and corticosteroids. At her first visit, a slit-lamp examination indicated a corneal ulcer confined within th...

  20. Use of Beauveria bassiana and Metarhizium anisopliae for fruit fly control: a novel approach

    Energy Technology Data Exchange (ETDEWEB)

    Toledo, Jorge; Liedo, Pablo, E-mail: jtoledo@ecosur.m [El Colegio de la Frontera Sur, Chiapas (Mexico). Dept. de Entomologia Tropical; Flores, Salvador; Montoya, Pablo [Secretaria de Agricultura, Ganaderia, Desarrollo Rural, Pesca y Alimentacion (SAGARPA), Chiapas (Mexico). Subdireccion de Desarrollo de Metodos; Campos, Sergio E.; Villasenor, Antonio [Secretaria de Agricultura, Ganaderia, Desarrollo Rural, Pesca y Alimentacion (SAGARPA), Chiapas (Mexico). Programa Moscamed. Direccion de Operaciones de Campo

    2006-07-01

    The potential of two species of entomopathogenic fungi, Beauveria bassiana (Bals.) and Metarhizium anisopliae (Met.) Sorokin, as practical fruit fly biocontrol agents is studied. These natural inhabitants of soil are found infecting a wide range of insect species that spend at least one stage of their life cycle in the soil. Sterile flies are used as vectors of the infection. A summary of results from different laboratory and field cage experiments is presented. (MAC)

  1. Field applications of Beauveria bassiana to control the European cherry fruit fly Rhagoletis cerasi

    OpenAIRE

    Daniel, Claudia; Wyss, Eric

    2010-01-01

    Field experiments with foliar applications of Beauveria bassiana ATCC 74040 (product Naturalis-L) were conducted to control the European cherry fruit fly Rhagoletis cerasi Loew (Diptera: Tephritidae), a major pest of cherries in Europe. Naturalis-L was applied at concentrations of 250 ml per 100 l in 7-day intervals during the flight period of R. cerasi. Flight activity monitored by yellow sticky traps was only slightly affected by treatments. Infection and mycosis of adult cherry fruit fl...

  2. Selection of Beauveria bassiana and Metarhizium anisopliae Isolates to Control Triatoma infestans

    Directory of Open Access Journals (Sweden)

    Luz Christian

    1998-01-01

    Full Text Available Twenty three isolates of Beauveria bassiana and 13 isolates of Metarhizium anisopliae were tested on third instar nymphs of Triatoma infestans, a serious vector of Chagas disease. Pathogenicity tests at saturated humidity showed that this insect is very susceptible to fungal infection. At lower relative humidity (50%, conditions expected in the vector microhabitat, virulence was significantly different among isolates. Cumulative mortality 15 days after treatment varied from 17.5 to 97.5%, and estimates of 50% survival time varied from 6 to 11 days. Maintaining lower relative humidity, four B. bassiana and two M. anisopliae isolates were selected for analysis of virulence at different conidial concentrations and temperatures. Lethal concentrations sufficient to kill 50% of insects (LC50 varied from 7.1x105 to 4.3x106 conidia/ml, for a B. bassiana isolate (CG 14 and a M. anisopliae isolate (CG 491 respectively. Most isolates, particularly B. bassiana isolates CG 24 and CG 306, proved to be more virulent at 25 and 30°C, compared to 15 and 20°C. The differential virulence at 50% humidity observed among some B. bassiana isolates was not correlated to phenetic groups in cluster analysis of RAPD markers. In fact, the B. bassiana isolates analyzed presented a high homogeneity (> 73% similarity.

  3. Compatibilidade de isolados de Beauveria bassiana (Ascomycetes: Clavicipitaceae com carrapaticidas químicos utilizados no controle do carrapato dos bovinos Compatibility of Beauveria bassiana (Ascomycetes: Clavicipitaceae with chemicals acaricides used in the control of cattle tick

    Directory of Open Access Journals (Sweden)

    Leila A. G. Barci

    2009-12-01

    Full Text Available O presente trabalho teve como escopo avaliar a compatibilidade dos isolados IBCB66 e IBCB21 de Beauveria bassiana com os carrapaticidas a base de Flumetrina + Coumafós, Deltametrina, Diclorvós + Cipermetrina, Diclorvós + Clorpirifós, Cipermetrina High Cis, Diclorvós + Cipermetrina High Cis, Cipermetrina e Amitraz utilizados no controle do carrapato Rhipicephalus (Boophilus microplus em nosso país. O efeito dos produtos comerciais sobre os isolados foi verificado por meio da observação do crescimento vegetativo, produção de conídios e viabilidade das estirpes do fungo B. bassiana. Com referência ao isolado IBCB66, os produtos Deltametrina, Cipermetrina High Cis e Amitraz foram classificados como compatíveis, não interferindo no desenvolvimento do entomopatógeno. O produto Cipermetrina foi classificado como tóxico e os produtos Flumetrina + Coumafós, Diclorvós + Cipermetrina, Diclorvós + Clorpirifós e Diclorvós + Cipermetrina High Cis, muito tóxicos. Em relação ao isolado IBCB21, os produtos Flumetrina + Coumafós, Diclorvós + Cipermetrina, Diclorvós + Clorpirifós, Cipermetrina High Cis, Diclorvós + Cipermetrina High Cis e Cipermetrina foram classificados como muito tóxicos e o produto Amitraz como tóxico. Entre os carrapaticidas avaliados, o produto Deltametrina foi o único que não produziu efeito tóxico sobre o entomopatógeno.The purpose of the present study was to assess compatibility between IBCB66 and IBCB21 isolates of Beauveria bassiana and acaricides: Flumethrin + Coumaphos, Deltamethrin, Dichlorvos + Cypermethrin, Dichlorvos + Chlorpyrifos, Cypermethrin High Cis, Dichlorvos + Cypermethrin High Cis, Cypermethrin and Amitraz, utilized on the control of Rhipicephalus (Boophilus microplus in our country. The effect of commercial products on the isolates was assayed according to observation of vegetative growth, conidia production, and viability of strains of B. bassiana fungus. With concerning about IBCB66

  4. Selectivity of Beauveria bassiana and Metarrhizium anisopliae to Trichogramma pretiosum Riley (Hymenoptera: Trichogrammatidae); Seletividade de Beauveria bassiana e Metarhizium anisopliae a Trichogramma pretiosum Riley (Hymenoptera: Trichogrammatidae)

    Energy Technology Data Exchange (ETDEWEB)

    Potrich, Michele; Silva, Everton L. da; Neves, Pedro M.O.J. [Universidade Estadual de Londrina (UEL), PR (Brazil). Centro de Ciencias Agrarias], e-mail: profmichele@gmail.com, e-mail: evertonloz@gmail.com, e-mail: pedroneves@uel.br; Alves, Luis F.A.; Daros, Alaxsandra [Universidade do Oeste do Parana (UNIOESTE), Cascavel, PR (Brazil). Centro de Ciencias Biologicas e da Saude. Lab. de Zoologia de Invertebrados], e-mail: lfaalves@unioeste.br; Haas, Jucelaine; Pietrowski, Vanda [Universidade do Oeste do Parana (UNIOESTE), Marechal Candido Rondon, PR (Brazil). Centro de Ciencias Agrarias], e-mail: jubarth@gmail.com, e-mail: vandapietrowski@gmail.com

    2009-07-01

    Trichogramma pretiosum Riley and the entomopathogenic fungi Beauveria bassiana and Metarhizium anisopliae are efficient biological control agents and are thought to be used jointly. In here, we investigated if these entomopathogens could have any side-effects on T. pretiosum. Therefore, 1 x 8 cards containing sterilized eggs of Anagasta kuehniella (Zeller) that were sprayed with 0.2 ml of B. bassiana or M. anisopliae (1.0 X 10{sup 9} conidia/ml) were offered to a T. pretiosum female for 24h (30 cards/fungus = 30 replicates). Afterwards, females were isolated in glass tubes. The control group was sprayed with sterile distillated water + Tween 80 (0.01%). In addition, 60 cards with sterilized eggs of A. kuehniella were submitted to parasitism by females of T. pretiosum for 24h. Of these cards, 30 were sprayed with B. bassiana or M. anisopliae and 30 with distillated water + Tween 80 (0.01%), and observed daily until parasitoid emergence. Metarhizium anisopliae decreased parasitoid emergence and caused confirmed mortality. Therefore, field and semi-field experiments should be conducted for a final assessment of the side-effects of these entomopathogens on Trichogramma as a ways to develop a control strategy in which both can be used. (author)

  5. Compatibility between the entomopathogenic fungus Beauveria bassiana and insecticides used in coffee plantations Compatibilidade entre o fungo entomopatogênico Beauveria bassiana e inseticidas usados na cultura do cafeeiro

    Directory of Open Access Journals (Sweden)

    Carolina Natali de Oliveira

    2003-12-01

    controle, reduzindo assim a quantidade de inseticidas. O efeito fungitóxico in vitro das formulações inseticidas de Tiametoxan, Ciflutrin, Deltametrin, Alfacipermetrina, Triazofos, Clorpirifós, Fenpropatrin e Endosulfan em três concentrações (RC= recomendação média para campo, 0,5 ´ RC e 2 ´ RC, foi avaliado sobre a germinação dos conídios, crescimento vegetativo e produção de conídios no fungo Beauveria bassiana. Apenas cinco formulações inseticidas, na concentração RC, proporcionaram viabilidade dos conídios acima de 60%. A viabilidade deve ser considerada o parâmetro mais importante a ser avaliado por ser o passo inicial no processo de infecção. As formulações de Alfacipermetrina, Tiametoxan e Ciflutrin, nas menores concentrações, causaram a menor inibição da germinação, sem diferença em relação à testemunha. Analisando-se o crescimento vegetativo, observou-se que a formulação de Tiametoxan nas menores concentrações, não inibiu o crescimento radial, sendo o crescimento vegetativo nos demais tratamentos inferior à testemunha. A formulação de Tiametoxan também proporcionou a menor inibição na produção de conídios. Os inseticidas com formulações de Alfacipermetrina e Tiametoxan mostraram-se compatíveis com o fungo Beauveria bassiana (CG 425, importante agente natural de controle da broca do café Hypothenemus hampei e podem ser recomendados para MIP no cafeeiro

  6. Evaluation of kinetic parameters of chitinases produced by Beauveria bassiana (Bals.) Vuill. /
    Avaliação de parâmetros cinéticos de quitinases produzidas por Beauveria bassiana (Bals.) Vuill.

    OpenAIRE

    Cristiane Mita; Vanessa Hitomi Sugahara; Jo I Wu; Pedro Manoel Oliveira Janeiro Neves; Dalva Tomoe Miyagui; Geni Varéa-Pereira; Danieli Cristina Sassá; Evelyn Kamogawa

    2008-01-01

    Entomopathogenic fungus Beauveria bassiana is currently used as a biocontrol agent for agricultural pests. The infection process involves extracellular enzymes such as proteases and chitinases that degrade the cuticle of the insects. The objective of this work was to evaluate kinetic parameters of pH, temperature, ionic concentration and time of reaction on chitinases activity. The fungus B. bassiana CG432 was cultivated on coffee berry borer Hypothenemus hampei (Ferrari) and the conidia grow...

  7. The characteristics of keratomycosis by Beauveria bassiana and its successful treatment with antimycotic agents

    Directory of Open Access Journals (Sweden)

    Hiroko Sonoyama

    2008-10-01

    Full Text Available Hiroko Sonoyama1, Kaoru Araki-Sasaki1, Shigeyasu Kazama1, Tsutomu Kawasaki1, Hidenao Ideta1, Atsuko Sunada2, Seishi Asari2, Yoshitsugu Inoue3, Kozaburo Hayashi41Ideta Eye Hospital, Kumamoto, Kumamoto, Japan; 2Department of Laboratory for Clinical Investigation, Osaka University Hospital, Suita, Osaka, Japan; 3Division of Ophthalmology and Visual Science, Department of Medicine of Sensory and Motor Organ, Tottori University, Yonago, Tottori, Japan; 4Immunology and Virology Section Lab, Immunology, NEI, NIH, Bethesda, MD, USAAbstract: Clinical findings and treatment of keratomycosis caused by Beauveria bassiana, an entomopathogenic filamentous fungus, are described for an 80-year-old woman, who was referred to the hospital for ocular pain and redness on the 9th day after an ocular injury caused by the frame of her glasses. She had a long history of recurrent diabetic iritis and continuously used topical antibiotics and corticosteroids. At her first visit, a slit-lamp examination indicated a corneal ulcer confined within the superficial stromal layer, along with a slight infiltration and edema. Only a very few inflammatory cells were seen in the anterior chamber. Direct microscopic examination of corneal scrapings revealed septate fungal hyphae with zig-zag rachis and budding that was subsequently identified as B. bassiana by slide culture. Topical voriconazole with miconazole, pimaricin and oral itraconazole were effective and the lesion disappeared leaving only a mild scar at 2 months. The sensitivity of B. bassiana to various antimycotic agents was confirmed by broth microdilution, agar dilution with the Clinical Laboratory Standard Institute standard, and a disk method using topically applied concentrations. B. bassiana, which exhibits a characteristic appearance in smears and causes superficial keratomycosis, is sensitive to voriconazole with miconazole, pimaricin, and itraconazole.Keywords: Beauveria bassiana, keratomycosis, filamentous

  8. Lethal effects of a Mexican Beauveria bassiana (Balsamo) strain against Meccus pallidipennis (Stal)

    Science.gov (United States)

    Lino, Zumaquero Rios José; Juventino, López-Tlacomulco José; Raúl, Rojas García; Estibaliz, Sansinenea

    2014-01-01

    The entomopathogenic fungus Beauveria bassiana (Balsamo 1835) Vuillemin is an effective alternative control agent against some agricultural pests and biological vectors of important diseases such as Chagas disease. In this work we studied an isolate of Beauveria bassiana from of the town of San Antonio Rayón, Puebla, Mexico and its entomopathogenic effects on Meccus pallidipennis (Stal 1872). Phylogenetic analysis using molecular comparison of the ITS and EF1α genes, showed that the resulting cladogram places the BUAP 04 strain with a relationship closer to the AFAO 9-6 strain, within the diversity of the B. bassiana sensu lato group. Although there was the possibility that BUAP 04 strain was a direct descendant of strains used in campaigns of biologic control, molecular study allowed us to recognize that it was a different fungus due to numerous inserts. A strain isolated from a T. dimiata was evaluated for pathogenicity against another triatoma (Meccus pallidipennis) species obtaining an LC50 of 4.16 × 106 spores/mL, confirming that the BUAP 04 strain is virulent for M. pallidipennis and could be a good prospect for formulations to control M. pallidipennis. PMID:25242941

  9. Protection of metal artifacts with the formation of metal–oxalates complexes by Beauveria bassiana

    OpenAIRE

    Joseph, Edith; Cario, Sylvie; Simon, Anaële; Wörle, Marie; Mazzeo, Rocco; Junier, Pilar; Job, Daniel

    2013-01-01

    Several fungi present high tolerance to toxic metals and some are able to transform metals into metal-oxalate complexes. In this study, the ability of Beauveria bassiana to produce copper oxalates was evaluated. Growth performance was tested on various copper-containing media. B. bassiana proved highly resistant to copper, tolerating concentrations of up to 20 g L-1, and precipitating copper oxalates on all media tested. Chromatographic analyses showed that this species produced oxalic acid a...

  10. RAPD e ITS Detectan Variación Molecular en Poblaciones Chilenea de Beauveria bassiana RAPD and ITS Reveal Molecular Variation of Chilean Populations of Beauveria bassiana

    Directory of Open Access Journals (Sweden)

    Viviana Becerra V

    2007-06-01

    Full Text Available Los hongos entomopatógenos son una alternativa atractiva para el control biológico de insectos plagas. En Chile, el Instituto de Investigaciones Agropecuarias (INIA, Centro Regional de Investigación Quilamapu mantiene aproximadamente 400 aislamientos de Beauveria, colectados a través del país. Esta colección ha sido parcialmente clasificada en base a su morfología y a su eficacia como controlador biológico. Sin embargo, es necesario complementar estos estudios con una caracterización a nivel genético-molecular, para determinar el nivel de diversidad genética de Beauveria bassiana e identificar posibles patrones de bandas que permitan dicriminar entre aislamientos. En este estudio, se analizaron 36 aislamientos de B. bassiana provenientes de diversas regiones geográficas del país. El análisis genético se realizó mediante el ADN Polimórfico Amplificado al Azar (RAPD y la Reacción en Cadena de la Polimerasa-Fragmentos de Restricción Polimórficos (PCR-RFLP de los espaciadores internos transcritos (ITS de las secuencias ribosomales del ADN (ITS-rDNA. El análisis de RAPD indicó una alta diversidad genética entre los aislamientos, con un promedio de 43% de similitud. Por otro lado, el análisis de los ITS determinó una menor diversidad, con un 83% de similitud entre aislamientos. La región ITS 1 mostró un mayor número de sitios de restricción que la región ITS 2. Los RAPD fueron más eficientes para discriminar (o identificar entre cepas debido al bajo número de haplotipos detectados con los ITS. Para los dos marcadores utilizados en este estudio, la diversidad genética no estuvo asociada con el origen geográfico de los aislamientos.Entomopathogenic fungi are an attractive alternative for the biological control of insects. In Chile, the Quilamapu Regional Research Center of the National Agricultural Research Institute (INIA has collected about 400 isolates of the genus Beauveria along the country. A partial

  11. Laboratory evaluation of Beauveria bassiana and Metarhizium anisopliae in the control of Haemaphysalis qinghaiensis in China.

    Science.gov (United States)

    Ren, Qiaoyun; Chen, Ze; Luo, Jin; Liu, Guangyuan; Guan, Guiquan; Liu, Zhijie; Liu, Aihong; Li, Youquan; Niu, Qingli; Liu, Junlong; Yang, Jifei; Han, Xueqing; Yin, Hong; Luo, Jianxun

    2016-06-01

    Haemaphysalis qinghaiensis, a prevalent tick species in China, is an ectoparasite that preferentially infests small ruminants and can transmit Theileria sp. and Babesia sp. In this study, we evaluated the pathogenicity of individual and mixed infections of the fungi Beauveria bassiana and Metarhizium anisopliae to H. qinghaiensis nymphs. The estimated LC50 for ticks immersed in solutions of B. bassiana, M. anisopliae and a mixture thereof were: 5.88056 × 10(4), 2.65 × 10(4), and 2.85 × 10(4) conidia mL(-1) respectively, and the nymphal mortality ranged from 52 to 100 %. Thus, these results suggest a potential approach for the biocontrol of H. qinghaiensis. PMID:27071674

  12. PATOGENICIDADE DE BEAUVERIA BASSIANA (BALS.) VUILL. AO ÁCARO Tetranychus urticae KOCH

    OpenAIRE

    Tamai Marco Antonio; Alves Sérgio Batista; Neves Pedro Janeiro

    1999-01-01

    O estudo da patogenicidade de Beauveria bassiana (Bals.) Vuill. ao ácaro Tetranychus urticae Koch foi desenvolvido a 25 ± 2°C, 70 ± 5% UR e 12 horas de fotofase, utilizando-se fêmeas recém-emergidas. Os ácaros foram mantidos durante seis dias em discos de folha de Canavalia ensiformis (L.) DC. inoculadas com B. bassiana, isolado 447, nas concentrações: 5x106, 1x107, 5x107, 1x108, 5x108 e 1x109 conídios/ml. Este isolado mostrou-se patogênico a T. urticae, apresentando aumento nos valores das m...

  13. THE EFFECT OF SELECTED PESTICIDES ON THE GROWTH OF ENTOMOPATHOGENIC FUNGI HIRSUTELLA NODULOSA AND BEAUVERIA BASSIANA

    Directory of Open Access Journals (Sweden)

    Cezary Tkaczuk

    2015-06-01

    Full Text Available The effect of three pesticides used in corn protection: Targa Super 05 (chizalofop-P-ethyl, Roundup 360SL (glyphosate and Karate Zeon 050CS (lambda-cyhalothrin, on the growth of entomopathogenic fungi Hirsutella nodulosa Petch and Beauveria bassiana (Bals. Vuill. was evaluated under laboratory conditions. Fungi isolates were cultured on Sabouraud’s medium with addition of pesticides at three different concentrations. H. nodulosa was more susceptible to pesticides than B. bassiana. The most inhibitory effect on tested entomopathogenic fungi showed chizalofop-P-ethyl herbicide. Lambda-cyhalothrin at the recommended field dose showed minor toxic effect on entomopathogenic fungi, which suggests the possibility of compatible use of this insecticide with biopesticides based on the tested species.

  14. Evaluación de Beauveria bassiana para el combate de insectos plaga en maíz almacenado

    Directory of Open Access Journals (Sweden)

    Juan Diego Molina

    2000-01-01

    Full Text Available El objetivo de este estudio fue evaluar la patogenicidad de aislamientos de Beauveria bassiana, para controlar los insectos plaga Prostephanus truncatus y Stophilus zeamais, en mazorcas de maíz almacenado. Se evaluó también la patogenicidad del hongo sobre Teritriosoma nigrescens, depredador natural de P. truncatus. Se mezclaron conidios secos del hongo con kaolinita y se aplicaron a trojas de maíz de 450 mazorcas acomodadas en capas de 50. Se montaron dos ensayos, en el primero se evaluaron aplicaciones del hongo al momento de almacenar el maíz, y en el segundo se evaluaron aplicaciones del hongo realizadas después de almacenar el maíz. La mortalidad de P. truncatus fue cuatro veces mayor en el ensayo donde se aplicó el hongo en forma preventiva. La mortalidad de S. zeamais fue el doble en el tratamiento donde se aplicó el hongo al momento de inocular con P. truncatus. Los niveles de mortalidad por B. bassiana fueron mayores en P. truncatus que en S. zeamais, pero S. zeamais, pero este último mostró un 20% más de infección que el primero

  15. Effect of Leaf Litters and Soils on Viability of Entomopathogenic Fungi Beauveria bassiana (Bals. Vuill

    Directory of Open Access Journals (Sweden)

    LISDAR IDWAN SUDIRMAN

    2008-09-01

    Full Text Available Viability of Beauveria bassiana is extremely low due to toxic compounds in soils. This research was aimed to study the effect of four groups of media on viability of B. bassiana Bb-Pb2. The first group was leaf litters of onion, flowering white cabbage, cabbage, and chinese mustard, respectively; the second group was the soils containing decomposed residues of each plant of the first group; the third group was the mixtures of each media of both groups above (1:1, and the fourth group was natural top soil as a control. Each plastic bag filled with one kg of each medium was inoculated with ten ml of B. bassiana conidia (106/ml of concentration and incubated in open area for 8 weeks. The results showed that all leaf litters of those plants and their compost soils affected the fungal viability. The highest decreasing number of colony was found on onion’s leaf litters, soil containing of decomposed onion, and the mixtures of both media. The treated B. bassiana showed significant reducing abilities of growth, conidia production and conidia germination on PDA media, except the one of control. It is suggested that the Bb-Pb2 isolate might not be effective as bioinsecticide in the soils containing either those leaf litters or composts.

  16. Efficacy of Molasses and Beauveria bassiana (Balsamo Vuill on the Control of Cosmopolites sorditus Germar, 1824

    Directory of Open Access Journals (Sweden)

    Flávia Queiroz de Oliveira

    2010-06-01

    Full Text Available This research sought to study the compatibility between the molasses and the entomopathogenic fungi Beauveria bassiana (Balsamo Vuill on the control of Cosmopolites sorditus Germar, 1824. The study was conducted on the Site Pitiá in a banana plantation of approximately 250 m2, located in the municipality of Areia, state of Paraiba, Brazil. The results showed that the constancy of C. sorditus was significantly higher in traps consisting of molasses+fungi (P <0.01. And significantly lower in traps without yeast and molasses. The frequency of C. sorditus was classified as accidental in traps with only B. bassiana (23.44% and in traps without the addition of B. bassiana and molasses (10.71%, and being accessory in traps consisting of molasses (28.43% and in traps with molasses+fungi (37.27%. Therefore the food bait molasses along with the fungi B. bassiana, may be used in an integrated control of C. sorditus in banana plantations.

  17. Development of Metarhizium anisopliae and Beauveria bassiana formulations for control of malaria mosquito larvae

    Directory of Open Access Journals (Sweden)

    Takken Willem

    2011-02-01

    Full Text Available Abstract Background The entomopathogenic fungi Metarhizium anisopliae and Beauveria bassiana have demonstrated effectiveness against anopheline larvae in the laboratory. However, utilising these fungi for the control of anopheline larvae under field conditions, relies on development of effective means of application as well as reducing their sensitivity to UV radiation, high temperatures and the inevitable contact with water. This study was conducted to develop formulations that facilitate the application of Metarhizium anisopliae and Beauveria bassiana spores for the control of anopheline larvae, and also improve their persistence under field conditions. Methods Laboratory bioassays were conducted to test the ability of aqueous (0.1% Tween 80, dry (organic and inorganic and oil (mineral and synthetic formulations to facilitate the spread of fungal spores over the water surface and improve the efficacy of formulated spores against anopheline larvae as well as improve spore survival after application. Field bioassays were then carried out to test the efficacy of the most promising formulation under field conditions in western Kenya. Results When formulated in a synthetic oil (ShellSol T, fungal spores of both Metarhizium anisopliae and Beauveria bassiana were easy to mix and apply to the water surface. This formulation was more effective against anopheline larvae than 0.1% Tween 80, dry powders or mineral oil formulations. ShellSol T also improved the persistence of fungal spores after application to the water. Under field conditions in Kenya, the percentage pupation of An. gambiae was significantly reduced by 39 - 50% by the ShellSol T-formulated Metarhizium anisopliae and Beauveria bassiana spores as compared to the effects of the application of unformulated spores. Conclusions ShellSol T is an effective carrier for fungal spores when targeting anopheline larvae under both laboratory and field conditions. Entomopathogenic fungi formulated with

  18. Field evaluation of the efficacy of neem oil (Azadirachta indica A. Juss) and Beauveria bassiana (Bals.) Vuill. in cotton production

    NARCIS (Netherlands)

    Togbe, C.E.; Haagsma, R.; Zannou, E.; Gbehounou, G.; Déguénon, J.M.; Vodouhe, S.; Kossou, D.; Huis, van A.

    2015-01-01

    Neem oil (Azadirachta indica A. Juss) alone and combined with the entomopathogenic fungus Beauveria bassiana (Balsamo) Vuillemin (isolate Bb11) was applied to control cotton pests. The efficacy of these treatments was compared with that of synthetic insecticides applied either in a calendar-based ap

  19. Cellular Immune Reactions of the Sunn Pest, Eurygaster integriceps, to the Entomopathogenic Fungus, Beauveria bassiana and Its Secondary Metabolites

    OpenAIRE

    Zibaee, Arash; Bandani, Ali Reza; Talaei-Hassanlouei, Reza; Malagoli, Davide

    2011-01-01

    In this study, five morphological types of circulating hemocytes were recognized in the hemolymph of the adult sunn pest, Eurygaster integriceps Puton (Hemiptera: Scutelleridae), namely prohemocytes, plasmatocytes, granulocytes, adipohemocytes, and oenocytoids. The effects of the secondary metabolites of the entomopathogenic fungus Beauveria bassiana on cellular immune defenses of Eurygaster integriceps were investigated. The results showed that the fungal secondary metabolites inhibited phag...

  20. Host range findings on Beauveria bassiana and Metarhizium anisopliae (Ascomycota: Hypocreales in Argentina Espectro de hospedadores hallado en Beauveria bassiana y Metarhizium anisopliae (Ascomycota: Hypocreales en Argentina

    Directory of Open Access Journals (Sweden)

    A. V. Toledo

    2008-12-01

    Full Text Available The natural insect host range of the entomopathogenic fungi (EPF Beauveria bassiana (Bb and Metarhizium anisopliae (Ma was investigated in Argentina during the winter of 2003 through spring of 2004. Fungi- infected insect samples (153 were collected from cornfields and the surrounding uncultivated areas in different localities of Buenos Aires (7, Tucumán (2, and Corrientes (3 provinces. The rates of Bb-infected host range varied among the Coleoptera (37%, Hemiptera (27% and Dermaptera (1.3%. While the rates of Ma-infected host range varied between the Coleoptera (0.7% and Hemiptera (34%. The greater host range resulted with B. bassiana found from eight species of Coleoptera (four families, one species of Dermaptera and four species of Hemiptera (three families, than the host range of M. anisopliae found infecting one species of Coleoptera and three species of Hemiptera (two families. We obtained 75 pure fungal isolates (48 Bb-isolates and 27 to Ma-isolates, and 56 of them (33 Bb-isolates and 23 Ma-isolates were morphologically characterized.El espectro natural de hospedadores de los hongos entomopatógenos (HEP Beauveria bassiana (Bb y Metarhizium anisopliae (Ma fue investigado en Argentina desde el invierno de 2003 hasta la primavera de 2004. Las muestras de insectos con infecciones fúngicas (153 fueron recolectadas a partir de campos de maíz y las áreas no cultivadas circundantes a los mismos, en diferentes localidades de las provincias de Buenos Aires (7, Tucumán (2 y Corrientes (3. El espectro de hospedadores infectados con Bb varió entre los Coleoptera (37%, Hemiptera (27% y Dermaptera (1,3%. Mientras que el espectro de hospedadores infectados con Ma varió entre los Coleoptera (0,7% y los Hemiptera (34%. El mayor espectro lo presentó Bb, encontrado en ocho especies de Coleoptera (cuatro familias, una especie de Dermaptera y cuatro especies de Hemiptera (tres familias, mientras que Ma fue encontrado infectando una especie de

  1. Susceptibility of Tetranychus urticae Koch. (Acari: Tetranychidae to Isolates of Entomopathogenic Fungus Beauveria bassiana

    Directory of Open Access Journals (Sweden)

    Slavimira A. Draganova

    2010-01-01

    Full Text Available Bioassays with five isolates of the entomopathogenic fungus Beauveria bassiana (Bals.- Criv. Vuillemin were conducted under laboratory conditions with a goal to estimate their virulence to the two-spotted spider mite Tetranychus urticae Koch. (Acari: Tetranychidae. Common bean plants with mites were treated by spraying conidial suspensions of isolates at concentrations of 106, 107 and 108 conidia/ml. Lethal effects of the fungal isolates wereevaluated as percentages of cumulative daily mortality due to mycoses, corrected for mortality in the control variant. Virulence of the isolates was estimated based on values of the median lethal time (LT50 calculated by probit analysis for the variants treated with conidial suspensions at the concentration of 106 conidia/ml.The two-spotted spider mite was found susceptible to the examined isolates of the entomopathogenic fungus B. bassiana. Mycosis caused to T. urticae by the B. bassiana isolates 444 Bb and 445 Bb had fast lethal effect after treatment with conidial suspensions even at the concentration of 106 conidia/ml. The mean mortality values of host individuals were 83.78 ± 3.62% and 68.49 ± 4.28% on the first day, respectively, and up to 100% in both variants on the fourth day.The isolates 426 Bb, 444 Bb and 445 Bb of B. bassiana were highly virulent to two-spotted spider mites with values of the median lethal time varied within overlapped narrow confidence intervals from 0.122 to 1.084 days (average value 0.162 days, from 0.117 to 1.398 days (average value 0.146 days and from 0.106 to 1.162 days (average value 0.131 days,respectively. Significant differences regarding virulence of the three isolates at p-level < 0.05 could not been proved. The other two examined isolates were distinctly less virulent to T. urticae than these three B. bassiana isolates.

  2. Evaluation of Beauveria bassiana (Hyphomycetes) isolates as potential agents for control of Dendroctonus valens

    Institute of Scientific and Technical Information of China (English)

    Long-Wa Zhang; Yu-Jun Liu; Jian Yao; Bin Wang; Bo Huang; Zeng-Zhi Li; Mei-Zhen Fan; Jiang-Hua Sun

    2011-01-01

    The red turpentine beetle (RTB), Dendroctonus valens LeConte, as a destructive invasive pest, has become one of the most economically important forest pest in China. Effective control measures are desperately needed. Entomopathogenic fungi, such as Beauveria bassiana, have shown great potential for the management of some bark beetle species. In this study, 12 isolates of B. bassiana from bark beetle were examined for biological characteristics and virulence, to assess their potential as biocontrol agents for RTB. There were significant differences (at P = 0.05) in colony growth rate, conidial yield, conidial germination, tolerance to UV light and extracellular proteases activity among the tested B. bassiana isolates. Isolates, including Bbl801, Bbl906, Bb789 and Bb773, exhibited the best characteristics, because they have faster hyphal growth rate, higher spore production and faster spore germination, higher UV tolerance and protease (Prl) production. The results of a pathogenicity test of B. bassiana on RTB larvae showed that most isolates of B. bassiana have demonstrated high efficacy and the highest virulent isolate was Bbl801, which killed 100% of the treated insects and had a median lethal time (LT50) of 4.60 days at a concentration of 1× 107 conidia/mL. Therefore, isolate Bb 1801 has a great potential for sustainable control of RTB in the forest. The correlation between biological characteristics and virulence of the fungal isolates is discussed and the possibility of combination of entomopathogenic fungi with semiochemicals, as one of the promising strategy for RTB control, is considered.

  3. Sensitivity of Beauveria bassiana conidia to abiotic factors after successive in vitro subcultures

    Directory of Open Access Journals (Sweden)

    Janaina Zorzetti

    2014-09-01

    Full Text Available The aim of this study was to evaluate the effect of in vitro successive subcultures of Beauveria bassiana isolates in different nutritional conditions on conidia heat and UV radiation tolerance and on sensitivity to azoxystrobin fungicide. The fungus was initially inoculated in Alphitobius diaperinus (Coleoptera: Tenebrionidae adults and after its development, the conidia were cultivated in PDA (potato dextrose agar and MPE (medium to produce Beauveria spp. conidia originating the first subculture 1st (A conidia, which were successively multiplied in their media until the 20th cultivation. Conidia taken from the 20th subculture were again inoculated in the insect and after sporulation they were once more multiplied in the media, producing the 1st (B conidia. For the tests, 1st (A, 10th, 20th and 1st (B conidia from the CG 152 and Unioeste 40 isolates were used. Successive subcultures and the medium nutritional conditions interfered on the fungus physiology, and the isolates showed different behaviors. The subcultures on PDA showed higher thermotolerance to Unioeste 40 in all subcultures and to CG 152 just after inoculation in the host. B. bassiana was susceptible to UV radiation, and this characteristic was influenced by the subcultures in different media. Both isolates were more tolerant to UV radiation when subcultivated on MPE, while just for the 40 Unioeste this tolerance increased after host inoculation. The B. bassiana sensitivity to azoxystrobin fungicide was affected after successive subcultures in both medium. Conidia originated in MPE were more resistant to fungicide and the host inoculation increased this tolerance. These results show that it is possible to enhance the fungi efficiency to control pests, through the selection of a virulent isolate, and handling their nutritional conditions during cultivation and host inoculation.

  4. Selectivity of Beauveria bassiana and Metarrhizium anisopliae to Trichogramma pretiosum Riley (Hymenoptera: Trichogrammatidae)

    International Nuclear Information System (INIS)

    Trichogramma pretiosum Riley and the entomopathogenic fungi Beauveria bassiana and Metarhizium anisopliae are efficient biological control agents and are thought to be used jointly. In here, we investigated if these entomopathogens could have any side-effects on T. pretiosum. Therefore, 1 x 8 cards containing sterilized eggs of Anagasta kuehniella (Zeller) that were sprayed with 0.2 ml of B. bassiana or M. anisopliae (1.0 X 109 conidia/ml) were offered to a T. pretiosum female for 24h (30 cards/fungus = 30 replicates). Afterwards, females were isolated in glass tubes. The control group was sprayed with sterile distillated water + Tween 80 (0.01%). In addition, 60 cards with sterilized eggs of A. kuehniella were submitted to parasitism by females of T. pretiosum for 24h. Of these cards, 30 were sprayed with B. bassiana or M. anisopliae and 30 with distillated water + Tween 80 (0.01%), and observed daily until parasitoid emergence. Metarhizium anisopliae decreased parasitoid emergence and caused confirmed mortality. Therefore, field and semi-field experiments should be conducted for a final assessment of the side-effects of these entomopathogens on Trichogramma as a ways to develop a control strategy in which both can be used. (author)

  5. Protection of metal artefacts with the formation of metal-oxalates complexes by Beauveria bassiana.

    Directory of Open Access Journals (Sweden)

    Edith eJoseph

    2012-01-01

    Full Text Available Several fungi present high tolerance to toxic metals and some are able to transform metals into metal-oxalate complexes. In this study, the ability of Beauveria bassiana to produce copper oxalates was evaluated in vitro. Growth performance was tested on various copper-containing media. B. bassiana proved highly resistant to copper, tolerating concentrations of up to 20 g.L-1, and precipitating copper oxalates on all media tested. Chromatographic analyses showed that this species produced oxalic acid as sole metal chelator. The production of metal-oxalates can be used in the restoration and conservation of archaeological and modern metal artefacts. The production of copper-oxalates was confirmed directly using metallic pieces (both archaeological and modern. The conversion of corrosion products into copper oxalates was demonstrated as well. In order to assess whether the capability of B. bassiana to produce metal-oxalates could be applied to other metals, iron and silver were tested as well. Iron appears to be directly sequestered in the wall of the fungal hyphae forming oxalates and probably goethite. However, the formation of a homogeneous layer on the object is not yet optimal. Silver nitrate was extracellularly reduced into nanoparticles of elemental silver by an unknown mechanism. The production of copper oxalates is immediately applicable for the conservation of copper-based artefacts. For iron and silver this is not yet the case. However, the vast ability of B. bassiana to transform toxic metals using different immobilization mechanisms seems to offer considerable possibilities for industrial applications, such as the bioremediation of contaminated soils or the green synthesis of chemicals.

  6. Relationship between Biological Characteristics of Beauveria bassiana (Bals.) Vuill and Pathogenicity to Bombyx mori L.%Relationship between Biological Characteristics of Beauveria bassiana (Bals.) Vuill and Pathogenicity to Bombyx mori L.

    Institute of Scientific and Technical Information of China (English)

    Haiyu LUO; Yecheng DENG; Yongmei LIAO; Ruiyu LI

    2012-01-01

    [Objective] This study was to investigate the relationship between biological characteristics of Beauveria bassiana (Bals.) Vuill and pathogenicity to Bombyx rnori L, with the aim to provide scientific basis for the control of white muscardine in Bombyx mori L. [Method] The strains isolated and purified from the 6 Beauveria bassiana biocontrol agents from all over the country and the 3 white muscardine silkworms collected from Guangxi provincial silkworm rearing areas were identified by the morphological observation and molecular biology technology. The pathogenicity of B. bassaina to silkworms was determined, and the biological characteristics such as growth diameter, sporulation and the extracellular protease activity of the different B. bassiana strains were compared. [Result] The isolated 9 strains were all B. bassaina (Bals.) Vuillemin, and all strains had high pathogenicity to silkworm, but with different pathogenicities. The growth diameter, sporulation and extracellular protease activity of different B. bassiana strains were also different, and showed correlation with the patheogenicity to silkworms. [Conclusion] B. bassiana spores production amount and exocellular protease activity had significant positive correlation with their pathogenicity to silkworm.

  7. Field evaluation of the synergistic effects of neem oil with Beauveria bassiana (Hypocreales: Clavicipitaceae) and Bacillus thuringiensis var. kurstaki (Bacillales: Bacillaceae)

    NARCIS (Netherlands)

    Togbe, C.E.; Zannou, E.; Gbehounou, G.; Kossou, D.; Huis, van A.

    2014-01-01

    In the present study, the synergistic effects of Beauveria bassiana (Bals.-Criv. Vuill.) (isolate Bb11) and Bacillus thuringiensis var. kurstaki (Berliner) with neem oil were evaluated in three agroecological zones in Be´nin. Four bioinsecticide treatments (neem oil, neem oil and B. bassiana used se

  8. Evaluation of the efficacy of beauveria bassiana for the control of the invasive fruit fly bactrocera invadens (Diptera: Tephritidae)

    International Nuclear Information System (INIS)

    Mango production plays an important role in Africa’s economy. However, the African invader fly, Bactrocera invadens is causing high yield losses as an important quarantine pest. Suppression of fruit flies for increased mango production will increasingly rely on management methods which exert low negative environmental impact. Beauveria bassiana is an insect pathogenic fungus used as microbial insecticide because it leaves produce to their fresh state, flavor, colour and texture with no change in the chemical composition of the product and is environmentally friendly. Evaluation of the efficacy of Beauveria bassiana for the control of the invasive Fruit Fly, Bactrocera invadens (Diptera: Tephriitidae) was carried out. The fungus B. bassiana (Botanigard® ES) containing 11.3% Beauveria bassiana GHA strain was applied at concentrations of 106, 53.0, 26.5, 13.3 and 6.65(x 106 spores/ml). When three developmental stages of the fruit fly (larvae, puparia and adults) were treated with Beauveria bassiana, the severity of the damage caused by the fungus increased with increasing fungal concentration. The results show lethal time (LT50) that ranged from 2.8 to 3.6 days for a dose of 106 x 106 spores/ml. Comparing methods of fungal application in the field, the result indicated that applying the fungus in fruit fly traps in mango canopies is the better method for fruit flies control in the field as compared to the soil surface spray method. However, both methods could be employed for better results The study of gamma radiation on the virulence of the fungus showed that the combined effect of the fungus and gamma irradiation gave better result by increasing adult mortality to 100 % within three days at 106 x106 spores/ml irradiated at 150 Gy than applying fungal treatment only. (author)

  9. Susceptibility of Agrilus planipennis (Coleoptera: Buprestidae) to Beauveria bassiana and Metarhizium anisopliae.

    Science.gov (United States)

    Liu, Houping; Bauer, Leah S

    2006-08-01

    The susceptibility of Agrilus planipennis Fairmaire (Coleoptera: Buprestidae) to selected strains of the entomopathogenic fungi Beauveria bassiana (Balsamo) Vuillemin and Metarhizium anisopliae (Metschnikoff) Sorokin was evaluated through bioassays with direct immersion or foliar exposure under laboratory conditions. Results showed that A. planipennis adults were susceptible to B. bassiana and M. anisoplae. Significant time-mortality response was found for each isolates. Isolate B. bassiana GHA killed A. planipennis adults at a faster rate compared with other isolates tested, with the lowest average time-to-death values. The LC50 values estimated under direct immersion method ranged from 1.7 x 10(5) to 1.9 x 10(7), 3.5 x 10(4) to 5.3 x 10(5), and 4.1 x 10(3) to 2.9 x 10(5) conidia/ml for B. basissiana and from 3.2 x 10(6) to 1.1 x 10(7), 4.5 x 10(3) to 4.5 x 10(5), and 1.4 x 10(2) to 1.2 x 10(5) conidia/ml for M. anisopliae at 4, 5, and 6 d after treatment, respectively. By days 5 and 6, B. bassiana GHA outperformed all other isolates tested except ARSEF 7234, followed by ARSEF 7152, 6393, and 7180. Significant concentration-mortality response was also observed for two B. bassiana GHA formulations, BotaniGard ES and Mycotrol O, and M. anisopliae F52 when insects were treated through foliar exposure. The LC50 values ranged from 114.5 to 309.6, 18.4 to 797.3, and 345.3 to 362.0 conidia/cm2 for BotaniGard, Mycotrol, and M. anisopliae F52, respectively. Based on the results of these bioassays, the efficacy of both B. bassiana GHA formulations and M. anisopliae F52 were similar against adult A. planipennis. The potential use of entomopathogenic fungi for management of A. planipennis in North America is discussed. PMID:16937660

  10. Effect of moisture content and inoculum on the growth and conidia production by Beauveria bassiana on wheat bran

    OpenAIRE

    Oscar Nuñez-Gaona; Gerardo Saucedo-Castañeda; Raquel Alatorre-Rosas; Octavio Loera

    2010-01-01

    The aim of the present work was to study the effect of moisture content and inoculum on the growth and conidia production by Beauveria bassiana on wheat bran (WB).The highest growth rate of B. bassiana 885.2 on WB media was obtained at a w=1.0, with no detected growth at a w < 0.97. Solid-state fermentation (SSF) using WB (66% moisture; a w=1.0) achieved a maximal yield of 1.18x10 10 conidia per gram of dry substrate (gds). This yield decreased one order of magnitude with higher moisture cont...

  11. Optimization of Solid-State Fermentation for Improved Conidia Production of Beauveria bassiana as a Mycoinsecticide.

    Science.gov (United States)

    Pham, Tuan Anh; Kim, Jeong Jun; Kim, Keun

    2010-06-01

    The production of conidia of entomopathogenic Beauveria bassiana by solid-state fermentation was studied for the development of a biocontrol agent against aphid Myzus persicae. The optimal conditions for conidia production on polished white rice were 40% moisture content, 25℃ culture temperature, 2-day-old seeding culture grown in 3% corn meal, 2% rice bran, 2% corn steep powder medium, initial conidia concentration of 10(7) conidia/g in the wet rice, 10% inoculum size, and use of a polyethylene bag as a container. The polyethylene bag containing inoculated rice was hand-shaken every 12 hr during fermentation. Using optimal conditions, the maximum conidia production obtained was 4.05 g conidia/100 g dry rice after 14 days of cultivation, a rate 2.83 times higher than conidia yield of pre-optimization. PMID:23956642

  12. Natural Occurrence of Beauveria bassiana (Balsamo Vuillemin (Hyphomycetes: Moniliales on Anticarsia gemmatalis Hübner (Lepidoptera: Noctuidae in the State of Mato Grosso do Sul

    Directory of Open Access Journals (Sweden)

    Camila Rossoni

    2013-07-01

    Resumo. Relata-se a ocorrência natural de um fungo entomopatogênico sobre a lagarta Anticarsia gemmatalis Hübner (Lepidoptera: Noctuidae em uma área de soja convencional situada no município de Dourados, Mato Grosso do Sul. A lagarta foi coletada a campo e levada ao laboratório de microbiologia da Universidade Federal da Grande Dourados (UFGD, onde permaneceu em câmera úmida por aproximadamente 7 dias. Posteriormente, o fungo foi isolado em meio de cultura (BDA para identificação da espécie do entomopatógeno. O fungo foi identificado como Beauveria bassiana (Balsamo Vuillemin (Hyphomycetes: Moniliales e, isso representa o primeiro registro de parasitismo, dessa espécie, sobre a lagarta-da-soja no Estado de Mato Grosso do Sul.

  13. Biological Control of Aphid Using Fungal Culture and Culture Filtrates of Beauveria bassiana.

    Science.gov (United States)

    Kim, Jeong Jun; Jeong, Gayoung; Han, Ji Hee; Lee, Sangyeob

    2013-12-01

    Aphids are one of the most destructive pests in crop production such as pepper, cucumber, and eggplants. The importance of entomopathogenic fungi as alternative pest control agents is increasing. Conidia of entomopathogenic fungi are influenced by environmental conditions, such as temperature and relative humidity, and cause slow and fluctuating mortality. These factors have prevented wider application and use of biocontrol agents. For investigation of means of mitigation of such problems, we conducted bioassays with 47 fungal culture filtrates in order to evaluate the potential of secondary metabolites produced by entomopathogenic fungi for use in aphid control. Among 47 culture filtrates cultured potato dextrose broth, filtrate of Beauveria bassiana Bb08 showed the highest mortality (78%) against green peach aphid three days after treatments. Filtrate of Bb08 cultured in Adamek's medium showed higher toxicity as 100% to third instar nymphs of the aphid compared with seven other filtrates cultured in different broths amended with colloidal chitin or oil. The culture filtrates and fungal cultures from media amended with colloidal chitin or oil had lower control efficacies than filtrates without these additives in three different media. These results indicate that the fungal culture fluid or culture filtrate of B. bassiana Bb08 cultured in Adamek's medium has potential for development as a mycopesticide for aphid control. PMID:24493943

  14. Sterile Males of Ceratitis Capitata (Diptera: Tephritidae) as Disseminators of Beauveria Bassiana Conidia for IPM Strategies

    International Nuclear Information System (INIS)

    Full text: Sterile Mediterranean fruit fly, Ceratitis capitata (Wied.), males were evaluated as vectors to spread Beauveria bassiana (Bals) conidia to wild C. capitata populations under field conditions. The inoculated sterile males were released by air, using the chilled adult technique over 7000 ha of coffee growing in Chimaltenango, Guatemala, Central America. The impact of releases was determined using dry traps baited with a food attractant. The effects of these releases on Apis mellifera, Linnaeus (honey bee), Hypothenemus hampei, Ferrari (coffee berry borer) and the parasitic mite Varroa destructor (Oudeman) were also evaluated. Inoculated sterile males were able to transmit fungal spores to 44% of the wild C. capitata flies captured in traps, which likely were infected through intra- and intersexual interactions during leks, mating or mating attempts. There was no transmission of the fungal spores to non- target insect species such as coffee berry borer, honey bees or varroa. We conclude that sterile males of Mediterranean fruit fly inoculated with B. bassiana can act as effective vectors of conidia to wild populations, constituting a safe, environmentally friendly and selective alternative for suppressing the medfly under a Sterile Insect Technique-based IPM approach. (author)

  15. Beauveria bassiana Lipase A expressed in Komagataella (Pichia pastoris with potential for biodiesel catalysis

    Directory of Open Access Journals (Sweden)

    Ana Claudia Vici

    2015-10-01

    Full Text Available Lipases (EC 3.1.1.3 comprise a biotechnologically important group of enzymes because they are able to catalyze both hydrolysis and synthesis reactions, depending on the amount of water in the system. One of the most interesting application of lipase is in the biofuel industry for biodiesel production by oil and ethanol (or methanol transesterification. Entomopathogenic fungi, which are potential source of lipases, are still poorly explored in biotechnological processes. The present work reports the heterologous expression and biochemical characterization of a novel Beauveria bassiana lipase with potential for biodiesel production. The His-tagged B. bassiana lipase A (BbLA was produced in Komagataella pastoris in Buffered Methanol Medium (BMM induced with 1% methanol at 30 °C. Purified BbLA was activated with 0.05% Triton X-100 and presented optimum activity at pH 6.0 and 50°C. N-glycosylation of the recombinant BbLA accounts for 31.5% of its molecular weight. Circular dichroism and molecular modeling confirmed a structure composed of α-helix and β-sheet, similar to α/β hydrolases. Immobilized BbLA was able to promote transesterification reactions in fish oil, demonstrating potential for biodiesel production. BbLA was successfully produced in Komagataella pastoris and shows potential use for biodiesel production by the ethanolysis reaction.

  16. Beauveria bassiana Lipase A expressed in Komagataella (Pichia) pastoris with potential for biodiesel catalysis

    Science.gov (United States)

    Vici, Ana C.; da Cruz, Andrezza F.; Facchini, Fernanda D. A.; de Carvalho, Caio C.; Pereira, Marita G.; Fonseca-Maldonado, Raquel; Ward, Richard J.; Pessela, Benevides C.; Fernandez-Lorente, Gloria; Torres, Fernando A. G.; Jorge, João A.; Polizeli, Maria L. T. M.

    2015-01-01

    Lipases (EC 3.1.1.3) comprise a biotechnologically important group of enzymes because they are able to catalyze both hydrolysis and synthesis reactions, depending on the amount of water in the system. One of the most interesting applications of lipase is in the biofuel industry for biodiesel production by oil and ethanol (or methanol) transesterification. Entomopathogenic fungi, which are potential source of lipases, are still poorly explored in biotechnological processes. The present work reports the heterologous expression and biochemical characterization of a novel Beauveria bassiana lipase with potential for biodiesel production. The His-tagged B. bassiana lipase A (BbLA) was produced in Komagataella pastoris in buffered methanol medium (BMM) induced with 1% methanol at 30°C. Purified BbLA was activated with 0.05% Triton X-100 and presented optimum activity at pH 6.0 and 50°C. N-glycosylation of the recombinant BbLA accounts for 31.5% of its molecular weight. Circular dichroism and molecular modeling confirmed a structure composed of α-helix and β-sheet, similar to α/β hydrolases. Immobilized BbLA was able to promote transesterification reactions in fish oil, demonstrating potential for biodiesel production. BbLA was successfully produced in K. pastoris and shows potential use for biodiesel production by the ethanolysis reaction. PMID:26500628

  17. Proteins in the Cocoon of Silkworm Inhibit the Growth of Beauveria bassiana.

    Science.gov (United States)

    Guo, Xiaomeng; Dong, Zhaoming; Zhang, Yan; Li, Youshan; Liu, Huawei; Xia, Qingyou; Zhao, Ping

    2016-01-01

    Silk cocoons are composed of fiber proteins (fibroins) and adhesive glue proteins (sericins), which provide a physical barrier to protect the inside pupa. Moreover, other proteins were identified in the cocoon silk, many of which are immune related proteins. In this study, we extracted proteins from the silkworm cocoon by Tris-HCl buffer (pH7.5), and found that they had a strong inhibitory activity against fungal proteases and they had higher abundance in the outer cocoon layers than in the inner cocoon layers. Moreover, we found that extracted cocoon proteins can inhibit the germination of Beauveria bassiana spores. Consistent with the distribution of protease inhibitors, we found that proteins from the outer cocoon layers showed better inhibitory effects against B. bassiana spores than proteins from the inner layers. Liquid chromatography-tandem mass spectrometry was used to reveal the extracted components in the scaffold silk, the outermost cocoon layer. A total of 129 proteins were identified, 30 of which were annotated as protease inhibitors. Protease inhibitors accounted for 89.1% in abundance among extracted proteins. These protease inhibitors have many intramolecular disulfide bonds to maintain their stable structure, and remained active after being boiled. This study added a new understanding to the antimicrobial function of the cocoon. PMID:27032085

  18. Effect of biofertilizers and neem oil on the entomopathogenic fungi beauveria bassiana (Bals.) vuill. and metarhizium anisopliae (Metsch.) sorok.

    OpenAIRE

    Hirose Edson; Neves Pedro M. O. J.; Zequi João A. C.; Martins Luís H.; Peralta Cristiane H.; Moino Jr. Alcides

    2001-01-01

    The in vitro fungitoxic effect of three biofertilizers, E.M.-4, Multibion Ô and Supermagro used in organic agriculture and the neem oil (Azadirachta indica A. Juss) on the entomopathogenic fungi Metarhizium anisopliae and Beauveria bassiana was studied. These products were mixed in a medium where the two fungi were inoculated, and germination, vegetative growth and conidiogenesis were assessed. The biofertilizers Supermagro and E.M.- 4 showed to be less toxic for the two fungi whereas Multibi...

  19. Diversity of Fungi Associated with Atta bisphaerica (Hymenoptera: Formicidae): The Activity of Aspergillus ochraceus and Beauveria bassiana

    OpenAIRE

    Ribeiro, Myriam M. R.; Karina D. Amaral; Vanessa E. Seide; Souza, Bressane M. R.; Della Lucia, Terezinha M. C.; Maria Catarina M. Kasuya; Danival J. de Souza

    2012-01-01

    The grass-cutting ant Atta bisphaerica is one of the most serious pests in several pastures and crops in Brazil. Fungal diseases are a constant threat to these large societies composed of millions of closely related individuals. We investigated the occurrence of filamentous fungi associated with the ant A. bisphaerica in a pasture area of Viçosa, Minas Gerais State, Brazil. Several fungi species were isolated from forager ants, and two of them, known as entomopathogenic, Beauveria bassiana an...

  20. Screening of liquid media and fermentation of an endophytic Beauveria bassiana strain in a bioreactor.

    Science.gov (United States)

    Lohse, Rieke; Jakobs-Schönwandt, Desiree; Patel, Anant V

    2014-01-01

    A novel approach for biological control of insect pests could be the use of the endophytic entomopathogenic Beauveria bassiana isolate ATP-02. For the utilization of the endophyte as a commercial biocontrol agent, the fungus has to be mass-produced. B. bassiana was raised in shake flask cultures to produce high concentrations of total spores (TS), which include blastospores (BS) and submerged conidiospores (SCS). The highest concentration of 1.33×10(9) TS/mL and the highest yield of 5.32×10(10) TS/g sucrose was obtained in the TKI broth with 5% sugar beet molasses which consists of 50% sucrose as a carbon source. In spite of the lower sugar concentration (2.5%) the amount of TS could be increased up to 11-times in contrast to the cultivation with 5% sucrose. The scale-up to a 2 L stirred tank reactor was carried out at 25°C, 200-600 rpm and 1 vvm at pH 5.5. A TS yield of 5.2×10(10) TS/g sucrose corresponding to a SCS yield of 0.2×10(10) SCS/g sucrose was obtained after 216 h. With regards to the culture medium the cost of 10(12) TS amounts to 0.24 €. Plutella xylostella larvae, which were fed with oilseed rape leaves treated with spores from fermentation resulted in 77 ± 5% mortality. Moreover, spores from submerged cultivation were able to colonize oilseed rape leaves via leaf application. This is the first report of fermentation of an endophytic B. bassiana strain in a low-cost culture medium to very high yields of TS. PMID:24949278

  1. External development of the entomopathogenic fungi Beauveria bassiana and Metarhizium anisopliae in the subterranean termite Heterotermes tenuis Desenvolvimento dos fungos entomopatogênicos Beauveria bassiana E Metarhizium anisopliae no cupim subterrâneo Heterotermes tenuis

    Directory of Open Access Journals (Sweden)

    Alcides Moino Jr.

    2002-06-01

    ao efeito do comportamento dos insetos sobre entomopatógenos. O objetivo deste trabalho foi descrever o desenvolvimento de Beauveria bassiana e Metarhizium anisopliae sobre H. tenuis por meio da Microscopia Eletrônica de Varredura (MEV, determinando a duração das fases de infecção fúngica. Também foram avaliadas duas técnicas de fixação para o preparo de amostras para MEV. Operários de H. tenuis foram inoculados com suspensões fúngicas de 1 x 10(9 conídios mL-1 e mantidos a 25 ± 1ºC e umidade relativa de 70 ± 10%. Foram coletados insetos de 0 a 144 horas após a inoculação e preparados pelas duas técnicas de fixação. Foram comparados os resultados obtidos com as duas técnicas e estimadas e comparadas as durações das fases do processo de infecção para três isolados fúngicos por meio de observações em MEV. B. bassiana e M. anisopliae têm ciclos de desenvolvimento semelhantes sobre H. tenuis, mas algumas diferenças importantes existem. As fases de penetração, colonização e conidiogênese são relativamente mais rápidas para M. anisopliae que para B. bassiana, o que resulta em uma taxa mais rápida de mortalidade do inseto. A técnica de fixação com vapor de OsO4 é satisfatória para preparação de insetos para observação do desenvolvimento de fungos entomopatogênicos em MEV.

  2. Genetic analyses place most Spanish isolates of Beauveria bassiana in a molecular group with word-wide distribution

    Directory of Open Access Journals (Sweden)

    Quesada-Moraga Enrique

    2011-04-01

    Full Text Available Abstract Background The entomopathogenic anamorphic fungus Beauveria bassiana is currently used as a biocontrol agent (BCA of insects. Fifty-seven Beauveria bassiana isolates -53 from Spain- were characterized, integrating group I intron insertion patterns at the 3'-end of the nuclear large subunit ribosomal gene (LSU rDNA and elongation factor 1-alpha (EF1-α phylogenetic information, in order to assess the genetic structure and diversity of this Spanish collection of B. bassiana. Results Group I intron genotype analysis was based on the four highly conserved insertion sites of the LSU (Ec2653, Ec2449, Ec2066, Ec1921. Of the 16 possible combinations/genotypes, only four were detected, two of which were predominant, containing 44 and 9 members out of 57 isolates, respectively. Interestingly, the members of the latter two genotypes showed unique differences in their growth temperatures. In follow, EF1-α phylogeny served to classify most of the strains in the B. bassiana s.s. (sensu stricto group and separate them into 5 molecular subgroups, all of which contained a group I intron belonging to the IC1 subtype at the Ec1921 position. A number of parameters such as thermal growth or origin (host, geographic location and climatic conditions were also examined but in general no association could be found. Conclusion Most Spanish B. bassiana isolates (77.2% are grouped into a major phylogenetic subgroup with word-wide distribution. However, high phylogenetic diversity was also detected among Spanish isolates from close geographic zones with low climatic variation. In general, no correlation was observed between the molecular distribution and geographic origin or climatic characteristics where the Spanish B. bassiana isolates were sampled.

  3. Preservation of beauveria bassiana (balsam) vuillemin (moniliales: moniliaceae) pathogenicityagainst the coffee borer in different systems

    OpenAIRE

    T. Bahamón; E. Aycardi; Orozco, J; Marín, P. (Pedro); Bustillo, A.

    2011-01-01

    Este trabajo tiene como objetivo evaluar técnicas de preservación de patogenicidad en el laboratorio, que permitan almacenar por tiempos prolongados cultivos de B. bassiana de manera que se puedan utilizar en la preparación de un producto industrial sin tener que recurrir tan frecuentemente a pases sobre poblaciones de Hypothenemus hampei (Ferrari) (Coleóptera: Scolytidae) para mantener su efectividad en el control de esta plaga. Existen numerosos trabajos sobre la preservación de la viabilid...

  4. Improving Efficacy of Beauveria bassiana against Stored Grain Beetles with a Synergistic Co-Formulant.

    Science.gov (United States)

    Storm, Clare; Scoates, Freya; Nunn, Adam; Potin, Olivier; Dillon, Aoife

    2016-01-01

    The potential of a dry powder co-formulant, kaolin, to improve the control of storage beetles by the entomopathogenic fungus Beauveria bassiana, isolate IMI389521, was investigated. The response of Oryzaephilus surinamensis adults to the fungus when applied to wheat at 1 × 10(10) conidia per kg with and without kaolin at 1.74 g per kg wheat was assessed. Addition of kaolin increased control from 46% to 88% at day 7 and from 81% to 99% at day 14 post-treatment. Following this the dose response of O. surinamensis and Tribolium confusum to both kaolin and the fungus was investigated. Synergistic effects were evident against O. surinamensis at ≥0.96 g of kaolin per kg of wheat when combined with the fungus at all concentrations tested. For T. confusum, adult mortality did not exceed 55%, however, the larvae were extremely susceptible with almost complete suppression of adult emergence at the lowest fungal rate tested even without the addition of kaolin. Finally, the dose response of Sitophilus granarius to the fungus at 15 and 25 °C, with and without kaolin at 1 g per kg of wheat, was examined. Improvements in efficacy were achieved by including kaolin at every fungal rate tested and by increasing the temperature. Kaolin by itself was not effective, only when combined with the fungus was an effect observed, indicating that kaolin was having a synergistic effect on the fungus. PMID:27571107

  5. Susceptibility of the Parasitoid Phymastichus coffea LaSalle (Hymenoptera: Eulophidae) to Beauveria bassiana under laboratory conditions; Susceptibilidad del parasitoide Phymastichus coffea LaSalle (Hymenoptera:Eulophidae) a Beauveria bassiana en condiciones de laboratorio

    Energy Technology Data Exchange (ETDEWEB)

    Castillo, Alfredo; Gomez, Jaime; Infante, Francisco [El Colegio de la Frontera Sur (ECOSUR), Chiapas (Mexico). Dept. de Entomologia Tropical], e-mail: acastill@ecosur.mx, e-mail: jgomez@ecosur.mx, e-mail: finfante@ecosur.mx; Vega, Fernando E. [United States Department of Agriculture (USDA), Beltsville, MD (United States). Agricultural Research Service. Sustainable Perennial Crops Lab.], e-mail: fernando.vega@ars.usda.gov

    2009-09-15

    The coffee berry borer, Hypothenemus hampei (Ferrari) (Coleoptera: Curculionidae), is the most important coffee pest worldwide. Beauveria bassiana is a generalist entomopathogenic fungus widely used by coffee farmers to control this pest and Phymastichus coffea LaSalle (Hymenoptera: Eulophidae) is an African endo parasitoid of H. hampei adults, recently imported to several Latin American and Caribbean countries to aid in the coffee berry borer control. The objective of this study was to determine if B. bassiana is detrimental to P. coffea. The susceptibility of the parasitoid was evaluated in terms of adult survivorship, mean lethal concentration (LC{sub 50}), mean lethal time (LT{sub 50}), reproduction and immature mortality. The main effect of the fungus resulted in reduction of adult longevity and mortality of 100% for immature stages of this parasitoid. The LC{sub 50} for adults was 0.11% equivalent to 9.53 x 10{sup 7} conidia/ml of B. bassiana and a LT{sub 50} of 29.4 h, equivalent to reduction of 22% of its normal longevity as an adult. P. coffea was capable of disseminating spores of B. bassiana to non-infected H. hampei adults, which could indirectly cause the death of its own progeny. These results could be valuable when considering the use of both organisms in the field, especially in an integrated pest management program. (author)

  6. Effect of Biofertilizers and Neem Oil on the Entomopathogenic Fungi Beauveria bassiana (Bals. Vuill. and Metarhizium anisopliae (Metsch. Sorok

    Directory of Open Access Journals (Sweden)

    Hirose Edson

    2001-01-01

    Full Text Available The in vitro fungitoxic effect of three biofertilizers, E.M.-4, Multibion Ô and Supermagro used in organic agriculture and the neem oil (Azadirachta indica A. Juss on the entomopathogenic fungi Metarhizium anisopliae and Beauveria bassiana was studied. These products were mixed in a medium where the two fungi were inoculated, and germination, vegetative growth and conidiogenesis were assessed. The biofertilizers Supermagro and E.M.- 4 showed to be less toxic for the two fungi whereas MultibionÔ caused major inhibition on M. anisopliae, with reductions in germination (-37.74%, colony diameter (-30.26% and conidiogenesis (-42.62%. Neem oil promoted a larger negative effect on B. bassiana, inhibiting germination (-45.27%, colony diameter (-36.62% and conidiogenesis (-84.93%.

  7. Susceptibility of the Parasitoid Phymastichus coffea LaSalle (Hymenoptera: Eulophidae) to Beauveria bassiana under laboratory conditions

    International Nuclear Information System (INIS)

    The coffee berry borer, Hypothenemus hampei (Ferrari) (Coleoptera: Curculionidae), is the most important coffee pest worldwide. Beauveria bassiana is a generalist entomopathogenic fungus widely used by coffee farmers to control this pest and Phymastichus coffea LaSalle (Hymenoptera: Eulophidae) is an African endo parasitoid of H. hampei adults, recently imported to several Latin American and Caribbean countries to aid in the coffee berry borer control. The objective of this study was to determine if B. bassiana is detrimental to P. coffea. The susceptibility of the parasitoid was evaluated in terms of adult survivorship, mean lethal concentration (LC50), mean lethal time (LT50), reproduction and immature mortality. The main effect of the fungus resulted in reduction of adult longevity and mortality of 100% for immature stages of this parasitoid. The LC50 for adults was 0.11% equivalent to 9.53 x 107 conidia/ml of B. bassiana and a LT50 of 29.4 h, equivalent to reduction of 22% of its normal longevity as an adult. P. coffea was capable of disseminating spores of B. bassiana to non-infected H. hampei adults, which could indirectly cause the death of its own progeny. These results could be valuable when considering the use of both organisms in the field, especially in an integrated pest management program. (author)

  8. Establishment of fungal entomopathogens Beauveria bassiana and Bionectria ochroleuca (Ascomycota: Hypocreales) as endophytes on artichoke Cynara scolymus.

    Science.gov (United States)

    Guesmi-Jouini, J; Garrido-Jurado, I; López-Díaz, C; Ben Halima-Kamel, M; Quesada-Moraga, E

    2014-06-01

    Entomopathogenic fungi (EPF) are commonly found in diverse habitats and are known to cause mycoses in many different taxa of arthropods. Various unexpected roles have been recently reported for fungal entomopathogens, including their presence as fungal endophytes, plant disease antagonists, rhizosphere colonizers and plant growth promoting fungi. In Tunisia, a wide range of indigenous EPF isolates from different species, such as Beauveria bassiana and Bionectria ochroleuca, were found to occur in the soil, and to be pathogenic against the artichoke aphid Capitophorus elaeagni (Hemiptera: Aphididae). Since endophytic fungi are recently regarded as plant-defending mutualists and their presence in internal plant tissue has been discussed as an adaptive protection against insects, we were interested on elucidating the possible endophytic behavior of B. bassiana and B. ochroleuca on artichoke, Cynara scolymus, after foliar spraying tehcnique. The leaf spray inoculation method was effective in introducing the inoculated fungi into the plant tissues and showed, then, an endophytic activity on artichoke even 10 days later. According S-N-K test, there was significant differences between the two fungal treatments, B. ochroleuca (84% a) and B. bassiana (78% a), and controls (0% b). Likewise, the inoculated entomopathogenic fungi were also isolated from new leaves even though with significant differences respectively between controls (0% c), B. bassiana (56% b) and B. ochroleuca (78% a). These results reveals significant new data on the interaction of inoculated fungi with artichoke plant as ecological roles that can be exploited for the protection of plants. PMID:24681358

  9. [Susceptibility of the parasitoid Phymastichus coffea LaSalle (Hymenoptera: Eulophidae) to Beauveria bassiana under laboratory conditions].

    Science.gov (United States)

    Castillo, Alfredo; Gómez, Jaime; Infante, Francisco; Vega, Fernando E

    2009-01-01

    The coffee berry borer, Hypothenemus hampei (Ferrari) (Coleoptera: Curculionidae), is the most important coffee pest worldwide. Beauveria bassiana is a generalist entomopathogenic fungus widely used by coffee farmers to control this pest and Phymastichus coffea LaSalle (Hymenoptera: Eulophidae) is an African endoparasitoid of H. hampei adults, recently imported to several Latin American and Caribbean countries to aid in the coffee berry borer control. The objective of this study was to determine if B. bassiana is detrimental to P. coffea. The susceptibility of the parasitoid was evaluated in terms of adult survivorship, mean lethal concentration (LC50), mean lethal time (LT50), reproduction and immature mortality. The main effect of the fungus resulted in reduction of adult longevity and mortality of 100% for immature stages of this parasitoid. The LC50 for adults was 0.11% equivalent to 9.53 x 10(7) conidia/ml of B. bassiana and a LT50 of 29.4h, equivalent to reduction of 22% of its normal longevity as an adult. P. coffea was capable of disseminating spores of B. bassiana to non-infected H. hampei adults, which could indirectly cause the death of its own progeny. These results could be valuable when considering the use of both organisms in the field, especially in an integrated pest management program. PMID:19943017

  10. Potential of Metarrhizium anisopliae and Beauveria bassiana isolates and Neem oil to control the aphid Lipaphis erysimi (Kalt.) (Hemiptera: Aphididae)

    International Nuclear Information System (INIS)

    This work aimed to determine the efficiency of the entomopathogenic fungi Metarrhizium anisopliae and Beauveria bassiana to control the aphid Lipaphis erysimi (Kalt.) (Hemiptera:Aphididae) in kale Brassica oleracea var acephala D.C., as well as their compatibility with a neem oil formulation (NeemsetoR). Ten isolates of both fungi were tested and the most pathogenic ones were B. bassiana CG001 and M. anisopliae CG30 with 90% and 4.4 days, and 64% and 3.8 days of mortality and median lethal time, respectively. Bioassays with neem at concentrations of 0.5, 1.0 and 2.0% were done either by leaf discs dipping or spraying the aphids on the leaf discs. The neem spraying treatment at 2.0% provided 90% mortality. The use of B. bassiana isolate CG001 or M. anisopliae isolate CG30 with neem at 0.125, 0.25, and 0.5%, demonstrated that these isolates could have their spore viability or colony growth affected when exposed to neem concentrations higher than 0.25%. In absolute values, the isolates B. bassiana CG001 and M. anisopliae CG30 are the most virulent to L. erysimi, and could be utilized in the management of this pest. (author)

  11. Selection of Wetting Agent for Dried Conidia of two Beauveria bassiana Strains from Different Production Systems to Control Tarnished Plant Bugs

    Science.gov (United States)

    The hydrophilic–lipophilic balance (HLB) number was used to select surfactant, TDA (polyoxy-ethylene tridecyl ether) with a range of HLB numbers in formulation development of two Beauveria bassiana strains, NI8 and GHA produced from different systems. The results indicated that optimal HLB number of...

  12. Application of hydrophilic-lypophilic balance (HLB) number to optimize a compatible non-ionic surfactant for dried aerial conidia of Beauveria bassiana

    Science.gov (United States)

    The hydrophilic-lipophilic balance (HLB) number system was used to optimize a compatible non-ionic surfactant, TDA(polyoxyethylene tridecyl ether) in formulations for two Beauveria bassiana strains, NI8 and GHA. The optimal HLB number for TDA was determined on the basis of wetting times for conidia...

  13. Field Applications of Entomopathogenic Fungi Beauveria bassiana (Hypocreales: Clavicipitaceae) and Metarhizium anisopliae F52 (Hypocreales: Nectriaceae) for the Control of Ixodes scapularis (Acari: Ixodidae)

    Science.gov (United States)

    Two commercial formulations of Beauveria bassiana (Balsamo-Crivelli) Vuillemin were applied to residential sites in Old Lyme, Connecticut for the control of nymphs of the blacklegged tick, Ixodes scapularis in 1999 and 2000. The pyrethroid bifenthrin was applied to other homes for comparison with B....

  14. Two strains of Pseudomonas fluorscens bacteria differentially affect survivorship of waxworm (Galleria mellonella) larvae exposed to an arthropod fungal pathogen, Beauveria bassiana

    Science.gov (United States)

    Two strains of Pseudomonas fluorescens were found contaminating a biopesticide used in a previous study against Varroa destructor infestations in honey bee hives. In the aforementioned study the biopesticide, a formulation of the arthropod pathogen Beauveria bassiana, failed to have any impact on t...

  15. Integrated applications of Bacillus thuringiensis serovar. tenebrionis and Beauveria bassiana for biologically-based integrated pest management of Colorado potato beetle

    Science.gov (United States)

    Research conducted over the past decade has indicated a low level of synergism and potentially high degree of complementarity between Bacillus thuringiensis (Bt)- and Beauveria bassiana (Bb)-based biopesticides applied for management of the Colorado potato beetle, Leptinotarsa decemlineata. In view...

  16. Impact of two treatments of a formulation of Beauveria bassiana (Deuteromycota: Hyphomycetes) conidia on Varroa mites (Acari: Varroidae) and on honeybee (Hymenoptera: Apidae) colony health

    Science.gov (United States)

    Bee colonies in southern France were treated with conidia from 2 strains of Beauveria bassiana – one commercial (GHA) and the other isolated from Varroa mites in the region (Bb05002). Objectives were to evaluate treatment effect on colony weight, adult bee mass, capped brood, and on Varroa fall onto...

  17. Evaluation of kinetic parameters of chitinases produced by Beauveria bassiana (Bals. Vuill. / Avaliação de parâmetros cinéticos de quitinases produzidas por Beauveria bassiana (Bals. Vuill.

    Directory of Open Access Journals (Sweden)

    Cristiane Mita

    2008-07-01

    Full Text Available Entomopathogenic fungus Beauveria bassiana is currently used as a biocontrol agent for agricultural pests. The infection process involves extracellular enzymes such as proteases and chitinases that degrade the cuticle of the insects. The objective of this work was to evaluate kinetic parameters of pH, temperature, ionic concentration and time of reaction on chitinases activity. The fungus B. bassiana CG432 was cultivated on coffee berry borer Hypothenemus hampei (Ferrari and the conidia grown on insect were used to prepare the inoculum containing 108conídia/mL. These conidia were inoculated at 1% (v/v in culture liquid medium containing D-glucose (10g, yeast extract (5g, NaNO3 (1,58g, Na2HPO4.7H2O (1,05g, KCl (1g, MgSO4.7H2O (0,6g and KH2PO4 (0,36g per liter. The cultivation was carried at 28°C and 180rpm during 5 days. Culture fluid was obtained by filtration and centrifugation at 8.000g, and the chitinases were isolated and concentrated by ultrafiltration using 10 and 100kDa cut off membranes under nitrogen pressure. Chitinase activity was detected and quantified using N-acetylglucosamine released by hydrolysis of colloidal chitin at 40 to 60ºC, at 50, 100 and 200 mM ionic concentrations of buffers sodium acetate (pH 4.0 to 6.0; sodium phosphate (pH 6.0 to 8.0; and Glycine-NaOH (pH 8.0 to 10.0 during 60 minutes. Maximum chitinase activity was at 45ºC and pH 5.5, and was also high at pH 6.0 and pH 8.5 using 50mM buffer. The chitinase activity increased and was stable during an hour at optimum conditions of the reaction, shown the stable nature of this enzyme.Beauveria bassiana é um fungo entomopatogênico utilizado no controle biológico de insetos-praga que infestam produtos agrícolas. O mecanismo de infecção envolve a produção de enzimas extracelulares, como proteases e quitinases que degradam a cutícula dos insetos. O objetivo deste trabalho foi avaliar parâmetros cinéticos de pH, temperatura, concentração iônica e tempo de

  18. Laboratory evaluation of a native strain of Beauveria bassiana for controlling Dermanyssus gallinae (De Geer, 1778) (Acari: Dermanyssidae).

    Science.gov (United States)

    Immediato, Davide; Camarda, Antonio; Iatta, Roberta; Puttilli, Maria Rita; Ramos, Rafael Antonio Nascimento; Di Paola, Giancarlo; Giangaspero, Annunziata; Otranto, Domenico; Cafarchia, Claudia

    2015-09-15

    The poultry red mite, Dermanyssus gallinae (De Geer, 1778) (Acari: Dermanyssidae) is one of the most economically important ectoparasites of laying hens worldwide. Chemical control of this mite may result in environmental and food contamination, as well as the development of drug resistance. High virulence of Beauveria bassiana sensu lato strains isolated from naturally infected hosts or from their environment has been demonstrated toward many arthropod species, including ticks. However, a limited number of studies have assessed the use of B. bassiana for the control of D. gallinae s.l. and none of them have employed native strains. This study reports the pathogenicity of a native strain of B. bassiana (CD1123) against nymphs and adults of D. gallinae. Batches of nymph and adult mites (i.e., n=720 for each stage) for treated groups (TGs) were placed on paper soaked with a 0.1% tween 80 suspension of B. bassiana (CIS, 10(5), 10(7) and 10(9) conidia/ml), whilst 240 untreated control mites for each stage (CG) were exposed only to 0.1% tween 80. The mites in TG showed a higher mortality at all stages (p<0.01) when compared to CG, depending on the time of exposure and the conidial concentration. A 100% mortality rate was recorded using a CIS of 10(9) conidia/ml 12 days post infection (DPI) in adults and 14 DPI in nymphs. B. bassiana suspension containing 10(9) conidia/ml was highly virulent towards nymph and adult stages of D. gallinae, therefore representing a possible promising natural product to be used in alternative or in combination to other acaricidal compounds currently used for controlling the red mite. PMID:26206607

  19. Evaluation of a New Entomopathogenic Strain of Beauveria bassiana and a New Field Delivery Method against Solenopsis invicta

    Science.gov (United States)

    Li, Jun; Guo, Qiang; Lin, Miaofeng; Jiang, Lu; Ye, Jingwen; Chen, Dasong; Li, Zhigang; Dai, Jianqing; Han, Shichou

    2016-01-01

    Solenopsis invicta Buren is one of the most important pests in China, and control measures are mainly based on the use of synthetic pesticides, which may be inadequate and unsustainable. Hence, there is a growing interest in developing biological control alternatives for managing S. invicta, such as the use of entomopathogenic fungi. To facilitate the commercialization of entomopathogenic fungi against S. invicta, 10 Beauveria bassiana isolates originating from different hosts were tested for virulence in laboratory bioassays, and the most pathogenic strain, ZGNKY-5, was tested in field studies using an improved pathogen delivery system. The cumulative mortality rate reached 93.40% at 1×108 mL-1 conidia after 504 h. The germination and invasion of the spores were observed under a scanning electron microscope, and several conidia adhered to the cuticle of S. invicta after 2 h. Furthermore, the germ tubes of the conidia oriented toward the cuticle after 48 h, and the mycelium colonized the entire body after 96 h. Based on the efficacy observed in the laboratory trials, further experiments were performed with ZGNKY-5 strain to evaluate its utility in an injection control technology against S. invicta in the field. We found that three dosage treatments of ZGNKY-5 strain (500 mL, 750 mL, and 1,000 mL per nest) had significant control effects. Our results show that this strain of Beauveria bassiana and our control method were effective against S. invicta in both laboratory and field settings. PMID:27341441

  20. Glucose concentration alters dissolved oxygen levels in liquid cultures of Beauveria bassiana and affects formation and bioefficacy of blastospores.

    Science.gov (United States)

    Mascarin, Gabriel Moura; Jackson, Mark A; Kobori, Nilce Naomi; Behle, Robert W; Dunlap, Christopher A; Delalibera Júnior, Ítalo

    2015-08-01

    The filamentous fungus Beauveria bassiana is an economically important pathogen of numerous arthropod pests and is able to grow in submerged culture as filaments (mycelia) or as budding yeast-like blastospores. In this study, we evaluated the effect of dissolved oxygen and high glucose concentrations on blastospore production by submerged cultures of two isolates of B. bassiana, ESALQ1432 and GHA. Results showed that maintaining adequate dissolved oxygen levels coupled with high glucose concentrations enhanced blastospore yields by both isolates. High glucose concentrations increased the osmotic pressure of the media and coincided with higher dissolved oxygen levels and increased production of significantly smaller blastospores compared with blastospores produced in media with lower concentrations of glucose. The desiccation tolerance of blastospores dried to less than 2.6 % moisture was not affected by the glucose concentration of the medium but was isolate dependent. Blastospores of isolate ESALQ1432 produced in media containing 140 g glucose L(-1) showed greater virulence toward whitefly nymphs (Bemisia tabaci) as compared with blastospores produced in media containing 40 g glucose L(-1). These results suggest a synergistic effect between glucose concentration and oxygen availability on changing morphology and enhancing the yield and efficacy of blastospores of B. bassiana, thereby facilitating the development of a cost-effective production method for this blastospore-based bioinsecticide. PMID:25947245

  1. Metabolic responses of Beauveria bassiana to hydrogen peroxide-induced oxidative stress using an LC-MS-based metabolomics approach.

    Science.gov (United States)

    Zhang, Chen; Wang, Wei; Lu, Ruili; Jin, Song; Chen, Yihui; Fan, Meizhen; Huang, Bo; Li, Zengzhi; Hu, Fenglin

    2016-06-01

    The entomopathogenic fungus, Beauveria bassiana, is commonly used as a biological agent for pest control. Environmental and biological factors expose the fungus to oxidative stress; as a result, B. bassiana has adopted a number of anti-oxidant mechanisms. In this study, we investigated metabolites of B. bassiana that are formed in response to oxidative stress from hydrogen peroxide (H2O2) by using a liquid chromatography mass spectrometry (LC-MS) approach. Partial least-squares discriminant analysis (PLS-DA) revealed differences between the control and the H2O2-treated groups. Hierarchical cluster analysis (HCA) showed 18 up-regulated metabolites and 25 down-regulated metabolites in the H2O2-treated fungus. Pathway analysis indicated that B. bassiana may be able to alleviate oxidative stress by enhancing lipid catabolism and glycometabolism, thus decreasing membrane polarity and preventing polar H2O2 or ROS from permeating into fungal cells and protecting cells against oxidative injury. Meanwhile, most of the unsaturated fatty acids that are derived from glycerophospholipids hydrolysis can convert into oxylipins through autoxidation, which can prevent the reactive oxygen of H2O2 from attacking important macromolecules of the fungus. Results showed also that H2O2 treatment can enhance mycotoxins production which implies that oxidative stress may be able to increase the virulence of the fungus. In comparison to the control group, citric acid and UDP-N-acetylglucosamine were down-regulated, which suggested that metabolic flux was occurring to the TCA cycle and enhancing carbohydrate metabolism. The findings from this study will contribute to the understanding of how the molecular mechanisms of fungus respond to environmental and biological stress factors as well as how the manipulation of such metabolisms may lead to selection of more effective fungal strains for pest control. PMID:27116916

  2. Could Sterile Males be Used to Vector a Microbiological Control Agent? The Case of Rhynchophorus Ferrugineus and Beauveria Bassiana

    International Nuclear Information System (INIS)

    Full text: Rhynchophorus ferrugineus (Coleoptera, Curculionidae) is the most threatening pest of palms worldwide. The potential of gamma-irradiated males to spread a pathogenic strain of the entomopathogenic fungus Beauveria bassiana (Ascomycota: Clavicipitaceae) to control this pest was studied. First, the effects of gamma irradiation (15 and 25 Gy) on the mating success and performance of adult males irradiated at age one day were studied in the laboratory. Although male longevity decreased after irradiation (118.6 vs. 244.7 days for irradiated and control males, respectively) and their testes suffered from the treatment, fecundity of mated females did not depend on the irradiation status of the male (86.8±5.5 eggs in 15 days). However, egg hatching was significantly lower in couples with irradiated males (31.4% vs. 86.5% for irradiated and control couples, respectively), and this value decreased after a second mating (6.1% vs. 85.9%). Therefore, irradiation did not affect male sexual competiveness but sperm quality. Second, a semi-field assay was carried out to evaluate infestation in young Phoenix canariensis caused by different combinations of couples with irradiated and/or B. bassiana-challenged males. The number of immature stages found in infested palms was significantly higher when females mated with untreated males and lower when mated with irradiated males (either B. bassiana-infected or not). Some females from the fungus-challenged treatments showed post-mortem hyphal growth, and this horizontal transmission proves that irradiated males could act as a vector for B. bassiana and should be considered as a new method to improve the biological control of R. ferrugineus. (author)

  3. A molecular tool for detection and tracking of a potential indigenous Beauveria bassiana strain for managing emerald ash borer populations in Canada.

    Science.gov (United States)

    Johny, Shajahan; Kyei-Poku, George

    2014-10-01

    Emerald ash borer is an invasive species from Asia. Beauveria bassiana strain L49-1AA is being tested for the control of emerald ash borer in Canada, using an autocontamination trapping system. We have developed a simplified allele discrimination polymerase chain reaction (PCR) assay to screen B. bassiana strain, L49-1AA from other Beauveria species by targeting the inter-strain genetic differences in 5' end of EF1-α gene of the genus Beauveria. A single nucleotide polymorphism (SNP) site, T→C was identified only in L49-1AA and was used to develop a simplified allele discrimination polymerase chain reaction (PCR) assay based on a modified allelic inhibition of displacement activity (AIDA) approach for distinguishing B. bassiana L49-1AA from all background Beauveria isolates. The SNP site was employed to design inner primers but with a deliberate mismatch introduced at the 3' antepenultimate from the mutation site in order to maximize specificity and detection efficiency. Amplification was specific to L49-1AA without cross-reaction with DNA from other Beauveria strains. In addition, the designed primers were also tested against environmental samples in L49-1AA released plots and observed to be highly efficient in detecting and discriminating the target strain, L49-1AA from both pure and crude DNA samples. This new method can potentially allow for more discriminatory tracking and monitoring of released L49-1AA in our autocontamination and dissemination projects for managing EAB populations. Additionally, the modified-AIDA format has potential as a tool for simultaneously identifying and differentiating closely related Beauveria species, strains/isolates as well as general classification of other pathogens or organisms. PMID:25110340

  4. Diversity of Fungi Associated with Atta bisphaerica (Hymenoptera: Formicidae: The Activity of Aspergillus ochraceus and Beauveria bassiana

    Directory of Open Access Journals (Sweden)

    Myriam M. R. Ribeiro

    2012-01-01

    Full Text Available The grass-cutting ant Atta bisphaerica is one of the most serious pests in several pastures and crops in Brazil. Fungal diseases are a constant threat to these large societies composed of millions of closely related individuals. We investigated the occurrence of filamentous fungi associated with the ant A. bisphaerica in a pasture area of Viçosa, Minas Gerais State, Brazil. Several fungi species were isolated from forager ants, and two of them, known as entomopathogenic, Beauveria bassiana and Aspergillus ochraceus, were tested against worker ants in the laboratory. The two species were highly virulent, achieving 50 percent worker mortality within 4-5 days. It is the first time A. ochraceus, a commonly found fungal species, is reported to infect Atta species at a high prevalence. Possible uses for the fungus within biological control are discussed.

  5. Selection of Beauveria bassiana and Metarhizium anisopliae isolates for the control of Blissus antillus (Hemiptera: Lygaeidae Seleção de isolados Beauveria Bassiana e Metarhizium Anisopliae para o controle de Blissus Antillus

    Directory of Open Access Journals (Sweden)

    Richard Ian Samuels

    2004-06-01

    Full Text Available Chinch bugs of the genus Blissus (Hemiptera: Lygaeidae are serious pests of maize, wheat, sorghum and various grasses. This study is the first to screen isolates of Beauveria bassiana and Metarhizium anisopliae against 4th instar and adult Blissus antillus aiming to develop a biological control program for this important pasture pest. Ten fungal isolates were initially screened and three isolates were chosen for further investigation. To determine virulence, insects were inoculated by immersion in concentrations of 5 ´ 10(8 conidia mL-1. Mortality was evaluated for 10 days. B. bassiana ARSEF 792 was the most virulent isolate to both nymphs and adults, causing 53 and 78% infection, respectively, and values for LT50 of 7.8 and 5.0 days, respectively. Germination studies were carried out to confirm viability and determine speed of germination as a pathogenicity factor. The production of conidia on the cadavers of insects infected with the three selected isolates was determined. The production of conidia on rice media was also evaluated. B. bassiana CG 24 produced the highest number of conidia on insects cadavers (14.9 ´ 10(7 conidia per insect and also on rice media (10.6 ´ 10(9 conidia per g.Percevejos do gênero Blissus (Hemiptera: Lygeidae são pragas importantes das plantações de milho, trigo e sorgo e de vários tipos de gramíneos forrageiros. Esse estudo é o primeiro a amostrar isolados de Beauveria bassiana e Metarhizium anisopliae contra aos 4(0 instares e adultos de Blissus antillus com a finalidade de desenvolver um programa de controle biológico dessa importante praga de pastagens. Dez isolados foram inicialmente testados e três foram escolhidos para maiores investigações. Para determinar a virulência, os insetos foram inoculados por imersão em suspensões de conídios a uma concentração de 5 ´ 10(8 conídios mL-1. Mortalidade foi avaliada por 10 dias. B. bassiana ARSEF 792 foi o isolado mais virulento para as ninfas e os

  6. Controle associado de Alphitobius diaperinuse efeito de microrganismos eficazes no desenvolvimento de Beauveria bassiana Associated control of Alphitobius diaperinus and effect of effective microorganisms in the development of Beauveria bassiana

    Directory of Open Access Journals (Sweden)

    Patricia Helena Santoro

    2008-01-01

    Full Text Available O objetivo deste trabalho foi avaliar a eficiência de Beauveria bassiana (Bb, terra diatomácea (TD e microrganismos eficazes (EM-4, associados ou não, no controle de Alphitobius diaperinus, e o efeito de EM-4 no desenvolvimento de B. bassiana. Os agentes de controle (Bb, TD e EM-4, em diferentes concentrações e combinações, foram aplicados em uma mistura de cama-de-frango e ração, em que os insetos foram acondicionados por dez dias. Avaliaram-se, in vitro: a germinação, as unidades formadoras de colônia (UFC, o crescimento vegetativo e a produtividade de conídios de Bb em contato com suspensão aquosa de EM-4 (1% não filtrada e filtrada. Os maiores índices de mortalidade foram observados nos tratamentos TD + Bb + EM-4 e TD + Bb, nas maiores concentrações. Verificou-se efeito não-aditivo sinérgico para TD + Bb nas três concentrações. Nos testes com EM-4 filtrado, não houve diferença em relação à testemunha quanto à germinação e às UFC, entretanto, o crescimento vegetativo e a produtividade de conídios foram negativamente afetados. O uso conjunto de B. bassiana e terra diatomácea, para o manejo de populações de A. diaperinus, pode reduzir o uso de produtos químicos.The objective of this work was to evaluate Beauveria bassiana (Bb, diatomaceous earth (TD and effective microorganisms (EM-4, associated or not, to Alphitobius diaperinus control, and the EM-4 effect on B. bassiana development. The control agents (Bb, TD and EM-4, in different concentrations and combinations, were applied in a mixture of litter and chicken food, where insects had been left per ten days. Conidia germination, colony-forming units (CFU, vegetative growth and the productivity of Bb conidia were evaluated when in contact with a filtered and non filtered watery EM-4 suspension (1%. The highest indices of mortality were observed in the treatments TD + Bb + EM and TD + Bb in the highest concentrations. A synergic non additive effect was

  7. Evaluating the virulence of Metarhizium anisopliae (Deuteromycotina: Hyphomycetes and Beauveria bassiana (Ascomycota: Hypocreales isolates to Arabian rhinoceros beetle, Oryctes agamemnon arabicus

    Directory of Open Access Journals (Sweden)

    M.W. Khudhair

    2015-12-01

    Full Text Available Virulence of entomopathogenic fungi Metarhizium anisopliae and Beauveria bassiana were tested against Arabian Rhinoceros Beetle, Oryctes agamemnon arabicus larvae. Four concentrations (1×105, 1×107, 1×109 and 1×1011 conidia/mL–1 of two locally isolated entomopathogenic fungi spore suspensions were used in this study via larval direct spraying. Results revealed that both isolates can cause high mortality rate reaching 100% after 29 days. However, Beauveria bassiana scored higher mortality rate in short time especially at the concentration of 1×1011 conidia/ mL–1 with lethal time (LT50 12.75 and LT90 20.00; while, Metarhizium anisopliae caused the higher percentage of malformed adults. Moreover, both isolates affected insect’s life cycle particularly in the pupal stage which was reduced remarkably by almost 50% in comparison with the control treatment.

  8. Effect of moisture content and inoculum on the growth and conidia production by Beauveria bassiana on wheat bran

    Directory of Open Access Journals (Sweden)

    Oscar Nuñez-Gaona

    2010-08-01

    Full Text Available The aim of the present work was to study the effect of moisture content and inoculum on the growth and conidia production by Beauveria bassiana on wheat bran (WB.The highest growth rate of B. bassiana 885.2 on WB media was obtained at a w=1.0, with no detected growth at a w < 0.97. Solid-state fermentation (SSF using WB (66% moisture; a w=1.0 achieved a maximal yield of 1.18x10 10 conidia per gram of dry substrate (gds. This yield decreased one order of magnitude with higher moisture contents or the addition of sugarcane bagasse (SCB as a texturiser. In SSF using WB (66% humidity,the time to obtain a yield of 1x10(10 conidia/gds, referred to as t10, could be predicted using a model considering common inoculum levels and maximal yields. For instance, t10 was 285 h with an inoculum of 1x10(6 conidia/gds; however, t10 was reduced to 232 h and 148 for inocula of 7x10(6 and 5x10(7 conidia/gds, respectively. The estimation of t10 values allowed both comparison between the cultures and prediction of harvesting times in production processes. Values for hydrophobicity were within 90 and 92%, whereas viability averages were around 70% for all the cultures

  9. Evaluation of the pathogenicity of multiple isolates of Beauveria bassiana (Hypocreales: Clavicipitaceae) on Rhynchophorus ferrugineus (Coleoptera: Dryophthoridae) for the assessment of a solid formulation under simulated field conditions

    OpenAIRE

    Ricaño, Jorge; Güerri Agulló, Berenice; Serna Sarriás, María José; Rubio Llorca, Germán; Asensio Berbegal, Leticia; Barranco, Pablo; López Llorca, Luis Vicente

    2013-01-01

    A solid state formulation of Beauveria bassiana (Balsamo) Vuillemin has been developed for biological control of the Red Palm Weevil (RPW), Rhynchophorus ferrugineus (Olivier, 1790). Two kinds of bioassays (dry conidia and dipping) using 10 isolates from several coleopterans in Mediterranean environments, identified 2 RPW derived isolates (193 and 203) as most pathogenic to RPW larvae and adults (zero survival within first 4–5 d for dry conidia, and 14 and 23 d for dipping bioassays). Isolate...

  10. An attempt to use the fungus Beauveria bassiana (Bals.) Vuill. in forest protection against the bark beetle Ips typographus (L.) in the field

    OpenAIRE

    Grodzki Wojciech; Kosibowicz Mieczysław

    2015-01-01

    In 2011–2013, trials on the use of the entomopathogenic fungus Beauveria bassiana against bark beetle (Ips typographus) populations were carried out under open field conditions in Norway spruce stands suffering from an outbreak in the Beskid Żywiecki Mts. in Poland. Modified pheromone traps were deployed to capture and thereafter release fungus-infected bark beetles to the forest environment. Infested spruce trees felled next to the traps remained unaffected by the transmission of the fungus ...

  11. Laboratory bioassay of Beauveria bassiana against Tetranychus urticae (Acari: Tetranychidae) on leaf discs and potted bean plants.

    Science.gov (United States)

    Ullah, Mohammad Shaef; Lim, Un Taek

    2015-03-01

    Use of the mycopathogen Beauveria bassiana (strain GHA), marketed as BotaniGard(®) ES, was evaluated as a plant protection strategy against the spider mite Tetranychus urticae Koch, which is considered one of the most economically important and cosmopolitan pests of many crops. Tetranychus urticae were treated with four concentrations of conidia (1 × 10(5), 1 × 10(6), 1 × 10(7), or 1 × 10(8) conidia/ml), and virulence was assessed on mites held at four relative humidity levels (35, 55, 75, and 95 ± 2 % RH) at 25 ± 1 °C. At 1 × 10(8) spores/ml, the LT50 value was 9.7 h at 95 % RH, which was significantly lower than values for other RH levels. At 1 × 10(7) spores/ml, the LT50 value was 43.8 h at 95 % RH, which was significantly different from values at 55 and 35 % RH. The efficacy of B. bassiana product was also verified on mites infesting potted bean plants with a concentration of 1 × 10(8) spores/ml. In double spray treatment where applications were made 2 × on days 5 and 10 after mite infestation, the nymphal and adult population of T. urticae were reduced to zero on days 20 and 15, respectively. With a single spray on day 5, the nymphal population was also greatly reduced, but increased rapidly after day 20. Single and double sprays with B. bassiana reduced leaf damage as measured by image analysis by 33 and 94 % compared to no treatment, respectively. These results suggest that 1 × 10(8) spores/ml was the most effective dose and that two applications, at a 5-day interval, provided control of T. urticae in our laboratory assay. PMID:25500970

  12. Potential of two entomopathogenic fungi, Beauveria bassiana and Metarhizium anisopliae (Coleoptera: Scarabaeidae), as biological control agents against the June beetle.

    Science.gov (United States)

    Erler, Fedai; Ates, A Ozgur

    2015-01-01

    The aim of this study was to evaluate the effectiveness of the entomopathogenic fungi (EPF), Beauveria bassiana (Bals.) Vuill. (Deuteromycotina: Hyphomycetes) strain PPRI 5339 [BroadBand, an emulsifiable spore concentrate (EC) formulation] and Metarhizium anisopliae (Metsch.) Sorokin (Hypocreales: Clavicipitaceae) strain F52 [Met52, both EC and granular (GR) formulations] against the larvae of Polyphylla fullo (L.) (Coleoptera: Scarabaeidae). Larvicidal bioassays were performed in foam boxes (100 by 75 by 50 cm; length by width by height), containing moist soil medium with some humus and potato tubers as food. Although the B. bassiana product (min. 4 × 10(9) conidia/ml) was applied at 100, 150, and 200 ml/100 l water; M. anisopliae strain F52 was applied at 500, 1,000, and 1,500 g/m(3) of moist soil medium for GR (9 × 10(8) cfu/g) and 75, 100, and 125 ml/100 l water for EC (5.5 × 10(9) conidia/ml) formulation. Both fungi were pathogenic to larvae of the pest; however, young larvae (1st and 2nd instars) were more susceptible to infection than older ones (3rd instar). Mortality rates of young and older larvae varied with conidial concentration of both fungi and elapsed time after application. The B. bassiana product was more effective than both of the formulations of the M. anisopliae product, causing mortalities up to 79.8 and 71.6% in young and older larvae, respectively. The highest mortality rates of young and older larvae caused by the M. anisopliae product were 74.1 and 67.6% for the GR formulation, 70.2 and 61.8% for the EC formulation, respectively. These results may suggest that both fungi have potential to be used for management of P. fullo. PMID:25881632

  13. RAPD e ITS Detectan Variación Molecular en Poblaciones Chilenea de Beauveria bassiana RAPD and ITS Reveal Molecular Variation of Chilean Populations of Beauveria bassiana

    OpenAIRE

    Viviana Becerra V; Mario Paredes C.; Carmen Rojo M; Andrés France I

    2007-01-01

    Los hongos entomopatógenos son una alternativa atractiva para el control biológico de insectos plagas. En Chile, el Instituto de Investigaciones Agropecuarias (INIA), Centro Regional de Investigación Quilamapu mantiene aproximadamente 400 aislamientos de Beauveria, colectados a través del país. Esta colección ha sido parcialmente clasificada en base a su morfología y a su eficacia como controlador biológico. Sin embargo, es necesario complementar estos estudios con una caracterización a nivel...

  14. A Distinctive Pattern of Beauveria bassiana-biotransformed Ginsenoside Products Triggers Mitochondria/FasL-mediated Apoptosis in Colon Cancer Cells.

    Science.gov (United States)

    Gum, Sang Il; Rahman, Md Khalilur; Won, Jong Soon; Cho, Min Kyung

    2016-01-01

    Ginseng is one of the most commonly used adaptogens. Transformation into the minor ginsenosides produces compounds with more effective action. Beauveria bassiana, a teleomorph of Cordyceps bassiana, is a highly efficient producer of mammalian steroids and produces large amounts of sugar-utilizing enzymes. However, the fermentation of steroid glycosides in ginseng with B. bassiana has never been studied. Thus, we evaluated the bioconversion of the major ginsenosides in white ginseng by B. bassiana. Interestingly, B. bassiana increased the total amount of protopanaxadiols and hydrolyzed Rb1 into minor ginsenosides, exhibiting high levels of Rd and Rg3, as well as moderate levels of Rb2 and Rc analyzed by high-performance liquid chromatography coupled with evaporative light-scattering detection. The β-glucosidase activity was highly increased, which led to the selective elimination of sugar moiety at the 20-C position of Rb1 to Rd, followed by Rg3. Rb2 and Rc accumulated because of the minimal activities of α-L-arabinopyranosidase and α-L-arabinofuranosidase, respectively. The fermentation product exerted dose-dependent cytotoxicity in HCT-15 cells, which are resistant to ginseng. The product, but not white ginseng, exhibited apoptotic effects via the Fas ligand and caspase 8/9. This study demonstrates for the first time that the B. bassiana-fermented metabolites have potent apoptotic activity in colon cancer cells, linking to a therapeutic use. PMID:26609787

  15. Laboratory and semi-field evaluation of Beauveria bassiana (Ascomycota: Hypocreales) against the lettuce aphid, Nasonovia ribisnigri (Hemiptera: Aphididae)

    DEFF Research Database (Denmark)

    Shrestha, Govinda; Enkegaard, Annie; Steenberg, Tove

    2015-01-01

    The lettuce aphid, Nasonovia ribisnigri (Mosley), is an economically important pest of lettuce worldwide. The entomopathogenic fungus Beauveria bassiana strain GHA has recently been reported as a potential biocontrol candidate for use against the lettuce aphid. This study provides information on...... the mortality inflicted by B. bassiana when applied against different life stages of the lettuce aphid under laboratory conditions and how fungus infection affects the aphid fecundity. In addition, temporal changes in persistence of fungus inoculum applied to foliage of young lettuce plants under semi......-field conditions was analysed. Immature life stages were generally the least susceptible to fungal infection and the susceptibility of all stages was dose-dependent, with the highest mortality occurring at the highest dose. B. bassiana significantly affected the rate of nymph production by the lettuce aphid, with...

  16. Differential metabolic responses of Beauveria bassiana cultured in pupae extracts, root exudates and its interactions with insect and plant.

    Science.gov (United States)

    Luo, Feifei; Wang, Qian; Yin, Chunlin; Ge, Yinglu; Hu, Fenglin; Huang, Bo; Zhou, Hong; Bao, Guanhu; Wang, Bin; Lu, Ruili; Li, Zengzhi

    2015-09-01

    Beauveria bassiana is a kind of world-wide entomopathogenic fungus and can also colonize plant rhizosphere. Previous researches showed differential expression of genes when entomopathogenic fungi are cultured in insect or plant materials. However, so far there is no report on metabolic alterations of B. bassiana in the environments of insect or plant. The purpose of this paper is to address this problem. Herein, we first provide the metabolomic analysis of B. bassiana cultured in insect pupae extracts (derived from Euproctis pseudoconspersa and Bombyx mori, EPP and BMP), plant root exudates (derived from asparagus and carrot, ARE and CRE), distilled water and minimal media (MM), respectively. Principal components analysis (PCA) shows that mycelia cultured in pupae extracts and root exudates are evidently separated and individually separated from MM, which indicates that fungus accommodates to insect and plant environments by different metabolic regulation mechanisms. Subsequently, orthogonal projection on latent structure-discriminant analysis (OPLS-DA) identifies differential metabolites in fungus under three environments relative to MM. Hierarchical clustering analysis (HCA) is performed to cluster compounds based on biochemical relationships, showing that sphingolipids are increased in BMP but are decreased in EPP. This observation further implies that sphingolipid metabolism may be involved in the adaptation of fungus to different hosts. In the meantime, sphingolipids are significantly decreased in root exudates but they are not decreased in distilled water, suggesting that some components of the root exudates can suppress sphingolipid to down-regulate sphingolipid metabolism. Pathway analysis finds that fatty acid metabolism is maintained at high level but non-ribosomal peptides (NRP) synthesis is unaffected in mycelia cultured in pupae extracts. In contrast, fatty acid metabolism is not changed but NRP synthesis is high in mycelia cultured in root exudates

  17. Compatibility of Beauveria bassiana with Neoseiulus barkeri for Control of Frankliniella occidentalis

    Institute of Scientific and Technical Information of China (English)

    WU Sheng-yong; GAO Yu-lin; XU Xue-nong; Mark S Goettel; LEI Zhong-ren

    2015-01-01

    The entomopathogenic fungusBeauveriabassiana (Balsamo) Vuilemin and predatory miteNeoseiulusbarkeri Hughes are effective biological control agents ofFranklinielaoccidentalis Pergande (Thysanoptera: Thripidae), one of the most important pests of ornamentals and vegetables world-wide. Combined application of both may enhance control efifciency. The functional response forN.barkeri on the ifrst instar larvae of western lfower thrips which were infected byB.bassiana for 12 and 24 h in the laboratory ((25±1)°C, (70±5)% RH, L:D=16 h:8 h) was determined. The virulence ofB.bassiana against the second instar and pupae of the thrips attacked byN.barkeri were also tested. The results showed that N.barkeri exhibited a Holing type II functional response on treated thrips. After having been treated with the fungus for 12 h and then offered to the predator, thrips were more vulnerable to be kiled byN.barkeri. The second instar larvae and pupae of the thrips which had been attacked by predatory mites were markedly more susceptible toB.bassiana infection than normal thrips; the cumulative corrected mortality ofB.bassiana of the second instar and pupae which were attacked byN.barkeri were 57 and 94%, respectively, compared to 35 and 80% in controls on the day 8. These ifndings highlight the potential use ofB.bassiana in combination withN.barkeri to controlF. occidentalis.

  18. Patogenicidade de Beauveria bassiana ao psilídeo Diaphorina citri e compatibilidade do fungo com produtos fitossanitários Beauveria bassiana pathogenicity to Diaphorina citri and compatibility of the fungus with phytosanitary products

    Directory of Open Access Journals (Sweden)

    Ana Paula Ferreira Pinto

    2012-12-01

    Full Text Available O objetivo deste trabalho foi avaliar a patogenicidade de Beauveria bassiana a ninfas de Diaphorina citri (Hemiptera: Psyllidae e verificar a compatibilidade do fungo com produtos fitossanitários e sua persistência em plantas de citros. Ninfas de D. citri foram pulverizadas com B. bassiana, nas concentrações 5x10(6, 1x10(7, 5x10(7, 1x10(8, 5x10(8 e 1x10(9 conídios mL-1, para determinação da concentração letal. Para avaliação da compatibilidade do fungo com produtos fitossanitários, extrato de nim e cinco inseticidas de quatro grupos químicos diferentes foram incorporados individualmente ao meio de cultura BDA em que o fungo foi cultivado. Avaliaram-se o crescimento vegetativo, a esporulação e a viabilidade do entomopatógeno. Plantas de citros, mantidas em casa de vegetação, foram tratadas primeiramente com os produtos fitossanitários e depois com o entomopatógeno. Avaliaram-se os tempos de exposição de 24 horas e de 7 e 14 dias. O fungo foi patogênico às ninfas de D. citri; a CL50 foi de 0,4x10(7 e a CL90 de 6,7x10(7 conidios mL-1, no décimo dia de avaliação. Em laboratório, os produtos fitosssanitários reduzem o crescimento do fungo. Em casa de vegetação, os produtos não afetam a sobrevivência do fungo nas plantas de citros.The objective of this work was to evaluate the pathogenicity of Beauveria bassiana to Diaphorina citri (Hemiptera: Psyllidae nymphs, and to check the compatibility of the fungus with phytosanitary products, and its persistence in citrus plants. Nymphs of D. citri were sprayed with B. bassiana in the concentrations 5x10(6, 1x10(7, 5x10(7, 1x10(8, 5x10(8 and 1x10(9 conidia mL-1 for lethal concentration determination. In order to evaluate the compatibility of the phytosanitary products with the fungus, neem extract and five insecticides of four different chemical groups were individually added to PDA culture medium, in which the fungus was cultivated. Vegetative growth, sporulation and viability

  19. Estimation of Median Lethal Concentration of Three Isolates of Beauveria bassiana for Control of Megacopta cribraria (Heteroptera: Plataspidae) Bioassayed on Solid Lygus spp. Diet.

    Science.gov (United States)

    Portilla, Maribel; Jones, Walker; Perera, Omaththage; Seiter, Nick; Greene, Jeremy; Luttrell, Randall

    2016-01-01

    The kudzu bug, Megacopta cribraria (F.), is an urban nuisance and significant agricultural pest. The median lethal concentrations of three strains of Beauveria bassiana (Balsamo), including the Mississippi Delta native strain (NI8) isolated from Lygus lineolaris (Palisot de Beauvois), the commercial strain BotaniGard(®) (GHA) (Victor, NY, USA), and the B. bassiana strain isolated from M. cribraria (KUDSC), were estimated on kudzu bug adults. A technique developed to evaluate B. bassiana against L. lineolaris was used. Younger adults (eight days after collection) were treated with NI8 and GHA and older adult (50 days after collection) were treated with NI8, GHA and KUDSC. Higher concentrations (n × 10⁶, n × 10⁷) of NI8 and GHA caused kudzu bug mortality two days after treatment in younger adults and similar concentrations of NI8, GHA, and KUDSC caused mortality one day after treatment in older adults. Lower concentrations (n × 10⁴, n × 10⁵) were not significantly different in mortality between strains. LS50 values of the KUDSC were significantly lower than NI8 and GHA values in older adults. This is the first available information on median lethal concentration of B. bassiana on kudzu bug adults bioassayed on artificial diet. It was determined that B. bassiana (KUDSC and NI8) are highly effective for young adults at very low doses (LC50 1.98-4.98 viable spores per mm²). PMID:27376335

  20. Anopheline and culicine mosquitoes are not repelled by surfaces treated with the entomopathogenic fungi Metarhizium anisopliae and Beauveria bassiana

    Directory of Open Access Journals (Sweden)

    Mnyone Ladslaus L

    2010-08-01

    Full Text Available Abstract Background Entomopathogenic fungi, Metarhizium anisopliae and Beauveria bassiana, are promising bio-pesticides for application against adult malaria mosquito vectors. An understanding of the behavioural responses of mosquitoes towards these fungi is necessary to guide development of fungi beyond the 'proof of concept' stage and to design suitable intervention tools. Methods Here we tested whether oil-formulations of the two fungi could be detected and avoided by adult Anopheles gambiae s.s., Anopheles arabiensis and Culex quinquefasciatus. The bioassays used a glass chamber divided into three compartments (each 250 × 250 × 250 mm: release, middle and stimulus compartments. Netting with or without fungus was fitted in front of the stimulus compartment. Mosquitoes were released and the proportion that entered the stimulus compartment was determined and compared between treatments. Treatments were untreated netting (control 1, netting with mineral oil (control 2 and fungal conidia formulated in mineral oil evaluated at three different dosages (2 × 1010, 4 × 1010 and 8 × 1010 conidia m-2. Results Neither fungal strain was repellent as the mean proportion of mosquitoes collected in the stimulus compartment did not differ between experiments with surfaces treated with and without fungus regardless of the fungal isolate and mosquito species tested. Conclusion Our results indicate that mineral-oil formulations of M. anisopliae and B. bassiana were not repellent against the mosquito species tested. Therefore, both fungi are suitable candidates for the further development of tools that aim to control host-seeking or resting mosquitoes using entomopathogenic fungi.

  1. A protocol for determination of conidial viability of the fungal entomopathogens Beauveria bassiana and Metarhizium anisopliae from commercial products.

    Science.gov (United States)

    Oliveira, Daian Guilherme Pinto; Pauli, Giuliano; Mascarin, Gabriel Moura; Delalibera, Italo

    2015-12-01

    Techniques for directly determining conidial viability have widespread use but also have limitations for quality control assessments of formulated mycoinsecticides, especially in emulsifiable oil. This study proposes a new method based on adaptations of already established protocols that use the direct viability method to make it more economical and accurate, thus enabling its use in the evaluation of formulated products. Appropriate parameters and conditions were defined using products based on Beauveria bassiana and Metarhizium anisopliae in the forms of pure conidia, fungus-colonized rice, ground fungus-colonized rice and oil dispersion. The established protocol, named ESALQ, consists of the transfer of 150 μL of a suspension containing about 0.7 and 1 × 10(6) conidia/mL onto Rodac® plates with 5 mL of potato dextrose agar culture medium + 5 mg/L of Pentabiotic® and 10 μL/L of Derosal® (Carbendazim) and subsequent counting of germinated and non-germinated conidia. For the ground fungus-colonized rice and oil dispersion formulations, prior to transferring the fungal suspension to the medium, rice should be decanted and the oil removed, respectively. This method was compared with another direct viability method and with the Colony-forming unit (CFU) and Fluorescence viability methods, comparing the accuracy obtained using the coefficient of variation (CV) of the analysis of each method. The results showed that in addition to the ease of application, the developed method has higher accuracy than the other methods (with a CV up to seven times lower than in the Standard method and up to 32 times lower than CFU). The CFU method underestimated the concentration of viable conidia in most of the tested fungal forms, and in the emulsifiable oil products, these values were 54% lower for B. bassiana and 84% lower for M. anisopliae. The adaptations and standardizations proposed in the ESALQ method showed effective improvements for routine quality assessment of

  2. Bacillus thuringiensis Cry3Aa toxin increases the susceptibility of Crioceris quatuordecimpunctata to Beauveria bassiana infection

    Science.gov (United States)

    The spotted asparagus beetle, Crioceris quatuordecimpunctata (Coleoptera: Chrysomelidae), is one of the most devastating pests of asparagus in China and elsewhere. In this study, we investigated the interaction of Bacillus thuringiensis (Bt) Cry3Aa toxin and the entomopathogenic fungus Beauveria bas...

  3. The entomopathogenic fungal endophytes Purpureocillium lilacinum (formerly Paecilomyces lilacinus and Beauveria bassiana negatively affect cotton aphid reproduction under both greenhouse and field conditions.

    Directory of Open Access Journals (Sweden)

    Diana Castillo Lopez

    Full Text Available The effects of two entomopathogenic fungal endophytes, Beauveria bassiana and Purpureocillium lilacinum (formerly Paecilomyces lilacinus, were assessed on the reproduction of cotton aphid, Aphis gossypii Glover (Homoptera:Aphididae, through in planta feeding trials. In replicate greenhouse and field trials, cotton plants (Gossypium hirsutum were inoculated as seed treatments with two concentrations of B. bassiana or P. lilacinum conidia. Positive colonization of cotton by the endophytes was confirmed through potato dextrose agar (PDA media plating and PCR analysis. Inoculation and colonization of cotton by either B. bassiana or P. lilacinum negatively affected aphid reproduction over periods of seven and 14 days in a series of greenhouse trials. Field trials were conducted in the summers of 2012 and 2013 in which cotton plants inoculated as seed treatments with B. bassiana and P. lilacinum were exposed to cotton aphids for 14 days. There was a significant overall effect of endophyte treatment on the number of cotton aphids per plant. Plants inoculated with B. bassiana had significantly lower numbers of aphids across both years. The number of aphids on plants inoculated with P. lilacinum exhibited a similar, but non-significant, reduction in numbers relative to control plants. We also tested the pathogenicity of both P. lilacinum and B. bassiana strains used in the experiments against cotton aphids in a survival experiment where 60% and 57% of treated aphids, respectively, died from infection over seven days versus 10% mortality among control insects. Our results demonstrate (i the successful establishment of P. lilacinum and B. bassiana as endophytes in cotton via seed inoculation, (ii subsequent negative effects of the presence of both target endophytes on cotton aphid reproduction using whole plant assays, and (iii that the P. lilacinum strain used is both endophytic and pathogenic to cotton aphids. Our results illustrate the potential of

  4. The effect of Mirabilis jalapa leaves biopesticide treatment on the mycelium growth of entomopathogenic fungi Beauveria bassiana inside the larvae body Crocidolomia binotalis

    Science.gov (United States)

    Pramita, Mia; Anggraeni, Tjandra

    2015-09-01

    Pest control with biological method (biopesticide and entomopathogenic fungi) is an alternative program to reduce application of chemical insecticide. Biopesticide of Mirabilis jalapa leaves has been discovered rich in secondary metabolites which has antifeedant activity that can provide physiological interference in insect larvae and the generation numbers[1]. Entomopathogenic fungi Beauveria bassiana has potential to control pest populations[2]. The growth of mycelium B. bassiana may interfere metabolism process inside the host body. Otherwise, B. bassiana produce toxins such as beauvericin that can increase mortality of pest. Combination of M. jalapa and B. bassiana reduce LT50 on C. binotalis larvae[3]. Thus, this study aims to determine influence of provision of biopesticide M. jalapa leaves on growth of mycelium entomopathogenic fungi B. bassiana inside larvae body C. binotalis and to detect the presence of beauvericin in vivo. Third instar larvae of C. binotalis were divided into a control, fungal and combination group. The combination group was given biopesticide and fungi. The concentration of biopesticide was 0.8% (w/v) and concentration of fungi spores was 107 spores/ml. Spores (vol. 5µl) done topically to larvae in interval 6 hours after treatment of biopesticide on non-pesticide cabbage leaves. Afterwards, histological observations performed at 24, 48, 72, 96 hours after treatment. The result show of emergence hyphae and mycelium growth inside lumen of larvae midgut on combination group faster than fungal group. This is thought to be caused by the influence of secondary metabolites of biopesticide M. jalapa leaves. In addition, beauviricin is detectable both of fungal and combination group. Thus, it can be concluded that treatment of biopesticide from M. jalapa leaves can accelerate on growth of mycelium entomopathogenic fungi B. bassiana inside the larvae body C. binotalis and toxic of B. bassiana such as beauvericin was detected on fungal and

  5. Synergistic interaction between the fungus Beauveria bassiana and desiccant dusts applied against poultry red mites (Dermanyssus gallinae).

    Science.gov (United States)

    Steenberg, Tove; Kilpinen, Ole

    2014-04-01

    The poultry red mite, Dermanyssus gallinae, is a major pest in egg production, feeding on laying hens. Widely used non-chemical control methods include desiccant dusts, although their persistence under field conditions is often short. Entomopathogenic fungi may also hold potential for mite control, but these fungi often take several days to kill mites. Laboratory experiments were carried out to study the efficacy of 3 types of desiccant dusts, the fungus Beauveria bassiana and combinations of the two control agents against D. gallinae. There was significant synergistic interaction between each of the desiccant dusts and the fungus, with observed levels of mite mortality significantly higher than those expected for an additive effect (up to 38 % higher). Synergistic interaction between desiccant dust and fungus was found also when different application methods were used for the fungus and at different levels of relative humidity. Although increased levels of mortality were reached due to the synergistic interaction, the speed of lethal action was not influenced by combining the two components. The persistence of the control agents applied separately or in combination did not change over a period of 4 weeks. Overall, combinations of desiccant dusts and fungus conidia seem to hold considerable promise for future non-chemical control of poultry red mites. PMID:24253584

  6. Optimization of erythritol and glycerol accumulation in conidia of Beauveria bassiana by solid-state fermentation, using response surface methodology.

    Science.gov (United States)

    Tarocco, Federico; Lecuona, Roberto E; Couto, Alicia S; Arcas, Jorge A

    2005-09-01

    Entomopathogenic fungi are widely produced for use as mycoinsecticides. Therefore, improvement of the shelf life of fungal propagules under good and adverse conditions should be a pre-requisite of their production. In order to improve conidial physiology as well as mycoinsecticide efficiency, culture conditions may be varied. The Doehlert design was used to generate response surfaces with an estimation of the parameters of the quadratic model allowing the study of three different factors at a different number of levels. This experimental design was applied to optimize water activity (aw), pH, and fermentation time for Beauveria bassiana conidial production and accumulation of polyols in solid-state fermentation. Thus, it was possible to identify the region in the experimental range in which the optimum values of these parameters were simultaneously achieved. Maximal conidia production was achieved at pH 5-6 and aw=0.999. Under these conditions, polyol accumulation was 3 mg erythritol/g conidia and 29.6 mg glycerol/g conidia. However, maximal polyol accumulation was achieved at pH 4.5 and aw 0.950; erythritol production increased 33-fold and glycerol production 4.5-fold. Under these conditions conidia production was 1,000 times lower. The possibilities of increasing the quality of the biocontrol agent without neglecting yield are discussed. PMID:15731900

  7. Evaluación de un biorreactor de lecho empacado para el desarrollo del hongo Beauveria bassiana

    Directory of Open Access Journals (Sweden)

    Zapata Zapata Arley David

    2003-06-01

    Full Text Available La evaluación del biorreactor de lecho empacado para el desarrollo del hongo Beauveria bassiana se hizo con base en las variables temperatura y concentración de conidias, utilizando un sustrato sólido constituido por trigo entero. Se tomaron como parámetros de operación, la altura del lecho, el flujo de aire y la posición dentro del biorreactor, siendo el tiempo de fermentación un parámetro predeterminado que permitió monitorear las variables y comparar la productividad en el desarrollo del hongo. Se pudo observar, con ayuda de un diseño de experimentos factorial y una prueba de Tukey, que bajo ciertas condiciones de operación como una relación H/D = 0.9 (H: altura del lecho, D: diametro del biorreactor y un flujo de aire de 12.3 L/min, se incrementó significativamente la productividad del hongo con respecto al método tradicional de producción (botellas bajo la escala ensayada, siendo la posición un factor poco significativo en el proceso. Palabras clave: Fermentación en estado sólido, control biológico.

  8. Pathogenicity induced by the entomopathogenic fungi Beauveria bassiana and Metarhizium anisopliae in Agrotisipsilon (Hufn.)

    International Nuclear Information System (INIS)

    Scanning electron microscopy (SEM) allowed to observe B. bassiana and M. anisopliae adhesion and penetration structure on A. ipsilon larvae treated with the Lc50 of the fungus, B. bassiana revealed adhesion and penetration structures in the infected larvae. Growth of the fungus on the infected larvae and signs of hyphal penetration of insect cuticle as well as proliferation of the cuticle were also appeared. On the other hand, the fungus, M. anisopliaeas declared by SEM showed a dense network together and caused the green spores on the insect cuticle. Also, SEM allowed observing the spores and hyphae of the fungus in the body cavity of infected larvae. Scanning electron microscopy is convenient tools to observe the mode of action of entomopathogenic fungi and to observe how they are able to colonize and infect the host.

  9. Estudio de las condiciones de mezclado en fermentador para la producción de blastosporas de Beauveria bassiana

    Directory of Open Access Journals (Sweden)

    Cipriano García Gutiérrez

    2013-12-01

    Full Text Available Título en ingles: Study of the mixing conditions in bioreactor for blastospores production of Beauveria bassiana.Resumen: Se caracterizaron tres fermentadores: New Brunswick M-19 de 14 litros, Applikon Biocontroller 1035 de 7 litros y New Brunswick Bioflo III de 7 litros, determinando el coeficiente volumétrico de transferencia de oxígeno (KLa, la retención de gas (RG y el tiempo de mezclado (tM. El fermentador New Brunswick Bioflo III tuvo los mejores valores con una relación de diámetro del impulsor/diámetro del tanque (DI/DT de 0.43, KLa = 9.5-208 h-1 y tM = 1.0-3.0 s, por lo que fue seleccionado para realizar la producción de blastosporas de Beauveria bassiana, utilizando melaza como fuente de carbono. Se estudiaron las condiciones de mezclado, utilizando diferentes combinaciones de impulsores tipo Rushton, Maxflo y Lightnin, bajo un diseño experimental factorial 32. El tiempo de propagación fue de 4 días, el volumen de trabajo 4 litros, 10% de inóculo (1x106 blastosporas/ml, temperatura 30°C, agitación de 400-500 rpm, aireación de 0.5-1.0 vvm, y pH de 5.4.El hongo se desarrolló mejor utilizando la combinación de impulsores Rushton-Maxflo a 400 rpm y 1.0 vvm (F = 10.324, p £ 0.0123 (DMS=0.585, obteniendo una concentración de 1.2x109 blastosporas/ml, 2.2 g/l de biomasa y 2.48 g/l de consumo de sustrato (Y x/s=0.89. Las condiciones de mezclado y los parámetros obtenidos pueden ser aplicados en otros fermentadores para optimizar la producción de blastosporas de B. bassiana en la elaboración experimental de bioinsecticidas.Palabras clave: fermentación líquida, aireación, agitación, hongo entomopatógeno.Abstract: In this work three fermenters were characterized: New Brunswick M-19 of 14 liters, Biocontroller Applikon 1035 of 7 liters and New Brunswick Bioflo III of 7 liters, determining the volumetric coefficient of oxygen transfer (KLa, gas retention (GH and the mixing time (tM. The fermenter New Brunswick Bioflo III

  10. Susceptibilidade de larvas de Cerotoma arcuata Olivier (Coleoptera: Chrysomelidae a Beauveria bassiana (Bals. Vuillemin, Metarhizium anisopliae (Metsch. Sorokin e Bacillus thuringiensis Berliner Susceptibility of Cerotoma arcuata Olivier (Coleoptera: Chrysomelidae larvae to Beauveria bassiana (Bals. Vuillemin, Metarhizium anisopliae (Metsch. Sorokin and Bacillus thuringiensis Berliner

    Directory of Open Access Journals (Sweden)

    Maria Lucia França Teixeira

    2007-02-01

    Full Text Available Larvas de 2° instar de Cerotoma arcuata foram avaliadas em relação à susceptibilidade aos fungos entomopatogênicos Beauveria bassiana, Metarhizium anisopliae e a bactéria Bacillus thuringiensis com as toxinas Cry3. Os insetos adultos foram mantidos em gaiolas e alimentados com plântulas de feijão (Phaseolus vulgaris L. e as larvas em "gerbox" com cotilédones de plântulas de feijão recém-germinadas. Das oito estirpes de B. bassiana avaliadas, CG 156 e CG 213 causaram 100% de mortalidade das larvas, as duas estirpes de M. anisopliae CG 210 e CG 321 foram patogênicas, eliminando 80 e 100% das larvas de C. arcuata, e, das cinco estirpes de B. thuringiensis testadas, o isolado CG 940 causou 70% de mortalidade das larvas.Second instar larvae of Cerotoma arcuata were evaluated concerning the susceptibility to fungi Beauveria bassiana and Metarhizium anisopliae and Bacillus thuringiensis strains containing Cry3 toxin. Adults of C. arcuata were kept in large cages and fed on bean seedlings and the larvae were reared in ‘gearbox’ feeding on germinated Phaseolus bean cotyledons. Strains CG 156 and CG 213 of B. bassiana killed 100% of the insect larvae and strains CG 210 and CG 321 of M. anisopliae killed 80 and 100% of the insect larvae. Strain CG 940 of B. thuringiensis killed 70% of the insect larvae.

  11. Conidia production by Beauveria bassiana (for the biocontrol of a diamondback moth) during solid-state fermentation in a packed-bed bioreactor.

    Science.gov (United States)

    Kang, S W; Lee, S H; Yoon, C S; Kim, S W

    2005-01-01

    Conidia of Beauveria bassiana CS-1, which have the potential for the control of the diamondback moth (Plutella xylostella), were produced by solid-state fermentation (SSF) using a packed-bed bioreactor with rice straw and wheat bran. As the packing density and the bed height were increased, the production of conidia decreased. In a packed-bed bioreactor under no aeration and no addition of polypropylene (PP) foam (control), the total average of conidia was 4.9 x 10(8) g-1. The production of conidia was affected more by the addition of PP foam as an inert support than forced aeration and was approx. 23 times higher than that of the control. The total average of conidia produced by B. bassiana was 1.1-1.2 x 10(10) g-1 . PMID:15703878

  12. Pyrethroid resistance in Anopheles gambiae leads to increased susceptibility to the entomopathogenic fungi Metarhizium anisopliae and Beauveria bassiana

    Directory of Open Access Journals (Sweden)

    Knols Bart GJ

    2010-06-01

    Full Text Available Abstract Background Entomopathogenic fungi are being investigated as a new mosquito control tool because insecticide resistance is preventing successful mosquito control in many countries, and new methods are required that can target insecticide-resistant malaria vectors. Although laboratory studies have previously examined the effects of entomopathogenic fungi against adult mosquitoes, most application methods used cannot be readily deployed in the field. Because the fungi are biological organisms it is important to test potential field application methods that will not adversely affect them. The two objectives of this study were to investigate any differences in fungal susceptibility between an insecticide-resistant and insecticide-susceptible strain of Anopheles gambiae sensu stricto, and to test a potential field application method with respect to the viability and virulence of two fungal species Methods Pieces of white polyester netting were dipped in Metarhizium anisopliae ICIPE-30 or Beauveria bassiana IMI391510 mineral oil suspensions. These were kept at 27 ± 1°C, 80 ± 10% RH and the viability of the fungal conidia was recorded at different time points. Tube bioassays were used to infect insecticide-resistant (VKPER and insecticide-susceptible (SKK strains of An. gambiae s.s., and survival analysis was used to determine effects of mosquito strain, fungus species or time since fungal treatment of the net. Results The resistant VKPER strain was significantly more susceptible to fungal infection than the insecticide-susceptible SKK strain. Furthermore, B. bassiana was significantly more virulent than M. anisopliae for both mosquito strains, although this may be linked to the different viabilities of these fungal species. The viability of both fungal species decreased significantly one day after application onto polyester netting when compared to the viability of conidia remaining in suspension. Conclusions The insecticide

  13. The entomopathogenic fungus Beauveria bassiana reduces instantaneous blood feeding in wild multi-insecticide-resistant Culex quinquefasciatus mosquitoes in Benin, West Africa

    Directory of Open Access Journals (Sweden)

    Howard Annabel FV

    2010-09-01

    Full Text Available Abstract Background Mosquito-borne diseases are still a major health risk in many developing countries, and the emergence of multi-insecticide-resistant mosquitoes is threatening the future of vector control. Therefore, new tools that can manage resistant mosquitoes are required. Laboratory studies show that entomopathogenic fungi can kill insecticide-resistant malaria vectors but this needs to be verified in the field. Methods The present study investigated whether these fungi will be effective at infecting, killing and/or modifying the behaviour of wild multi-insecticide-resistant West African mosquitoes. The entomopathogenic fungi Metarhizium anisopliae and Beauveria bassiana were separately applied to white polyester window netting and used in combination with either a permethrin-treated or untreated bednet in an experimental hut trial. Untreated nets were used because we wanted to test the effect of fungus alone and in combination with an insecticide to examine any potential additive or synergistic effects. Results In total, 1125 female mosquitoes were collected during the hut trial, mainly Culex quinquefasciatus Say. Unfortunately, not enough wild Anopheles gambiae Giles were collected to allow the effect the fungi may have on this malaria vector to be analysed. None of the treatment combinations caused significantly increased mortality of Cx. quinquefasciatus when compared to the control hut. The only significant behaviour modification found was a reduction in blood feeding by Cx. quinquefasciatus, caused by the permethrin and B. bassiana treatments, although no additive effect was seen in the B. bassiana and permethrin combination treatment. Beauveria bassiana did not repel blood foraging mosquitoes either in the laboratory or field. Conclusions This is the first time that an entomopathogenic fungus has been shown to reduce blood feeding of wild mosquitoes. This behaviour modification indicates that B. bassiana could potentially be a new

  14. Endophytic Ability of Different Isolates of Entomopathogenic Fungi Beauveria bassiana (Balsamo) Vuillemin in Stem and Leaf Tissues of Maize (Zea mays L.).

    Science.gov (United States)

    Renuka, S; Ramanujam, B; Poornesha, B

    2016-06-01

    The present study was conducted to examine the ability of six promising indigenous isolates of Beauveria bassiana (NBAII-Bb-5a, 7, 14, 19, 23 and 45) as an endophyte in maize stem and leaf tissues. Maize seedlings (var. Nithyashree) were inoculated with conidial suspensions and were examined for endophytic establishment in leaf and stems at different intervals during 15-90 days after treatment. All six isolates showed colonization in stem and leaf tissues with varying abilities of colonization and persistence. The mean percent colonization ranged from 7.41 to 20.37 % in older stem tissues and 3.70 to 21.29 % in young stem tissues and in leaf, it ranged from 6.46 to 27.78 % in older leaf tissues and 11.11 to 26.85 % in young leaf tissues. Among six isolates tested, Bb-23 isolate recorded the maximum mean colonization in older stem (20.37 %), older leaf (27.78 %) and in young stem (21.29 %). Bb-5a isolate showed maximum mean colonization in young leaf tissues (26.85 %). Persistence of inoculated fungal isolates decreased with increase in age of the plant. No physical symptoms of damage were observed in any of the B. bassiana treated plants. No colonization of B. bassiana was observed in the untreated control maize plants. The results obtained in plating and PCR techniques were similar with regard to the confirmation of endophytic establishment of B. bassiana. This study indicated the possibility of using B. bassiana as an endophyte in maize for management of maize stem borer, Chilo partellus. PMID:27570303

  15. Conclusion on the peer review of the pesticide risk assessment of the active substances Beauveria bassiana strains ATCC-74040 and GHA

    Directory of Open Access Journals (Sweden)

    European Food Safety Authority

    2013-01-01

    Full Text Available The conclusions of the European Food Safety Authority (EFSA following the peer review of the initial risk assessments carried out by the competent authority of the rapporteur Member State Germany, for the pesticide active substances Beauveria bassiana strains ATCC-74040 and GHA are reported. The context of the peer review was that required by Commission Regulation (EC No 2229/2004, as amended by Commission Regulation (EC No 1095/2007 and Commission Regulation (EU No 114/2010. The conclusions were reached on the basis of the evaluation of the representative uses of Beauveria bassiana strains ATCC-74040 and GHA as an insecticide on tomatoes for strain ATCC-74040 and on tomatoes, cucumbers and ornamentals for strain GHA. The reliable endpoints concluded as being appropriate for use in regulatory risk assessment, derived from the available studies and literature in the dossier peer reviewed, are presented. Missing information identified as being required by the regulatory framework is listed. Concerns are identified.

  16. Seleção de isolados de Metarhizium anisopliae e Beauveria bassiana patogênicos a soldados de Atta bisphaerica e Atta sexdens rubropilosa em condições de laboratório Selection of Metarhizium anisopliae and Beauveria bassiana isolates pathogenic to Atta bisphaerica and Atta sexdens rubropilosa soldiers under laboratory conditions

    Directory of Open Access Journals (Sweden)

    Alzimiro Marcelo Conteiro Castilho

    2010-06-01

    Full Text Available As formigas do gênero Atta são pragas importantes de diversas culturas agrícolas, pastagens e reflorestamentos. Os fungos entomopatogênicos estão entre os fatores naturais de mortalidade dessas formigas e por isso apresentam potencial para serem usados no controle biológico dessa praga. O presente trabalho teve como objetivo selecionar isolados de Metarhizium anisopliae e Beauveria bassiana patogênicos a soldados de Atta bisphaerica e Atta sexdens rubropilosa em condições de laboratório. Para a avaliação da patogenicidade, foram utilizados oito isolados de M. anisopliae e seis de B. bassiana. O experimento foi conduzido em DIC, sendo a parcela composta por um grupo de 10 soldados por espécie de formiga, sendo utilizadas três repetições por tratamento. Para cada isolado, três grupos de soldados foram pulverizados com suspensão de 1,0 x 10(8 conídios ml-1 e mantidos em câmara úmida (25±1°C, 80±1% de UR e no escuro sem alimentação, sendo a mortalidade verificada diariamente. Dos 14 isolados testados, quatro de M. anisopliae e quatro de B. bassiana foram patogênicos aos soldados de ambas as espécies de formigas. A virulência foi avaliada para os isolados que causaram mortalidade igual ou maior a 50%. Para cada isolado, suspensões contendo 1,0 x 10(6 a 1,0 x 10(11 conídios ml-1 foram pulverizadas sobre três grupos de 10 soldados e igualmente acondicionados como no teste de patogenicidade. A porcentagem de mortalidade foi calculada a cada 24 horas para determinação do TL50. O isolado ENA04 de M. anisopliae foi mais patogênico, causando mais de 80% de mortalidade nos primeiros três dias após a inoculação, apresentou maior capacidade de esporular nos cadáveres dos soldados e foi o mais virulento para os soldados de A. bisphaerica, com um TL50 de 1,15 dias. Todos os isolados patogênicos aos soldados de A. sexdens rubropilosa foram igualmente virulentos.The ants of the genus Atta are important pests of several

  17. Effect of plant extracts and a disinfectant on biological parameters and pathogenicity of the fungus Beauveria bassiana (Bals.) Vuill. (Ascomycota: Cordycipitaceae).

    Science.gov (United States)

    Martins, C C; Alves, L F A; Mamprim, A P

    2016-06-01

    The fungus Beauveria bassiana is naturally found in poultry houses and causes high rates of mortality in Alphitobius diaperinus. Laboratory and field experiments have shown the potential of this fungus as an insect control agent. However, in poultry houses, bacteria as Salmonella, can be found and have been studied alternative control methods for this pathogen. Thus, this study aimed to evaluate the effect of plant extracts and a disinfectant on the fungus Beauveria bassiana (strain Unioeste 4). Conidial viability, colony-forming unit (CFU) counts, vegetative growth, conidia production, insecticidal activity of the fungus and compatibility were used as parameters in the evaluation of the effect of these products on the fungus. Alcoholic and aqueous extracts of jabuticaba (Myrciaria cauliflora (Mart.), guava (Psidium guajava (L.)), and jambolan (Syzygium cumini (L.), at concentrations of 10% as well as the commercial disinfectant, Peroxitane® 1512 AL, were evaluated at the recommended concentrations (RC), 1:200 (RC), 0.5 RC and 2 RC. There was a negative influence of alcoholic and aqueous extracts of jabuticaba, guava and three dilutions of Peroxitane on the viability of conidia. The CFUs and vegetative growth of the fungus were affected only by the Peroxitane (all dilutions). For conidial production, the aqueous extract of guava had a positive effect, increasing production, while the Peroxitane at the R and RC concentrations resulted in a negative influence. The mortality of A. diaperinus, caused by the fungus after exposure to these products, was 60% for the peracetic acid at 0.5 RC, and above 80% for the extracts. Thus, the results showed that all the extracts and Peroxitane at RC 0.5 are compatible with the fungus B. bassiana Unioeste 4, however only the extracts had a low impact on inoculum potential. PMID:27143049

  18. Populational parameters of Spalangia endius Walker (Hymenoptera: Pteromalidae) on Pupae of Musca domestica L. (Diptera: Muscidae) treated with two strains of Beauveria bassiana (Bals.) Vuil. (Deuteromycetes).

    Science.gov (United States)

    Lecuona, Roberto; Crespo, Diana; La Rossa, Francisco

    2007-01-01

    The parasitoid Spalangia endius Walker is an efficient controller of Dipteran pupae, such as Musca domestica L. The entomopathogenic fungus Beauveria bassiana (Bals.) Vuil. is a regulator of insect populations, including these synanthropic pests. The aim of this work was to explore the possibilities of utilizing both agents in a combined form for the biocontrol of the domestic fly. Recently formed M. domestica pupae were inoculated by immersion in conidia suspension (10(8) conidia/ml) with two strains of B. bassiana (Bb6 and Bb10). The inoculated pupae were offered to the female parasitoid. In one bioassay they were offered pupae inoculated a single day and in other, pupae inoculated the following day as well. In both bioassays non inoculated (control) pupae were offered to the parasitoids until their death. Thirty females of S. endius were used for each strain and bioassay. From the study of the parasitoid offspring, life tables were built and the reproduction net rate (R(0)) and intrinsic natural increase (r(m)) were obtained among other demographic parameters; the parasitism percentages and sex ratios were also analyzed. B. bassiana did not affect significantly the biodemography of the parasitoid when pupae were inoculated a single time. On the other hand the R0 and the rm were smaller than that of the control without the fungus when pupae were inoculated twice, although sporulation was not observed in the cadavers of S. endius. PMID:17934618

  19. Field applications of entomopathogenic fungi Beauveria bassiana and Metarhizium anisopliae F52 (Hypocreales: Clavicipitaceae) for the control of Ixodes scapularis (Acari: Ixodidae).

    Science.gov (United States)

    Stafford, Kirby C; Allan, Sandra A

    2010-11-01

    Two commercial formulations of Beauveria bassiana (Balsamo-Crivelli) Vuillemin were applied to residential sites in Old Lyme, CT, for the control of nymphs of the blacklegged tick, Ixodes scapularis, in 1999 and 2000. The pyrethroid bifenthrin was applied to other premises for comparison with B. bassiana. A wood chip barrier was installed and maintained at six of the treated properties. In 1999, control of I. scapularis nymphs ranged from 74.5 to 83.0% on lawns without wood chips and from 88.9 to 90% on lawns with wood chip barriers. As a control check, no ticks (n = 23) collected at pretreatment or control sites died from B. bassiana, although 15 of 18 nymphs from treated lawns developed mycoses. Control of I. scapularis on the lawns in 2000 with the two B. bassiana products was lower, as follows: 38.0 and 58.7% without the barrier and 56.9 and 55.1% with the wood chip barrier. Posttreatment differences in nymphal numbers between treatments and control were significant (P = 0.005 and P = 0.039, 1999 and 2000, respectively). The bifenthrin provided 86 and 87% control each year, respectively. The application of Metarhizium anisopliae (Metschnikoff) Sorokin strain F52 to 9 residential sites in Westport and Weston, CT, in 2002 provided significant (P = 0.034; P = 0.039) reductions in nymphal tick abundance with 55.6 and 84.6% fewer ticks on lawn and woodland plots, respectively. These results suggest the application of entomopathogenic fungi could provide another approach for the control of I. scapularis nymphs in residential or similar landscapes. PMID:21175060

  20. [Interaction of Metarhizium anisopliae (Metsch.) Sorok., Beauveria bassiana (Bals.) Vuill. and the parasitoid Oomyzus sokolowskii (Kurdjumov) (Hymenoptera: Eulophidae) with larvae of diamondback moth, Plutella xylostella (L.) (Lepidoptera: Plutellidae)].

    Science.gov (United States)

    dos Santos, Hugo J G; Marques, Edmilson J; Barros, Reginaldo; Gondim, Manoel G C

    2006-01-01

    Chemical insecticides are broadly applied to control diamondback moth, Plutella xylostella (L.). Diamondback moth is a major pest of cruciferous worldwide, and resistance of this pest to insecticide has been often reported. Thus, this research investigated the interactions among the fungi Metarhizium anisopliae (Metsch.) Sorok., Beauveria bassiana (Bals.) Vuill., and the larval-pupal parasitoid Oomyzus sokolowskii (Kurdjumov) before and after application of the fungi on DBM larvae offered to the parasitoid. The experiment was carried out at 26+/-l degreeC, 75+/- 5% RH and 12h photophase using a completely randomized design, with eight treatments with six replications each. The isolates E9 of M. anisopliae and ESALQ 447 of B. bassiana, were used at the concentration of 10(7) conidia ml(-1). The results showed that M. anisopliae and B. bassiana reduced the parasitism of P. xylostella by O. sokolowskii. Additive effects were found on the mortality of P. xylostella with the different combinations among the fungi and parasitoid, except for the treatment B. bassiana inoculated 24h before exposition of the larvae to O. sokolowskii. The isolates were more efficacious when applied after exposition of the larvae to the parasitoid. The efficiency of O. sokolowskii was negatively influenced by the presence of the fungi, mainly when the fungi were applied 24h before diamondback's larvae were exposed to the parasitoid. The association of the fungi with the parasitoid presents potential to be tested in field. The use of these natural enemies in the integrated management of P. xylostella may economically improve the cabbage productive system, especially for organic farming. PMID:17348136

  1. Potential of Metarrhizium anisopliae and Beauveria bassiana isolates and Neem oil to control the aphid Lipaphis erysimi (Kalt.) (Hemiptera: Aphididae); Potencial de isolados de Metarhizium anisopliae e Beauveria bassiana e do oleo de Nim no controle do pulgao Lipaphis erysimi (Kalt.) (Hemiptera: Aphididae)

    Energy Technology Data Exchange (ETDEWEB)

    Araujo Junior, Jose M. de; Marques, Edmilson J.; Oliveira, Jose V. de [Universidade Federal Rural de Pernambuco (UFRPE), Recife, PE (Brazil). Dept. de Agronomia - Entomologia], e-mail: jma_junior@yahoo.com.br, e-mail: emar@depa.ufrpe.br, e-mail: vargasoliveira@uol.com.br

    2009-07-15

    This work aimed to determine the efficiency of the entomopathogenic fungi Metarrhizium anisopliae and Beauveria bassiana to control the aphid Lipaphis erysimi (Kalt.) (Hemiptera:Aphididae) in kale Brassica oleracea var acephala D.C., as well as their compatibility with a neem oil formulation (Neemseto{sup R}). Ten isolates of both fungi were tested and the most pathogenic ones were B. bassiana CG001 and M. anisopliae CG30 with 90% and 4.4 days, and 64% and 3.8 days of mortality and median lethal time, respectively. Bioassays with neem at concentrations of 0.5, 1.0 and 2.0% were done either by leaf discs dipping or spraying the aphids on the leaf discs. The neem spraying treatment at 2.0% provided 90% mortality. The use of B. bassiana isolate CG001 or M. anisopliae isolate CG30 with neem at 0.125, 0.25, and 0.5%, demonstrated that these isolates could have their spore viability or colony growth affected when exposed to neem concentrations higher than 0.25%. In absolute values, the isolates B. bassiana CG001 and M. anisopliae CG30 are the most virulent to L. erysimi, and could be utilized in the management of this pest. (author)

  2. Seleção de isolados de Metarhizium anisopliae e Beauveria bassiana patogênicos a soldados de Atta bisphaerica e Atta sexdens rubropilosa em condições de laboratório Selection of Metarhizium anisopliae and Beauveria bassiana isolates pathogenic to Atta bisphaerica and Atta sexdens rubropilosa soldiers under laboratory conditions

    OpenAIRE

    Alzimiro Marcelo Conteiro Castilho; Marcelo Elias Fraga; Elen de Lima Aguiar-Menezes; Carlos Alberto da Rocha Rosa

    2010-01-01

    As formigas do gênero Atta são pragas importantes de diversas culturas agrícolas, pastagens e reflorestamentos. Os fungos entomopatogênicos estão entre os fatores naturais de mortalidade dessas formigas e por isso apresentam potencial para serem usados no controle biológico dessa praga. O presente trabalho teve como objetivo selecionar isolados de Metarhizium anisopliae e Beauveria bassiana patogênicos a soldados de Atta bisphaerica e Atta sexdens rubropilosa em condições de laboratório. Para...

  3. Identification of proteases produced by entomopathogenic fungi Beauveria bassiana (Bals) Vuill. strain CG432 previously activated in coffee berry borer alive (Hypothenemus hampei)
    Identificação de proteases produzidas pelo fungo entomopatogênico Beauveria bassiana (Bals) Vuill. Cepa CG432 previamente ativada em insetos vivos de broca do café ((Hypothenemus hampei))

    OpenAIRE

    Luiz Filipe Protásio Pereira; Diogo Maciel de Magalhães; Humberto Josué de Oliveira Ramos; Dalva Trevisan; Eliana Tiemi Ito; Jurandir Pereira Pinto; Vanessa Hitomi Sugahara; Geni Silva Varéa; Jakeliny Akemi Yamamoto Oliveira

    2012-01-01

    Conídios de fungos entomopatogênicos atravessam o exoesqueleto do inseto pela ação mecânica do tubo germinativo e produção de múltiplas isoformas de proteases, quitinases e lipases em resposta à composição da cutícula do inseto. Desta forma o objetivo deste trabalho foi extrair, purificar e caracterizar a estrutura de proteases produzidas em cultivo submerso por Beauveria bassiana CG432 previamente ativada em adultos vivos de broca-do-café (Hypothenemus hampei). Uma suspensão contendo 106 con...

  4. Regulative roles of glutathione reductase and four glutaredoxins in glutathione redox, antioxidant activity, and iron homeostasis of Beauveria bassiana.

    Science.gov (United States)

    Zhang, Long-Bin; Tang, Li; Ying, Sheng-Hua; Feng, Ming-Guang

    2016-07-01

    Multiple glutaredoxins (Grx) and glutathione reductase (Glr) are vital for the thiol-disulfide redox system in budding yeast but generally unexplored in filamentous fungi. Here we characterized the Beauveria bassiana redox system comprising dithiol Grx1, monothiol Grx2-4, Grx-like Grx5, and Glr orthologue. Each grx or glr deletion was compensated by increased transcripts of some other grx genes in normal cultures. Particularly, grx3 compensated the absence of grx1, grx2, grx5, or glr under oxidative stress while its absence was compensated only by undeletable grx4 under normal conditions but by most of other undeleted grx and glr genes in response to menadione. Consequently, the redox state was disturbed in Δglr more than in Δgrx3 but not in Δgrx1/2/5. Superoxide dismutases were more active in normal Δgrx1-3 cultures but less in Δgrx5 or Δglr response to menadione. Total catalase activity increased differentially in all the mutant cultures stressed with or without H2O2 while total peroxidase activity decreased more in the normal or H2O2-stressed culture of Δglr than of Δgrx3. Among the mutants, Δgrx3 showed slightly increased sensitivity to menadione or H2O2; Δglr exhibited greater sensitivity to thiol-oxidizing diamide than thiol-reducing 1-chloro-2,4-dinitrobenzene as well as increased sensitivity to the two oxidants. Intriguingly, all the mutants grew slower in a Fe(3+)-inclusive medium perhaps due to elevated transcripts of two Fe(3+) transporter genes. More or fewer phenotypes linked with biocontrol potential were altered in four deletion mutants excluding Δgrx5. All the changes were restored by targeted gene complementation. Overall, Grx3 played more critical role than other Grx homologues in the Glr-dependent redox system of the fungal entomopathogen. PMID:26969041

  5. 球孢白僵菌液体制剂研究%The Study on A Liquid Preparation of Beauveria Bassiana

    Institute of Scientific and Technical Information of China (English)

    朱天辉; 杨世璋; 李远翔

    2001-01-01

    Effects of different media and fermentative conditions on the production of spores and cumulation of mycelial substence for Beauveria bassiana were studied by means of liquid fermentation. The results show that Beauveria bassiana does not produce blastospores on five media except for the medium (substitute code D) which contains 5% waste sugar, 1% corn abstract, and 0.1% K2HPO4, meanwhile, the D-medium, on which Beauveria bassiana grows well and produces bigger spores, is regarded as a ideal liquid carrier. The optimal fermentative conditions are as follows: temperature 25~30℃, pH6.0~7.0, Vibrating time 96hr, and not excess 1/6 flak volume as ventilation index.%通过液体发酵试验,研究了不同营养基质、不同发酵条件对球孢白僵菌液生分生孢子、芽孢子、干物质积累的影响,结果显示:在5种培养基中,除“糖蜜5%、玉米浸提液1%、K2HPO4 0.1%”(代号D)外,其它均不产生芽孢子,以D配方生物量最高,孢子较大,为本试验选出的液体制剂的理想载体,最佳发酵条件为温度25~30℃,pH6.0~7.0,通气量以瓶装培养液量为指标不超过1/6瓶装量,发酵时间以96小时为佳。白僵菌液体制剂的理想载体与最佳发酵条件的组合可使白僵菌液生分生孢子达2.5×1010左右,超过了目前四川固体发酵的生产水平。

  6. Identification of proteases produced by entomopathogenic fungi Beauveria bassiana (Bals Vuill. strain CG432 previously activated in coffee berry borer alive (Hypothenemus hampeiIdentificação de proteases produzidas pelo fungo entomopatogênico Beauveria bassiana (Bals Vuill. Cepa CG432 previamente ativada em insetos vivos de broca do café ((Hypothenemus hampei

    Directory of Open Access Journals (Sweden)

    Luiz Filipe Protásio Pereira

    2012-02-01

    Full Text Available Conídios de fungos entomopatogênicos atravessam o exoesqueleto do inseto pela ação mecânica do tubo germinativo e produção de múltiplas isoformas de proteases, quitinases e lipases em resposta à composição da cutícula do inseto. Desta forma o objetivo deste trabalho foi extrair, purificar e caracterizar a estrutura de proteases produzidas em cultivo submerso por Beauveria bassiana CG432 previamente ativada em adultos vivos de broca-do-café (Hypothenemus hampei. Uma suspensão contendo 106 conídios ativados/mL foi inoculada em meio de cultura líquido a 28ºC, 150 rpm por 3 dias. O extrato de proteases (EP foi obtido da centrifugação a 8000 g por 20 minutos, fracionado e concentrado por ultrafiltração em membrana de porosidade controlada 100 kDa e 3 kDa, respectivamente. A cromatografia de gel filtração em Sephadex G-100 separou um pico proteico (Pico II que apresentou 56% de resíduos do aminoácido ácido aspártico quando analisado por HPLC em coluna de fase reversa ODS-C18; atividade específica 43 vezes superior ao EP sobre soro albumina bovina; atividade de protease tipo-subtilisina e uma única banda proteica revelada por nitrato de prata e Coomassie Brilhant Blue em zimograma sobre gelatina por eletroforese PAGE em condições nativas. A homogeneidade do Pico II foi confirmada pela revelação de uma única banda durante a determinação do pH isoelétrico igual a 4,5, porém a determinação da massa molecular separou 2 bandas de 23 e 26 kDa por eletroforese PAGE-2D. As proteases foram caracterizadas como serino proteases com resíduo cisteína importante para a atividade, pois foram inibidas por fluoreto fenil-metil-sufonil e ácido p-cloromercúriobenzóico. As proteases do Pico II apresentaram Km 4x10-4 sobre substrato tipo-subtilisina.

  7. Advances and Perspectives of the use of the entomopathogenic fungi beauveria bassiana and metarhizium anisopliae for the control of arthropod pests in poultry production

    Directory of Open Access Journals (Sweden)

    DGP Oliveira

    2014-03-01

    Full Text Available Global poultry production is plagued by a wide variety of arthropods. The problems associated with their chemical control have led to an increasing search for control alternatives, and entomopathogenic fungi seem to be a promising strategy. Despite the large number of insects and mites considered as important pests in animal production, studies on the use of entomopathogenic fungi for their control are still scarce compared with agricultural pests, particularly in Brazil. This article reviews some damages and control aspects of the main arthropod pests that affect Brazilian poultry production, including house flies, lesser mealworms, and feather mites, by the use of the entomopathogenic fungi Beauveria bassiana and Metarhizium anisopliae. Studies published in the last 20 years were reviewed, and the main problems and limitations of that pest-control strategy are discussed.

  8. Genetic improvement of the nematicidal fungus Lecanicillium attenuatum against Heterodera glycines by expression of the Beauveria bassiana Cdep1 protease gene.

    Science.gov (United States)

    Xie, Ming; Zhang, Yan-Jun; Zhang, Xiao-Lin; Peng, De-Liang; Yu, Wen-Bin; Li, Qian

    2016-07-01

    Lecanicillium attenuatum is an important nematophagous fungus with potential as a biopesticide against plant-parasitic nematodes. The Pr1A-like cuticle-degrading protease (Cdep1) gene originating from the entomopathogenic fungus Beauveria bassiana was transformed into the nematophagous fungus L. attenuatum using a polyethylene-glycol mediated protoplast-based transformation system. Protease activity was increased 0.64- to 1.63-fold 2-10d after growth in the transformed L. attenuatum. Inhibition of egg-hatching and J2 motility of soybean cyst nematodes (Heterodera glycines) by cell-free fungal culture filtrates were enhanced by 17-76% 2-14d and 43-152% 1-13d after incubation, respectively. PMID:27342597

  9. An entomopathogenic strain of Beauveria bassiana against Frankliniella occidentalis with no detrimental effect on the predatory mite Neoseiulus barkeri: evidence from laboratory bioassay and scanning electron microscopic observation.

    Directory of Open Access Journals (Sweden)

    Shengyong Wu

    Full Text Available Among 28 isolates of Beauveria bassiana tested for virulence against F. occidentalis in laboratory bioassays, we found strain SZ-26 as the most potent, causing 96% mortality in adults at 1×10(7 mL(-1conidia after 4 days. The effect of the strain SZ-26 on survival, longevity and fecundity of the predatory mite Neoseiulus (Amblyseius barkeri Hughes were studied under laboratory conditions. The bioassay results showed that the corrected mortalities were less than 4 and 8% at 10 days following inoculation of the adult and the larvae of the predator, respectively, with 1×10(7 conidia mL(-1 of SZ-26. Furthermore, no fungal hyphae were found in dead predators. The oviposition and postoviposition durations, longevity, and fecundity displayed no significant differences after inoculation with SZ-26 using first-instar larvae of F. occidentalis as prey in comparison with untreated predator. In contrast, the preoviposition durations were significantly longer. Observations with a scanning electron microscope, revealed that many conidia were attached to the cuticles of F. occidentalis at 2 h after treatment with germ tubes oriented toward cuticle at 24 h, penetration of the insect cuticle at 36 h, and finally, fungal colonization of the whole insect body at 60 h. In contrast, we never observed penetration of the predator's cuticle and conidia were shed gradually from the body, further demonstrating that B. bassiana strain SZ-26 show high toxicity against F. occidentalis but no pathogenicity to predatory mite.

  10. The effect of leaf biopesticide (Mirabilis jalapa) and entomopathogenic fungi (Beauveria bassiana) combinations to some physiological characters and histology of Crocidolomia pavonana (Lepidoptera: Pyralidae) larvae

    Science.gov (United States)

    Sirajuddin, Nur Tasmiah; Anggraeni, Tjandra

    2014-03-01

    Crocidolomia pavonana is one of the most prominent pest that cause damage to vegetables especially Brassicaceae such us cabbage, broccoli, mustard greens and turnips, these vegetable have been widely consumed and cultivated in Indonesia. The invation of this pest might created high risk of cultivated failure. Enviromentally pest control efforts by utilizing biological control agents such us biopesticides of plants and entomopathogenic fungi have been carried out, but the work was relatively long and strongly influenced by environmental factors. The purpose of this study was to combine biopesticide of Mirabilis jalapa and entomopathogenic fungi Beauveria bassiana to look at mortality of C. pavonana larvae observing by histological incision and scanning electron microscope. Concentration treatments of extracts M. jalapa was (control; 0,1; 0,2; 0,4 and 0,8 gr/ml) and the result showed that the effective concentration was 0,8 g/ml which affect significantly (PHistological incision observed at hour 24, 48, 72 and 96, where the biggest damage occurred at hour 96. Observation by scanning electron microscope showed fungus spores that attach to the body surface of larvae subsequently penetrate into the body. Thus the combination use of biopesticides M. jalapa and fungi B. bassiana, can be used as an alternative pest control C. pavonana.

  11. The effect of leaf biopesticide (Mirabilis jalapa) and entomopathogenic fungi (Beauveria bassiana) combinations to some physiological characters and histology of Crocidolomia pavonana (Lepidoptera: Pyralidae) larvae

    International Nuclear Information System (INIS)

    Crocidolomia pavonana is one of the most prominent pest that cause damage to vegetables especially Brassicaceae such us cabbage, broccoli, mustard greens and turnips, these vegetable have been widely consumed and cultivated in Indonesia. The invation of this pest might created high risk of cultivated failure. Enviromentally pest control efforts by utilizing biological control agents such us biopesticides of plants and entomopathogenic fungi have been carried out, but the work was relatively long and strongly influenced by environmental factors. The purpose of this study was to combine biopesticide of Mirabilis jalapa and entomopathogenic fungi Beauveria bassiana to look at mortality of C. pavonana larvae observing by histological incision and scanning electron microscope. Concentration treatments of extracts M. jalapa was (control; 0,1; 0,2; 0,4 and 0,8 gr/ml) and the result showed that the effective concentration was 0,8 g/ml which affect significantly (P<0,05) in reduce pupa weight, improve pupasi time, lowering percentage of emergence imago and improve the long phase of pupa which differ significantly with control. The combination of biopesticides proved to accelerate the mortality of larvae. Histological incision observed at hour 24, 48, 72 and 96, where the biggest damage occurred at hour 96. Observation by scanning electron microscope showed fungus spores that attach to the body surface of larvae subsequently penetrate into the body. Thus the combination use of biopesticides M. jalapa and fungi B. bassiana, can be used as an alternative pest control C. pavonana

  12. The effect of leaf biopesticide (Mirabilis jalapa) and entomopathogenic fungi (Beauveria bassiana) combinations to some physiological characters and histology of Crocidolomia pavonana (Lepidoptera: Pyralidae) larvae

    Energy Technology Data Exchange (ETDEWEB)

    Sirajuddin, Nur Tasmiah, E-mail: nurtasmiah@yahoo.com; Anggraeni, Tjandra, E-mail: nurtasmiah@yahoo.com [Sekolah Ilmu dan Teknologi Hayati - ITB, Jalan Ganesa 10 Bandung (Indonesia)

    2014-03-24

    Crocidolomia pavonana is one of the most prominent pest that cause damage to vegetables especially Brassicaceae such us cabbage, broccoli, mustard greens and turnips, these vegetable have been widely consumed and cultivated in Indonesia. The invation of this pest might created high risk of cultivated failure. Enviromentally pest control efforts by utilizing biological control agents such us biopesticides of plants and entomopathogenic fungi have been carried out, but the work was relatively long and strongly influenced by environmental factors. The purpose of this study was to combine biopesticide of Mirabilis jalapa and entomopathogenic fungi Beauveria bassiana to look at mortality of C. pavonana larvae observing by histological incision and scanning electron microscope. Concentration treatments of extracts M. jalapa was (control; 0,1; 0,2; 0,4 and 0,8 gr/ml) and the result showed that the effective concentration was 0,8 g/ml which affect significantly (P<0,05) in reduce pupa weight, improve pupasi time, lowering percentage of emergence imago and improve the long phase of pupa which differ significantly with control. The combination of biopesticides proved to accelerate the mortality of larvae. Histological incision observed at hour 24, 48, 72 and 96, where the biggest damage occurred at hour 96. Observation by scanning electron microscope showed fungus spores that attach to the body surface of larvae subsequently penetrate into the body. Thus the combination use of biopesticides M. jalapa and fungi B. bassiana, can be used as an alternative pest control C. pavonana.

  13. Proteomic and Phosphoproteomic Insights into a Signaling Hub Role for Cdc14 in Asexual Development and Multiple Stress Responses in Beauveria bassiana

    Science.gov (United States)

    Wang, Zhi-Kang; Wang, Jie; Liu, Jing; Ying, Sheng-Hua; Peng, Xiao-Jun; Feng, Ming-Guang

    2016-01-01

    Cdc14 is a dual-specificity phosphatase that regulates nuclear behavior by dephosphorylating phosphotyrosine and phosphoserine/phosphothreonine in fungi. Previously, Cdc14 was shown to act as a positive regulator of cytokinesis, asexual development and multiple stress responses in Beauveria bassiana, a fungal insect pathogen. This study seeks to gain deep insight into a pivotal role of Cdc14 in the signaling network of B. bassiana by analyzing the Cdc14-specific proteome and phosphoproteome generated by the 8-plex iTRAQ labeling and MS/MS analysis of peptides and phosphopeptides. Under normal conditions, 154 proteins and 86 phosphorylation sites in 67 phosphoproteins were upregulated in Δcdc14 versus wild-type, whereas 117 proteins and 85 phosphorylation sites in 58 phosphoproteins were significantly downregulated. Co-cultivation of Δcdc14 with NaCl (1 M), H2O2 (3 mM) and Congo red (0.15 mg/ml) resulted in the upregulation / downregulation of 23/63, 41/39 and 79/79 proteins and of 127/112, 52/47 and 105/226 phosphorylation sites in 85/92, 45/36 and 79/146 phosphoproteins, respectively. Bioinformatic analyses revealed that Cdc14 could participate in many biological and cellular processes, such as carbohydrate metabolism, glycerophospholipid metabolism, the MAP Kinase signaling pathway, and DNA conformation, by regulating protein expression and key kinase phosphorylation in response to different environmental cues. These indicate that in B. bassiana, Cdc14 is a vital regulator of not only protein expression but also many phosphorylation events involved in developmental and stress-responsive pathways. Fourteen conserved and novel motifs were identified in the fungal phosphorylation events. PMID:27055109

  14. Proteomic and Phosphoproteomic Insights into a Signaling Hub Role for Cdc14 in Asexual Development and Multiple Stress Responses in Beauveria bassiana.

    Science.gov (United States)

    Wang, Zhi-Kang; Wang, Jie; Liu, Jing; Ying, Sheng-Hua; Peng, Xiao-Jun; Feng, Ming-Guang

    2016-01-01

    Cdc14 is a dual-specificity phosphatase that regulates nuclear behavior by dephosphorylating phosphotyrosine and phosphoserine/phosphothreonine in fungi. Previously, Cdc14 was shown to act as a positive regulator of cytokinesis, asexual development and multiple stress responses in Beauveria bassiana, a fungal insect pathogen. This study seeks to gain deep insight into a pivotal role of Cdc14 in the signaling network of B. bassiana by analyzing the Cdc14-specific proteome and phosphoproteome generated by the 8-plex iTRAQ labeling and MS/MS analysis of peptides and phosphopeptides. Under normal conditions, 154 proteins and 86 phosphorylation sites in 67 phosphoproteins were upregulated in Δcdc14 versus wild-type, whereas 117 proteins and 85 phosphorylation sites in 58 phosphoproteins were significantly downregulated. Co-cultivation of Δcdc14 with NaCl (1 M), H2O2 (3 mM) and Congo red (0.15 mg/ml) resulted in the upregulation / downregulation of 23/63, 41/39 and 79/79 proteins and of 127/112, 52/47 and 105/226 phosphorylation sites in 85/92, 45/36 and 79/146 phosphoproteins, respectively. Bioinformatic analyses revealed that Cdc14 could participate in many biological and cellular processes, such as carbohydrate metabolism, glycerophospholipid metabolism, the MAP Kinase signaling pathway, and DNA conformation, by regulating protein expression and key kinase phosphorylation in response to different environmental cues. These indicate that in B. bassiana, Cdc14 is a vital regulator of not only protein expression but also many phosphorylation events involved in developmental and stress-responsive pathways. Fourteen conserved and novel motifs were identified in the fungal phosphorylation events. PMID:27055109

  15. The Pal pathway required for ambient pH adaptation regulates growth, conidiation, and osmotolerance of Beauveria bassiana in a pH-dependent manner.

    Science.gov (United States)

    Zhu, Jing; Ying, Sheng-Hua; Feng, Ming-Guang

    2016-05-01

    The Pal/Rim pathway essential for fungal adaptation to ambient pH has been unexplored in Beauveria bassiana, a classic fungal entomopathogen. Here, we show the characterized Pal pathway comprising transcription factor PacC and upstream six Pal partners (PalA/B/C/F/H/I) in B. bassiana. Their coding genes were all transcribed most abundantly in standard wild-type culture under the alkaline condition of pH 9. Deletion of pacC or each pal gene resulted in a significant delay of culture acidification in a minimal broth (initial pH = 7.3). This delay concurred with altered accumulation levels of intra/extracellular organic acids and drastically depressed expression of some enzyme genes required for the syntheses of oxalic and lactic acids. Our deletion mutants except ΔpalI showed growth defects and maximal sensitivity to NaCl, KCl, LiCl, or sorbitol at pH 9, an alkaline condition leading to fragmented vacuoles in their hyphal cells exposed to osmotic stress. In these mutants, conidiation was significantly facilitated at pH 3 more than at pH 7 but suppressed slightly at pH 9. Mild virulence defects also occurred in the absence of pacC or any pal gene. These changes were restored by targeted gene complementation. Taken together, PacC and Pal partners regulate the growth, conidiation, and osmotolerance of B. bassiana in a pH-dependent manner, highlighting their vitality for the fungal pH response. PMID:26754817

  16. Interaction between TATA-Binding Protein (TBP and Multiprotein Bridging Factor-1 (MBF1 from the Filamentous Insect Pathogenic Fungus Beauveria bassiana.

    Directory of Open Access Journals (Sweden)

    Chi Song

    Full Text Available TATA-binding protein (TBP is a ubiquitous component of eukaryotic transcription factors that acts to nucleate assembly and position pre-initiation complexes. Multiprotein bridging factor 1 (MBF1 is thought to interconnect TBP with gene specific transcriptional activators, modulating transcriptional networks in response to specific signal and developmental programs. The insect pathogen, Beauveria bassiana, is a cosmopolitan fungus found in most ecosystems where it acts as an important regulator of insect populations and can form intimate associations with certain plants. In order to gain a better understanding of the function of MBF1 in filamentous fungi, its interaction with TBP was demonstrated. The MBF1 and TBP homologs in B. bassiana were cloned and purified from a heterologous E. coli expression system. Whereas purified BbTBP was shown to be able to bind oligonucleotide sequences containing the TATA-motif (Kd ≈ 1.3 nM including sequences derived from the promoters of the B. bassiana chitinase and protease genes. In contrast, BbMBF1 was unable to bind to these same target sequences. However, the formation of a ternary complex between BbMBF1, BbTBP, and a TATA-containing target DNA sequence was seen in agarose gel electrophoretic mobility shift assays (EMSA. These data indicate that BbMBF1 forms direct interactions with BbTBP, and that the complex is capable of binding to DNA sequences containing TATA-motifs, confirming that BbTBP can link BbMBF1 to target sequences as part of the RNA transcriptional machinery in fungi.

  17. Ação do fungo Beauveria bassiana associado a gel polimerizado de celulose no controle do carrapato Anocentor nitens em teste de campo Action of the fungus Beauveria bassiana associated with cellulose polymerized gel in the control of the tick Anocentor nitens in a field test

    Directory of Open Access Journals (Sweden)

    E.J. Souza

    2009-02-01

    Full Text Available Foram selecionados 20 equídeos naturalmente infestados por Anocentor nitens, dos quais seus pavilhões auriculares foram submetidos a quatro tratamentos distintos: gel associado a Beauveria bassiana, apenas gel, apenas B. bassiana e um grupo-controle. Procederam-se à contagem e ao registro do número total de fêmeas adultas (>3mm em cada pavilhão auricular, nos dias 0, 1, 4, 7, 11, 14, 18, 21, 25 e 28, para cálculo do percentual de controle. Foram coletadas e mantidas em laboratório 20 fêmeas pertencentes a cada tratamento, para cálculo dos períodos de pré-postura, postura, incubação e eclosão, e peso médio das posturas. No grupo tratado com o composto gel associado a B. bassiana, observou-se percentual de controle maior que 50%, entre o 4º e o 25º dia, assim como decréscimo progressivo do peso médio da postura das fêmeas coletadas no período entre o 7º e 14º dia. Para os outros tratamentos, o percentual de controle manteve-se abaixo de 20%, e o peso da postura não apresentou diferença significativa. Os percentuais de controle, assim como as reduções no peso médio da postura, sugerem que a utilização do composto gel associado a B. bassiana potencializou a virulência do entomopatógeno.Twenty horses naturally infected by Anocentor nitens were selected and their auricular pinna were submitted to four treatments: gel associated with Beauveria bassiana, gel only, B. bassiana only, and a control group. The count and the register of the total number of grown up tick females (>3mm were performed in each auricular pinna on days 0, 1, 4, 7, 11, 14, 18, 21, 25, and 28 for the calculus of percentage of control. Twenty females from each treatment were collected and maintained in laboratory, to calculate the periods of pre-oviposition, oviposition, incubation, and hatching and mean weight of oviposition. In the group treated with the gel associated to B. bassiana, it was observed a control percentage higher than 50% from the 4º

  18. Molecular tracing of white muscardine in the silkworm, Bombyx mori (Linn.) II. Silkworm white muscardine is not caused by artificial release or natural epizootic of Beauveria bassiana in China.

    Science.gov (United States)

    Chen, Xue; Huang, Cui; He, Lingmin; Zhang, Shengli; Li, Zengzhi

    2015-02-01

    The fungal pathogen Beauveria bassiana causes serious economic losses in sericulture. Its origin is usually attributed to the release of B. bassiana insecticides against pine caterpillars (Dendrolimus punctuatus). In the present study, 488 B. bassiana isolates obtained from silkworm (Bombyx mori) collected from 13 Chinese provinces, and 327 B. bassiana isolates obtained from D. punctatus collected from 9 provinces, were analyzed for population genetic structure using the ISSR technique based on genetic distance. A UPGMA dendrogram clustered them into three independent clades: two B. mori clades and one D. punctatus clade. A 3-D principal component analysis further divided them into two completely independent host groups, revealing high host-specificity. This suggested that white muscardine occurring in B. mori populations throughout southern China was not caused by any B. bassiana strain either naturally prevailing in D. punctatus populations or by any strain artificially released as a fungal insecticide against D. punctatus. We further investigated the genetic differentiation coefficient Gst and gene flow between B. mori-pathogenic and D. punctatus-pathogenic B. bassiana isolates from across China and from five provinces inhabited by both B. mori and D. punctatus. The Gst value across China was computed as 0.410, while the values of the five provinces ranged from 0.508 to 0.689; all above 0.25, which is the threshold for significant genetic differentiation. This suggests that B. bassiana strains isolated from the two different hosts maintained their respective heredity without a convergent homogenization trend, and reduces the possibility that the host range of the caterpillar isolates could expand and enhance their virulence in B. mori. These findings indicate that the use of B. bassiana does not threaten the safety of sericulture. PMID:25541121

  19. Selection of optimum conditions of medium acidity and aeration for submerget cultivation of Bacillus thuringiensis and Beauveria bassiana

    Directory of Open Access Journals (Sweden)

    O. A. Dregval

    2010-06-01

    Full Text Available The paper deals with the influence of medium pH and aeration rate on growth and sporulation of Bacillus thuringiensis and Вeauveria bassiana, which are main constituents of the complex microbial insecticide. It was established optimal medium pH for B. thuringiensis – 6.0 and for В. bassiana – 6.0–7.0. The maximum productivity of the studied microorganisms was observed in the same range of aeration – 7– 14 mmol O2/l/h. The selected conditions of cultivation are necessary for the production of complex biological insecticide based on the association of B. thuringiensis and B. bassiana.

  20. Phylogeny and systematics of the anamorphic, entomopathogenic genus Beauveria

    Science.gov (United States)

    Beauveria is a cosmopolitan anamorph genus of arthropod pathogens that includes the agronomically important species B. bassiana and B. brongniartii, which are used as mycoinsecticides for the biological control of pest insects. Recent phylogenetic evidence demonstrates that Beauveria is monophyletic...

  1. Patogenicidade de Beauveria bassiana ao psilídeo Diaphorina citri e compatibilidade do fungo com produtos fitossanitários

    Directory of Open Access Journals (Sweden)

    Ana Paula Ferreira Pinto

    2012-12-01

    Full Text Available O objetivo deste trabalho foi avaliar a patogenicidade de Beauveria bassiana a ninfas de Diaphorina citri (Hemiptera: Psyllidae e verificar a compatibilidade do fungo com produtos fitossanitários e sua persistência em plantas de citros. Ninfas de D. citri foram pulverizadas com B. bassiana, nas concentrações 5x10(6, 1x10(7, 5x10(7, 1x10(8, 5x10(8 e 1x10(9 conídios mL-1, para determinação da concentração letal. Para avaliação da compatibilidade do fungo com produtos fitossanitários, extrato de nim e cinco inseticidas de quatro grupos químicos diferentes foram incorporados individualmente ao meio de cultura BDA em que o fungo foi cultivado. Avaliaram-se o crescimento vegetativo, a esporulação e a viabilidade do entomopatógeno. Plantas de citros, mantidas em casa de vegetação, foram tratadas primeiramente com os produtos fitossanitários e depois com o entomopatógeno. Avaliaram-se os tempos de exposição de 24 horas e de 7 e 14 dias. O fungo foi patogênico às ninfas de D. citri; a CL50 foi de 0,4x10(7 e a CL90 de 6,7x10(7 conidios mL-1, no décimo dia de avaliação. Em laboratório, os produtos fitosssanitários reduzem o crescimento do fungo. Em casa de vegetação, os produtos não afetam a sobrevivência do fungo nas plantas de citros.

  2. Biological Control of the Chagas Disease Vector Triatoma infestans with the Entomopathogenic Fungus Beauveria bassiana Combined with an Aggregation Cue: Field, Laboratory and Mathematical Modeling Assessment.

    Directory of Open Access Journals (Sweden)

    Lucas Forlani

    2015-05-01

    Full Text Available Current Chagas disease vector control strategies, based on chemical insecticide spraying, are growingly threatened by the emergence of pyrethroid-resistant Triatoma infestans populations in the Gran Chaco region of South America.We have already shown that the entomopathogenic fungus Beauveria bassiana has the ability to breach the insect cuticle and is effective both against pyrethroid-susceptible and pyrethroid-resistant T. infestans, in laboratory as well as field assays. It is also known that T. infestans cuticle lipids play a major role as contact aggregation pheromones. We estimated the effectiveness of pheromone-based infection boxes containing B. bassiana spores to kill indoor bugs, and its effect on the vector population dynamics. Laboratory assays were performed to estimate the effect of fungal infection on female reproductive parameters. The effect of insect exuviae as an aggregation signal in the performance of the infection boxes was estimated both in the laboratory and in the field. We developed a stage-specific matrix model of T. infestans to describe the fungal infection effects on insect population dynamics, and to analyze the performance of the biopesticide device in vector biological control.The pheromone-containing infective box is a promising new tool against indoor populations of this Chagas disease vector, with the number of boxes per house being the main driver of the reduction of the total domestic bug population. This ecologically safe approach is the first proven alternative to chemical insecticides in the control of T. infestans. The advantageous reduction in vector population by delayed-action fungal biopesticides in a contained environment is here shown supported by mathematical modeling.

  3. Targeting of insect epicuticular lipids by the entomopathogenic fungus Beauveria bassiana: hydrocarbon oxidation within the context of a host-pathogen interaction

    Directory of Open Access Journals (Sweden)

    Nicolas ePedrini

    2013-02-01

    Full Text Available Broad host range entomopathogenic fungi such as Beauveria bassiana attack insect hosts via attachment to cuticular substrata and the production of enzymes for the degradation and penetration of insect cuticle. The outermost epicuticular layer consists of a complex mixture of non-polar lipids including hydrocarbons, fatty acids, and wax esters. Long chain hydrocarbons are major components of the outer waxy layer of diverse insect species, where they serve to protect against desiccation and microbial parasites, and as recognition molecules or as a platform for semiochemicals. Insect pathogenic fungi have evolved mechanisms for overcoming this barrier, likely with sets of lipid degrading enzymes with overlapping substrate specificities.. Alkanes and fatty acids are substrates for a specific subset of fungal cytochrome P450 monooxygenases involved in insect hydrocarbon degradation. These enzymes activate alkanes by terminal oxidation to alcohols, which are further oxidized by alcohol and aldehyde dehydrogenases, whose products can enter β-oxidation pathways. B. bassiana contains at least 83 genes coding for cytochrome P450s (CYP, a subset of which are involved in hydrocarbon oxidation, and several of which represent new CYP subfamilies/families. Expression data indicated differential induction by alkanes and insect lipids and 4 CYP proteins have been partially characterized after heterologous expression in yeast. Gene knockouts revealed a phenotype for only one (cyp52X1 out of 6 genes examined to date. CYP52X1 oxidizes long chain fatty acids and participates in the degradation of specific epicuticular lipid components needed for breaching the insect waxy layer. Examining the hydrocarbon oxidizing CYP repertoire of pathogens involved in insect epicuticle degradation can lead to the characterization of enzymes with novel substrate specificities. Pathogen targeting may also represent an important co-evolutionary process regarding insect cuticular

  4. SELECTION OF BEAUVERIA BASSIANA (BALSAMO VUILLEMIN ISOLATES FOR MANAGEMENT OF MYZUS PERSICAE (SULTZAR (HOM.: APHIDAE BASED ON VIRULENCE AND GROWTH RELATED CHARACTERISTICS

    Directory of Open Access Journals (Sweden)

    Mohammad S. Al-alawi

    2014-01-01

    Full Text Available Isolates of the entomopathogenic fungus Beauveria bassiana originated from Jordan were evaluated for their efficacy against the green peach aphid, Myzus persicae under laboratory and greenhouse conditions. Efficacy evaluation involved testing all isolates at a concentration of 1×107 conidia/mL followed by concentration dependent and greenhouse bioassays for the top virulent isolates. Growth characteristics related to virulence were evaluated for high, intermediate and low virulent isolates. Results showed that three isolates namely: BAU004, BAU018 and BAU019 were highly virulent to the aphid in the laboratory causing more than 75% infection. In the greenhouse, the three isolates caused infection from 41.3 to 46.5%. For the growth characteristics, isolate BAU019 produced more spores than the other highly virulent ones including the commercial isolate GHA. Highly virulent isolates also showed faster hyphal growth than low virulent isolates. These findings indicate that isolates BAU004, Bau018 and BAU019 might be developed as commercial microbial insecticides for safe and effective control of green peach aphid.

  5. Impact of two treatments of a formulation of Beauveria bassiana (Deuteromycota: Hyphomycetes) conidia on Varroa mites (Acari: Varroidae) and on honeybee (Hymenoptera: Apidae) colony health.

    Science.gov (United States)

    Meikle, William G; Mercadier, Guy; Holst, Niels; Girod, Vincent

    2008-12-01

    Bee colonies in southern France were treated with conidia (asexual spores) from two strains of Beauveria bassiana, an entomopathogenic fungus. One strain was commercial (GHA) and the other had been isolated from Varroa mites in the region (Bb05002). Objectives were to evaluate treatment effect on colony weight, adult bee mass, capped brood, and on Varroa fall onto sticky boards. Treatments included conidia formulated with either carnauba or candelilla wax powder, candelilla wax powder alone, or control; in two treatment groups formulation was applied a second time after one week. Treatment did not affect colony health. Colonies treated twice with Bb05002 conidia and carnauba wax powder had significantly higher mite fall compared to colonies treated with blank candelilla wax powder. The proportion of fallen mites that were infected in both conidia treatments was higher than controls for 18 days after the second treatment. The number of fungal propagules on the bees themselves remained elevated for about 14 days after the second treatment. These results were compared to published results from previous experiments with regard to infection duration. PMID:18506583

  6. Survival Rate and Transcriptional Response upon Infection with the Generalist Parasite Beauveria bassiana in a World-Wide Sample of Drosophila melanogaster.

    Directory of Open Access Journals (Sweden)

    Francesco Paparazzo

    Full Text Available The ability to cope with infection by a parasite is one of the major challenges for any host species and is a major driver of evolution. Parasite pressure differs between habitats. It is thought to be higher in tropical regions compared to temporal ones. We infected Drosophila melanogaster from two tropical (Malaysia and Zimbabwe and two temperate populations (the Netherlands and North Carolina with the generalist entomopathogenic fungus Beauveria bassiana to examine if adaptation to local parasite pressures led to differences in resistance. Contrary to previous findings we observed increased survival in temperate populations. This, however, is not due to increased resistance to infection per se, but rather the consequence of a higher general vigor of the temperate populations. We also assessed transcriptional response to infection within these flies eight and 24 hours after infection. Only few genes were induced at the earlier time point, most of which are involved in detoxification. In contrast, we identified more than 4,000 genes that changed their expression state after 24 hours. This response was generally conserved over all populations with only few genes being uniquely regulated in the temperate populations. We furthermore found that the American population was transcriptionally highly diverged from all other populations concerning basal levels of gene expression. This was particularly true for stress and immune response genes, which might be the genetic basis for their elevated vigor.

  7. Patogenitas Beberapa Cendawan Entomopatogen (Lecanicillium lecanii, Metarhizium anisopliae, dan Beauveria bassiana)terhadap Aphis glycines pada Tanaman Kedelai

    OpenAIRE

    Widariyanto, Riri

    2016-01-01

    The objectives of the research were to study the effectiveness of entomopatogen’s fungus ( L. Lecanii, M. Anisopliae, and B. bassiana) to Aphis glycines in soybean on field. Research done at Farm of Faculty of Agriculture of University of Sumatera Utara, Medan from December 2015 until Februari 2016. The method used Randomized Block Design by seven treatment that is : P0/control (Instar 4 of Aphis glycines without treatment Entomopathogen), P1 (Instar 2 of Aphis glycines + Lecanicillium lecani...

  8. Soil application of Beauveria bassiana GHA against apple sawfly, Hoplocampa testudinea (Hymenoptera: Tenthredinidae)

    DEFF Research Database (Denmark)

    Świergiel, Weronika; Meyling, Nicolai Vitt; Porcel, Mario;

    2016-01-01

    ) Vuillemin (BotaniGard) against apple sawfly under common organic orchard practices. We also assessed the efficacy of B. bassiana GHA and Metarhizium brunneum Petch (indigenous strain) against sawfly in the laboratory. Larvae treated with either fungus in the laboratory died faster than control larvae and......, but reversion to background levels occurred within a year. It remains to be investigated whether this has a detrimental effect on nontarget organisms. Additional work is needed to bridge the knowledge gap between laboratory and field efficacy in orchards....

  9. A New Dibenz[b,e]oxepine Derivative, 1-Hydroxy-10-methoxy-dibenz[b,e]oxepin-6,11-dione, from a Marine-Derived Fungus, Beauveria bassiana TPU942

    Directory of Open Access Journals (Sweden)

    Michio Namikoshi

    2012-11-01

    Full Text Available 1-Hydroxy-10-methoxy-dibenz[b,e]oxepin-6,11-dione (1 was obtained from the culture broth of a marine-derived fungus, Beauveria bassiana TPU942, isolated from a marine sponge collected at Iriomote Island in Okinawa, together with two known compounds, chrysazin (2 and globosuxanthone A (3. The structure of 1 was elucidated on the basis of its spectroscopic data (HREIMS, 1D and 2D NMR experiments including 1H–1H COSY, HMQC and HMBC spectra. Dibenz[b,e]oxepines are rare in nature, and only six natural products have been reported. Therefore, compound 1 is the seventh natural product in this class. Compounds 2 and 3 showed an antifungal activity against Candida albicans, and 3 inhibited the cell growth against two human cancer cell lines, HCT-15 (colon and Jurkat (T-cell lymphoma. Compound 1 did not show an apparent activity in the same bioassays.

  10. Réponse des stades larvaires de Helicoverpa armigera (Hübner (Lepidoptera : Noctuidae à l'application de champignons entomopathogènes Metarhizium anisopliae et Beauveria bassiana

    Directory of Open Access Journals (Sweden)

    Tamò, M.

    2012-01-01

    Full Text Available Response of the nymphs of Helicoverpa armigera (Hübner (Lepidoptera: Noctuidae to entomopathogenic fungi Metarhizium anisopliae and Beauveria bassiana. Two experiments on dose/mortality response between the instars of Helicoverpa armigera and two strains of entomopathogenic fungi, Metarhizium anisopliae (Met 31 and Beauveria bassiana (Bb 11 were carried out in laboratory conditions. In the first experiment, M. anisopliae Met 31 was tested on the third instar of H. armigera, while in the second experiment, both Met 31 and Bb 11 were tested on the fourth instar. In all the experiments, the following different doses of conidia per insect were used: 104, 105, 106, 107. The following parameters were measured: mortality and sporulation rates, the number of pupae formed and the number of adults that emerged. Abbott's formula was used to correct the treatment mortality rates. LD50 was determined using Cox-regression. For the third instar in experiment one, no significant difference was observed between high doses (106 and 107 conidia per insect. For instar L4, only the dose of 107 conidia per insect showed high mortality rates (74%. For the strain Bb 11, in spite of the variation observed between the mortality rates induced by high doses (106 and 107 conidia per insect, no significant difference was recorded at the 5% level. No mycosis was observed from cadavers resulting from lower doses when tested on L4. The control recorded the highest numbers of pupae and adults. These two parameters were related to the level of dosage: the higher the dose, the lower the numbers of pupae and adults that emerged. For all the strains of fungi used, whatever the larval stage of H. armigera, the dose/mortality response was significant.

  11. Antagonism of Beauveria bassiana against Two Fusarium spp.Pathogenic to Cotton%球孢白僵菌对两种植物病原镰孢的拮抗作用

    Institute of Scientific and Technical Information of China (English)

    张胜利; 李增智

    2011-01-01

    体外测定了球孢白僵菌Beauveria bassiana对两种棉花病原镰孢——棉花枯萎病菌Fusarium oxysporium f.sp.vasinfecturn和棉花红腐病菌Fusarium verticillioides的拮抗作用。平板对峙培养时,两种镰孢的生长均受到明显抑制。不同含孢量的球孢白僵菌对两种镰孢的抑制效果不同,且抑制率与孢子浓度成显著的线性量效关系;在接种量为6×107孢子.mL-1时,对两种菌的抑制率均达到90%以上,对红腐病菌的抑制率稍高。白僵菌代谢液对两种植物病原菌也表现出抑菌作%In vitro antagonism of Beauveria bassiana,an entomopathogenic fungus,was tested against Fusarium oxysporium f.sp.vasinfecturn,pathogen of cotton wilt,and F.verticillioides,pathogen of cotton red rot.On dual culture,B.bassiana showed obvious inhibition on the growth of the two pathogens.Different doses of conidia had different inhibitory effects,with inhibition rate linearly correlated to inoculum,suggesting that the antagonism was associated with competition for nutrition and space.The inhibition on the two pathogens was both over 90% at inoculum of 6×107 spores·mL-1,slightly higher on F.verticillioide.The metabolite in SDY shake culture of B.bassiana also displayed inhibition,with inhibition rate linearly correlated to metabolite concentration,suggesting that the antagonism was also associated with antibiotic substances.Based on the comparison of inhibition rates,antibiosis was considered to contribute more than competition.In the analysis on the antibiotic metabolite,none of the lyophilized supernatant extracted by 4 different organic extractants showed obvious inhibition on the Fusarium spp.,while addition of crude extract of either polysaccharide or protein significantly inhibited mycelium growth of the two Fusarium spp.,suggesting that the main inhibitory substances are polysaccharide and protein with high molecular weight.

  12. Evaluacion del efecto de Beauveria bassiana en el control biológico de Varroa destructor, parasito de la abeja melífera (Apis mellifera en la finca Felisa en el municipio de los Patios, Norte de Santander - Evaluacion del efecto de Beauveria bassiana en el control biológico de Varroa destructor, parasito de la abeja melífera (Apis mellifera en la finca Felisa en el municipio de los Patios, Norte de Santander

    Directory of Open Access Journals (Sweden)

    Francy Liliana Duarte

    2013-08-01

    Full Text Available Beekeeping is an activity that produces significant benefits to agriculture and the environment; Through the pollination action of bees helps to increase productivity as well as biodiversity in the ecosystem. In recent years, has significantly increased prevalence of parasites in this species, particularly the Varroasis, a disease caused by the mite Varroa destructor. The causal agent produces losses between 30% and 50% of total production and in turn can cause damage to the quality of honey by the excessive use of chemicals for disease control and the slow and progressive deterioration health of producers. Noting this, we evaluated the incidence of fungus Beauveria bassiana in natural populations of Varroa destructor in acarofauna associated, and the remains of the hive by pathogenicity tests in laboratory conditions to evaluate the effect of the biocontrol entomopathogenic then enter in apiaries infected with the disease. According to the results obtained in the adult infestation of V. destructor in Apis mellifera Africanized sampling Felisa made on the farm in the municipality of Los Patios, recorded rates of infestation in hives from 3.4% to 8.3% on the infection status of breeding was 4.5% to 13.7%. In laboratory tests it was possible to observe thatthe fungus B. bassiana attacked by an effective control mites without harming bees, propolis and honey allowing the insect to continue their normal activities, controlling the disease in a biological, not chemical.

  13. Integrated use of Beauveria bassiana and Bacillus thuringiensis serovar.tenebrionis for microbial biocontrol of colorado potato beetle%球孢白僵菌和苏云金杆菌拟步甲血清亚种联合使用防治马铃薯甲

    Institute of Scientific and Technical Information of China (English)

    斯蒂芬· 瑞特; Mark A Ramos

    2007-01-01

    This paper reviews the potential for using insect pathogens to control the Colorado potato beetle,Leptinotarsa decemlineata,and summarizes results from nearly 10 years of research by USDA-ARS-PPRU scientists aimed at developing methods and strategies for integrated use of Bacillus thuringiensis and Beauveria bassiana for biologically-based management of potato beetles in the northeastern USA.The described studies have resulted in 1) design of a tractor-mounted hydraulic spray system that improved targeting and consequent efficacy of microbial control agents, 2) discovery of synergism between the bacterial pathogen Bacillus thuringiensis (Bt) and the fungal pathogen Beauveria bassiana (Bb),3) findings that substantial mortality of beetle larvae treated with B.bassiana during foliar spray programs did not occur until after they entered the soil to pupate, and 4) observations that spray applications made in the evening (at sunset) were significantly, but not substantially, more effective than applications made during the morning hours.These findings have led to development of a bio-based pest management system based on three spray applications made in the following order at 3-5-day intervals:Bt alone,Bt and Bb mixed,and Bb alone.This spray program,with the applications initiated at 50% egg hatch,is intended to control the actively feeding larval stages (providing protection from defoliation) and reduce survivorship to the adult stage (providing long-term control by reducing populations of overwintering adults). In the initial test of the integrated management system,beetle control and potato yields were statistically equivalent to those in plots in which the beetles were controlled with chemical insecticides.Demonstration of the effectiveness of this program will continue over the next 2-3 field seasons.

  14. Caracterización molecular de 15 aislamientos de Beauveria bassiana asociados con Cosmopolites y Metamasius en plátano y banano en tres regiones de Colombia

    Directory of Open Access Journals (Sweden)

    Muñoz Flórez Jaime Eduardo

    2008-09-01

    Full Text Available Se colectaron picudos de Cosmopolites y Metamasius en municipios del Valle del Cauca, Caldas y Quindío. Se obtuvieron cultivos monospóricos con diluciones de 10-10 y 10-11. Los aislamientos fueron almacenados a -80°C con glicerol al 10% y el ADN a –20°C. Los marcadores moleculares RAM generaron 82 fragmentos de los cuales 67% fueron polimórficos con una heterocigocidad de 0.24, que indica diversidad media a alta. A un índice de similitud 0.84 se formaron 5 grupos: uno con 11 aislamientos y 4 con un solo aislamiento. En el gran grupo se detectó un duplicado y se encontró diversidad del hongo en los sitios muestreados. No se encontró relación entre aislamientos sobre Cosmopolites y Metamasius o zona geográfica en la formación de grupos genéticos.

  15. Rosalia longicorn Rosalia alpina (LINNAEUS, 1758 (Coleoptera: Cerambycidae as a host of the entomopathogenic fungus Cordyceps bassiana LI, LI, HUANG

    Directory of Open Access Journals (Sweden)

    Bartnik Czesław

    2016-06-01

    Full Text Available The paper describes, for the first time, the occurrence of the entomopathogenic fungus Cordyceps bassiana (anamorph: Beauveria bassiana on the imago of the endangered beetle Rosalia longicorn Rosalia alpina from the Low Beskid Mountains (the Carpathians, SE Poland. Furthermore, an isolate of the saprotrophic fungus Hypoxylon fragiforme was obtained as a result of laboratory tests on R. alpina specimens. Relationships between the identified fungi and R. alpina are discussed.

  16. Efectividad de Aislamientos de Hongos Entomopatógenos Sobre Larvas de Polilla del Tomate Tuta absoluta Meyrick (Lepidoptera: Gelechiidae) Effectivity of Entomopathogenic Fungus Strains on Tomato Moth Tuta absoluta Meyrick (Lepidoptera: Gelechiidae) Larvae

    OpenAIRE

    Marta Rodríguez; Marcos Gerding; Andrés France

    2006-01-01

    La polilla del tomate, Tuta absoluta Meyrick, es una plaga importante en el cultivo del tomate (Lycopersicon esculentum L.) en Chile. Estudios de laboratorio fueron realizados para evaluar la virulencia y efectividad de Qu-M558 de Metarhizium anisopliae var. anisopliae y Qu-B912 de Beauveria bassiana. La primera evaluación fue realizada aplicando concentraciones de 0 a 10(8) conidia mL-1 directamente sobre larvas de tercer estadio mediante el sistema de pulverización torre Potter. Las compara...

  17. Effects of multiple applications of a Beauveria based biopesticide on Varroa destructor (Acari: Varroidae) densities in honey bee (Hymenoptera: Apidae) colonies

    Science.gov (United States)

    A biopesticide, formulated with a strain of Beauveria bassiana isolated from varroa mites, was tested in an experiment in southern France and the results were were compared to published results from previous experiments with the same biopesticide. Bee colonies were treated either with biopesticide, ...

  18. Development of a method for detection and quantification of B. brongniartii and B. bassiana in soil.

    Science.gov (United States)

    Canfora, L; Malusà, E; Tkaczuk, C; Tartanus, M; Łabanowska, B H; Pinzari, F

    2016-01-01

    A culture independent method based on qPCR was developed for the detection and quantification of two fungal inoculants in soil. The aim was to adapt a genotyping approach based on SSR (Simple Sequence Repeat) marker to a discriminating tracing of two different species of bioinoculants in soil, after their in-field release. Two entomopathogenic fungi, Beauveria bassiana and B. brongniartii, were traced and quantified in soil samples obtained from field trials. These two fungal species were used as biological agents in Poland to control Melolontha melolontha (European cockchafer), whose larvae live in soil menacing horticultural crops. Specificity of SSR markers was verified using controls consisting of: i) soil samples containing fungal spores of B. bassiana and B. brongniartii in known dilutions; ii) the DNA of the fungal microorganisms; iii) soil samples singly inoculated with each fungus species. An initial evaluation of the protocol was performed with analyses of soil DNA and mycelial DNA. Further, the simultaneous detection and quantification of B. bassiana and B. brongniartii in soil was achieved in field samples after application of the bio-inoculants. The protocol can be considered as a relatively low cost solution for the detection, identification and traceability of fungal bio-inoculants in soil. PMID:26975931

  19. 不同温度下白僵菌Bb04菌株对红火蚁工蚁的致病力%Pathogenicity of strain Bb04 of Beauveria bassiana (Bals) Vuill. to red imported fire ant workers under different temperatures

    Institute of Scientific and Technical Information of China (English)

    刘晓燕; 吕利华; 何余容

    2014-01-01

    Red imported fire ant ( RIFA) , Solenopsis invicta Buren, is one of the most devastating pests in the world . Entomopathengenic fungi have been applied to control many crops insect pests successfully worldwide and may be a promising control for RIFA.The effect of temperature on pathogenicity of strain Bb 04 of Bearveria bassiana, a suitable candidate to the RIFA workers , was studied in the laboratory .[Method]The RIFA workers were infected with two concentrations of B.bassiana spore suspension (1 ×105 conidia· mL-1 and 1 ×108 conidia· mL-1 ) and kept under 17, 21, 25, 29 and 33 ℃ conditions.[Result]The results showed there were significant differences in virulence of Bb 04 to RIFA under different temperatures .When workers of RIFA were treated with 1 ×108 conidia· mL-1 , the total mortality of infected RIFA after 15 days reached as high as 100%under 21℃, 25℃and 29 ℃.Total mortality was 99.36%at 17 ℃and 98.74%at 33 ℃.However, after 15 days with an infection rate of 1 ×105 conidia/mL, total mortalities of treated workers at 17 ℃, 21 ℃, 25 ℃, 29 ℃and 33 ℃were only 16.83%, 29.42%,36.18%, 33.17%and 27.21%, respectively .At 17, 21 and 25 ℃, LT50 values of Bb04 against RIFA decreased from 5.41 at 17℃to 3.88 at 21 ℃and then 2.57 days at 25℃.LT50 increased again to 2.97 at 29℃and 5.11 at 33℃.[Conclusion and significance]25 ℃was the most effective temperature to promote infection of RIFA by Bb 04 and should be applied in both spring and autumn in the field .%【背景】白僵菌是一种应用最广泛的虫生真菌,已被用于工厂化大量生产,可防治多种农林害虫。【方法】试验设置17、21、25、29和33℃5个温度水平,采用喷雾法,将浓度为1×105和1×108个· mL-1的白僵菌孢子悬浮液分别感染红火蚁工蚁,以测试不同温度下白僵菌菌株对红火蚁工蚁的致病力。【结果】当浓度为1×108个· mL-1时,在21、25和29℃条件下,红火蚁工蚁在15 d

  20. 75 FR 10186 - Beauveria bassiana HF23; Amendment of Exemption from the Requirement of a Tolerance

    Science.gov (United States)

    2010-03-05

    ... evaluated whether there is any potential for residues of the pesticide to result in or on meat, milk... requirement for a tolerance (the legal limit for a pesticide chemical residue in or on a food) only if EPA... exposure of infants and children to the pesticide chemical residue in ] establishing a tolerance and...

  1. The characteristics of keratomycosis by Beauveria bassiana and its successful treatment with antimycotic agents

    OpenAIRE

    Hiroko Sonoyama; Kaoru Araki-Sasaki; Shigeyasu Kazama; Tsutomu Kawasaki; Hidenao Ideta; et al

    2008-01-01

    Hiroko Sonoyama1, Kaoru Araki-Sasaki1, Shigeyasu Kazama1, Tsutomu Kawasaki1, Hidenao Ideta1, Atsuko Sunada2, Seishi Asari2, Yoshitsugu Inoue3, Kozaburo Hayashi41Ideta Eye Hospital, Kumamoto, Kumamoto, Japan; 2Department of Laboratory for Clinical Investigation, Osaka University Hospital, Suita, Osaka, Japan; 3Division of Ophthalmology and Visual Science, Department of Medicine of Sensory and Motor Organ, Tottori University, Yonago, Tottori, Japan; 4Immunology and Virology Section Lab, Immunol...

  2. Imbibitional damage in conidia of the entomopathogenic fungi Beauveria bassiana, Metarhizium anisopliae, and Metarhizium acridum

    Science.gov (United States)

    When dried organisms are immersed in water, rapid imbibition may cause severe damage to plasma membranes; in unicellular organisms, such damage is usually lethal. This study investigated effects of pre-immersion moisture levels and immersion temperature on imbibitional damage in three insect pathoge...

  3. Compatibility between the entomopathogenic fungus Beauveria bassiana and insecticides used in coffee plantations Compatibilidade entre o fungo entomopatogênico Beauveria bassiana e inseticidas usados na cultura do cafeeiro

    OpenAIRE

    Carolina Natali de Oliveira; Pedro Manuel Oliveira Janeiro Neves; Lídio Sueki Kawazoe

    2003-01-01

    Microbial control in integrated pest management (IPM) programs of coffee plantations is an important factor for the reduction of pest population densities. The use of selective pesticides can be associated with entomopathogens, increasing the efficiency of the control and reducing the use of required insecticides. The in vitro fungitoxic effect of insecticide formulations of Thiamethoxam, Cyfluthrin, Deltamethrin, Alpha-Cypermethrin, Triazophos, Chlorpyrifos, Fenpropathrin and Endosulfan and ...

  4. In vitro compatibility between three bacterial sugarbeet disease-control agents and the entomopathogenic fungi, Metarhizium anisopliae and Beauveria bassiana

    Science.gov (United States)

    The rhizosphere is the primary arean for entomopathogenic fungi (EPF) deployed against soil-dwelling pests, and is also the site of action of biological agents used against root pathogens. Interactions between EPF and soil microbes, much less biofungicidal agents, have been barely studied, however, ...

  5. Efectividad de Aislamientos de Hongos Entomopatógenos Sobre Larvas de Polilla del Tomate Tuta absoluta Meyrick (Lepidoptera: Gelechiidae Effectivity of Entomopathogenic Fungus Strains on Tomato Moth Tuta absoluta Meyrick (Lepidoptera: Gelechiidae Larvae

    Directory of Open Access Journals (Sweden)

    Marta Rodríguez

    2006-06-01

    Full Text Available La polilla del tomate, Tuta absoluta Meyrick, es una plaga importante en el cultivo del tomate (Lycopersicon esculentum L. en Chile. Estudios de laboratorio fueron realizados para evaluar la virulencia y efectividad de Qu-M558 de Metarhizium anisopliae var. anisopliae y Qu-B912 de Beauveria bassiana. La primera evaluación fue realizada aplicando concentraciones de 0 a 10(8 conidia mL-1 directamente sobre larvas de tercer estadio mediante el sistema de pulverización torre Potter. Las comparaciones fueron realizadas calculando el área bajo la curva del progreso de la mortalidad a través del tiempo. No se observaron diferencias en las áreas entre aislamientos (P = 0,384. La CL50 y CL90 para Qu-B912 fue de 10(4,4 y 10(7,6 conidias mL-1, y para Qu-M558 de 10(5,4 y 10(9,1 conidias mL-1,respectivamente. Un segundo estudio fue realizado aplicando sobre hojas de tomate suspensiones de 0 a 10(8 conidias mL-1 del aislamiento Qu-B912, a través de la torre de pulverización Potter. Larvas del tercer estadio de T. absoluta fueron alimentadas con estas hojas infectadas. Trece días después de la inoculación los porcentajes de mortalidad alcanzaron un 68% a la máxima concentración de inóculo.The tomato moth, Tuta absoluta Meyrick, is a serious pest on tomatoes (Lycopersicon esculentum L. crops in Chile. Laboratory studies were conducted to evaluate the virulence and effectiveness of the isolates Metarhizium anisopliae var. anisopliae isolate Qu-M558 and Beauveria bassiana isolate Qu-B912, on third instar of T. absoluta larvae. The first evaluation was carried out spraying directly on third instar larvae, spore suspensions (0 to 10(8 conidia mL-1 of each isolate through a Potter tower. Comparisons were made by calculating the area under a mortality progress curve. Differences were not observed in the areas between isolates (P = 0.384. The LC50 and LC90 for Qu-B912 were 10(4.4 and 10(7.6 conidia mL-1, and for Qu-M558 were 10(5.4 and 10(9.1 conidia mL-1

  6. Development of a CO2 releasing co-formulation 1 based on starch, Saccharomyces cerevisiae and Beauveria bassiana attractive towards western corn rootworm larvae

    Science.gov (United States)

    CO2 is known as an attractant for many soil-dwelling pests. To implement an attract-and-kill strategy for soil pest control, CO2 emitting formulations need to be developed. This work aimed at the development of a slow release bead system in order to bridge the gap between application and hatching of...

  7. The entomopathogenic fungus Beauveria bassiana reduces instantaneous blood feeding in wild multi-insecticide-resistant Culex quinquefasciatus mosquitoes in Benin, West Africa

    NARCIS (Netherlands)

    A.F.V. Howard; R. N'Guessan; C.J.M. Koenraadt; A. Asidi; M. Farenhorst; M. Akogbeto; M.B. Thomas; B.G.J. Knols; W. Takken

    2010-01-01

    Background: Mosquito-borne diseases are still a major health risk in many developing countries, and the emergence of multi-insecticide-resistant mosquitoes is threatening the future of vector control. Therefore, new tools that can manage resistant mosquitoes are required. Laboratory studies show tha

  8. DEVELOPMENT OF A BIOASSAY SYSTEM FOR THE PREDATOR XYLOCORIS FLAVIPES (REUTER) AND ITS USE IN SUBCHRONIC TOXICITY/PATHOGENICITY STUDIES OF BEAUVERIA BASSIANA (BALS.) VUILL. STRAIN GHA.

    Science.gov (United States)

    Microbial biocontrol agents are useful commercially only if they do not harm other natural biocontrol organisms, at recommended use rate in the environment where the microorganism is being used. To test the hypothesis that the predatory warehouse pirate bug, Xylocoris flavipes (Reuter), is not adve...

  9. Synergistic interaction between the fungus Beauveria bassiana and desiccant dusts applied against poultry red mites (Dermanyssus gallinae)

    DEFF Research Database (Denmark)

    Steenberg, Tove; Kilpinen, Ole Østerlund

    2014-01-01

    The poultry red mite, Dermanyssus gallinae, is a major pest in egg production, feeding on laying hens. Widely used non-chemical control methods include desiccant dusts, although their persistence under field conditions is often short. Entomopathogenic fungi may also hold potential for mite contro...

  10. Assessing deposition and persistence of Beauveria bassiana GHA (Ascomycota: Hypocreales) applied for control of emerald ash borer, Agrilus planipennis (Coleoptera: Buprestidae), in a commercial tree nursery

    Science.gov (United States)

    Determining the deposition and field persistence of mycoinsecticides is essential in the development of effective and economical application strategies, including specifically the timing and frequency of spray applications. In this study we used three methods to evaluate the persistence of Beauveri...

  11. Tri-Tek (Petroleum Horticultural Oil) and Beauveria bassiana: Use in Eradication Strategies for Bemisia tabaci Mediterranean Species in UK Glasshouses

    OpenAIRE

    Cuthbertson, Andrew G. S.; Collins, Debbie A.

    2015-01-01

    The sweetpotato whitefly Bemisia tabaci (Gennadius) (Hemiptera: Aleyrodidae) is a pest of global importance on both outdoor and glasshouse crops. To date, B. tabaci has not become established in the UK. The UK holds Protected Zone status against this pest and, as a result, B. tabaci entering on plant material is subjected to a policy of eradication. Mediterranean species is now the most prevalent Bemisia species entering the UK. Increasing neonicotinoid resistance is becoming increasingly wid...

  12. Metabolic profiles and free radical scavenging activity of Cordyceps bassiana fruiting bodies according to developmental stage.

    Directory of Open Access Journals (Sweden)

    Sun-Hee Hyun

    Full Text Available The metabolic profiles of Cordyceps bassiana according to fruiting body developmental stage were investigated using gas chromatography-mass spectrometry. We were able to detect 62 metabolites, including 48 metabolites from 70% methanol extracts and 14 metabolites from 100% n-hexane extracts. These metabolites were classified as alcohols, amino acids, organic acids, phosphoric acids, purine nucleosides and bases, sugars, saturated fatty acids, unsaturated fatty acids, or fatty amides. Significant changes in metabolite levels were found according to developmental stage. Relative levels of amino acids, purine nucleosides, and sugars were higher in development stage 3 than in the other stages. Among the amino acids, valine, isoleucine, lysine, histidine, glutamine, and aspartic acid, which are associated with ABC transporters and aminoacyl-tRNA biosynthesis, also showed higher levels in stage 3 samples. The free radical scavenging activities, which were significantly higher in stage 3 than in the other stages, showed a positive correlation with purine nucleoside metabolites such as adenosine, guanosine, and inosine. These results not only show metabolic profiles, but also suggest the metabolic pathways associated with fruiting body development stages in cultivated C. bassiana.

  13. Drug: D09176 [KEGG MEDICUS

    Lifescience Database Archive (English)

    Full Text Available bassiana Vuillemin.; Standards for non-pharmacopoeial crude drugs Crude drugs [BR:br08305] Animals Insects D09176 Stiff silkworm PubChem: 96025856 ... ...91], Beauveria bassiana [TAX:176275] Same as: E00308 Bombycidae Silkworm infected Cordycepitaceae Beauveria

  14. Optimization of cyclosporin A production by Beauveria nivea in continuous fed-batch fermentation

    Directory of Open Access Journals (Sweden)

    Dong Huijun

    2011-01-01

    Full Text Available To develop the effective control method for fed-batch culture of cyclosporin A production, we chose fructose, L-valine and (NH42HPO4 as feeding nutrients and compared their productivities in relation to different concentrations. The feeding rate of three kinds of feeding materials was controlled to maintain the suitable residual concentration. The fed-batch fermentation results indicated that the optimal concentrations of fructose, L-valine and (NH42HPO4 were about 20 g/L, 0.5 g/L and 0.6 g/L for cyclosporin A production, respectively. The cultivation of Beauveria nivea could produce cyclosporin A up to 6.2 g/L for 240 hrs through a continuous feeding-rate-controlled-batch process under the optimal feeding conditions.

  15. Beauveria brongniartii Sacc. (Petch) against Melolontha spp. white grubs in forest nurseries with different soil pH

    OpenAIRE

    Sierpińska Alicja; Popowska-Nowak Elżbieta; Bednarek Andrzej

    2015-01-01

    In 2011, the General Directorate of State Forests in Poland managed 669 forest nurseries on the total area of 2411 ha that produced forest tree seedlings bare root systems, hence vulnerable to Melolontha spp. white grubs. Up to date, no chemical or biological plant protection product for control of cockchafer grubs in forests has been registered in Poland. The study was carried out with the aim to evaluate the efficacy of a biocontrol product Bovecol with BP strain of Beauveria brongniartii o...

  16. Selección de Aislamientos de Hongos Entomopatógenos para el Control de Huevos de la Polilla del Tomate, Tuta absoluta Meyrick (Lepidoptera: gelechiidae) Entomopathogenic Fungi Isolates Selection for Egg Control of Tomato Moth Tuta absoluta Meyrick (Lepidoptera: gelechiidae) Eggs

    OpenAIRE

    Marta Rodríguez S.; Marcos Gerding P.; Andrés France

    2006-01-01

    Se realizó un estudio en laboratorio sobre la patogenicidad de 64 aislamientos de Metarhizium anisopliae var. anisopliae y 70 de Beauveria bassiana, en huevos de polilla del tomate Tuta absoluta. La primera evaluación se realizó por aplicación directa de suspensiones de 10(7) conidias mL-1 para cada aislamiento, con el sistema de pulverización de la torre de Potter. La mortalidad y esporulación sobre huevos fueron significativamente mayores con los aislamientos M. anisopliae Qu-M558 y B. bass...

  17. Selección de cepas de hongos entomopatógenos para el manejo de anastrepha obliqua (macquart, 1835) (diptera: tephritidae) en colombia

    OpenAIRE

    Osorio-Fajardo, Armando; Nelson A Canal

    2011-01-01

    Se evaluaron 15 cepas de los hongos entomopatógenos Beauveria bassiana y Metarhizium anisopliae sobre adultos de un día de edad de la mosca de la fruta Anastrepha obliqua. El trabajo se realizó con el fin de seleccionar las cepas más virulentas al insecto y estudiar el efecto sobre los adultos jóvenes cuando el hongo era aplicado antes de la emergencia. Mediante un screening con una concentración de 1x107 conidias/mL se seleccionaron las tres cepas más virulentas, siendo dos de ellas de Beauv...

  18. Cyclodepsipeptides and Other O-Containing Heterocyclic Metabolites from Beauveria felina EN-135, a Marine-Derived Entomopathogenic Fungus

    Directory of Open Access Journals (Sweden)

    Feng-Yu Du

    2014-05-01

    Full Text Available Bioassay-guided fractionation of a culture extract of Beauveria felina EN-135, an entomopathogenic fungus isolated from a marine bryozoan, led to the isolation of a new cyclodepsipeptide, iso-isariin D (1; two new O-containing heterocyclic compounds that we have named felinones A and B (2 and 3; and four known cyclodepsipeptides (4–7. The structures were elucidated via spectroscopic analysis, and the absolute configurations of 1 and 2 were determined using single-crystal X-ray diffraction and CD, respectively. All isolated compounds were evaluated for antimicrobial activity and brine-shrimp (Artemia salina lethality.

  19. A multi-screening approach for marine-derived fungal metabolites and the isolation of cyclodepsipeptides from Beauveria felina

    International Nuclear Information System (INIS)

    Extracts obtained from 57 marine-derived fungal strains were analyzed by HPLC-PDA, TLC and 1H NMR. The analyses showed that the growth conditions affected the chemical profile of crude extracts. Furthermore, the majority of fungal strains which produced either bioactive of chemically distinctive crude extracts have been isolated from sediments or marine algae. The chemical investigation of the antimycobacterial and cytotoxic crude extract obtained from two strains of the fungus Beauveria felina have yielded cyclodepsipeptides related to destruxins. The present approach constitutes a valuable tool for the selection of fungal strains that produce chemically interesting or biologically active secondary metabolites. (author)

  20. A multi-screening approach for marine-derived fungal metabolites and the isolation of cyclodepsipeptides from Beauveria felina

    Energy Technology Data Exchange (ETDEWEB)

    Vita-Marques, Aline Maria de; Lira, Simone P.; Berlinck, Roberto G.S. [Universidade de Sao Paulo (USP), Sao Carlos, SP (Brazil). Inst. de Quimica]. E-mail: rgsberlinck@iqsc.usp.br; Seleghim, Mirna H.R. [Universidade Federal de Sao Carlos (UFSCAR), SP (Brazil). Dept. de Ecologia e Biologia Evolutiva; Sponchiado, Sandra R.P. [UNESP, Araraquara, SP (Brazil). Inst. de Quimica. Dept. de Bioquimica e Tecnologia Quimica; Tauk-Tornisielo, Samia M. [UNESP, Rio Claro, SP (Brazil). Centro de Estudos Ambientais; Barata, Margarida [Faculdade de Ciencias de Lisboa (Portugal). Centro de Biologia Ambiental. Dept. de Biologia Vegetal; Pessoa, Claudia; Moraes, Manoel O. de; Cavalcanti, Bruno Coelho [Universidade Federal do Ceara (UFC), Fortaleza, CE (Brazil). Dept. de Fisiologia e Farmacologia; Nascimento, Gislene G.F. [Universidade Metodista de Piracicaba (UNIMEP), SP (Brazil). Faculdade de Ciencias da Saude; Souza, Ana O. de [Instituto Butantan, Sao Paulo, SP (Brazil); Galetti, Fabio C.S.; Silva, Celio L. [Universidade de Sao Paulo (USP), Ribeirao Preto, SP (Brazil). Faculdade de Medicina. Dept. de Bioquimica e Imunologia; Silva, Marcio; Pimenta, Eli F.; Thiemann, Otavio [Universidade de Sao Paulo (USP), Sao Carlos, SP (Brazil). Inst. de Fisica; Passarini, Michel R.Z.; Sette, Lara D. [Universidade Estadual de Campinas (UNICAMP), Campinas, SP (Brazil). Centro Pluridisciplinar de Pesquisas Quimicas, Bioligicas e Agricolas. Div. de Recursos Microbianos

    2008-07-01

    Extracts obtained from 57 marine-derived fungal strains were analyzed by HPLC-PDA, TLC and {sup 1}H NMR. The analyses showed that the growth conditions affected the chemical profile of crude extracts. Furthermore, the majority of fungal strains which produced either bioactive of chemically distinctive crude extracts have been isolated from sediments or marine algae. The chemical investigation of the antimycobacterial and cytotoxic crude extract obtained from two strains of the fungus Beauveria felina have yielded cyclodepsipeptides related to destruxins. The present approach constitutes a valuable tool for the selection of fungal strains that produce chemically interesting or biologically active secondary metabolites. (author)

  1. A multi-screening approach for marine-derived fungal metabolites and the isolation of cyclodepsipeptides from Beauveria felina

    Directory of Open Access Journals (Sweden)

    Aline Maria de Vita-Marques

    2008-01-01

    Full Text Available Extracts obtained from 57 marine-derived fungal strains were analyzed by HPLC-PDA, TLC and ¹H NMR. The analyses showed that the growth conditions affected the chemical profile of crude extracts. Furthermore, the majority of fungal strains which produced either bioactive of chemically distinctive crude extracts have been isolated from sediments or marine algae. The chemical investigation of the antimycobacterial and cytotoxic crude extract obtained from two strains of the fungus Beauveria felina have yielded cyclodepsipeptides related to destruxins. The present approach constitutes a valuable tool for the selection of fungal strains that produce chemically interesting or biologically active secondary metabolites.

  2. Selection, Identification and Culture Characteristics of a Highly Virulent Strain of Beauveria towards Sympiezomias citri%柑橘灰象甲一株高毒力白僵菌菌株的筛选鉴定及培养特性

    Institute of Scientific and Technical Information of China (English)

    王定锋; 黎健龙; 王庆森; 李慧玲; 吴光远

    2014-01-01

    %, highest muscardine rates of 97.78%and shortest LT50 of 3.77 d after fungal inoculation at a concentration of 1.0×108 spores/mL (7 d, 26 ℃). The LC50 value was 4.55×104 spores/mL at 26 ℃. According to culture characteristics, morphology feature and rDNA ITS sequence analysis, the strain Bb2-1 was identified to be Beauveria bassiana. The effect of five medium types (PDA, PPDA, 1/4 SDAY, SDAY, and Czapek), five temperature gradient (15, 20, 25, 30 and 35 ℃), seven different pH value (pH 4.0—10.0) and seven different illumination periods (0L:24D, 24L:0D, 18L:6D, 12L:12D, 6L:18D, dark in the first 7 days and light in the last 7 days, and light in the first 7 days and dark in the last 7 days) on colony growth and sporulation of the strain Bb2-1 were evaluated through the determination of colony diameter and sporulation. The results showed that SDAY medium at pH 7.0 was the most optimal medium for the colony growth and sporulation of the strain Bb2-1 at 25 ℃, and photoperiod didn’t pose any obvious effects on colony growth, but prolonging illumination time was benefit to the sporulation. In this study, the selection of a highly virulent B. bassiana (Bb2-1) towards S. citri and the evaluation of culture characteristics of Bb2-1 would provide reference for large scale production of the fungi to control this beetle.

  3. Selection and characterization of Beauveria spp. isolates to control the broad mite Polyphagotarsonemus latus (Banks, 1904) (Acari: Tarsonemidae).

    Science.gov (United States)

    Martins, C C; Alves, L F A; Mamprim, A P; Souza, L P A

    2016-01-01

    This study was performed under laboratory conditions to identify isolates of the fungus Beauveria spp. that can control Polyphagotarsonemus latus in the greenhouse and field. Thirty Beauveria spp. isolates were tested by spraying 1 mL conidia (1 × 108 conidia/mL) on pepper leaf discs containing 15 mites. Evaluations were performed on the 3rd and 6th day post application by counting the number of dead mites. Vegetative growth and conidial production were measured from the selected isolates, and bioassays were conducted in the greenhouse on bean seedlings in plastic pots. The isolate Unioeste 53 was selected, and a conidial suspension (1 × 108 conidia/mL) was applied with a backpack sprayer. The evaluation consisted of pre- and post-treatment counts of the number of live mites on ten leaflets in both the plots treated with the fungus and control plots, and the same procedure was followed for the field experiment. In the laboratory, the Unioeste 53 isolate resulted in total and confirmed mortality rates of 70% and 57.7%, respectively. In the greenhouse, the population decreased by 76.71% by the 16th day after application. In the field, the population decreased by 66% by the 12th day after application, demonstrating the potential of this fungus for mite management. PMID:27332672

  4. USO DE BIOINSECTICIDAS PARA EL CONTROL DE PLAGAS DE HORTALIZAS EN COMUNIDADES RURALES

    OpenAIRE

    Cipriano García-Gutiérrez; María Berenice González-Maldonado

    2010-01-01

    Se evaluó el uso de bioinsecticidas elaborados a base de hongos entomopatógenos (Beauveria bassiana, Metarhizium anisopliae y Paecilomyces fumosoroseus); la producción se hizo de manera artesanal en comunidades rurales y se utilizaron para el control de plagas de hortalizas. Los productos fueron formulados con celite® y se usaron a dosis de 240g (1.2x1012 esporas/ha), para el control de plagas sobre plantaciones de lechuga Lactuca sativa L., rábano Rhapanus sativus, cebolla Allium cepa L., re...

  5. Selección de Aislamientos de Hongos Entomopatógenos para el Control de Huevos de la Polilla del Tomate, Tuta absoluta Meyrick (Lepidoptera: gelechiidae Entomopathogenic Fungi Isolates Selection for Egg Control of Tomato Moth Tuta absoluta Meyrick (Lepidoptera: gelechiidae Eggs

    Directory of Open Access Journals (Sweden)

    Marta Rodríguez S.

    2006-06-01

    Full Text Available Se realizó un estudio en laboratorio sobre la patogenicidad de 64 aislamientos de Metarhizium anisopliae var. anisopliae y 70 de Beauveria bassiana, en huevos de polilla del tomate Tuta absoluta. La primera evaluación se realizó por aplicación directa de suspensiones de 10(7 conidias mL-1 para cada aislamiento, con el sistema de pulverización de la torre de Potter. La mortalidad y esporulación sobre huevos fueron significativamente mayores con los aislamientos M. anisopliae Qu-M558 y B. bassiana Qu-B911, Qu-B912 y Qu-B928. Estos aislamientos fueron evaluados nuevamente en suspensiones crecientes de 0 a 10(8 conidias mL-1. Los aislamientos Qu-M558 y Qu-B912, produjeron los mayores porcentajes de mortalidad sobre la base del cálculo del área bajo la curva del progreso de mortalidad de huevos, 80 y 60%, respectivamente.A pathogenicity study of 64 Metarhizium anisopliae var. anisopliae and 70 Beauveria bassiana isolates against tomato moth Tuta absoluta eggs, was carried out under laboratory conditions. The first evaluation was accomplished by spraying suspensions of 10(7 conidias mL-1 of each isolate directly on eggs, through a Potter tower. Mortality and conidia production on the eggs were significantly higher with the isolates M. anisopliae Qu-M558 and B. bassiana Qu-B911, Qu-B912 and Qu-B928. These isolates were newly evaluated using increasing conidia concentrations (0 to 10(8 conidia mL-1 of each of the five selected isolates. The isolates Qu-B912 and Qu-M558 produced the highest mortality percentages based on the area under mortality progress curve for each concentration, 80 and 60%, respectively.

  6. Selection of Native Fungi Strains Pathogenic to Vespula germanica (Hymenoptera: Vespidae Selección de Aislamientos Nativos de Hongos Patogénicos a Vespula germanica (Hymenoptera: Vespidae

    Directory of Open Access Journals (Sweden)

    Loreto Merino

    2007-12-01

    Full Text Available The yellowjacket wasp, Vespula germanica F., is considered a serious pest of productive and recreational activities worldwide. A pathogenicity study was carried out with 29 strains of Metarhizium anisopliae and 30 of Beauveria bassiana against worker and male wasps. Wasps of the same age were fed with liquid sugar baits containing 1 x 10(8 conidia mL-1 suspensions of each strain. The highest mortality and sporulation were obtained with the strains Qu-B941 and Qu-B933 of Beauveria bassiana, reaching 79 and 95% mortality for workers and 66 and 73% for males, respectively. The strains were tested on workers of V. germanica with increasing amounts of bait from 0 to 1 x 10(8 conidia mL-1. The results also showed that 1 x 10(8 conidia mL-1 increased up to 90 and 97% the mortality of workers with Qu-B941 and Qu-B933 strains, respectively.La avispa chaqueta amarilla, Vespula germanica F., es una especie cosmopolita, considerada en muchos países como un problema serio para el desarrollo de actividades productivas y recreativas. Entre las nuevas alternativas para el control de la plaga está el uso de hongos entomopatógenos. Se estudió la patogenicidad de 29 aislamientos de Metarhizium anisopliae y 30 de Beauveria bassiana, sobre obreras y machos de la avispa. La evaluación se realizó sobre adultos de igual edad, administrando dosis de 1 x 10(8 conidia mL-1 de cada aislamiento, en cebos líquidos azucarados. La mortalidad y esporulación de los aislamientos de Beauveria bassiana Qu-B941 y Qu-B933 fueron significativamente mayores, alcanzando porcentajes de mortalidad de 79 y 95% para obreras y de 66 y 73% para machos, respectivamente. Estos aislamientos fueron evaluados en cebos con suspensiones crecientes de 0 a 1 x 10(8 conidia mL-1 sobre obreras de V. germanica. Los resultados obtenidos muestran que mayores concentraciones de inóculo incrementan significativamente los índices de mortalidad, alcanzando 90 y 97% para Qu-B941 y Qu-B933

  7. Baeuveria bassiana (BalsVuill and Metarhizium anisioplae (Metsch. Sorokin in the pupas control of Prodiplosis longifila Gagné on asparagus crop

    Directory of Open Access Journals (Sweden)

    Carolina Cedano

    2012-03-01

    Full Text Available The objective of the present work was to evaluate the effect of the entomopathogen fungi Baeuveria bassiana and Metarhizium anisioplae of the Prodiplosis longifila pupas, in order to reduce the adult population of this insect. The treatments consisted on the application of two different propagel concentrations (mycel and conidia of each entomopathogen. One of these concentration was 1x106 propagels/ml (obtained from the total amount of conidia collected of 25 kg of rice colonized by the entomopathogen; and the other one, was 1x107 propagels/ml (obtained from the total amount of conidia collected of 40 kg of rice colonized by the entomopathogen. As a check a non application treatment was considered. The applications were trough the irrigation system and started 15 days after the end of harvest and were repeated each five days during a month, coincident with the period of most falls of pupas of the soil. As a result Baeuveria bassiana at 1x107 propagels/ml shown 53.4 % of the total pupas colonized by the entomopathogen, which allows indicating B. bassiana as a promissory biocontrol of this specie

  8. Cotton in Benin: governance and pest management

    NARCIS (Netherlands)

    Togbe, C.E.

    2013-01-01

    Key words: cotton, synthetic pesticides, neem oil (Azadirachta indica), Beauveria bassiana, Bacillus thuringiensis, field experiment, farmers’ participation   Pests are one of the main factors limiting cotton production worldwide. Most of the pest control strategies in cotton producti

  9. Mass production of fungal entomopathogens

    Science.gov (United States)

    Hypocrealean fungi encompassing Beauveria bassiana, B. brongniartii, Isaria fumosorosea, I. farinosa, several Lecanicillium spp., Nomuraea rileyi, and Metarhizium spp. are being increasingly exploited worldwide for insect pest management because of the ease with which they can be produced in contras...

  10. Digital signage sobre IP

    OpenAIRE

    Casademont Filella, Albert

    2012-01-01

    Projecte que versa sobre el disseny i la implementació d'un sistema de Digital Signage (Cartelleria Digital) sobre IP, creant un gestor que permeti controlar de forma remota tot un conjunt de petits dispositius connectats a pantalles que emeten continguts multimèdia com vídeos, imatges, feeds rss...

  11. Optical and structural properties of plasma-treated Cordyceps bassiana spores as studied by circular dichroism, absorption, and fluorescence spectroscopy

    Science.gov (United States)

    Lee, Geon Joon; Sim, Geon Bo; Choi, Eun Ha; Kwon, Young-Wan; Kim, Jun Young; Jang, Siun; Kim, Seong Hwan

    2015-01-01

    To understand the killing mechanism of fungal spores by plasma treatment, the optical, structural, and biological properties of the insect pathogenic fungus Cordyceps bassiana spores were studied. A nonthermal atmospheric-pressure plasma jet (APPJ) was used to treat the spores in aqueous solution. Optical emission spectra of the APPJ acquired in air indicated emission peaks corresponding to hydroxyl radicals and atomic oxygen. When the APPJ entered the aqueous solution, additional reactive species were derived from the interaction of plasma radicals with the aqueous solution. Fluorescence and absorption spectroscopy confirmed the generation of hydroxyl radicals and hydrogen peroxide in the plasma-activated water (PAW). Spore counting showed that plasma treatment significantly reduced spore viability. Absorption spectroscopy, circular dichroism (CD) spectroscopy, and agarose gel electrophoresis of the DNA extracted from plasma-treated spores showed a reduction in spore DNA content. The magnitude of the dip in the CD spectrum was lower in the plasma-treated spores than in the control, indicating that plasma treatment causes structural modifications and/or damage to cellular components. Tryptophan fluorescence intensity was lower in the plasma-treated spores than in the control, suggesting that plasma treatment modified cell wall proteins. Changes in spore viability and DNA content were attributed to structural modification of the cell wall by reactive species coming from the APPJ and the PAW. Our results provided evidence that the plasma radicals and the derived reactive species play critical roles in fungal spore inactivation.

  12. Optical and structural properties of plasma-treated Cordyceps bassiana spores as studied by circular dichroism, absorption, and fluorescence spectroscopy

    Energy Technology Data Exchange (ETDEWEB)

    Lee, Geon Joon, E-mail: gjlee@kw.ac.kr; Sim, Geon Bo; Choi, Eun Ha [Plasma Bioscience Research Center/Department of Electrical and Biological Physics, Kwangwoon University, Seoul 139-701 (Korea, Republic of); Kwon, Young-Wan [KU-KIST Graduate School of Converging Science and Technology, Korea University, Seoul 136-701 (Korea, Republic of); Kim, Jun Young; Jang, Siun; Kim, Seong Hwan, E-mail: piceae@naver.com [Department of Microbiology and Institute of Basic Sciences, Dankook University, Cheonan 330-714 (Korea, Republic of)

    2015-01-14

    To understand the killing mechanism of fungal spores by plasma treatment, the optical, structural, and biological properties of the insect pathogenic fungus Cordyceps bassiana spores were studied. A nonthermal atmospheric-pressure plasma jet (APPJ) was used to treat the spores in aqueous solution. Optical emission spectra of the APPJ acquired in air indicated emission peaks corresponding to hydroxyl radicals and atomic oxygen. When the APPJ entered the aqueous solution, additional reactive species were derived from the interaction of plasma radicals with the aqueous solution. Fluorescence and absorption spectroscopy confirmed the generation of hydroxyl radicals and hydrogen peroxide in the plasma-activated water (PAW). Spore counting showed that plasma treatment significantly reduced spore viability. Absorption spectroscopy, circular dichroism (CD) spectroscopy, and agarose gel electrophoresis of the DNA extracted from plasma-treated spores showed a reduction in spore DNA content. The magnitude of the dip in the CD spectrum was lower in the plasma-treated spores than in the control, indicating that plasma treatment causes structural modifications and/or damage to cellular components. Tryptophan fluorescence intensity was lower in the plasma-treated spores than in the control, suggesting that plasma treatment modified cell wall proteins. Changes in spore viability and DNA content were attributed to structural modification of the cell wall by reactive species coming from the APPJ and the PAW. Our results provided evidence that the plasma radicals and the derived reactive species play critical roles in fungal spore inactivation.

  13. Sobre el Paisaje Cultural

    OpenAIRE

    Hernández León, Juan Miguel

    2008-01-01

    El 4º Congreso Europeo sobre Investigación Arquitectónica y Urbana EURAU’08, organizado por la Escuela Técnica Superior de Arquitectura de la Universidad Politécnica de Madrid y dedicado a reflexionar sobre el “Paisaje cultural”, continúa la tarea de intercambio de conocimientos científicos y experiencias docentes entre las escuelas y facultades europeas de Arquitectura emprendida en las ediciones anteriores de Marsella, acerca de “La cuestión doctoral”, de Lille, sobre “El espacio considerad...

  14. Ultrafiltros sobre ω.

    OpenAIRE

    Mancilla Hernández, Salvador

    2012-01-01

    El objetivo del presente trabajo estudiar los ideales y filtros sobre conjuntos numerables, los que comúnmente conocemos como filtros sobre ω o ideales sobre ω. Dentro de estos, nos enfocaremos en la clase de I-ultrafiltros los cuales fueron estudiados por James Baumgartner en [11]. Y dentro de esta clase de ultrafiltros, nos concentraremos cuando I es {A ⊆ ω : n∈A g(n) < ∞}, también conocido como ideal sumable con respecto a g, donde g es una sucesión de números reales no negativ...

  15. Antiproliferative and Apoptosis-Inducing Activities of 4-Isopropyl-2,6-bis(1-phenylethylphenol Isolated from Butanol Fraction of Cordyceps bassiana

    Directory of Open Access Journals (Sweden)

    Ji Hye Kim

    2015-01-01

    Full Text Available The Cordyceps species have been widely used for treating various cancer diseases. Although the Cordyceps species have been widely known as an alternative anticancer remedy, which compounds are responsible for their anticancer activity is not fully understood. In this study, therefore, we examined the anticancer activity of 5 isolated compounds derived from the butanol fraction (Cb-BF of Cordyceps bassiana. For this purpose, several cancer cell lines such as C6 glioma, MDA-MB-231, and A549 cells were employed and details of anticancer mechanism were further investigated. Of 5 compounds isolated by activity-guided fractionation from BF of Cb-EE, KTH-13, and 4-isopropyl-2,6-bis(1-phenylethylphenol, Cb-BF was found to be the most potent antiproliferative inhibitor of C6 glioma and MDA-MB-231 cell growth. KTH-13 treatment increased DNA laddering, upregulated the level of Annexin V positive cells, and altered morphological changes of C6 glioma and MDA-MB-231 cells. In addition, KTH-13 increased the levels of caspase 3, caspase 7, and caspase 9 cleaved forms as well as the protein level of Bax but not Bcl-2. It was also found that the phosphorylation of AKT and p85/PI3K was also clearly reduced by KTH-13 exposure. Therefore, our results suggest KTH-13 can act as a potent antiproliferative and apoptosis-inducing component from Cordyceps bassiana, contributing to the anticancer activity of this mushroom.

  16. Crescimento, esporulação e viabilidade de fungos entomopatogênicos em meios contendo diferentes concentrações do óleo de nim (Azadirachta indica Growth, esporulation and viability of entomopathogenic fungi under mediums with differents Nim oil (Azadirachta indica concentrations

    Directory of Open Access Journals (Sweden)

    Renata Paro Marques

    2004-12-01

    Full Text Available A associação de extratos de origem vegetal com fungos entomopatogênicos pode aumentar a eficiência do controle biológico de pragas, reduzir custos e impactos ambientais. No presente trabalho, avaliou-se, através da concentração inibitória mínima, o efeito do óleo de nim (NIM-I-GO sobre o crescimento, esporulação e viabilidade de Metarhizium anisopliae, Beauveria bassiana e Paecilomyces farinosus. Utilizou-se o meio BDA, contendo diferentes concentrações de óleo de nim (C1: 5% de óleo de nim, e sucessivamente concentrações iguais a ½ da concentração anterior, até C11: 0,0048% de óleo de nim. O óleo de nim reduziu o crescimento de colônias de B. bassiana e P. farinosus, que não diferiram significativamente do controle apenas na concentração C11, mas para M. anisopliae o mesmo efeito foi observado com 0,039% de óleo de nim (C8. A esporulação também foi significativamente reduzida pelo óleo de nim, exceto na concentração C11 para B. bassiana; contudo, não se verificou efeito do óleo na viabilidade de esporos dos fungos.The association of vegetable extracts with entomopathogenic fungi can increase the efficiency of biological control of pests, to reduce costs and environmental impacts. The present work aimed to evaluate, through minimal inibitory concentration, the effect of the neem oil (NIM-I-GO on the growth, esporulation and viability of Metarhizium anisopliae, Beauveria bassiana and Paecilomyces farinosus. For this purpose the PDA medium was used containing different concentrations of neem oil (C1: 5% of neem oil, and successively concentrations ½ of the previous concentration, until the concentration C11:0,0048% of neen oil. The neen oil reduced the growth of B. bassiana and P. farinosus, which didn’t differ significantly of the control at the concentration C11. Similar effect was observed for M. anisopliae with 0,039% of neem oil (C8. The esporulation was also significantly reduced by the neem oil

  17. Selection of Entomopathogenic Fungi to Control Varroa destructor (Acari: Varroidae Selección de Hongos Entomopatógenos para el Control de Varroa destructor (Acari: Varroidae

    Directory of Open Access Journals (Sweden)

    Marta Rodríguez

    2009-12-01

    Full Text Available The aim of this work was select entomopathogenic fungi tolerant to temperatures inside the brood area of honey bees (Apis mellifera for to control Varroa destructor. For this purpose, 50 Beauveria bassiana (Balsamo Vuillemin and 48 Metarhizium anisopliae (Metschn. Sorokin isolates were evaluated at 30 and 35 ºC. For each isolate, colony discs of 5 mm with mycelium were placed in the center of a Petri dish with Sabouraud dextrose agar (SDA medium. The dishes were incubated at 30 and 35 °C, without light. Radial growth of each colony was measured daily. All the B. bassiana and M. anisopliae isolates presented a lineal growth rate at a temperature of 30 ºC. However, at 35 ºC, most of the isolates did not grow, except three B. bassiana and 14 M. anisopliae isolates (P El objetivo de este trabajo fue seleccionar hongos entomopatógenos tolerantes a las temperaturas del nido de cría de las abejas (Apis mellifera, para ser utilizados en el control de Varroa destructor. Se evaluaron 50 aislamientos de Beauveria bassiana (Balsamo Vuillemin y 48 de Metarhizium anisopliae (Metschn. Sorokin a temperaturas de 30 y 35 ºC. Discos de agar de 5 mm de diámetro con micelio de colonias de cada aislamiento, se depositaron en el centro de placas Petri con medio agar Sabouraud dextrosa (ASD. Las placas fueron incubadas a 30 y 35 °C y oscuridad y diariamente se midió el radio de cada colonia. Todos los aislamientos de B. bassiana y M. anisopliae var. anisopliae presentaron una tendencia lineal a través del tiempo a temperaturas de incubación de 30 °C. A 35 °C la mayoría de los aislamientos no crecieron, excepto tres aislamientos de B. bassiana y 14 de M. anisopliae (p < 0,001. Estos aislamientos fueron seleccionados para realizar pruebas de patogenicidad sobre V. destructor, aplicando una suspensión de 10(7 conidias mL-1. El aislamiento más efectivo fue Qu-M845 de M. anisopliae (p = 0,0033, produjo una mortalidad de 85%. La capacidad patogénica de este

  18. Evaluation of Some Biocontrol Agents/Antagonistic Microbes Against Pastule Development of Leaf Rust of Wheat Caused by Puccinia recondita f. sp. Tritici Roberge ex. Desmaz (Erikson and Henn D.M. Henderson

    Directory of Open Access Journals (Sweden)

    A. Sheroze

    2002-01-01

    Full Text Available Out of five biocontrol agents/antagonistic microbes viz., Verticillium lecanii, Paecilomyces fumosoroseus, Beauveria bassiana, Cladosporium cladosporiodes and Metarrhizium anisopliae, Beauveria bassiana proved the best in retarding the postulation/rust development in wheats. When the microbes tested alone against leaf rust development, B. bassiana proved excellent and in combination with Verticillium lecanii and Paecilomyces furnosoroseus. Although there was an increase in colony diameter after 2nd week but the pattern of growth was the same as after one week of incubation of bio-control agents application.

  19. Mitos sobre agroecologia.

    OpenAIRE

    Canuto, João Carlos

    2011-01-01

    O presente ensaio vem a discutir alguns aspectos do discurso sobre a Agroecologia, procurando evidenciar contradições do senso comum, advindas seja de parte da comunidade leiga, dos meios de comunicação ou da comunidade científica. Coloca em debate alguns mitos sobre os sistemas agroecológicos, tais como: que sejam tecnologicamente retrógrados, de baixa produtividade, exigentes em mão-de-obra, economicamente inviáveis e “puramente ideológicos”.

  20. Inferencias sobre Grafos

    OpenAIRE

    Sira M. Allende; Carlos N. Bouza

    2002-01-01

    El estudio de un juego puede ser modelado asumiendo que solo algunas partidas son observadas. Entonces el árbol del juego debe ser estimado utilizando información muestral. Similarmente ocurre al obtener información sobre el comportamiento de las decisiones tomadas por individuos muestreados sobre un árbol de decisión teórico. Al considerar una medida de probabilidad que caracterice el comportamiento de redes aleatorias se puede obtener un estimado del árbol asociado. Este problema es el anal...

  1. Inferencias sobre Grafos

    Directory of Open Access Journals (Sweden)

    Sira M. Allende

    2002-05-01

    Full Text Available El estudio de un juego puede ser modelado asumiendo que solo algunas partidas son observadas. Entonces el árbol del juego debe ser estimado utilizando información muestral. Similarmente ocurre al obtener información sobre el comportamiento de las decisiones tomadas por individuos muestreados sobre un árbol de decisión teórico. Al considerar una medida de probabilidad que caracterice el comportamiento de redes aleatorias se puede obtener un estimado del árbol asociado. Este problema es el analizado en este trabajo. Algunos resultados experimentales obtenidos usando Recocido Simulado ilustran el procedimiento. Su papel en el estudio de modelos económicos y de mercadeo es discutido.

  2. Escrito sobre el cuerpo

    Directory of Open Access Journals (Sweden)

    Antonio Malalana Ureña

    2013-09-01

    Full Text Available El catálogo, en una edición bilingüe español-inglés, es una pequeña guía de la exposición Shirin Neshat. Escrito sobre el cuerpo, muestra que se integra dentro de los actos de PHOTOESPAÑA13, el festival internacional de fotografía y artes visuales. El esquema del libro es sencillo y los textos son extremadamente divulgativos. El primero de ellos, Escrito sobre el cuerpo (pp. 10-15, cuyo autor es Octavio Zaya, comisario de la exposición, resume la trayectoria de esta intelectual, que "interactúa" con la fotografía y los formatos audiovisuales, y nos presenta la argumentación narrativa de los documentos expuestos, contextualizando la obra recopilada.

  3. Estudios sobre Borges

    OpenAIRE

    Facultad de Humanidades y Ciencias de la Educación

    1991-01-01

    Contenidos de la obra: De Barthes a Pierre Menard | José Luis De Diego Pierre Menard, autor del Quijote: De la poligrafía al fraude | Andrea Cucatto Homenaje a Roberto Arlt: La otra cara de la moneda | Fabio Espósito Emma a través del espejo: Una lectura de Emma Zunz | Graciela Beatriz Goldchluk Sobre el concepto de verdad en Borges | Sergio Pastormerlo

  4. Sobre genes y electrones

    OpenAIRE

    Martín Pereda, José Antonio

    1992-01-01

    El autor reflexiona sobre un artículo publicado en una revista, en el que se pronosticaba un declive para los científicos dedicados a la física y la ciencia armamentística, debido al fin de la guerra fría, y un ascenso al poder de los biólogos y de todos aquellos relacionados con las ciencias y las tecnologías de la vida.

  5. Apuntes sobre liderazgo

    OpenAIRE

    Contreras, Manuel E.

    2010-01-01

    Este trabajo presenta una breve síntesis de las principales teorías de liderazgo y se centra sobre el enfoque de liderazgo adaptativo de Ronald Heifetz. El documento originalmente fue desarrollado para las sesiones de educación a distancia de INDES. Ha sido revisado para usar en otros ámbitos de capacitación y ha sido utilizado en sesiones presenciales llevadas a cabo por INDES, como por otras entidades en universidades y centros de capacitación de America Latina.

  6. Informe APEI sobre movilidad

    OpenAIRE

    Arroyo Vázquez, Natalia

    2011-01-01

    Este informe incluye una amplia aproximación al concepto de movilidad, desde un punto de vista introductorio, que nunca antes en nuestro ámbito había abarcado todos los aspectos que tienen que ver con él, desde cuestiones técnicas como los dispositivos móviles, sistemas operativos y navegadores, conectividad y estándares —cuya intención es poder comprender todos aquellos aspectos relacionados con la movilidad y que tienen una incidencia directa sobre los contenidos— hasta otras más relacionad...

  7. Sobre el razonamiento judicial

    OpenAIRE

    Asís Roig, Rafael de

    1998-01-01

    El trabajo elabora modelos a través de los cuáles es posible reconstruir la argumentación judicial plasmada en las sentencias y, a la vez, hacer explícitas las reglas que sirven de justificación a sus decisiones, y el marco normativo utilizado como referencia. El estudio analiza tanto los pronunciamientos sobre hechos como los que se refieren a la calificación jurídica, en principio, desde una perspectiva descriptiva. Ahora bien, también se llevan a cabo reflexiones y propuestas que van más a...

  8. Sobre historia mundial hoy

    Directory of Open Access Journals (Sweden)

    Vera Weiler

    2010-08-01

    Full Text Available Los procesos de globalización son una realidad; su enorme impacto sobre la vida humana los ha convertido en un tema recurrente sobre el que se escribe y se comenta a diario también en Colombia. Los libros que de ellos tratan, ante todo los que 10 hacen en tono crítico, baten records en la industria editorial en todo el mundo. Las expectativas que acerca del futuro abrigan cientos de millones de personas se relacionan con 10 que ellas esperan, para bien o para mal, de la globalización. Las posturas que los gobernantes ocupan al respecto en el mundo son, cuando menos de aceptación, generalmente de activa participación en pos de la globalización. Por un lado, crece la preocupación y se multiplican las protestas; por el otro, dominan los razonamientos de los especialistas en materia de maximización de los rendimientos de los capitales que presentan la globalización, al estilo que se viene imponiendo, como el camino ineludible del gobierno universal de la eficiencia. ¿Tienen que decir algo los historiadores frente a todo esto?.

  9. Cloning and sequence analysis of cDNA and upstream sequence of Bbhsp70 gene from Beauveria bassiana%球孢白僵菌热休克蛋白基因Bbhsp70的cDNA及上游序列克隆与分析

    Institute of Scientific and Technical Information of China (English)

    谢翎; 陈红梅; 蒲顺昌; 汤强; 李增智; 黄勃

    2009-01-01

    运用SMART RACE RT-PCR技术与DNA步移技术,首次从球孢白僵菌中克隆出完整的热休克蛋白基因Bbhsp70编码区序列及上游序列.该基因cDNA全长2405bp,5'端非翻译区171bp,3'端非翻译区263bp,开放阅读框(ORF)1971bp,编码656个氨基酸.成熟蛋白理论分子量为71.3kDa,理论等电点为4.92.上游序列长度3559bp,其中有305bp序列与cDNA序列重叠.分析表明,上游序列中没有明显的TAYA-盒和CAAT-盒,但含有CCAAT-binding factor、GC-box等重要的转录因子结合位点,以及热激应答元件(HSE)和GATA元件等启动子顺式调控元件.

  10. Voz sobre frame relay

    OpenAIRE

    D´Elia, Gabriel Anibal

    2000-01-01

    Esta tesis trata el tema de VOFR, desde la digitalización de la voz hasta su transmisión a través de dicha red, así también como la comparación con otros medios de transporte como VOIP. Dada las características del protocolo frame relay y su disponibilidad se eligió como el medio más apropiado para la transmisión de voz y datos en forma integrada sobre una misma red. El trabajo comienza con una breve explicación de la voz, su digitalización y forma actual de transmisión a través de una red di...

  11. Excertos sobre o sedentarismo

    Directory of Open Access Journals (Sweden)

    Alexandre Palma

    2014-09-01

    Full Text Available O sedentarismo tem sido tratado como algo perfeitamente determinável, objetivo e, portanto, que pode ser apreendido. Por outro lado, o conceito de sedentarismo ainda permanece questionável e, por conseguinte, os instrumentos mostram-se inconsistentes. Neste sentido, o objetivo do presente estudo foi mostrar que diferentes discursos de verdade vêm concorrendo por esse conceito, o que nos motiva a pensar qual é a verdade ou, até mesmo, se há alguma verdade sobre ele. Após apresentarmos diferentes possibilidades de compreender o sedentarismo, através do uso de aforismos, entendemos que postular um discurso como verdade talvez apenas signifique que as pessoas nele creem e que há uma vontade de verdade como uma vontade voltada para o poder.

  12. Crescimento, esporulação e viabilidade de fungos entomopatogênicos em meios contendo diferentes concentrações do óleo de nim (Azadirachta indica) Growth, esporulation and viability of entomopathogenic fungi under mediums with differents Nim oil (Azadirachta indica) concentrations

    OpenAIRE

    Renata Paro Marques; Antonio Carlos Monteiro; Gener Tadeu Pereira

    2004-01-01

    A associação de extratos de origem vegetal com fungos entomopatogênicos pode aumentar a eficiência do controle biológico de pragas, reduzir custos e impactos ambientais. No presente trabalho, avaliou-se, através da concentração inibitória mínima, o efeito do óleo de nim (NIM-I-GO) sobre o crescimento, esporulação e viabilidade de Metarhizium anisopliae, Beauveria bassiana e Paecilomyces farinosus. Utilizou-se o meio BDA, contendo diferentes concentrações de óleo de nim (C1: 5% de óleo de nim,...

  13. Sobre el nombre "Quechua"

    Directory of Open Access Journals (Sweden)

    Rodolfo Cerrón-Palomino

    1985-06-01

    Full Text Available Uno de los primeros problemas con el que a menudo tropiezael estudioso de los idiomas ágrafos, como es el caso de las lenguasaborígenes de América, es el de su denominación (glotónimo.En la medida ,en que, por razones históricas, las noticias sobretales lenguas, y por consiguiente los primeros estudios sobre lasmismas, surgen a partir del contacto con los miembros de la civilización occidental, los nombres de los distintos idiomas, así comode los grupos étnicos que los manejan, son el resultado casi siempre arbitrario cie designaciones fortuitas hechas por viajeros, misiioneros y exploradores, quienes por lo general se basan, para ello, bien en descripciones físicas de los grupo étnicos, en ciertos indios geográficos que constituyen el habitat de los mismos, e incluso en prejuicios que se nutren de un marcado europocentrismo.

  14. Refletindo sobre idosos institucionalizado

    Directory of Open Access Journals (Sweden)

    Cenir Gonçalves Tier

    2004-06-01

    Full Text Available Trata-se de uma pesquisa qualitativa, descritiva que teve por objetivo identificar como vem sendo o relacionamento idoso-família, identificando os motivos que levaram os familiares a optarem pela institucionalização do seu idoso, obtendo-se também a visão da família sobre o cuidado no lar. Para coleta dos dados utilizou-se um instrumento com perguntas abertas. A coleta dos dados efetivou-se nos meses de agosto de 2002 a julho de 2003, sendo sujeitos da pesquisa, familiares de idosos de uma instituição asilar em um município da região noroeste do Rio Grande do Sul. Através da análise de conteúdo constatou-se que a maior dificuldade encontrada pela família, visando dispensar cuidados ao idoso é a "falta de tempo para cuidar" do seu familiar idoso, pois a maioria deles exige cuidados em tempo integral.

  15. Compatibility of Encarsia formosa (Hymenoptera: Aphelinidae with Commercial Products Under Laboratory Conditions

    Directory of Open Access Journals (Sweden)

    Jennifer Barrera Mojica

    2013-04-01

    Full Text Available The greenhouse white fly, Trialeurodes vaporariorum one of the major pests of tomatoes under greenhouse conditions, but, Its mainly controlled with chemical insecticides. However, there are alternative control strategies as entomopathogens fungi and parasitoids (Encarsia formosa. In this study we evaluated the compatibility of commercial product with adults and pupae of E. formosa under laboratory conditions. Eight treatments were evaluated for adults and pupae of the parasitoid, including two concentrations of the entomopathogenic fungus Beauveria bassiana (5 x 107 and 5 x 109 conidia/ml, commercial doses of four chemical products commonly used to control pests on tomato crops and two controls. These treatments were applied directly on parasitoids, and their mortality rate on adults and pupae were recorded daily. There was no difference in E. formosa pupae among relative with the Bacillus thuringiensis products (p > 0.05, indicating that its compatible with the parasitoid pupae under laboratory conditions. Finally, it was found that products with active ingredients of Tiocyclam hidrogenoxalato and B. thuringiensis are incompatibles with E. formosa adults under laboratory conditions.COMPATIBILIDAD DE Encarsia formosa (HYMENOPTERA: APHELINIDAE CON PRODUCTOS COMERCIALES EN CONDICIONES DE LABORATORIO La mosca blanca de los invernaderos, Trialeurodes vaporariorum, es una de las principales plagas de cultivos de tomate bajo invernadero y es controlada principalmente con insecticidas químicos. Sin embargo, existen estrategias alternativas de control como hongos entomopatógenos (Beauveria bassiana y enemigos naturales como parasitoides (Encarsia formosa. En el presente estudio se evaluó la compatibilidad de productos comerciales con adultos y pupas de E. formosa bajo condiciones de laboratorio. Se evaluaron ocho tratamientos para pupas y adultos del parasitoide, incluyendo dos concentraciones del hongo entomopatógeno Beauveria

  16. 4-Isopropyl-2,6-bis(1-phenylethylaniline 1, an Analogue of KTH-13 Isolated from Cordyceps bassiana, Inhibits the NF-κB-Mediated Inflammatory Response

    Directory of Open Access Journals (Sweden)

    Woo Seok Yang

    2015-01-01

    Full Text Available The Cordyceps species has been a good source of compounds with anticancer and anti-inflammatory activities. Recently, we reported a novel compound (4-isopropyl-2,6-bis(1-phenylethylphenol, KTH-13 with anticancer activity isolated from Cordyceps bassiana and created several derivatives to increase its pharmacological activity. In this study, we tested one of the KTH-013 derivatives, 4-isopropyl-2,6-bis(1-phenylethylaniline 1 (KTH-13-AD1, with regard to anti-inflammatory activity under macrophage-mediated inflammatory conditions. KTH-13-AD1 clearly suppressed the production of nitric oxide (NO and reactive oxygen species (ROS in lipopolysaccharide (LPS and sodium nitroprusside- (SNP- treated macrophage-like cells (RAW264.7 cells. Similarly, this compound also reduced mRNA expression of inducible NO synthase (iNOS and tumor necrosis factor-α (TNF-α, as analyzed by RT-PCR and real-time PCR. Interestingly, KTH-13-AD1 strongly diminished NF-κB-mediated luciferase activities and nuclear translocation of NF-κB family proteins. In accordance, KTH-13-AD1 suppressed the upstream signaling pathway of NF-κB activation, including IκBα, IKKα/β, AKT, p85/PI3K, and Src in a time- and dose-dependent manner. The autophosphorylation of Src and NF-κB observed during the overexpression of Src was also suppressed by KTH-13-AD1. These results strongly suggest that KTH-13-AD1 has strong anti-inflammatory features mediated by suppression of the Src/NF-κB regulatory loop.

  17. Lizonia baldini sobre Polytrichum formosum

    OpenAIRE

    Girbal i Lladó, Josep; Lloret Maya, Francisco; Pérez Obiol, Ramon

    1982-01-01

    S'ha trobat al Montseny (UTM:DG 46 26) l'ascomicet briofil Lizonia baldini (Pir) Dobb (Ordre Dothideales) parasit sobre Polytrichum formosum Hedw. Es descriuen les característiques dels exemplars observats i s'indica la seva incidencia en la producció d'anteridis

  18. Visiones educativas sobre los MOOC

    OpenAIRE

    Cabero Almenara, Julio

    2015-01-01

    Los “Cursos Masivos en Abiertos” o MOOC se están convirtiendo en una de las tecnologías de gran penetración en el terreno educativo en los últimos tiempos, considerándose por algunos como una tecnología que creará un tsunami sobre la educación

  19. Discurso sobre la historia colombiana

    OpenAIRE

    Quijano Otero, José María

    2010-01-01

    Resumen de las lecciones de Historia Patria, desde la llegada de Colón hasta los primeros brotes independentistas. Sobre la manera de estudiar los hechos históricos: su enlace, las causas que los produjeron, i los efectos que de ellos derivaron.

  20. Antimicrobial properties of nest volatiles in red imported fire ants, Solenopsis invicta (hymenoptera: formicidae)

    Science.gov (United States)

    Wang, Lei; Elliott, Brad; Jin, Xixuan; Zeng, Ling; Chen, Jian

    2015-12-01

    The antimicrobial property of volatiles produced by red imported fire ants, Solenopsis invicta, against Beauveria bassiana, a common entomopathogenic fungus, was demonstrated. The germination rate of B. bassiana spores was significantly reduced after they were exposed to volatiles within an artificial ant nest. Since the air that contained the same level of O2 and CO2 as that in artificial fire ant nests did not suppress the germination rate of B. bassiana, the observed reduction of germination rate must be caused by the toxicity of nest volatiles. Nest fumigation may be an important component of the social immune system in S. invicta.

  1. Inactivation of certain insect pathogens by ultraviolet radiation

    International Nuclear Information System (INIS)

    The UV-sensitivity of two baculoviruses (granulosis virus, nuclear polyhedrosis virus) and two entomopathogenic microorganisms (Bacillus thuringiensis, Beauveria bassiana) was determined by radiation tests. In the far UV (254 nm) the stability, measured at an inactivation rate of 99%, was in declining order: nuclear polyhedra >= conidia of B. bassiana > granula > spores of B. thuringiensis >= vegetative cells of B. thuringiensis. In the near UV (285-380 nm) the following order could be found: conidia of B. bassiana >= nuclear polyhedra > spores of B. thuringiensis >= granula > vegetative cells of B. thuringiensis. Far UV had a much higher germicidal effect for all pathogens tested than near UV. (orig.)

  2. Susceptibility of entomopathgenic fungi to OMRI certified surfactants for biopesticide applications

    Science.gov (United States)

    Three entomopathgenic fungi, Beauveria bassiana, Metarhizium brunneum,and Isaria fumosorosea were evaluated for their compatibility with six surfactants. The surfactants are certified to comply with the U.S. National organic standards and are permitted to be used in organic production systems. The f...

  3. Formulating entompathogens for control of boring beetles in avocado orchards

    Science.gov (United States)

    A foam formulation of Beauveria bassiana was adapted to control boring beetles in avocado orchards. The two geographically independent avocado growing areas in the United States are threatened by emerging diseases vectored by boring beetles. In the California growing region, Fusarium dieback is vect...

  4. Historicismo: notas sobre um paradigma

    OpenAIRE

    José D’Assunção Barros

    2012-01-01

    Este artigo tem por objetivo desenvolver algumas considerações sobre o Historicismo e sua possibilidade de ser examinado como um dos paradigmas que concorrem para o estabelecimento de uma história científica no século XIX. O primeiro ponto tratado é relativo às origens do paradigma Historicista na transição do século XVIII para o século XIX. Na sequência, aproximamo-nos da apropriação conservadora do paradigma historicista no novo contexto no qual a burguesia européia está assentada no Poder,...

  5. COMENTARIOS SOBRE MEMORIA Y COMUNIDAD

    OpenAIRE

    José A. Escalona Delfino

    2009-01-01

    El presente trabajo es una reflexión sobre aspectos esenciales en torno a la relación memoria-comunidad y su importancia para la investigación científica de las sociedades y los grupos humanos. Sin penetrar en profundidad en la trayectoria histórica del tema, ni en el tratamiento específico que importantes hombres de ciencia, considerados sus progenitores o procreadores, han dado a estos conceptos, hacemos particulares consideraciones con respecto al concepto de Memoria Histórica o Colectiva....

  6. Nota sobre Keynes y Brentano

    OpenAIRE

    Crespo, Ricardo F.; IAE (Universidad Austral) y CONICET

    2013-01-01

    Este trabajo explora la posibilidad de una relación entre el pensamiento de John Maynard Keynes y el del filósofo alemán Franz Brentano (1839-1917) en los campos lógico y epistemológico. George E. Moore -profesor de Keynes- y Keynes mismo leyeron y alabaron el libro de Brentano El origen del conocimiento moral (1889). ¿Tomó Keynes algunas ideas lógicas o epistemológicas de Brentano? El trabajo sugiere que, a pesar de ciertas similitudes entre las ideas lógicas y sobre la verdad de Keynes y Br...

  7. Thomas Hobbes: sobre el miedo

    OpenAIRE

    Carlos Bührle

    2004-01-01

    Este trabajo pretende echar cierta luz sobre el papel del miedo en el pensamiento político de Hobbes. Sabido es que esta pasión subyace al contrato social, en el sentido de que impulsa al hombre a abandonar el estado de naturaleza a fin de encontrar seguridad y de deshacerse de la amenaza de la muerte violenta. Teniendo en cuenta que el miedo y la muerte son inseparables en la filosofía de Hobbes, surge una pregunta fundamental: ¿hasta qué punto podemos decir que el miedo desaparece completam...

  8. Sobre la crisis financiera internacional

    OpenAIRE

    Antonio Torrero Mañas

    2013-01-01

    Este trabajo es una reflexión sobre la crisis financiera internacional en la mitad de su sexto año. Respecto a la evolución de la crisis tengo una sensación agridulce. La parte positiva es que se ha evitado un descalabro inmediato de gran entidad. Mi mayor inquietud procede de los desequilibrios que pueden provocar las finanzas internacionales sin que exista ninguna institución moderadora y ordenadora de los flujos con un ámbito supranacional. Creo que una fuente válida de inspiración serí...

  9. Lumbalgias en hockey sobre cesped

    OpenAIRE

    Rodríguez, Claudia

    2011-01-01

    Se realizó un estudio tomando como muestra a 84 jugadoras de hockey sobre hierba amateurs, mayores de 18 años de la primera categoría de la ciudad de Mar del Plata, en la cual el objetivo general fue determinar la incidencia del gesto deportivo en las lumbalgias de dichas jugadoras. El dolor lumbar tiene una alta prevalencia entre los deportistas, se ha relacionado con déficits en la fuerza extensora lumbar, y el hecho de padecerlo representa un obstáculo importante para la ...

  10. Modelos ambientales sobre la vejez

    OpenAIRE

    Izal, María; Fernández-Ballesteros, Rocío

    1990-01-01

    La perspectiva ambiental en el estudio de la vejez es probablemente un ámbito poco conocido. En este trabajo se expone una revisión crítica de los principales modelos de explicación de las relaciones ambiente-conducta en la vejez. Finalmente, se discute sobre la superación de algunas limitaciones presentes en estas formulaciones teóricas, presentándose posibles alternativas teóricas y metodológicas para el desarrollo de esta área.

  11. Entorno colaborativo sobre laboratorios remotos

    OpenAIRE

    Grosclaude, Eduardo; Sznek, Jorge Eduardo; Ramos Garcia, Vicente; Bertogna, Mario Leandro; López Luro, Francisco; Zanellato, Claudio

    2006-01-01

    El proyecto de investigación Software para Procesos Colaborativos incluye una línea de acción sobre el desarrollo de experiencias en Laboratorios Remotos. Esta línea está dedicada a complementar las tareas de aprendizaje con un soporte tecnológico de sistemas, entendido como todas aquellas actividades de infraestructura que promuevan la disponibilidad de recursos y apoyen la escalabilidad de procesos en la tarea educativa apuntalada por tecnologías de información. En este trabajo se describe ...

  12. Recursos y enlaces sobre comunidades de aprendizaje

    OpenAIRE

    Ferrer Esteban, Gerard

    2005-01-01

    Obras y artículos sobre el proyecto Comunidades de Aprendizaje desarrollado en el Estado español. Tesis doctorales sobre comunidades de aprendizaje. Fundamentación teórica de las comunidades de aprendizaje. Sitios en Internet relacionados con las comunidades de aprendizaje y proyectos afines de desarrollo comunitario en contextos escolares.

  13. On GAMER, plataforma de continguts sobre videojocs

    OpenAIRE

    Villegas Bonachera, José Ricardo

    2015-01-01

    Desenvolupament d'una plana web amb disseny responsiu sobre videojocs en català a partir del gestor de continguts WordPress. Desarrollo de una página web con diseño responsivo sobre videojuegos en catalán a partir del gestor de contenidos WordPress. Bachelor thesis for the Multimedia program on Computer Science.

  14. Historicismo: notas sobre um paradigma

    Directory of Open Access Journals (Sweden)

    José D’Assunção Barros

    2012-08-01

    Full Text Available Este artigo tem por objetivo desenvolver algumas considerações sobre o Historicismo e sua possibilidade de ser examinado como um dos paradigmas que concorrem para o estabelecimento de uma história científica no século XIX. O primeiro ponto tratado é relativo às origens do paradigma Historicista na transição do século XVIII para o século XIX. Na sequência, aproximamo-nos da apropriação conservadora do paradigma historicista no novo contexto no qual a burguesia européia está assentada no Poder, combinando-se com a consolidação dos modernos estados-nações. A especificação das características deste paradigma constituem o principal ponto de análise

  15. Somos un envase : Discursos sobre el aborto

    OpenAIRE

    Löcher, Jennifer Irene

    2014-01-01

    No hay persona que no tenga opinión acerca del asunto y, cada vez más, la sociedad argentina debate sobre la pregunta de si se debe legalizar/despenalizar el aborto o no. Nunca antes se habló tanto sobre el tema públicamente: se publican artículos en los diarios, hay manifestaciones a favor y hay manifestaciones en contra de la legalización del aborto. El siguiente trabajo pretende relevar y analizar discursos que circulan socialmente alrededor del debate sobre el aborto. (Párrafo extraíd...

  16. Concepciones sobre la docencia universitaria de calidad

    OpenAIRE

    Arbeláez López, Ruby; Fortes del Valle, M. Carmen; Grau Rubio, Claudia

    2008-01-01

    Con esta investigación hemos querido participar en el proceso de búsqueda y construcción del sentido de calidad aplicado a la docencia universitaria, con el objetivo general de evidenciar las concepciones sobre docencia de calidad que pueden deducirse de los procesos de evaluación de los profesores universitarios. Nuestra meta final intenta propiciar la revisión de las políticas educativas y el enriquecimiento de la cultura sobre docencia y sobre evaluación docente. La mayor aportación de nue...

  17. Ensaio sobre Saramago = Essay on Saramago

    OpenAIRE

    Weigert, Sergio

    2013-01-01

    Partindo da obra de José Saramago, Ensaio sobre a Cegueira, constrói-se o “Ensaio sobre Saramago” sob perspectiva filosófica, fundamentada particularmente em Fredric Jameson. A interrupção da quotidianidade, matéria do desenvolvimento do conteúdo, faz aflorar a hipótese da temporalidade congelada, suporte da argumentação do teórico. Levanta-se a discussão sobre Modernidade e Pós-Modernidade da obra de Saramago, avançando no recurso da ironia, não como alicerce, mas como teia que tece, envolve...

  18. Puente sobre el Oosterschelde, Holanda

    Directory of Open Access Journals (Sweden)

    Hoving, H. T.

    1967-03-01

    Full Text Available This new bridge, forming part of the Delta project, is made of concrete, and was built by successive overhangs. Precast units were mainly used. The bridge is 5,000 m long, and is 11.85 m wide. The main spans are 95 m in length, except one, which can be opened up to sea traffic, which is 40 m long. The free height of the bridge over the sea is 15 m, which is insufficient for large ships. This required that one of the spans, in deep water, should open up, on hinges, and provide free passage to large ships. The intermediate bridge supports are of special interest. They rest on piles which go down to 38 m. They are hollow, cylindrical, of 4.35 m external diameter, and are driven into the ground in several stages, as they penetrate through the sands at the bottom of the Oosterschelde. To drive them in, an excavating device, inside the pile, was utilised, and also a dredging and suction mechanism, to clean out the bottom, and allow the piles to sink by gravity. But when external friction did not allow this to happen, the piles were weighed down with up to 500 tons of ballast. A series of three of these piles, in a row, makes up each bridge support. A cross member over the pile heads supports, in turn, the bridge deck. The bridge was built in successive sections, overhanging from each support, and then finally connected with a central portion. Use of precast units has been very extensive, so that the bridge can be justiaflably regarded as being prefabricated.Este nuevo puente, que forma parte del Plan de obras denominadas del Delta, es de hormigón y se ha construido por el procedimiento de voladizos sucesivos, utilizando, en su mayor parte, elementos prefabricados. Tiene una longitud total de 5.000 m; una anchura de 11,85 m; tramos principales de 95 m de luz, salvo uno, levadizo, que tiene 40 m. La altura libre sobre las ag^uas del mar es de 15 m, que es insuficiente para las naves de gran tonelaje; esto exigió que uno de sus tramos, en aguas

  19. Puente sobre el rio Medway

    Directory of Open Access Journals (Sweden)

    Freeman, Fox, Ingenieros

    1963-02-01

    have been prestressed both longitudinally and transversally. Between the two circulation roadways an elastic barrier has been placed, supported on metal posts.El puente sobre el río Medway tiene la misión de salvar dicho río en el nuevo trazado de carretera necesario para aliviar el denso tráfico estival entre Dower y Londres. Está situado en las proximidades de la ciudad de Rochester. La estructura se ha construido utilizando las vías de concurso. De todos los tipos presentados se eligió una estructura de hormigón armado. La longitud total de la obra es de 1.000 m. Los tres tramos principales de la obra salvan el río. El central es de 152 m de luz, y los dos adyacentes son de 103 m cada uno. Los accesos tienen un total de 18 tramos, que arrojan una longitud de 654 m. La anchura del puente es de 34 m, y la calzada se ha subdividido en dos direcciones de tráfico de 7,30 m cada una y, además, se han dejado dos espaldones laterales de 2,40 m de anchura. En planta se puede admitir que el puente tiene una alineación recta con una ligerísima curva, y que en el plano vertical presenta una pendiente de desagüe entre las pilas 9 y 10. Los estribos son de hormigón armado: tipo celular el del este y de hormigón en masa el del oeste. Los estribos se apoyan sobre pilotes hexagonales de hormigón armado cuya circunferencia circunscrita tiene 55 cm de radio y de 12 a 20 m de longitud. Cuando el firme se hallaba a profundidades inferiores a 6 m, los estribos se cimentaban directamente sobre el firme. Las pilas constituyen pórtico y tienen una altura variable de 9 a 30 m sobre el nivel del suelo. Los tramos de acceso forman una estructura continua simplemente apoyada. Cada tramo se compone de ocho vigas longitudinales de 30 a 41 m de longitud y de 190 toneladas cada una. Estas vigas son del tipo pretensado y prefabricado. El tramo central es del tipo cantilever, constituido por dos brazos, de 30 m de longitud, formados por vigas cajón. Cada una de estas vigas consta

  20. PERSPECTIVAS INFANTILES SOBRE LA TERRITORIALIDAD

    Directory of Open Access Journals (Sweden)

    Noelia Enriz

    2009-12-01

    Full Text Available En este trabajo nos proponemos un acercamiento a las diversas ideas infantiles sobre el territorio habitado, en el contexto particular de la población mbyá guaraní de Misiones. La fragilidad territorialidad a la que es expuesta la población indígena en Argentina se manifiestan cotidianamente en diversas áreas. La población mbyá, ha sido surcada por los límites de los estados nacionales de Paraguay, Brasil y Argentina. La sedentarización y los cercamientos de tierras en los diferentes estados, han impulsado transformaciones de las lógicas de subsistencia, de habitación y organización comunitaria. En el caso de la provincia de Misiones la acreditación burocrática de los títulos de tierras se encuentra aplazada, el estado no se compromete con la concreción de este derecho.

  1. Estudo multicasos sobre atividades inovativas

    Directory of Open Access Journals (Sweden)

    Sonia Regina Hierro Parolin

    2013-09-01

    Full Text Available Em estudos sobre competitividade argumenta-se que as empresas necessitam de estratégias baseadas em inovações e de capacidades internas em constantes e intensas transformações, não somente nos padrões tecnológicos, mas também no encadeamento do processo de gestão das atividades inovativas, como processos dinâmicos, não lineares e diversificados, em função de múltiplos fatores dos ambientes interno e externo. Para contribuir com essas discussões, neste artigo apresenta-se um estudo multicasos em quatro indústrias de médio e grande portes, de segmentos, densidades tecnológicas e históricos com inovações diferentes entre si. Como principais resultados, salientam-se o encadeamento das atividades inovativas como parte de uma estratégia organizacional para obter resultados com inovação e a afluência de todas as pessoas, e não somente as alocadas em pesquisa e desenvolvimento, para o cumprimento dessa estratégia.

  2. Sobre a psicopatologia dos atos

    Directory of Open Access Journals (Sweden)

    Roberto Calazans

    2015-07-01

    Full Text Available Este artigo pretende apresentar a psicopatologia dos atos a partir do esquema de Jacques Lacan sobre a angústia. Diferenciamos os acting-out, a passagem ao ato, os sintomas, as inibições e a angústia fazendo uma duplicação do esquema de Lacan levando em consideração os registros do simbólico, do real e do imaginário. Esse esquema permite uma abordagem da questão dos atos do sujeito sem cair em uma perplexidade do clínico, nem na confusão entre os atos e a ação. Permite também uma melhor orientação do clínico em relação às diversas modalidades de respostas subjetivas que não se restringem à questão sintomática, que é o campo inaugural da clínica psicanalítica desde a sua fundação por Sigmund Freud. Acreditamos contribuir, assim, para um maior esclarecimento desse esquema no ensino de Lacan e para que ele possa servir de orientação para o tratamento dos atos do sujeito na clínica.

  3. El Impuesto sobre Sociedades - Tema 5

    OpenAIRE

    Andrés Aucejo, Eva

    2008-01-01

    El Impuesto sobre Sociedades: Hecho imponible. Sujeto pasivo. Imputación temporal de ingresos y gastos. Régimen de transparencia fiscal. La base imponible: Ingresos computables, partidas deducibles y no deducibles. Reinversión de beneficios extraordinarios.

  4. Los derechos de autor sobre obtenciones vegetales

    Directory of Open Access Journals (Sweden)

    Rosario Silva Gilli

    2015-01-01

    Full Text Available Contenido: Las creaciones en la agricultura. Los derechos de autor sobre obtenciones vegetales. El Convenio Internacional para la protección de las obtenciones vegetales (París 1961 y sus revisiones de Ginebra 1972, 1978,1991 Objeto de la protección legal. Condiciones del cultivar. Alcance de la protección. La protección de obtenciones vegetales en el Mercosur. Los Derechos de autor en el Mercosur. El Protocolo de Armonización de normas sobre Propiedad Intelectual en el Mercosur. El Acuerdo de Cooperación y facilitación sobre la protección de las obtenciones vegetales en los Estados Partes del Mercosur.  Alcance de la normativa Mercosur. Los Derechos sobre cultivares en Uruguay. Los Derechos de autor como derechos humanos. ¿Derechos de autor vs. derecho de propiedad intelectual? Reflexión final

  5. PERSPECTIVAS INFANTILES SOBRE LA TERRITORIALIDAD

    Directory of Open Access Journals (Sweden)

    NOELIA ENRIZ

    2009-12-01

    Full Text Available In this paper we propose a different approach to children's ideas about the geographical area in the particular context of the Mbyá Guarani population, from Misiones (Argentine. The territorial fragility, that is exposed to the indigenous people in Argentina aremanifested daily in several areas. Mbyá population, has been crossed by the boundaries of national states of Paraguay, Brazil and Argentina. The sedentary and enclosures land processes in different states, have prompted changes in the logic of subsistence, housing and community organization. In Misiones province case, bureaucratic accreditation of land titles is postponed, the state is not committed to the realization of this right.RESUMEN: En este trabajo nos proponemos un acercamiento a las diversas ideas infantiles sobre el territorio habitado, en el contexto particular de la población mbyá guaraní de Misiones. La fragilidad territorialidad a la que es expuesta la población indígena en Argentina se manifiestan cotidianamente en diversas áreas. La población mbyá, ha sido surcada por los límites de los estados nacionales de Paraguay, Brasil y Argentina. La sedentarización y los cercamientos de tierras en los diferentes estados, han impulsado transformaciones de las lógicas de subsistencia, de habitación y organización comunitaria. En el caso de la provincia de Misiones la acreditación burocrática de los títulos de tierras se encuentra aplazada, el estado no se compromete con la concreción de este derecho.

  6. Consideraciones preliminares sobre la credibilidad

    Directory of Open Access Journals (Sweden)

    Fernando Verdugo

    2004-01-01

    Full Text Available A modo de introducción al Seminario Interno de Profesores de la Facultad de Teología de la PUC, el autor recuerda, en primer lugar, lo que suele entenderse por "credibilidad" y, también, algunos de los criterios generales por los cuales algo o alguien adquiere la calidad de creíble (el que sea razonable, relevante o significativo, capaz de producir gozo estético, etc.. Luego, en la parte más extensa, el autor vuelve a llamar la atención sobre la necesidad de atender a los condicionamientos culturales de la fe cristiana. La fe, al igual que toda experiencia humana, está culturalmente mediada. Tomar conciencia de ese hecho y asumir las consecuencias metodológicas es indispensable para una teología que quiere poner atención a los desafíos actuales y contribuir así a la credibilidad del cristianismoThis article reprints the introductory session to the internal seminar of lecturers from the Faculty of Theology of the UC. In the first place, the author sums up what is usually understood by `credibility' and the general criteria through which something or someone gains credibility (being reasonable, relevant or significant, capable of producing aesthetic pleasure. Then the author deals at length with the need to take notice of the cultural conditionings of the Christian faith. The faith, the same as any other human experience, is culturally mediated. It is crucial for theology to become aware of this fact and come to terms with its methodological consequences, if it wants to face current challenges and so contribute to the credibility of Christianity

  7. Impacto psicosocial del Downsizing sobre los trabajadores

    Directory of Open Access Journals (Sweden)

    CRISTÓBAL JIMÉNEZ JIMÉNEZ

    2006-01-01

    Full Text Available El presente trabajo intenta ahondar en lo expuesto en un trabajo anterior sobre el downsizing como fenómeno psicosociolaboral, analizando su impacto psicosocial. En primer lugar, se exponen los diferentes niveles de comprensión de este fenómeno, para pasar al análisis de los efectos y consecuencias sobre las personas, diferenciando entre dos tipos de víctimas: a los que se van de la organización (despedidos y b los que se quedan en la organización (supervivientes, prestando especial atención a lo que se conoce ya como el "síndrome del superviviente", para lo que se aporta información sobre sus características, las variables moderadoras que intervienen y los modelos explicativos del mismo. Se termina con algunas consideraciones sobre la actualidad y relevancia de dicho síndrome sugiriendo la idea de que el fenómeno del downsizing y sus consecuencias sobre las personas nos enfrenta a lo que podríamos ya considerar como un nuevo síndrome de la Psicopatología Laboral: el síndrome del superviviente.

  8. DISERTACIÓN SOBRE JUSTICIA Y EQUIDAD

    Directory of Open Access Journals (Sweden)

    Sayuri P. Tamura M.

    2001-01-01

    Full Text Available «Disertación sobre equidad y justicia» es básicamente una respuesta a una inquietud en particular que yo tenía sobre las distintas posiciones que existen sobre estos dos temas y cómo definir cuál es la más acertada. Hice una descripción del punto de vista de Amartya Sen –la violación de los derechos sobre la propiedad privada es justificable si evitan las hambrunas2– frente al de Robert Nozick –la propiedad privada es un derecho fundamental y como tal debe ser respetado3–, sin embargo, aunque ambos enfoques son totalmente contrarios tienen mucho sentido, por lo cual es bastante difícil decidirse por uno en particular. Fue de esta forma, enfrentando sus opiniones, que yo logré desarrollar una posición frente a estas dos perspectivas, y así dar mi opinión al DISERTACIÓN SOBRE JUSTICIA Y EQUIDAD SAYURI P. TAMURA M. Estudiante de Economía y Negocios Internacionales de la Universidad ICESI. respecto. Al final, llegué a una conclusión, que aunque no es la más original y tampoco es la única, tiene mucho sentido y seguramente de ser posible, la situación del país podría cambiar para bien.

  9. Ensaio sobre Saramago = Essay on Saramago

    Directory of Open Access Journals (Sweden)

    Weigert, Sergio

    2013-01-01

    Full Text Available Partindo da obra de José Saramago, Ensaio sobre a Cegueira, constrói-se o “Ensaio sobre Saramago” sob perspectiva filosófica, fundamentada particularmente em Fredric Jameson. A interrupção da quotidianidade, matéria do desenvolvimento do conteúdo, faz aflorar a hipótese da temporalidade congelada, suporte da argumentação do teórico. Levanta-se a discussão sobre Modernidade e Pós-Modernidade da obra de Saramago, avançando no recurso da ironia, não como alicerce, mas como teia que tece, envolvendo tecido e artista.

  10. Impacto psicosocial del Downsizing sobre los trabajadores

    OpenAIRE

    CRISTÓBAL JIMÉNEZ JIMÉNEZ; JOSÉ LUIS SÁNCHEZ LAGUNA

    2006-01-01

    El presente trabajo intenta ahondar en lo expuesto en un trabajo anterior sobre el downsizing como fenómeno psicosociolaboral, analizando su impacto psicosocial. En primer lugar, se exponen los diferentes niveles de comprensión de este fenómeno, para pasar al análisis de los efectos y consecuencias sobre las personas, diferenciando entre dos tipos de víctimas: a) los que se van de la organización (despedidos) y b) los que se quedan en la organización (supervivientes), prestando especial atenc...

  11. Principios sobre semáforos

    OpenAIRE

    VALENCIA ALAIX, VÍCTOR GABRIEL

    2000-01-01

    Debido a la ausencia de una publicación que reuniese los aspectos más relevantes sobre semáforos y en el marco académico sobre ingeniería de tránsito de los cursos de pregrado y posgrado en Vías y Transporte de la Universidad Nacional de Colombia - Sede Medellín, se ha preparado este documento como guía introductoria a dicho tema. En su preparación se han recogido los tópicos principales de varias publicaciones internacionales y nacionales, además, su desarrollo ha considerado la experi...

  12. Sobre la esclavitud: libro de artista

    OpenAIRE

    MACHADO JIMÉNEZ, ALBERTO

    2015-01-01

    Sobre la esclavitud es un libro de artista, donde encontraremos imágenes acompañadas de breves frases que hacen referencia al tema propuesto en cada ilustración para que así se pueda comprender mejor la intención de este trabajo, reflexionar sobre la manera que tenemos de ver las cosas, en este caso, con respecto a la esclavitud. Dar a conocer distintas formas de ser esclavo en este sistema sería uno de los objetivos principales. Hacer litografías, dibujos con el uso de acua...

  13. Rastros: dizendo sobre os fazeres/dizeres

    OpenAIRE

    MELLO MARISOL BARENCO CORRÊA DE

    2001-01-01

    Com vistas ao aclaramento de noções erroneamente herdadas do contexto social e histórico da cultura moderna ocidental, que teve/tem como um de seus projetos o "apagamento" do sujeito, ou o distanciamento entre os sujeitos e suas formas de fazer, dizer, pensar, este artigo pretende contribuir com elementos para a construção de um outro paradigma nas ciências humanas. Trata-se de um relato sobre o processo de construção de nossa própria pesquisa, articulado à reflexão sobre as diversas formas d...

  14. Consideraciones sobre diferentes procesos productivos y sus consecuencias sobre el medio ambiente

    OpenAIRE

    Caridad Ramos Alvariño

    2004-01-01

    En el presente trabajo se exponen algunas consideraciones sobre diferentes procesos productivos y sus consecuencias sobre el medio ambiente. La disminución del impacto negativo de algunas producciones sobre el medio ambiente es favorable, pero el problema va más allá y de lo que se trata es de la necesidad de una transformación sostenible de las producciones que puedan conducir a una vida agradable y una naturaleza conservada entre otras muchas cuestiones que agobian hoy al mundo. La solución...

  15. Toxicity of natural insecticides on the larvae of wheat head armyworm, Dargida diffusa (Lepidoptera: Noctuidae).

    Science.gov (United States)

    Reddy, Gadi V P; Antwi, Frank B

    2016-03-01

    The wheat head armyworm, Dargida (previously Faronta) diffusa (Walker) (Lepidoptera: Noctuidae), is widely distributed in North American grasslands and is most common on the Great Plains, where it is often a serious pest of corn and cereal crops. Six commercially available botanical or microbial insecticides used against D. diffusa were tested in the laboratory: Entrust(®) WP (spinosad 80%), Mycotrol(®) ESO (Beauveria bassiana GHA), Aza-Direct(®) (azadirachtin), Met52(®) EC (Metarhizium brunneum F52), Xpectro(®) OD (Beauveria bassiana GHA+pyrethrins), and Xpulse(®) OD (Beauveria bassiana GHA+azadirachtin). Concentrations of 0.1, 0.5, 1.0 and 2.0 fold the lowest labelled rates of formulated products were tested for all products, while for Entrust WP additional concentrations of 0.001 and 0.01 fold the label rates were also assessed. Survival rates were determined from larval mortality at 1-9 days post treatment application. We found that among the tested chemicals, Entrust(®) (spinosad) was the most effective, causing 83-100% mortality (0-17% survival rate) at day 3 across all concentrations. The others, in order of efficacy from most to least, were Xpectro(®) (B. bassiana GHA+pyrethrins), Xpulse(®)OD (B. bassiana GHA+azadirachtin), Aza-Direct(®) (azadirachtin), Met52(®) EC (M. brunneum F52), and Mycotrol(®) ESO (B. bassiana GHA). These products and entomopathogenic fungi caused 70-100% mortality (0-30% survivability) from days 7 to 9. The tested products and entomopathogenic fungi can be used in management of D. diffusa. PMID:26855414

  16. Las fuentes cristianas sobre Jesús

    Directory of Open Access Journals (Sweden)

    Melero Martínez, J.M.

    2010-01-01

    Full Text Available El artículo es una presentación de las fuentes históricas sobre Jesús de Nazaret: fuentes sinópticas, fuente Q, fuentes afines a la gnosis, fragmentos de evangelio con material sinóptico o joánico, evangelios judeocristianos y otras fuentes.

  17. Sobre o natural e o actor

    OpenAIRE

    Tavares, Margarida

    2010-01-01

    Neste artigo, procura-se reflectir sobre o conceito de natural quando aplicado ao trabalho do actor. Parte-se de quatro relevantes textos da dramaturgia ocidental, a saber: Hamlet, de Shakespeare; Crítica da ‘Escola das mulheres’ e O improviso de Versalhes, de Molière; e O teatro cómico, de Goldoni.

  18. Sobre un sistema no lineal de epidemias

    OpenAIRE

    Ortega S., Luis

    2012-01-01

    Un modelo sobre epidemias que describe la población infectada y la población susceptible de ser infectada en el cual se toma en consideraci6n el efecto de difusión es el siguiente: [Formula Matemática].

  19. 4-Isopropyl-2,6-bis(1-phenylethyl)aniline 1, an Analogue of KTH-13 Isolated from Cordyceps bassiana, Inhibits the NF-κB-Mediated Inflammatory Response.

    Science.gov (United States)

    Yang, Woo Seok; Ratan, Zubair Ahmed; Kim, Gihyeon; Lee, Yunmi; Kim, Mi-Yeon; Kim, Jong-Hoon; Cho, Jae Youl

    2015-01-01

    The Cordyceps species has been a good source of compounds with anticancer and anti-inflammatory activities. Recently, we reported a novel compound (4-isopropyl-2,6-bis(1-phenylethyl)phenol, KTH-13) with anticancer activity isolated from Cordyceps bassiana and created several derivatives to increase its pharmacological activity. In this study, we tested one of the KTH-013 derivatives, 4-isopropyl-2,6-bis(1-phenylethyl)aniline 1 (KTH-13-AD1), with regard to anti-inflammatory activity under macrophage-mediated inflammatory conditions. KTH-13-AD1 clearly suppressed the production of nitric oxide (NO) and reactive oxygen species (ROS) in lipopolysaccharide (LPS) and sodium nitroprusside- (SNP-) treated macrophage-like cells (RAW264.7 cells). Similarly, this compound also reduced mRNA expression of inducible NO synthase (iNOS) and tumor necrosis factor-α (TNF-α), as analyzed by RT-PCR and real-time PCR. Interestingly, KTH-13-AD1 strongly diminished NF-κB-mediated luciferase activities and nuclear translocation of NF-κB family proteins. In accordance, KTH-13-AD1 suppressed the upstream signaling pathway of NF-κB activation, including IκBα, IKKα/β, AKT, p85/PI3K, and Src in a time- and dose-dependent manner. The autophosphorylation of Src and NF-κB observed during the overexpression of Src was also suppressed by KTH-13-AD1. These results strongly suggest that KTH-13-AD1 has strong anti-inflammatory features mediated by suppression of the Src/NF-κB regulatory loop. PMID:26819495

  20. New solid-state fermentation chamber for bulk production of aerial conidia of fungal biocontrol agents on rice.

    Science.gov (United States)

    Ye, S D; Ying, S H; Chen, C; Feng, M G

    2006-06-01

    A novel solid-state fermentation apparatus, namely an upright multi-tray conidiation chamber, was developed to facilitate the production of aerial conidia of fungal biocontrol agents, such as Beauveria bassiana. The chamber with 25 bottom-meshed metal trays had a capacity of > or =50 kg rice with each tray holding > or =2 kg. In repeated trials, a mean yield of 2.4 (1.8-2.7) x 10(12) conidia kg(-1) rice was harvested from the 7-day cultures of B. bassiana in a fully loaded chamber. The new apparatus has a high potential for bulk production of fungal conidia. PMID:16786244

  1. Transcriptional control of fungal cell cycle and cellular events by Fkh2, a forkhead transcription factor in an insect pathogen

    OpenAIRE

    Wang, Juan-juan; Qiu, Lei; Cai, Qing; Ying, Sheng-Hua; Feng, Ming-Guang

    2015-01-01

    Transcriptional control of the cell cycle by forkhead (Fkh) transcription factors is likely associated with fungal adaptation to host and environment. Here we show that Fkh2, an ortholog of yeast Fkh1/2, orchestrates cell cycle and many cellular events of Beauveria bassiana, a filamentous fungal insect pathogen. Deletion of Fkh2 in B. bassiana resulted in dramatic down-regulation of the cyclin-B gene cluster and hence altered cell cycle (longer G2/M and S, but shorter G0/G1, phases) in unicel...

  2. Integrated pest management and entomopathogenic fungal biotechnology in the Latin Americas: II key research and development prerequisites

    International Nuclear Information System (INIS)

    In the first part of this review article (Valencia and Khachatourians, 1998) we presented the special opportunity that entomopathogenic fungi (EPF) offer for integrated pest management (IPM) in the Latin Americas. As expected, along with the opportunities, there are challenges for the use of EPF. First that there are only two fungi, Beauveria bassiana and Metarhizium anisopliae, for which some prerequisite knowledge of basic and applied mycology for industrial research and development (R and D) are in place. Because of precedent setting leadership in the development of certain EPF, e.g., B. bassiana in IPM, Latin America stands to contribute to and gain from future

  3. Entomopathogenic fungi for control of arthropod pests in egg production facilities

    DEFF Research Database (Denmark)

    Steenberg, Tove; Kilpinen, Ole

    Beauveria bassiana and other species of entomopathogenic fungi are potential candidates for microbial control of major pests in egg layers, e.g. the poultry red mite (Dermanyssus gallinae), the housefly (Musca domestica) and the darkling beetle (Alphitobius diaperinus). We have selected an isolate...... of B. bassiana with high efficacy against all target pests in laboratory assays, and will review the existing information on the natural occurrence of these fungi in farms with confined animals and discuss the possibilities and constraints for exploitation of entomopathogenic fungi as control agents...

  4. Diferentes visões sobre a cidade

    Directory of Open Access Journals (Sweden)

    Veriano Takuji Miura

    2010-06-01

    Full Text Available A paisagem urbana sempre exerceu um fascínio sobre os homens. Ela tem sido, ao mesmo tempo, sonho e pesadelo de um tempo. Em diferentes momentos, a paisagem urbana tem sido abordada de modo a expressar as singularidades de seu tempo. Nesse sentido, o objetivo deste artigo é trazer uma discussão sobre as diferentes visões da cidade propostas por acadêmicos, cineastas e romancistas. Desde a visão romantizada das cidades da Idade Média, de Ítalo Calvino, até as “cidades virtuais” de Pierre Lévy, destaca-se o longo percurso da chamada “aventura da modernidade”.

  5. El problema de Steklov sobre el cono

    OpenAIRE

    Óscar Andrés Montaño Carreño

    2012-01-01

    Sea (Mn, g) un cono de altura 0 ≤ xn+1 ≤ 1 en R n+1, dotado con una métrica rotacionalmente invariante 2ds2 + f 2 (s)dw2 , donde dw2 representa la métrica estándar sobre S n−1 , la esfera unitaria (n − 1)-dimensional. Supongamos que Ric(g) ≥ 0. En este artículo demostramos que si h > 0 es la curvatura media sobre ∂M y ν1 es el primer valor propio del problema de Steklov, entonces ν1 ≥ h. Abstract. Let (Mn, g) be a cone of height 0 ≤ xn+1 ≤ 1 in R ...

  6. Productos derivados sobre bienes de consumo

    OpenAIRE

    Francisco Venegas Martinez; Salvador Cruz Ake

    2010-01-01

    Este trabajo de investigacion desarrolla un modelo de equilibrio general con expectativas racionales en tiempo continuo util para la determinacion de precios de contratos forward, contratos futuros, bonos cupon cero y opciones europeas (de compra y venta) sobre bienes de consumo. Para ello, el modelo considera un individuo representativo en una economia con dos bienes, los cuales son producidos con tecnologias estocasticas. Por ultimo, el modelo propuesto permite examinar estrategias para obt...

  7. Apuntes sobre la flora gallega, XVII

    OpenAIRE

    Amigo Vázquez, Javier; Pulgar Sañudo, Íñigo

    2005-01-01

    Presentamos un nuevo capítulo dentro de la serie de contribuciones al conocimiento actualizado de la Flora de Galicia, aportando información de interés corológico sobre 11 taxa recolectados: Bidens frondosa L., Crypsis alopecuroides (Piller & Mitterp.) Schrad., Cyperus fuscus L., Cyperus michelianus (L.) Link, Dittrichia graveolens (L.) Desf., Echinochloa crus-galli (L.) P. Beauv. subsp. hispidula (Retz.) Honda, Eragrostis curvula (Schrad.) Nees, Hypericum hirsutum L., Lindernia dubia (L.) Pe...

  8. Reflexiones sobre el concepto de justicia

    Directory of Open Access Journals (Sweden)

    Víctor C. Pascual Planchuelo

    2005-06-01

    Full Text Available Este ensayo constituye una reflexión sobre el concepto de Justicia. No se centra, como tantos estudios al respecto, en el plano teórico y metafísico, sino que atiende problemas de mayor actualidad: la opinión de los ciudadanos, la postura de los profesionales y otros asuntos controvertidos del ámbito del Derecho.

  9. Neopolares de problemas de empaquetamiento sobre semigrupos

    OpenAIRE

    Aráoz Durand, Julián Arturo

    1982-01-01

    Los neopolares permiten caracterizar las caras de un poliedro combinatorio como vértices de poliedros altamente estructurados. Esto sirve para generar planos de cortes y para obtener propiedades duales en problemas de programación entera. Gomory caracterizó neopolares para problemas sobre grupos, Aráoz en "Polyhedral Neopolarities" extendió estos resultados a semigrupos de cubrimiento. En este trabajo se caracterizan neopolares importantes de semigrupos de empaquetamiento que incluyen los pro...

  10. Consideraciones sobre la motricidad del violinista

    OpenAIRE

    Allende, Pablo

    2009-01-01

    Comienza la exposición hablando de que intenta prevenir las patologías en los violinistas mediante secuencias de ejercicios específicos, de diferentes técnicas corporales y fisioterapéuticas. Presenta datos estadísticos sobre el índice de patologías que se encuentran entre estos intérpretes para por último presentar tablas de ejercicios propiamente dichas para intentar paliar estas dolencias

  11. Evaluación del riesgo ambiental de carbofurano en bioensayos con organismos no blanco

    Directory of Open Access Journals (Sweden)

    José Alberto Iannacone

    2011-06-01

    Full Text Available El carbofurano es uno de los plaguicidas más empleado en la agricultura peruana. El objetivo de este trabajo fue evaluar el riesgo ambiental del carbofurano en bioensayos de toxicidad, sobre once especies no destinatarias. La siguiente secuencia relativa de mayor a menor cocientes de riesgo (CR del carbofurano para los 19 puntos finales de efecto en once especies fue encontrada: Daphnia magna (mortalidad > Lemna minor (inhibición de formación de las hojas > Paracheirodon innesi (nado extraño = P. innesi (incremento del movimiento opercular > Chironomus calligraphus (mortalidad > L. minor (necrosis > P. innesi (mortalidad > L. minor (clorosis > Tetrapygus niger (inhibición de la fecundación > Coturnix japonica (mortalidad > Oncorhynchus mykiss (incremento de coloración > Ceraeochrysa cincta (no eclosión de huevos > O. mykiss (mortalidad con oxígeno > O. mykiss (mortalidad sin oxígeno > Trichogramma pretiosum (mortalidad > C. cincta (mortalidad > T. pretiosum (no emergencia de adultos > Trichogramma pintoi (mortalidad > Beauveria bassiana (inhibición del crecimiento. Los cocientes de riesgo (CR indicaron en todos los casos un alto riesgo del carbofurano principalmente en el ambiente acuático en comparación con el terrestre.Carbofuran is one of the most employed pesticides in Peruvian agriculture. This research aimed to evaluate the risk assessment in bioassays of carbofuran on eleven non-target species. The following relative sequence in decreasing ecotoxicity order in terms of RQ (Risk quotient to carbofuran to 19 end points on 11 species was found: Daphnia magna (mortality > Lemna minor (inhibition of new fronds > Paracheirodon innesi (strange swim = P. innesi (increase of opercula movement > Chironomus calligraphus (mortality > L. minor (necrosis > P. innesi (mortality > L. minor (chlorosis > Tetrapygus niger (inhibition of fertilization> Coturnix japonica (mortality > Oncorhynchus mykiss (increase of coloration > Ceraeochrysa

  12. Effects of biorational pesticides on four coccinellid species (Coleoptera: Coccinellidae) having potential as biological control agents in interiorscapes.

    Science.gov (United States)

    Smith, S F; Krischik, V A

    2000-06-01

    The direct toxicity of insecticidal soap, horticultural oil, Azatin, an extract from the Neem tree containing azadiractin, and BotainiGard, a commercial formulation of the entomopathogenic fungus Beauveria bassiana, was assessed on adults of four species of coccinellids--Hippodamia convergens (Guérin-Ménéville), Coleomegilla maculata (DeGeer), Harmonia axyridis Pallas, and Cryptolaemus montrouzieri Mulsant. All biorationals caused less mortality than a conventional pesticide, carbaryl (Sevin). Horticultural oil (Sunspray ultrafine oil) consistently had no effect on beetle survivorship. Insecticidal soap (M-Pede) significantly reduced survival in all replicates for C. maculata and in at least one of the three replicates for the other three coccinellid species. Beauveria bassiana (BotaniGard) significantly reduced survival of C. montrouzieri at 72 h after spray in all three replicates. Azatin reduced survivorship in only one species, C. maculata, in only one of the three replicates. PMID:10902323

  13. Pensamiento ciceroniano sobre el rol del ciudadano en la obra “Sobre los deberes”

    Directory of Open Access Journals (Sweden)

    Luis Diego Brenes Villalobos

    2013-01-01

    Full Text Available : El ensayo repasa -en los orígenes del republicanismo- el aporte realizado por uno de sus autores clásicos más importante, Marco Tulio Cicerón. En concreto, se revisa la visión de este sobre el rol del ciudadano y el concepto de ciudadanía como intrínsecamente ligada a la República y a la concepción del humanismo. Al efecto, el ensayo se centra en la obra “Sobre los deberes” (De officiis.

  14. Cotton in Benin: governance and pest management

    OpenAIRE

    Togbe, C.E.

    2013-01-01

    Key words: cotton, synthetic pesticides, neem oil (Azadirachta indica), Beauveria bassiana, Bacillus thuringiensis, field experiment, farmers’ participation   Pests are one of the main factors limiting cotton production worldwide. Most of the pest control strategies in cotton production rely heavily on the application of synthetic pesticides. The recurrent use of synthetic pesticides has large consequences for the environment (air, water, fauna, and flora) and human health. In cott...

  15. Method To Enhance Growth and Sporulation of Pelletized Biocontrol Fungi †

    OpenAIRE

    Knudsen, G R; Eschen, D. J.; Dandurand, L. M.; Wang, Z. G.

    1991-01-01

    The biocontrol fungi Trichoderma harzianum, used to control soilborne plant pathogens, and Beauveria bassiana, used to control insect pests, were formulated as mycelial biomass in alginate pellets with wheat bran added. After drying for 0, 4, or 16 h, pellets were placed in water or in aqueous solutions of polyethylene glycol (PEG) 8000 for 4 to 24 h and then allowed to continue drying. PEG-treated pellets containing T. harzianum showed significantly greater proliferation of hyphae in soil th...

  16. Evolution in biocontrol strains: insight from the harlequin ladybird Harmonia axyridis

    OpenAIRE

    Tayeh, Ashraf; Estoup, Arnaud; Laugier, Guillaume; Loiseau, Anne; Turgeon, Julie; Toepfer, Stefan

    2012-01-01

    After being used as a biocontrol agent against aphids for decades without harmful consequences, the Asian harlequin ladybird Harmonia axyridis has suddenly become an invasive pest on a worldwide scale. We investigate the impact of captive breeding on several traits of this ladybird such as genetic diversity, fecundity, survival and pathogen resistance. We conducted an experiment in the laboratory to compare the fecundity and the susceptibility to the entomopathogenic fungus Beauveria bassiana...

  17. Biochemiluminescence of certain fungi

    OpenAIRE

    Janusz Sławiński; Danuta Sławińska; Irena Majchrowicz

    2014-01-01

    Twelve species of fungi growing on the Sabouraud medium in darkness and illumination in an incubator, were tested to find out their ability to emit the ultra-weak biochemiluminescence. Using a sensitive photon-counling device, it was possible to measure biochemiluminescence intensity during ten days of cultures growth. Boletus edulis, Pestalotia funerea and Microsporum gypseum displayed biochemiluminescence, while Aspergillus nidulans, A. quadrilineatus, Beauveria bassiana, Macrophoma candoll...

  18. S-(−)-10,11-Dihydroxyfarnesoic Acid Methyl Ester Inhibits Melanin Synthesis in Murine Melanocyte Cells

    OpenAIRE

    Seung-Hwa Baek; Jun-Won Ahn; Sung-Hee Nam; Cheol-Sik Yoon; Jae-Cheon Shin; Sang-Han Lee

    2014-01-01

    The development of antimelanogenic agents is important for the prevention of serious aesthetic problems such as melasmas, freckles, age spots, and chloasmas. In the course of screening for melanin synthesis inhibitors, we found that the culture broth from an insect morphopathogenic fungus, Beauveria bassiana CS1029, exhibits potent antimelanogenic activity. We isolated and purified an active metabolite and identified it as S-(−)-10,11-dihydroxyfarnesoic acid methyl ester (dhFAME), an insect j...

  19. Efficacy of Entomopathogenic Nematodes and Entomopathogenic Fungi against Masked Chafer White Grubs, Cyclocephala spp. (Coleoptera: Scarabaeidae)

    OpenAIRE

    Wu, ShaoHui

    2013-01-01

    Entomopathogenic nematodes (EPN) (Heterorhabditis bacteriophora and H. megidis) and entomopathogenic fungi (EPF) (Metarhizium anisopliae and Beauveria bassiana) were evaluated for efficacy against masked chafer white grub, Cyclocephala spp., under laboratory and greenhouse conditions, as well as their efficacy against various grub stages in the field.  Under both laboratory and greenhouse conditions, additive interactions were found between EPN and EPF in their combined application against Cy...

  20. Soportes apoyados sobre vigas pretensadas (EE. UU.

    Directory of Open Access Journals (Sweden)

    Editorial, Equipo

    1965-12-01

    Full Text Available This work has been awarded a prize by the Prestreesed Concrete Institute. It refers to a number of flyovers on the Arroyo Seco, of California. This river has been canalized, to help drainage in case of heavy rainfall. The canal runs through a highly populated zone, and a motor road and accessory ramps had to cross the canal. The resulting design involves three prestressed girders, lightly arched in a parabolic outline, resting on each river shore, running along the line of the bridge, over the canal. It was decided that the bridge piles should not rest on the river bed, in order not to reduce its flow capacity. The girders of a maximum length of 39 ms, are box shaped, and stiffened with thin diaphragms. The cylindrical pile, 1.50 m in diameter, is an integral part of the girder, and applies to it a concentrated load of about 4000 tons. The girders rest on reinforced concrete cubes, which in turn are supported by concrete slabs and piles driven into the soil.Esta obra ha sido premiada por el Prestressed Concrete Institute y se refiere a una serie de pasos superiores sobre el Arroyo Seco, en California, que se ha canalizado para servir de desagüe en el caso de avenidas torrenciales. El canal se halla en una zona de edificación densa y se trata del paso—sobre aquél—de una autopista y rampas de acceso. La solución adoptada consistió en tres vigas pretensadas, ligeramente arqueadas con perfil parabólico, apoyadas en las dos márgenes y situadas en correspondencia con los tres soportes, sobre el propio canal, ya que ninguno de aquéllos debía apoyarse en el lecho de este último al objeto de no disminuir su capacidad de desagüe. Las vigas—de unos 39 m de longitud la mayor—son del tipo cajón, rigidizadas con unos diafragmas de pequeño espesor. El soporte cilíndrico, de 1,50 m de diámetro, se solidariza con la viga y le transmite una notable carga concentrada, del orden de 4.000 toneladas. Los apoyos de estas vigas son simples dados

  1. Comentarios sobre dibujo analítico

    OpenAIRE

    Mata Botella, Elena

    2004-01-01

    Cuaderno de apoyo a la docencia del DIBUJO DE ARQUITECTURA que pretende hacer reflexionar al alumno (de primero o segundo de carrera) sobre un tipo de dibujo que aquí se ha llamado “dibujo analítico”. Un dibujo que a través de operaciones gráficas y conceptuales como la esquematización y la selección de información, tiende a alejarse de la descripción del objeto arquitectónico para adentrarse en determinados aspectos o dimensiones que subyacen en el proyecto arquitectónico. Unas notas intr...

  2. Claves sobre el poder de las mujeres

    OpenAIRE

    García de León Álvarez, María Antonia

    2012-01-01

    El objeto de este texto es esbozar una síntesis sobre algunos nudos de mi obra en el área de Género y Poder. El estudio del poder es un punto de partida ineludible para abordar todo tema de Género, es decir, es necesario arrancar desde la comprensión del fenómeno social del poder, ya que el Patriarcado es un sistema estructurado de poder por género. Este punto de partida indica la relevancia del tema (nada más ni nada menos que el poder, tema clave en las Ciencias Sociales).

  3. Mapping sobre arquitecturas heterogéneas

    OpenAIRE

    De Giusti, Laura Cristina

    2008-01-01

    La programación de algoritmos paralelos, a diferencia de los algoritmos secuenciales, no cuenta para su representación con un único modelo. Esa carencia ocasiona que su aplicación sobre una arquitectura heterogénea, a través de modelos existentes, no halle el resultado que se ambiciona. La computación paralela ha propuesto, como pocas, significativos quiebres en el ámbito de la Ciencia de la Computación, al provocar la reformulación y generación de nuevos conceptos. El desarrollo de nuevos mo...

  4. Sobre la hiperinflación peruana

    OpenAIRE

    Oscar Dancourt; Ivory Yong

    1989-01-01

    El propósito de este artículo es contar una historia que ya ha sido muy bien contada en otras circunstancias: la historia de las hiperinflaciones. La deuda que tenemos con esa literatura económica clásica (Van Walre de Bordes (1924), Keynes (1971), Bresciani-Turroni (1968); Schacht (1927), Graham (1930). Robinson (1976)) no puede contabilizarse ni en una bibliografía, ni en unas cuantas citas. También debemos mucho a la literatura maierrta sobre las hiperinflaciones (especialmente Cagan (1967...

  5. Nota sobre Phelipaea reuteriana Rchb. F. (Orobanchaceae)

    OpenAIRE

    Pujadas-Salvá, Antonio J.; Crespo Villalba, Manuel Benito

    2006-01-01

    Recientemente se ha demostrado que Phelipaea reuteriana Rchb. f. es el nombre prioritario para Orobanche tunetana Beck, habiéndose rescatado aquél en el género Phelipanche Pomel (= Orobanche sect. Trionychon Wallr.). En la presente nota, sobre la base de los datos moleculares accesibles, se discute la conveniencia de separar las distintas secciones de Orobanche en géneros independientes y, por el contrario, se propone la nueva combinación Orobanche reuteriana (Rchb. f.) M.B. Crespo & A. Pujad...

  6. Notas sobre Phelipaea reuteriana Rchb. f. (Orobanchaceae)

    OpenAIRE

    Crespo Villalba, Manuel Benito; Pujadas Salvá, Antonio

    2006-01-01

    Recientemente se ha demostrado que Phelipaea reuteriana Rchb. f. es el nombre prioritario para Orobanche tunetana Beck, habiéndose rescatado aquél en el género Phelipanche Pomel (= Orobanche sect. Trionychon Wallr.). En la presente nota, sobre la base de los datos moleculares accesibles, se discute la conveniencia de separar las distintas secciones de Orobanche en géneros independientes y, por el contrario, se propone la nueva combinación Orobanche reuteriana (Rchb. f.) M.B. Crespo & A. Pujad...

  7. El tullido. Un cuento sobre los cuentos

    OpenAIRE

    Fernández-Urtasun, R. (Rosa)

    2005-01-01

    Este artículo realiza una lectura literaria y simbólica de El tullido, uno de los cuentos de Christian Andersen que pasó desapercibido entre los relatos que se publicaron tras su muerte. El relato del argumento va acompañado de una reflexión sobre los temas que aparecen recogidos en el texto: las tradiciones orales, la belleza del arte, la esperanza, la creación, la importancia de la escritura y de la lectura, la esencia de la literatura.

  8. Notas sobre envidia, equilibrio y optimalidad

    OpenAIRE

    Cristini, Marcela; Chisari, Omar Osvaldo

    1980-01-01

    Demostramos aquí -aún para coeficientes de producción distintos de la unidad- la suficiencia de las características del equilibrio para determinar el efecto aludido sobre la situación de ambos agentes. Damos otra condición suficiente, que no supone necesariamente el equilibrio; generalizamos los resultados a un número mayor de consumidores y deducimos propiedades del óptimo de Pareto, definido como aquella situación en la que no es posible mejorar el nivel de utilidad de un agente sin reducir...

  9. Productos derivados sobre bienes de consumo

    OpenAIRE

    Francisco Venegas Martínez; Salvador Cruz Ake

    2010-01-01

    Este trabajo de investigación desarrolla un modelo de equilibrio general con expectativas racionales en tiempo continuo útil para la determinación de precios de contratos forward , contratos futuros, bonos cupón cero y opciones europeas (de compra y venta) sobre bienes de consumo. Para ello, el modelo considera un individuo representativo en una economía con dos bienes, los cuales son producidos con tecnologías estocásticas. Por último, el modelo propuesto permite examinar estrategias para o...

  10. Observaciones sobre colostomía

    OpenAIRE

    Escobar T., Jaime; Castro, Augusto de; Peñalosa, Federico

    2011-01-01

    Se hace una revisión sobre 133 casos de colostomías hechas en pacientes del Hospital San Juan de Dios de Bogotá en un período de cinco años; el 43.7 por ciento de los casos eran heridas por arma de fuego. La mortalidad global fue de 16.5 por ciento. La colostomía derivativa, en ASA, ha bajado la mortalidad en las heridas de colon en dicho hospital.

  11. Avances sobre bases de datos no convencionales

    OpenAIRE

    Arroyuelo, Jorge; Esquivel, Susana Cecilia; Grosso, Alejandro; Ludueña, Verónica; Reyes, Nora Susana; Chávez, Edgar; Navarro, Gonzalo

    2014-01-01

    En la actualidad han surgido, debido a los avances alcanzados en tecnologías de información y comunicación, aplicaciones no tradicionales sobre bases de datos de todo tipo de datos, valga la redundancia. Éstos pueden ser imágenes, texto libre, secuencias de ADN, audio, video, etc., pueden estar o no estructurados y provenir de diversas fuentes (satélites, telescopios, revistas, fotografías, música, etc.), como también ser de diferentes tamaños, generalmente muy grandes. Por otro lado, las con...

  12. Literatura infantil sobre problemas infantiles: la diabetes

    OpenAIRE

    Lázaro Fernández, Patricia

    2015-01-01

    Debido al creciente número de casos de diabetes infantil que se está dando en la sociedad actual, no es raro encontrarse en las aulas cada vez más casos de esta enfermedad. Por esta razón, he decidido analizar dos libros sobre esta temática, para hacer un acercamiento del material seleccionado a las aulas y poder desarrollar junto con los niños un aprendizaje colectivo y cooperativo. En este trabajo se expone la importancia de la literatura y la literatura infantil como una ...

  13. Algunas reflexiones sobre la supervivencia empresarial

    OpenAIRE

    Sarabia Alzaga, José María

    1995-01-01

    Dos bloques-tópico, bien conocidos, configuran el esquema lógico de las reflexiones que se proponen. El primero de ellos se centra en nuestra realidad global: el entorno; el segundo, en los impactos que éste ha generado en la empresa, exponiendo una síntesis contrastada -y hoy día vigente- sobre cómo las empresas de éxito están consiguiendo sobrevivir. Como conclusión, se sintetizan algunas ideas o lineas generales de actuación que pudieran ayudar a mejorar o reforzar las propias experiencias...

  14. Sentencias Constitucionales sobre la muerte digna

    OpenAIRE

    Serrano, J. M.

    2006-01-01

    La sentencia comentada ha sido considerada como relevante en la discusión sobre el derecho a la vida en relación con la eutanasia. Sin embargo, las peculiaridades del caso qeu le dio origen y la propia argumentación del tribunal la alejan d euna interpretación relevante en torno a los dos tópicos del derecho a la vida y a la dignidad. Por el contrario la sentencia resulta decepcionate en su argumentación más propia. Primero respecto a la propia huelga de hambre que condena sin matices en rela...

  15. Consideraciones sobre de la ética

    OpenAIRE

    Enrique Cantolla Bernal

    2005-01-01

    El presente ensayo muestra como el hombre, a través de la historia, a estado constantemente buscando beneficios para su vida y ha debido cumplir con varias tareas, que con el tiempo han dado origen a costumbres y comportamientos que han llevado a constituir la moral y la ética. Esta última, nos permite definir y determinar los principales fines de la vida del hombre y cuales son los principios y normas que lo rigen. Así, el estudio de la ética nos plantea la interrogante sobre "los fines de l...

  16. Recursos sobre propiedad intelectual en internet

    OpenAIRE

    Sorli Rojo, Ángela; Merlo Vega, José Antonio

    2001-01-01

    El concepto de propiedad intelectual, entendido en su sentido más amplio, englobaría todos los aspectos relacionados con los derechos que se obtienen de una creación, tanto en su forma original, como de sus posibles reproducciones y transformaciones. En este trabajo se recopilan y analizan una serie de fuentes de información accesibles en Internet sobre este tema. No obstante, la idea de propiedad intelectual no coincide plenamente con la de propiedad industrial, que es mucho m...

  17. Efecto de masticar chicle sobre la halitosis

    OpenAIRE

    De Luca Monasterios, Fiorella; Chimenos Küstner, Eduardo; López López, José

    2014-01-01

    Fundamento y objetivo: Este estudio pretende estimar la prevalencia de halitosis oral en una población joven y mostrar el efecto del chicle sobre el aliento. Pacientes y método: Estudio prospectivo de campo descriptivo correlacional, de corte transversal. Se seleccionaron a conveniencia 121 jóvenes, de los que 98 concluyeron el estudio, el cual se realizó en el Hospital Odontológico Universitario-Universidad de Barcelona. El protocolo consistió en: cuestionario, evaluación clínica oral, prueb...

  18. Futuros: estudo de caso sobre futuros cambiais

    OpenAIRE

    Santo, Paula Cristina Rosa da Silva Espírito

    2010-01-01

    Mestrado em Contabilidade A presente dissertação foi realizada com vista à obtenção do grau de mestre em Contabilidade pelo Instituto Superior de Contabilidade e Administração de Lisboa. Para o desenvolvimento desta dissertação foi escolhido o tema “Contratos de Futuros”. Em termos estruturais esta monografia divide-se em duas partes. Na primeira parte faz-se uma exposição sobre o tema os “Futuros”. Na segunda parte é apresentado o trabalho de investigação que foi desenvolvido. Na...

  19. ALGUNAS CONSIDERACIONES SOBRE GUARDA Y CUIDADO

    OpenAIRE

    Antonio A. Salomón Salomón; Yusleidys Arteaga Gónzalez; Beatriz Figueraz González; Diosbel Fuentes Guilarte

    2011-01-01

    Desde comienzos del segundo tercio del pasado siglo, la mayor parte de los ordenamientos jurídicos se ocuparon de reformar el derecho de familia. Las nuevas concepciones sociales sobre la familia estaban fuertemente inspiradas en el principio de igualdad acogido por la Organización de Naciones unidas. La igualdad de los cónyuges y las relaciones de igualdad de los progenitores respecto a los hijos encontró un respaldo jurídico para fundamentar las reformas del derecho de familia en la igualda...

  20. Reflexiones sobre contabilidad privada y contabilidad nacional

    OpenAIRE

    José Arturo Gutiérrez

    1995-01-01

    Se discuten las interrelaciones de la contabilidad privada y la contabilidad nacional, insistiendo en sus condicionantes internos contradictorios en relación con la sobredeterminación de la formación económico-social vigente. En relación con ello se introduce la reflexión sobre la unidad contradictoria entre empresa y capital, esto es, la base técnica frente a su determinante socioeconómico, conflicto que la propia contabilidad privada expresa: al describir el capital aporta necesariamente el...

  1. Puntualizaciones sobre el concepto de latencia

    OpenAIRE

    Bortolazzo, Antonela

    2007-01-01

    El presente escrito revisa un concepto elaborado por Freud, como es la noción de Período de latencia sexual. Antes de hacer explícito el enfoque desde el cual será abordado quisiera mencionar que, lo que a continuación se desarrolla se enmarca en el trabajo de investigación que sobre el concepto de Latencia realiza, desde hace catorce años, la Cátedra de Psicología Evolutiva I, de la cual formo parte. En esta oportunidad me propongo indagar el concepto de latencia en el marco de la teoría ...

  2. Consideraciones criminológicas sobre las bandas juveniles

    OpenAIRE

    Medina, Juanjo, Ralphs, Robert, Aldridge, Judith

    2010-01-01

    Este artículo ofrece una serie de reflexiones originales sobre la definición de las bandas juveniles y resume algunos de los debates claves en el campo de investigación sobre bandas. En particular, se presta especial atención a los estudios sobre la relación entre bandas y delincuencia, las teorías que explican la formación de las bandas y los factores que empujan a los jóvenes a vincularse a las mismas, los estudios sobre respuestas de política criminal a este fenómeno, ...

  3. Más sobre Abalone y algo sobre tuercas: los tetrahexos

    OpenAIRE

    Rupérez, José Antonio; García, Manuel

    2012-01-01

    Comentamos los problemas planteados en anterior artículo sobre jugadas del ABALONE, describiéndolo de nuevo y presentamos el puzle de los Polihexos, fácil de construir y entretenido de resolver; útil para plantear ejercicios de combinatoria y simetrías.

  4. Debate sobre estudios postcoloniales y subalternos

    Directory of Open Access Journals (Sweden)

    David Morris

    2001-01-01

    Full Text Available A partir de los comentarios a la reseña elaborada por Ian S. Mclean sobre el libro: Cuerpos incas y el cuerpo de Cristo. El Corpus Christi en Cuzco colonial, Perú, escrito por Carolyn Dean, surge un debate sobre los Estudios Postcoloniales y Subalternos, que se desarrolló entre el 12 de agosto y el 3 de septiembre de 2001, a través de la lista de correo electrónico de H-Latam, grupo de discusión dedicado a la historia latinoamericana. En él participaron destacados especialistas en el tema, quienes analizaron, entre otras cuestiones, el uso de la jerga y las formas de escritura, la novedad de sus planteamientos, sus influencias filosóficas y epistemológicas, su pretensión de captar el punto de vista de los vencidos y subordinados, la pertinencia de unas ideas originalmente desarrolladas para el estudio del colonialismo inglés y luego aplicadas al colonialismo español en América Latina.

  5. El problema de Steklov sobre el cono

    Directory of Open Access Journals (Sweden)

    Óscar Andrés Montaño Carreño

    2012-12-01

    Full Text Available Sea (Mn, g un cono de altura 0 ≤ xn+1 ≤ 1 en R n+1, dotado con una métrica rotacionalmente invariante 2ds2 + f 2 (sdw2 , donde dw2 representa la métrica estándar sobre S n−1 , la esfera unitaria (n − 1-dimensional. Supongamos que Ric(g ≥ 0. En este artículo demostramos que si h > 0 es la curvatura media sobre ∂M y ν1 es el primer valor propio del problema de Steklov, entonces ν1 ≥ h. Abstract. Let (Mn, g be a cone of height 0 ≤ xn+1 ≤ 1 in R n+1, endowed with a rotationally invariant metric 2ds2 + f 2 (sdw2 , where dw2 represents the standard metric on S n−1 , the (n − 1-dimensional unit sphere. Assume Ric(g ≥ 0. In this paper we prove that if h > 0 is the mean curvature on ∂M and ν1 is the first eigenvalue of the Steklov problem, then ν1 ≥ h.

  6. Sobre la aplicabilidad del Principialismo Norteamericano

    Directory of Open Access Journals (Sweden)

    Pablo Requena Meana

    2008-01-01

    Full Text Available La propuesta de cuatro principios prima facie que Beauchamp y Childress han sugerido para la bioética (el principialismo se ha impuesto como uno de los paradigmas más seguidos, no sólo en los Estados Unidos, sino también en muchas otras partes del mundo. Este modelo ha sido criticado desde distintos puntos de vista, sobre todo en los últimos quince años. Una de las mayores objeciones que se hace al principialismo es la dificultad de aplicar la propuesta a los casos de la vida real. El problema de fondo está en que, a la falta de jerarquización de principios, se suma la ausencia casi total de indicaciones antropológicas sobre los bienes morales que deberían proteger dichos principios. El resultado es que ante un dilema ético se pueden sacar conclusiones opuestas, según se utilice un principio u otro. Los autores proponen como instrumentos para superar estos conflictos la especificación y ponderación de los principios y reglas morales; pero, en bastantes casos, no resultan suficientes.

  7. Hábitos de consumo sobre la cerveza

    OpenAIRE

    Velasco Matilla, Débora

    2015-01-01

    Estudio de los hábitos de consumo de cerveza en un pueblo determinado situado en la provincia de Segovia, Cantalejo. Contiene un resumen sobre la historia de la cerveza y su tipología y un estudio de mercado sobre la cerveza partiendo de una encuesta.

  8. Violência sobre Crianças

    OpenAIRE

    Sacadura, Catarina Brito; Aragão, Maria José

    2014-01-01

    Trata-se de um estudo de revisão sobre a violência exercida sobre crianças, os agentes da violência, os sujeitos da violência, os factores de risco, as consequências na idade adulta e a recidividade de violência sexual.

  9. Argentina neodesarrollista : Debates sobre el modelo

    OpenAIRE

    Féliz, Mariano

    2015-01-01

    En este libro desarrollamos estudios diversos sobre la economía argentina; las políticas públicas y la estructura social; el proyecto de desarrollo en el país y la región; y la dinámica del capitalismo a escala global. En todos los casos, el objetivo de los textos es analítico y pedagógico a la vez. Pretenden aportar a la comprensión de los diversos problemas, presentando elementos de una propuesta superadora partiendo de la crítica de la economía dominante y desde una lectura que se nutra de...

  10. Algunas observaciones sobre el mundo actual

    OpenAIRE

    Tello, Ángel Pablo

    1993-01-01

    El artículo expone las nuevas condiciones políticas creadas en el mundo a partir de la caída del Muro de Brelín y la disolución de la Unión Soviética. Desde allí, el autor intenta reflexionar sobre las líneas de acción que emergen en el planeta como consecuencia de ello y de la ausencia de referencias globales que se observaron durante décadas. En particular, el ascenso de los nacionalismos que no sólo es un fenómeno que afecta a los países en desarrollo, sino también a las potencias industri...

  11. Sobre a moralidade do direito em Kant

    Directory of Open Access Journals (Sweden)

    Joãosinho Beckenkamp

    2009-07-01

    Full Text Available http://dx.doi.org/10.5007/1677-2954.2009v8n1p63Na atual literatura sobre a fi losofi a prática de Kant há uma tendência a negligenciar a distinção feita na Metaphysik der Sitten entre direito (Jus e ética (Ethica, a ponto de ser a doutrina do direito de Kant vista como uma mera aplicação do imperativo categórico. Este artigo procura mostrar que Kant apresenta em sua doutrina do direito uma série de argumentos que logram estabelecer o direito de modo inteiramente independente da ética.

  12. NOTAS SOBRE A LÓGICA ESTOICA

    Directory of Open Access Journals (Sweden)

    Valter Duarte Moreira Júnior

    2014-02-01

    Full Text Available Diante do grande desenvolvimento da Lógica e do cálculo proposicional no século XX, estudiosos do assunto em todo o mundo se concentraram em um rigoroso estudo dessa disciplina e sua história. Nesse processo, o eminente lógico polonês Jan Lukaziewicz descobriu em sua pesquisa sobre história da lógica a Lógica Estoica, que, já em III a. C., havia antecipado diversos métodos e conceitos da Lógica Moderna. Nossa intenção neste artigo é fazer um breve esboço da lógica desenvolvida pelos Estoicos.

  13. Apuntes sobre el Cultivo del Cacao

    Directory of Open Access Journals (Sweden)

    Ochoa Horacio

    1940-03-01

    Full Text Available Por muchos años permaneció el cultivo del cacao en nuestro país, en un deplorable atraso técnico; el agricultor a duras penas si tenía conocimientos generales de su explotación y, de una industria que tuvo su auge debido a la extensividad de las plantaciones, hoy sólo resta una reducida porción de ella. ¿Qué factores operaron esa tan notoria reducción hasta el punto de que exportadores en otros tiempos nos convertimos en importadores obligados de ese producto? Hay muchas razones de orden técnico y de orden económico. Los cacaotaleros obtenían halagadoras retribuciones cuando el jornal consistía en la alimentación que se le daba a la peonada y cuando, generoso, añadía una sobretasa en dinero. Bajo ese sistema de explotación, el descuadre que pudiera ocasionar tanto las enfermedades criptogámicas como los plagas, no era suficiente como para provocar el pesimismo en el hacendado y por tanto inducirlo al abandono de la plantación. A medida que las condiciones sociales del campesino se fueron modificando y su standard de vida aumentaba, cambió fundamentalmente el mecanismo de la industria Se observó entonces que los árboles morían y que era pobre la producción; que lo que en tiempos pasados fuera un negocio lucrativo, se les había convertido en una actividad improductiva y, para controlar estos fenómenos que se generalizaban en todas las zonas cacaotaleras, opusieron la ignorancia, el rutinarismo y la desidia. Lentamente se han ido modificando los conceptos antiguos sobre el trabajo cultural y los cuidados que con relación a las enfermedades y plagas requiere este delicado cultivo; la rutina está echando paso atrás y las experiencias científicas que procuran la prosperidad del plantío, se ponen en práctica en algunas zonas . Esto da esperanza para la reconstitución de la industria cacaotalera en nuestro país, que cuenta con inmensas regiones de óptima calidad para hacerla florecer sobre bases nuevas, con

  14. Sobre el Boletín

    Directory of Open Access Journals (Sweden)

    Andrés Arias

    2014-03-01

    Full Text Available En la página de Internet de la Biblioteca Luis Ángel Arango se indica que una de la funciones principales del Boletín es la de reseñar la novedades bibliográfica que van apareciendo en el país. "Novedades": de lo nuevo, tanto en las publicaciones como en las reseñas. Es decir, si lo que asegura la página de la Biblioteca es cierto, quien se acerca al Boletín debe encontrarse con comentarios recientes sobre libros recientes. Con guía que le ayuden a elegir entre las mil ofertas que hay en el mercado bibliográfico. Pero bien sabemos que este objetivo no se cumple.

  15. NOTAS SOBRE A LÓGICA ESTOICA

    OpenAIRE

    Valter Duarte Moreira Júnior

    2014-01-01

    Diante do grande desenvolvimento da Lógica e do cálculo proposicional no século XX, estudiosos do assunto em todo o mundo se concentraram em um rigoroso estudo dessa disciplina e sua história. Nesse processo, o eminente lógico polonês Jan Lukaziewicz descobriu em sua pesquisa sobre história da lógica a Lógica Estoica, que, já em III a. C., havia antecipado diversos métodos e conceitos da Lógica Moderna. Nossa intenção neste artigo é fazer um breve esboço da lógica desenvolvida pelos Estoicos....

  16. Sobre la rehabilitación de la arquitectura

    OpenAIRE

    Iglesia Salgado, Félix de la

    2012-01-01

    El presente ensayo reflexiona sobre el papel actual de la técnica de la arquitectura ante determinadas estrategias y comportamientos urbanos que, volcadas sobre nuevas situaciones resultado del cambio cualitativo y cuantitativo que se produce en nuestras ciudades, proponen una nueva urbanidad; una búsqueda, a partir de la rehabilitación del tejido residencial y los espacios de relación, sobre el control de los nuevos lugares y formas de habitabilidad que se hacen visibles como partes de una r...

  17. Pistas para pensar las significaciones imaginarias sobre la invariancia

    OpenAIRE

    Bilyk, Pablo Andrés

    2011-01-01

    Este escrito propone un primer esbozo de nominalizaciones sobre las significaciones imaginarias en torno a la idea de invariancia, con el fin de comenzar a mapear categorías para transitar que nos permitan pensar las construcciones fantasmáticas sobre el no-cambio. En definitiva, se trata de avanzar sobre la problematización de los modos de funcionamiento, constitución y reconfiguraciones de las hegemonías en los entramados sociales contemporáneos.

  18. Pilas de arena sobre grafos dirigidos y algo de complejidad

    Directory of Open Access Journals (Sweden)

    Carolina Mejía Moreno

    2006-01-01

    Full Text Available En este artículo estudiamos el Modelo de Pilas de Arena sobre grafos dirigidos. El comportamiento del modelo sobre grafos dirigidos es más complejo (en término estrictos que sobre grafos no dirigidos; es por ello que, para muchas de las preguntas centrales de la teoría, no se conoce la respuesta en el caso dirigido. En este artículo se ha sintetizado la teoría para digrafos, se han simplificado algunas pruebas y se concretan algunos resultados relacionados con la complejidad de predicción del autómata.

  19. El puente Bendorf sobre el Rin (Alemania

    Directory of Open Access Journals (Sweden)

    Hirschfeld, Kurt

    1966-03-01

    Full Text Available This recently completed bridge over the Rhine is 524 m long, and is a reinforced concrete structure, built by successive overhangs, without the aid of formwork or scaffolding. The centre span is 208 m in length, and the other six vary between 43 and 71 m. The deck consists of two independent parts, including a continuous box girder, with a hinge at the crown of the main span. It is stiffened with transversal diaphragms, spaced every 34 m. The piles rest on pneumatic caissons, which go down to 16 m below the river bed. The attachment between the piles and the caissons is rigid, at the central pile, and at the other piles it operates through a roller bearing. The central span was constructed without intermediate supports for the first 40 m, and beyond that stage, for greater safety, a provisional movable tower was built, as a temporary point of support for the free overhang. The various sections were concreted and post-tensioned with 32 mm bars, by the Dywidag procedure. Account was taken of the varying deformations that took place at each section, so as to add the necessary counter-deflection that finally enabled the two sides of the arch to meet at the crown at the calculated point.Este puente, recientemente construido, sobre el Rin, tiene una longitud total de 524 m, es de hormigón armado y se ha realizado por el procedimiento de voladizos sucesivos, sin entramado auxiliar ni cimbras. La luz del tramo central es de 208 m, y las de los otros seis oscilan entre 43 y 71 m. La estructura del tablero se compone de dos partes independientes, formadas por una viga tipo cajón, continua, con una articulación en la clave del tramo central y rigidizada con diafragmas transversales espaciados a 34 m. Las pilas centrales se apoyan sobre cajones neumáticos que descienden 16 m debajo del fondo del río. La unión entre estas pilas y la estructura cajón es rígida, y de tipo rodillo en las otras pilas. El tramo central se ha construido por voladizos

  20. Algunas reflexiones sobre el poder itinerante almohade.

    Directory of Open Access Journals (Sweden)

    Maribel FIERRO

    2009-12-01

    Full Text Available La primera parte del artículo consiste en la presentación de dos estudios sobre el poder itinerante en el Magreb: Jocelyne Dakhlia (1988 para las épocas hafsí y posteriores; Manuela Marín (2005 sobre el caso almohade. En la segunda parte, primeramente se analiza la convergencia del itinerario de Ibn Tumart con las conquistas de ‘Abd al-Mu’min: el movimiento –real o legendario– del fundador mesiánico del imperio marca el territorio conquistado por su sucesor el califa y su presencia inserta el espacio en la memoria, la geografía y el poder imperiales. A continuación, se plantea la compleja cuestión de la «capitalidad» almohade: se puede hablar de una capital sagrada (Tinmal, una capital central (Marrakech, capitales regionales (Sevilla, Túnez y de una nueva capital inacabada (Rabat. Pero es la presencia (hadar del propio califa la que determina dónde está el centro del imperio.La première partie de cet article présente deux études sur le pouvoir itinérant au Mahgreb : celle de Jocelyne Dakhlia (1986 sur la période hafside et les suivantes, celle de Manuela Marín (2005 sur le cas almohade.Dans la seconde partie, on analyse d’abord la convergence de l’itinéraire d’Ibn Tumart avec les conquêtes d’‘Abd al-Mu’min : le  trajet – réel ou légendaire – du fondateur messianique de l’empire marque le territoire conquis par son successeur le calife et sa présence ancre l’espace dans la mémoire, la géographie et le pouvoir impériaux. Ensuite, on examine la question complexe de la « capitalité » almohade : on peut parler d’une capitale sacrée (Tinmal, d’une capitale centrale (Marrakech, de capitales régionales (Séville, Tunis et d’une nouvelle capitale inachevée (Rabat. Mais c’est la présence (hadar du calife lui-même qui détermine où est le centre de l’empire.

  1. NOTAS SOBRE A IRRACIONALIDADE DA GUERRA

    Directory of Open Access Journals (Sweden)

    Edilene Leal

    2014-08-01

    Full Text Available Nesse artigo, procedemos a uma análise sobre a irracionalidade da guerra em tempos cada vez mais caracterizados pela evolução da racionalidade técnica, ou seja, em tempos contemporâneos. Esse é o ponto a partir do qual traçamos, aqui, um percurso argumentativo dividido em duas partes. Na primeira, reconstituímos elementos da concepção de guerra de filósofos como Maquiavel, Clausewitz e Kant, destacando, nos dois primeiros pensadores, a prerrogativa de que a guerra é racional quando se configura meio para fins políticos. Na segunda parte, confrontamos essa racionalidade política da guerra com a dupla dimensão técnica que a guerra assumiu: de um lado, a guerra como um fim em si mesmo e não mais como meio da ação política; de outro, a dimensão racionalizante da guerra como resultado do progresso técnico e científico, atualizada como guerra do terror.

  2. sobre la población

    Directory of Open Access Journals (Sweden)

    Mauricio Schoijet

    2005-01-01

    Full Text Available En este artículo se analizan varios elementos de la obra de Thomas Malthus sobre población, en particular la recepción de su teoría y su posición política. Se resumen las críticas políticas, ideológicas y científicas que ha recibido, y se examinan asuntos hasta ahora no tratados por otros comentaristas, como es el caso de las excepciones admitidas por Malthus respecto al papel de las relaciones sociales feudales en la agricultura de Polonia y Rusia. Se sugiere que pese a que su teoría tendía a reforzar la pesada represión social y sexual existente, Malthus no fue apoyado por la burguesía británica (contrariamente a la apreciación de Marx. Se deduce que Malthus no percibió cabalmente los avances de la agricultura, y se refuta la tesis de Donald Winch de que habría sido un liberal de izquierda en política pues si bien en algunos aspectos se le puede considerar progresista, en otros, esenciales, conservador extremadamente represivo o protofascista, incluso precursor de la teoría de los golpes de Estado.

  3. Consideraciones sobre de la ética

    Directory of Open Access Journals (Sweden)

    Enrique Cantolla Bernal

    2005-12-01

    Full Text Available El presente ensayo muestra como el hombre, a través de la historia, a estado constantemente buscando beneficios para su vida y ha debido cumplir con varias tareas, que con el tiempo han dado origen a costumbres y comportamientos que han llevado a constituir la moral y la ética. Esta última, nos permite definir y determinar los principales fines de la vida del hombre y cuales son los principios y normas que lo rigen. Así, el estudio de la ética nos plantea la interrogante sobre "los fines de la vida en este mundo" y cuales son las conductas para conseguirlos. Sin embargo, el autor plantea que el hombre se enfrenta a la elección de valores alternativos y ante la interrogante de ¿cuál es el sumo bien del ser humano y de la sociedad?, han surgido diversas teorías que muestran como, casi todas las sociedades, han elegido la búsqueda de la felicidad como "el sumo bien", pero este concepto de "la felicidad" ha variando producto de las diversas teorías y doctrinas, que han emergido a lo largo de su historia.

  4. Fechas y sospechas sobre Lucas de Tuy

    Directory of Open Access Journals (Sweden)

    Linehan, Peter

    2002-06-01

    Full Text Available The present essay seeks to establish what we know, as opposed to what we think we know, about the author of the Chronicon Mundi. Amongst the issues investigated are those of don Lucas's origins, the nature of his connections with León, the date of his activity as chronicler, and the use which may have been made of that work by D. Rodrigo Jiménez de Rada in the De rebus Hispaniae.

    El presente estudio busca establecer qué es lo que sabemos, en oposición a qué es lo que pensamos que sabemos, sobre el autor del Chronicon mundi. Entre los aspectos investigados están los orígenes de don Lucas de Tuy, la naturaleza de sus conexiones con León, la datación de su actividad como cronista así como el uso que pudiera haber hecho Rodrigo Jiménez de Rada de su obra en el De rebus Hispaniae.

  5. Estudio sobre encofrados de madera modernos

    Directory of Open Access Journals (Sweden)

    de la Peña Aznar, Juan M.

    1980-06-01

    Full Text Available This article is a compendium of almost all of the existing literature, in addition to important contributions by the author, on forms —an important aspect of the building industry, as their cost is not infrequently as high or higher than that of the actual concrete poured. Thus, to the benefit of architects, engineers, site supervisors and carpenters, data are provided, as well as charts and calculations for a rational use of these forms, whether wooden, metal or of other material.

    En este artículo se compendia casi toda la literatura existente, así como importantes aportaciones del autor, sobre encofrados, capítulo importante en la construcción, ya que su costo resulta no pocas veces tan elevado o más que el propio hormigón vertido. Así pues en beneficio de arquitectos, ingenieros, encargados y carpinteros se dan datos, cuadros y ábacos para el empleo racional de los citados encofrados, sean de madera, metálicos, etc.

  6. Estudio sobre encofrados de madera modernos

    Directory of Open Access Journals (Sweden)

    de la Peña Aznar, Juan M.

    1980-10-01

    Full Text Available This article is a compendium of almost all of the existing literature, in addition to important contributions by the author, on forms —an important aspect of the building industry, as their cost is not infrequently as high or higher than that of the actual concrete poured. Thus, to the benefit of architects, engineers, site supervisors and carpenters, data are provided, as well as charts and calculations for a rational use of these forms, whether wooden, metal or of other material.

    En este artículo se compendia casi toda la literatura existente, así como importantes aportaciones del autor, sobre encofrados, capítulo importante en la construcción, ya que su costo resulta no pocas veces tan elevado o más que el propio hormigón vertido. Así pues en beneficio de arquitectos, ingenieros, encargados y carpinteros se dan datos, cuadros y ábacos para el empleo racional de los citados encofrados, sean de madera, metálicos, etc.

  7. Estudio sobre encofrados de madera modernos

    Directory of Open Access Journals (Sweden)

    de la Peña Aznar, Juan M.

    1980-03-01

    Full Text Available This article is a compendium of almost all of the existing literature, in addition to important contributions by the author, on forms —an important aspect of the building industry, as their cost is not infrequently as high or higher than that of the actual concrete poured. Thus, to the benefit of architects, engineers, site supervisors and carpenters, data are provided, as well as charts and calculations for a rational use of these forms, whether wooden, metal or of other material.

    En esta artículo sa compendia casi toda la literatura existente, así como importantes aportaciones del autor, sobre encofrados, capítulo importante en la construcción, ya que su costo resulta no pocas veces tan elevado o más que el propio hormigón vertido. Así, pues, en beneficio de arquKectos, ingenieros, encargados y carpinteros, se dan datos, cuadros y abacos para el empleo racional de los citados encofrados, sean de madera, metálicos, etcétera.

  8. Consideraciones sobre diferentes procesos productivos y sus consecuencias sobre el medio ambiente

    Directory of Open Access Journals (Sweden)

    Caridad Ramos Alvariño

    2004-01-01

    Full Text Available En el presente trabajo se exponen algunas consideraciones sobre diferentes procesos productivos y sus consecuencias sobre el medio ambiente. La disminución del impacto negativo de algunas producciones sobre el medio ambiente es favorable, pero el problema va más allá y de lo que se trata es de la necesidad de una transformación sostenible de las producciones que puedan conducir a una vida agradable y una naturaleza conservada entre otras muchas cuestiones que agobian hoy al mundo. La solución al problema puede ser alcanzada con mayor prioridad en la reducci ón de la fuente primaria de la contaminación, seguida por el reciclaje y el desarrollo de tecnologías limpias. La reducción en la fuente se aplica por los cambios de productos y procesos. El cambio de la fuente se relaciona con la composición o el uso de los productos intermedios y finales, que reduzcan los residuos de producción, su uso o la disposición de los productos. Los cambios de procesos están relacionados con la sustitución de las materias primas de entrada, la modificación de las tecnologías y las mejoras operacionales. Las opciones específicas pueden incluir: el uso de materiales menos tóxicos, el aumento de la automatización, los procedimientos para las operaciones y el mantenimiento, el control de inventario, entre otros.

  9. Algunas reflexiones acerca de la encuesta sobre trabajo colaborativo

    OpenAIRE

    Gargiulo, Sandra; Ponz, María Jimena

    2014-01-01

    Comenzamos el mes de noviembre con un nuevo tema del mes: Dinámicas de trabajo colaborativo virtual. Para ello, queremos compartir los resultados arrojados por la encuesta sobre el trabajo colaborativo que muchos de ustedes han completado.

  10. Normativa sobre el impuesto sobre los gases efecto hivernadero (Green house gases tax)

    OpenAIRE

    Rodrigo de Larrucea, Jaime

    2013-01-01

    Como dice el apartado V de la Exposición de motivos de la Ley 16/2013, se crea un nuevo impuesto sobre los gases de efecto invernadero, relativo a los gases fluorados que se utilizan habitualmente en numerosos sectores como refrigerantes, disolventes, agentes espumantes o agentes extintores de incendios, para paliar de alguna manera su negativa contribución al calentamiento de la atmósfera, con un potencial de calentamiento global mucho más elevado que el CO2.

  11. Notas sobre o bicho-da-seda no folclore Chinês

    Directory of Open Access Journals (Sweden)

    Nelson Papavero

    2011-03-01

    Full Text Available Notas sobre o bicho-da-seda no folclore chinês. Duas lendas sobre o bicho-da-seda (Bombyx mori Linnaeus, 1758 no folclore chinês são apresentadas: uma sobre a sua origem, a outra sobre os gatos como protetores do bicho-da-seda e da sericultura.

  12. Banco Interamericano de Desarrollo informe sobre sostenibilidad 2011

    OpenAIRE

    Banco Interamericano de Desarrollo (BID)

    2012-01-01

    El Informe de Sostenibilidad contiene información sobre las contribuciones del BID a la sostenibilidad durante el año 2011. También proporciona información sobre las tendencias fundamentales del desarrollo y las dimensiones de sostenibilidad en América Latina y el Caribe. Este año, el informe se centra en la sostenibilidad y la agricultura en la región

  13. Reflexiones sobre el género y la censura

    OpenAIRE

    Daniel Cazés Menache

    2006-01-01

    Este trabajo analiza y reflexiona sobre la primera censura social: la censura genérica, es decir, la estructurada sobre la adscripción de género, arena en la que se sintetizan todas las censuras sociales destinadas a controlar a cada sujeto y a mantenerlo sometido a dominios de los que no podrá librarse ni para aceptarlos ni para ejercerlos.

  14. EFEITO DE CALDAS SOBRE Corynespora cassiicola

    Directory of Open Access Journals (Sweden)

    Mercia Celoto

    2014-11-01

    Full Text Available The target spot (Corynespora cassiicola, main leaf disease occurred in barbados cherry in the regionof Junqueirópolis, SP, causing severe defoliates of plants. After the cleaning prune, producers apply line sulfhur in plants, for presenting fungicidal, insecticide and acaricide action. The objective of this study was to assess the effect of line sulfhur (75% and 3% - used by producers, bordeaux mixture (75% and „calda Viçosa‟ (75% on Corynespora cassiicola. The syrups were incorporate into potato-dextrose-agar or spore suspension for determination of inhibition of the mycelia growth and spores germination. Leaves barbados cherry, with symptoms of target spot, were treated with syrups. In wet champer, high humidity, was verified that sporulation occured in lesions, however the spores lost viability by presence of syrups in surface. In vitro, line sulfhur to 75% inhibited completely the mycelia growth of the fungus. Line sulfhur, Bordeaux mixture and „calda Viçosa‟ inhibited completely the spores germination. For the reasons, the use of syrups in barbados cherry, can contribute in reduction of souce of inoculum of the pathogen. A mancha alvo (Corynespora cassiicola é a principal doença da cultura da acerola, na região de Junqueirópolis, SP, causando desfolha precoce nas plantas. Após a realização da poda de limpeza anual, os produtores aplicam a calda sulfocálcica nas plantas, por apresentar ação fungicida, inseticida e acaricida. O objetivo deste trabalho foi avaliar em condições in vitro e in vivo o efeito das caldas sulfocálcica, bordalesa e Viçosa sobre Corynespora cassiicola. As caldas foram utilizadas nas seguintes concentrações: calda sulfocálcica (75 e 3% - concentração utilizada por produtores, calda Bordalesa (75% e calda Viçosa (75%. As caldas foram incorporadas em meio de batata-dextrose-ágar ou suspensão de esporos para determinação das inibições do crescimento micelial e da germinação de esporos

  15. Construcciones en yeso proyectado sobre vegetales

    Directory of Open Access Journals (Sweden)

    Martínez, Hubert

    1986-07-01

    Full Text Available A construction method developed in early 1981 in Senegal, whose main objective is the evaluation of natural and human sources, specially those of wild vegetables and the phosphogypsum (a waste of chemical industry in Senegal. The introduction of the mechanical projection allows a noticeably growth in work performances and an improvement of the quality. The projection reduces de number of trades intervening in the work, doing away with plasters, watertightness systems and paintings, and simplifying the setting of technical installations and of carpentry. The acquisition of this projecting material is not very expensive, so, it is easy for small and medium enterprises to reach an expertness in gypsum work. Its finantial rentability is assured for a prize of the gypsum of 180% of the prize of the cement.Procedimiento de construcción desarrollado al comienzo de 1981 en el Senegal, teniendo como objetivo la valoración de las fuentes naturales y humanas, especialmente los vegetales en estado silvestre y el fosfoyeso, residuo de la industria química del Senegal. La introducción de la proyección mecánica permite aumentar sensiblemente el rendimiento del trabajo y mejorar la calidad. La proyección reduce el número de oficios que intervienen en la obra por la supresión de enlucidos, sistemas de estanquidad y pinturas sobre la gruesa obra y simplifica la colocación de las instalaciones técnicas y de carpintería. La adquisición del material de proyección, necesitando un capital relativamente modesto, se encuentra al alcance de pequeñas y medianas empresas que deseen especializarse en los trabajos de yeso. La rentabilidad financiera del procedimiento está asegurada para un precio del yeso de hasta el 180% del precio del cemento.

  16. Estudio sobre encofrados de madera modernos

    Directory of Open Access Journals (Sweden)

    de la Peña Aznar, Juan M.

    1980-12-01

    Full Text Available The author continues the development of the subject «Modern Timber Formwork», by summing up the comparative examination —already carried out in Part III of this Study— of the different types of glued timber existing on the market. In addition, the loads and stresses allovk/able for coniferous timber and the proposal for establishing Regulations for the Timber Section of the Research and Experimental Forestry Institute of Spain are given. In part V of the author's Study, published in this article, the important subject of the glues used for joining timber, a truly vital point in order to obtain louvered timber beams which are simply glued together, is approached.

    El autor continúa el desarrollo del tema sobre «Encofrados de madera modernos», resumiendo el estudio comparativo —ya hecho en la Parte III de este Estudio— de las diferentes vigas de madera encolada existentes en el mercado dando, además, las cargas y tensiones admisibles para maderas coníferas y la propuesta de Reglamentación de la Sección de Maderas del Instituto Forestal de Investigaciones y Experiencias de España. En la parte V del Estudio del autor, publicada en este artículo, se aborda el importante tema de las colas empleadas para las uniones de madera, algo realmente vital para la obtención de vigas de madera en celosía simplemente encoladas.

  17. Sobre o campo da Psicologia Social

    Directory of Open Access Journals (Sweden)

    Belinda Mandelbaum

    2012-03-01

    Full Text Available O campo da Psicologia Social é apresentado como território fértil, na contemporaneidade, para constituir-se como um laboratório para a produção em Ciências Humanas, uma vez que, no século XX, cada vez mais o social foi em direção ao psicológico. Neste campo, nosso embate dá-se no modo como entendemos o hífen pressuposto na integração psicossocial. A autora propõe que, entre o psicológico e o social, o hífen domina, pois ele é a própria essência relacional que é inerente a cada um dos elementos. Sugere que o modelo para entender o homem e suas circunstâncias proposto por Freud imbrica de forma indissociável o psicológico e o social, a ontogênese e a filogênese, com uma potência que teve impacto sobre todo o campo das Ciências Humanas. A Psicanálise é um instrumento hermenêutico para colaborar na elucidação dos fenômenos sociais. A autora utiliza imagens construídas por Freud e Walter Benjamin e poemas de Carlos Drummond de Andrade para fortalecer o entendimento do hífen psicossocial tanto em sua ação multidimensional quanto em sua organização.

  18. Sobre el genio de las mujeres

    Directory of Open Access Journals (Sweden)

    Valcárcel, Amelia

    1992-11-01

    Full Text Available Not available.

    A los varones, desde Tácito a Schopenhauer, nunca les ha parecido que las verdaderas mujeres son las que tienen en casa, sino las que tienen los otros varones (los germanos, los orientales. Por su parte, Wojtyla ha hecho profesión de fe «en el genio de las mujeres», reclutando enternecidos agradecimientos como el de Macciochi. La autora del presente artículo adopta una perspectiva histórica y una actitud analítica para aclarar qué es ese genio que como genérico nos adjudican. En primer lugar, la idea de genio es romántica y va emparejada con la de destino, sobre todo en el caso de los genios colectivos. Se trata de nociones que se construyen estipulativamente con fines pragmáticos y no admiten, por definición, contraejemplos. En el caso del genio de las mujeres, los llamados «valores femeninos» que lo constituyen pertenecen al ámbito de la Siulichkeit, y su eventual convalidación en el de la Moralitiit no puede obviar el proceso consistente en la crítica y el desmarcarse de una Sittlichkeit adjudicada como estereotipia que se contrasta, no con otra estereotipia simétrica, sino con lo universal, que se solapa con el genérico masculino. La autora, por último, nos recuerda que la fabricación de este genio que, a título de colectivo, se nos atribuye a las mujeres tiene lugar a costa de la usurpación de nuestra individualidad y de la ausencia de esquemas pragmáticos de reconocimiento de la genialidad individual que pueda producirse en el genérico femenino. Ahora bien: es esta última la que las mujeres necesitamos para poder romper con las tradiciones establecidas e instituir nuevos relatos.

  19. Estudos sobre a Esquistosomose em Pernambuco, Brasil

    Directory of Open Access Journals (Sweden)

    Aggeu Magalhães

    1940-01-01

    Full Text Available Os autores referem os resultados dos estudos sobre esquistosomose realisados, em Pernambuco, de Novembro de 1938 a Dezembro de 1939. Não se extendem em discussão, nem comentarios, tampouco, relacionam suas verificações com o que já foi relatado sobre o assunto em trabalhos nacionais e estrangeiros, pelo fato de que, não se trata de um resultado definitivo e sim de atividades que irão proseguir. Os estudos sistematicos em torno da endemia esquistosomica foram executados em duas localidades diversas pela população e pela situação geografica e ecologica. Pontezinha é uma povoação de 1200 habitantes localizada proximo a um conjunto de charcos e lagõas de agua dôce onde pululam caramujos do tipo olivaceus de Spix, e apresenta uma taxa de infestação de 21,4% para individuos do sexo masculino, e de 14,7% para os do sexo feminino. A distribuição por grupos de idade mostra que a incidencia cresce até o grupo de 16 a 20 anos de idade, quando atinge a percentagem de 37,8%, para decrescer em seguida. Em Vitoria a incidencia foi maior nos indivíduos do sexo feminino, atingindo a taxa de 41,4%, dando o sexo masculino a taxa de 36,9%. Por idade a percentagem maxima é atingida pelo grupo de 11 a 15 anos. Vitoria é uma cidade de 1500 habitantes, construida á margem do rio Tapacurá, onde se encontram numerosos caramujos do tipo centimetralis Lutz. A divergencia de incidencia corre por conta dos habitos da população e pela utilização que ela faz do rio, sendo maior em Vitoria porque a proximidade do rio facilita o uso de suas aguas para banho e serviços domesticos, condicionando este ultimo fato, a maior infestação das mulheres. O estudo da frequencia da infestação dos caramujos por cercarias de diversos trematodios, permite suspeitar uma relação inversa entre a taxa de infestação e o diametro maximo atingido pelos caramujos, parecendo este fato confirmar os trabalhos de Vianna Martins sobre a identidade dos hospedeiros

  20. As vicissitudes do "ensaio sobre o dom"

    Directory of Open Access Journals (Sweden)

    Lygia Sigaud

    1999-10-01

    Full Text Available A partir dos anos 60, antropólogos de diferentes tradições nacionais passaram a convergir no sentido de considerar que o texto de Marcel Mauss, "Ensaio sobre o Dom", contivesse uma teoria da troca, que atribui à identificação entre a coisa dada e o espírito do doador o princípio de explicação das transações. Esta interpretação contrasta com a que tiveram os contemporâneos de Mauss, os quais resgataram do trabalho suas dimensões relativas ao direito, às obrigações e às prestações totais. Partindo desta constatação, o artigo problematiza o destino do ensaio e busca torná-lo inteligível. Para tanto examina as condições sociointelectuais que contribuíram para que se produzisse a inflexão na leitura e a consolidação de uma espécie de crença coletiva em relação ao trabalho. Através deste estudo de caso, a autora identifica mecanismos que operam no processo de construção de teorias, na conformação de representações acerca de textos e na sua consagração no âmbito da antropologia.From the 1960s, anthropologists of different national traditions came to share the view that Marcel Mauss’s text, "Essay on the Gift," contained a theory of exchange which takes the identification between the thing given and the spirit of the donor as the explanatory principle of transactions. This interpretation contrasts with that held by Mauss’s contemporaries, who lifted from the work aspects relating to law, obligations and total prestations. Starting from this fact, the article problematizes the essay’s fate and seeks to make it intelligible. To this end, it examines the socio-intellectual conditions which contributed to producing this inflection in the readings of the work and the consolidation of a kind of collective belief concerning it. Through this case study, the author identifies mechanisms which operate in the process of constructing theories, in the conformity found in representations of certain texts, and in the

  1. Marginalia: algumas notas adicionais sobre o dom

    Directory of Open Access Journals (Sweden)

    Pierre Bourdieu

    1996-10-01

    Full Text Available Prosseguindo a análise do dom, este artigo busca ultrapassar as visões fenomenológica, estruturalista e economicista do fenômeno. Para tanto, desloca o eixo de interrogação na direção do tempo e da incerteza ligados ao intervalo entre o dom e o contradom, do agente e da ação ligados às práticas, da economia de bens simbólicos e o habitus específico que a funda. Demonstrase assim, contra todo reducionismo (à consciência, ao cálculo inconsciente ou ao cálculo propriamente dito, que a razão do dom só pode repousar sobre sua dupla verdade, seu caráter generoso e obrigatório. Por outro lado, demonstrase também que foi somente através de uma revolução simbólica, e não o desenvolvimento de uma suposta natureza humana, que uma economia da troca pôde, historicamente, se destacar da economia do dom, cuja possibilidade continua aberta, dependendo apenas dos investimentos coletivos que sejam efetuados em sua direção.Resuming an analysis of the gift, this article seeks to go beyond the phenomenological, structuralist, and economicist view of this phenomenon. It thereby shifts the trust of questioning towards the time and uncertainty linked with the interval between the gift and the counter-gift, the agent and the action linked to such practices, the economy of symbolic goods, and the specific habitus underlying it. It thus demonstrates against any and all reductionism (to consciousness, to unconcious calculation, and to calculation per se that the gift's reason can only lie in its double truth, its generous and obligatory nature, both disinterested and interested. The author also demonstrates historically that it is only through a symbolic revolution, and not the development of a supposed human nature, that an economy of exchange can stand out from the economy of the gift, whose possibility remains open, requiring collective investments in its direction.

  2. Dois estudos sobre o trabalho dos petroleiros

    Directory of Open Access Journals (Sweden)

    Leda Leal Ferreira

    1996-06-01

    Full Text Available O presente artigo traz um resumo de dois estudos realizados na área do petróleo, o primeiro feito em uma unidade de refino e o segundo abarcando o trabalho de operadores exercendo várias funções dentro de uma refinaria e de terminais marítimos de petróleo. Nos dois casos, o ponto central foi a análise da atividade dos trabalhadores, isto é, o que eles faziam e como o faziam para dai conta das exigências de produção que lhes eram atribuídas. No entanto, os métodos utilizados foram diferentes: no primeiro caso utilizou-se a Análise Ergonômica do Trabalho (AET e no segundo, a Análise Coletiva do Trabalho (ACT. Além de apresentar os principais resultados destes estudos, a autora faz considerações sobre as diferenças entre os dois métodos e um apelo à comunidade científica para que se preocupe mais em estudar a atividade real dos trabalhadores e assim contribuir para um melhor conhecimento do que se passa no interior das unidades produtivas, evitando que sofrimentos humanos inúteis e até catástrofes industriais continuem a ocorrer.This paper describes two studies about petroleum industry. The first was developed in a refinery and the second focuses on the work of operators in various jobs within a refinery and maritime petroleum units. In both cases, the focal point was the analyses of activities, that is, what the workers do and how they do it in order to meet production demandai put on them. However, two different methods were applied in the studies. Ergonomics Work Analyses (EWA was used on the first case and Collective Work Analyses (CWA, on the second. Besides showing the main results, the author compares the two methods. She also draws the scientific community attention to the importance of studding the workers actual activity in order to contribute to a better understanding of what is going on inside production units, avoiding useless human suffering, and the still ocurring undustrial disasters.

  3. Sensibilidade de fungos entomopatogênicos a agroquímicos usados no manejo da cana-de-açúcar

    Directory of Open Access Journals (Sweden)

    Aline Aparecida Alves Botelho

    2011-01-01

    Full Text Available Os agroquímicos empregados no manejo da cana-de-açúcar podem afetar a ação de fungos entomopatogênicos usados no controle biológico de pragas da cultura. Este trabalho teve por objetivo investigar se os inseticidas, herbicidas e maturadores utilizados no manejo da cana-de-açúcar têm efeito tóxico sobre os fungos Beauveria bassiana e Metarhizium anisopliae. Foram utilizados os inseticidas thiametoxan, aldicarbe e fipronil, os herbicidas imazapir, diuron, metribuzin, hexazinone+diuron, clomazone+ametrina, 2,4 diclorofenoxiacético e glifosato, e os maturadores etil-trinexapac, sulfometurom-metílico e glifosato também. Os fungos foram cultivados em meio de cultura batata-dextrose-ágar contendo os agroquímicos. Avaliou-se o crescimento micelial, a produção e viabilidade dos conídios, e fez-se a avaliação da toxicidade dos agroquímicos. O inseticida à base de thiametoxan foi considerado compatível, pois não afetou o crescimento micelial, a produção e a viabilidade dos conídios dos dois fungos. O inseticida formulado com fipronil se mostrou parcialmente tóxico para os fungos, sendo considerado moderadamente compatível, enquanto o aldicarbe foi considerado tóxico. Os herbicidas avaliados afetaram o crescimento micelial, a produção e a viabilidade dos conídios dos entomopatógenos e foram classificados como tóxicos, mas aqueles formulados com imazapir, glifosato e metribuzim foram considerados compatíveis. Entre os agroquímicos usados como maturadores apenas o glifosato foi classificado como compatível. Os agroquímicos usados no manejo da cana-de-açúcar, e que foram testados neste estudo, têm majoritariamente efeito tóxico sobre B. bassiana e M. anisopliae podendo comprometer sua ação como bioagentes de controle de pragas da cultura.

  4. Comentarios sobre la Ley de Ordenamiento Territorial Sostenible

    Directory of Open Access Journals (Sweden)

    Arturo J. Yglesias

    2014-04-01

    Full Text Available La denominada Ley de Ordenamiento Territorial Sostenible, no fue bien recibida en el medio jurídico. Tanto los profesores de las diferentes materias de Derecho de nuestra Facultad como las asociaciones profesionales y otros grupos e juristas de nuestro medio, formularon reservas de diverso calibre sobre el texto de la ley que van desde sus aspectos adjetivos como la terminología y redacción hasta cuestiones sustanciales como lo que ella dice sobre el régimen de la propiedad territorial y otras cuestiones vinculadas.Desde el discurso político vimos lanzar opiniones iracundas y alarmistas sobre las modificaciones que la ley estaría haciendo al régimen de la propiedad privada, sobre su supuesta inconstitucionalidad.Nosotros nos vamos a referir a la ley a sus antecedentes y de las críticas que se le hacían, en la parte que toca a nuestra materia, esto es en lo relativo al régimen de la propiedad y debemos decir, a vía de adelanto, que no vemos en ella nada que afecte el derecho de propiedad consagrado por la Constitución de la República, ni los principios generales que regulan la propiedad territorial conforme al Código Civil, conforme a la vieja ley de Centros Poblados, sus modificativas ni demás normas sobre la materia.

  5. Revisitando uma carta em português sobre Sabbatai Zvi

    Directory of Open Access Journals (Sweden)

    Rodrigues da Silva Tavim, José Alberto

    2007-06-01

    Full Text Available The present paper deals with the Iberian context of the production-translation of a text in Portuguese language about Shabbatai Zevi, in 1666. We refer the production of similar texts and the information about the adherents in Spain, mostly in Malaga. We reflect on the various messsianic currents that crossed the different social groups in Portugal. We present a text that proves the spreading of news about Shabbatai in Portuguese Lands, and the interest kindled among the Portuguese Conversos. And we place the hypothesis that this text to the movement of Shabbatai, could have different readings, among them one that could be convenient to the conversos.

    Este artículo aborda el contexto de la producción-traducción de un texto en portugués sobre Sabetay Sebí, en 1666. Se alude a la producción de otros textos similares y a la información sobre los adeptos del movimiento en España, sobre todo en Málaga. Se reflexiona sobre las varias corrrientes mesiánicas que cruzaban los diferentes grupos sociales en Portugal. Se presenta un texto que prueba la divulgación de noticias sobre Sabetay, en tierras portuguesas y del interés desperttado entre los medios conversos sobre el movimiento. Y se plantea la hipótesis de que este texto contrario al movimiento de Sabbatai pudiera tener varias lecturas, entre ellas una que debería ser conveniente para los conversos.

  6. Perspectivas sobre la comunicación

    Directory of Open Access Journals (Sweden)

    Naranjo Pereira, María Luisa

    2005-12-01

    Full Text Available Existen diversas teorías, enfoques y modelos de comunicación; de cada uno de ellos pueden rescatarse aspectos de gran valor para el logro de una comunicación eficaz. Este documento presenta una revisión de esos aspectos, para que se pueda comprender mejor y enriquecer uno de los procesos más importantes para el ser humano: el proceso de comunicación. Este es un ensayo en el cual se da a conocer la posición de la autora sobre el tema abordado. Se rescata el acento del enfoque humanista en la relación humana y en las etapas donde se desarrolla. A partir de la comunicación pragmática, se analizan los axiomas comunicacionales en que se fundamenta y lo que se conoce como patologías de esos axiomas. Además se revisan las principales características que distinguen la asertividad en la comunicación y las distintas formas de manipulación que la entorpecen. Del enfoque de Virginia Satir, se presentan los diversos aspectos de la comunicación, tanto funcional como disfuncional y los modelos de comunicación propuestos por esta autora. Se revisan aspectos importantes del enfoque de la comunicación educativa, tales como el control de la distancia, la voz y el cuerpo, las palabras y el situacional; así como los elementos que bloquean el proceso de comunicación y las sugerencias acerca de formas correctas de escuchar. Además, se hace referencia a la necesidad de emplear procesos educativos más holísticos y constructivistas y una comunicación-interrelación horizontal y con equidad. Each of the diverse theories, approaches, and models of communication can provide valuable elements for the attainment of effective communication. This article presents a review of those elements with the goal of providing a better understanding and enhancement of one of the most important processes for human beings: the process of communication. This essay presents the author´s position on the topic. The importance given to human relationships and the stages

  7. Datos sobre la vida sexual en dos ciudades colombianas

    OpenAIRE

    Giraldo Neira, Octavio

    2012-01-01

    Uno de los temas más difíciles de investigar científicamente es el referente a la vida sexual, principalmente por la dificultad de obtener datos precisos y verídicos sobre la conducta de los individuos. Este es un tema que se trata vagamente ó solo a través de la consulta médica ó el chiste. Resulta difícil preguntar a la gente sobre su conducta sexual y más difícil aun obtener una respuesta verdadera y clara. Este informe, aunque breve, ha logrado en parte eludir estos escollos. En primer lu...

  8. Concepciones implícitas sobre el desarrollo infantil

    OpenAIRE

    Vilar Martínez, C.; Blasco Cubedo, María Jesús; Hernández Blasi, Carlos

    2001-01-01

    Setenes Jornades de Foment de la Investigació de la FCHS (Any 2001-2002) Partiendo del trabajo de Martí, E. et al. (1994) “ Ideas previas de una población universitaria sobre el desarrollo infantil” hemos realizado un estudio descriptivo para identificar las concepciones implícitas del conocimiento que tienen estudiantes universitarios sobre el desarrollo infantil. La muestra estaba constituida por 111 estudiantes de la Universitat Jaume I, con una media de edad de 19 años. Median...

  9. Impacto de la enfermedad inflamatoria intestinal sobre la sexualidad

    OpenAIRE

    Carrera Alonso, Elisa

    2015-01-01

    Introducción. La enfermedad inflamatoria intestinal (EII) tiene un impacto significativo en la calidad de vida de los pacientes que la padecen. Aunque parece razonable pensar que la enfermedad puede tener un impacto negativo sobre la sexualidad, existe escasa evidencia sobre este tema. Con nuestro estudio pretendemos aclarar algunas de estas incógnitas. Hipótesis y Objetivos. Se planteó si los pacientes con EII tenían una calidad de vida sexual alterada en los momentos en los que su enfermed...

  10. EL PENSAMIENTO SOCIAL SOBRE EL SUICIDIO EN ESTUDIANTES DE BACHILLERATO

    OpenAIRE

    Gabriel Montes Sosa; Francisco Montes Villegas

    2009-01-01

    En este estudio se analiza desde el marco de las representaciones sociales cómo los jóvenes preparatorianos manifiestan su pensamiento social sobre el suicidio. Se aplicaron cuestionarios abiertos a 169 jóvenes, mujeres y varones de bachillerato, para conocer la ocurrencia potencial de suicidio, las situaciones a las que se debe y su definición. Los resultados muestran que los jóvenes organizan su idea sobre el suicidio a partir de varios elementos en común: problemas diversos, depresión, baj...

  11. Estudos sobre o comportamento do consumidor na SciELO

    OpenAIRE

    Santana, Dhione Oliveira; Reis, Ana Alinny Cruz dos; Oliveira, Rafaela Santana

    2016-01-01

    Os estudos sobre o comportamento do consumidor têm chamado à atenção de pesquisadores de diversos países e de diversas áreas do conhecimento com objetivos dos mais variados possíveis. O presente artigo faz um estudo bibliométrico interdisciplinar sobre o comportamento do consumidor no contexto internacional (países Ibero-americanos e da África do Sul) da plataforma SciELO (Scientific Electronic Library Online). O presente estudo analisou 153 artigos científicos, como conclusão, observou-se qu...

  12. Miradas de viajeros sobre Oriente (siglos xii-xiv)

    OpenAIRE

    Guglielmi, Nilda

    2016-01-01

    Hemos titulado estas páginas Miradas de viajeros sobre Oriente. En efecto, hablaremos de ciertas miradas, de modos particulares de pasar y de testimoniar. Creo que la elección del término mirada no es azarosa. Coincido en esto con lo expresado por Houari Touati al referirse al primado del ojo sobre el oído en la cultura musulmana. La mirada es fundamental para el conocimiento de la Verdad que implica también un conocimiento de sí. Dice la sura 6, Del ganado: “103. Les regards (des hommes) ne ...

  13. (I) Informe sobre conflicto violento en colombia (2011–2012)

    OpenAIRE

    2014-01-01

    Las negociaciones de paz entre el gobierno nacional y las FARC avanzan de modo considerable. Al momento del cierre del presente informe –julio de 2014–, se construyó un acuerdo sobre los tres primeros puntos de la agenda –la reforma agraria, la participación política y las drogas ilícitas–. Sin duda la negociación progresa, los puntos sobre los que se trazó un acuerdo tocan dimensiones neurálgicas de la vida colectiva: el agro y su atraso histórico, la democracia y sus cierres, el narcotráfic...

  14. Banco Interamericano de Desarrollo informe sobre sostenibilidad 2010

    OpenAIRE

    Banco Interamericano de Desarrollo (BID)

    2011-01-01

    Este es el sexto Informe Anual sobre Sostenibilidad del Banco. Cubre el progreso y desempeño del Banco Interamericano de Desarrollo en materia de sostenibilidad durante el año fiscal 2010. El documento proporciona información sobre las tendencias fundamentales del desarrollo y las dimensiones relacionadas con la sostenibilidad en América Latina y el Caribe. Estas tendencias afectan, tanto positiva como negativamente, la capacidad de los países para garantizar la sostenibilidad, el crecimiento...

  15. Diálogos sobre juventudes : Estudios de otras miradas

    OpenAIRE

    Fornasari, María Elisa; Decca, Lorena

    2012-01-01

    Medina, Gabriel (ed.) (2009). Juventudes, territorios de identidad y tecnologías. Círculo de Reflexiones de Estudios Poscoloniales. Universidad Autónoma de la Ciudad de México. México. Los estudios sobre juventud/es han seguido diversas trayectorias y han sido abordados desde diferentes perspectivas a partir de su visibilización como problemática. El libro de Gabriel Medina parte de un diagnóstico: la existencia de importantes vacíos en los estudios sobre lo joven y la vigencia de trabajos...

  16. La perspectiva cualitativa en los estudios sobre pobreza

    OpenAIRE

    Mateo Pérez, Miguel A.

    2002-01-01

    Los estudios sobre pobreza internacional han estado marcados por el enfoque cuantitativo. Sin embargo desde hace unos años los estudios cualitativos están adquiriendo una gran relevancia. Este artículo presenta las características de un estudio cualitativo sobre pobreza y género realizado en España durante los últimos tres años, estableciendo algunas líneas de trabajo básicas para el estudio de la pobreza desde la perspectiva cualitativa.

  17. Códigos y grafos sobre anillos de enteros complejos

    OpenAIRE

    Martínez Fernández, María del Carmen

    2007-01-01

    RESUMEN: El objetivo de esta tesis es definir códigos perfectos sobre diferentes espacios de señal multidimensionales. Para resolver este problema, esta memoria presenta una relación original entre las Teorías de Grafos, Números y Códigos. Uno de nuestros principales resultados es la propuesta de una métrica adecuada sobre constelaciones de señal de tipo cuadrático, hexagonal y cuatro-dimensional. Esta métrica es la distancia entre los vértices de una nueva clase de grafos de Cayley definidos...

  18. La tributación estatal sobre los residuos nucleares

    OpenAIRE

    Rozas Valdés, José Andrés

    2014-01-01

    Este trabajo se dedica al análisis pormenorizado de los nuevos impuestos estatales -'Impuesto de la producción de combustible nuclear gastado y residuos radiactivos resultantes de la generación de energía nucleoeléctrica' y el 'Impuesto sobre el almacenamiento del combustible nuclear gestado y residuos radiactivos en instalaciones centralizadas'- a partir de sus fundamentos, para terminar con unas consideraciones sobre su compatibilidad con las tasas equivalentes y con los impuestos autonómic...

  19. Notas sobre palmas colombianas y una del brasil

    OpenAIRE

    2012-01-01

    Por mucho tiempo se ha creído que la palma de moriche de los Llanos orientales, en la región del Meta, era la Mauritia flexuosa L. f., especie típica del genero y originaria de Surinam. Al menos todas las obras botánicas publicadas por autores colombianos sobre la flora de nuestro país coinciden en la identificación anotada, incluso mi reciente trabajo sobre las Palmas de Colombia (Caldasia: 1: 22 y 32. 1940). Sin embargo, en este último trabajo, -que no es más que una nómina preliminar de la...

  20. UN PENSAMIENTO EMERGENTE SOBRE EL ARTE CONTEMPORÁNEO

    OpenAIRE

    Ingrid Solana

    2009-01-01

    Este artículo trata de configurar un pensamiento emergente en torno a la reflexividad actual sobre el arte. Para ello, se analizan el stencil y el net.art como medios expresivos eminentemente autocríticos. Este ensayo recoge algunos aspectos teóricos sobre el pensamiento actual en torno al arte. Se basa, en su mayor parte, en las teorías estéticas de Gilles Deleuze y de Félix Guattari en ¿Qué es la filosofía?, aunque señala múltiples problemáticas que conciernen al pensamiento posmoderno. Las...

  1. Fiscalidad de las entidades financieras. Impuesto sobre Sociedades

    OpenAIRE

    Muñoz Ortega, Julián

    2015-01-01

    Las entidades de crédito experimentan cambios de calado en su tributación directa con la reforma 2014 del Impuesto sobre Sociedades, en especial por lo que respecta a la nueva regulación de las pérdidas por deterioro y la doble imposición nacional e internacional Archivo con presentación de las novedades más relevantes a aplicar por entidades de crédito a partir de la Ley 27/2014, de 27 de noviembre, del Impuesto sobre Sociedades

  2. Miradas de adolescentes argentinos sobre la intimidad en Facebook

    OpenAIRE

    Dillon, Alfredo

    2013-01-01

    A partir d'entrevistes a adolescents de diferents barris de la ciutat de Buenos Aires, aquest treball explora com es reconfigura per part d'aquests usuaris l'esfera de l'íntim en Facebook. L'objectiu va ser indagar sobre les representacions de joves de 17 i 18 anys en relació amb aquest tema. Per mitjà d'entrevistes en profunditat, es va interrogar als adolescents sobre els seus criteris per publicar continguts a la xarxa social, la proliferació de rumors en la plataforma i la necessitat de p...

  3. Santa sexualidad: concepciones de dos monjas sobre feminidad y sexualidad

    OpenAIRE

    Isabel Cristina Giraldo Quijano

    2009-01-01

    En el contexto de la religión católica, la feminidad y la sexualidad femenina se configuran según dogmas y representaciones sociales específicos, en los que la imagen de Cristo -y todo lo que ello implica- actúa como elemento fundamental en la construcción de las concepciones de las mujeres consagradas a la vida religiosa sobre sex ualidad, erotismo, cuerpo. amor. Este artículo pretende explorar desde un punto de vista sociológico las concepciones de dos monjas sobre los temas mencionados....

  4. Protocolo de kyoto: debate sobre ambiente y desarrollo en las discusiones sobre cambio climático

    OpenAIRE

    Rodríguez S. Liliana

    2008-01-01

    El comportamiento climático del planeta y sus consecuencias han propiciado debates sobre los modelos de desarrollo de los países responsables del deterioro acelerado del ambiente y de los fenómenos naturales por estos días recurrentes. Sin embargo, países como Estados Unidos, luego de firmar compromisos como la Convención sobre Cambio Climático, rehúsan adquirir las obligaciones del Protocolo de Kyoto, por temor a sufrir deterioro en sus economías. En este escenario, donde la nació...

  5. "Meu prazer agora é risco": sentidos sobre sexualidade entre jovens de um grupo sobre saúde

    OpenAIRE

    João Paulo Pereira Barros; Veriana de Fátima Rodrigues Colaço

    2013-01-01

    A sexualidade assumiu a condição de centralidade subjetiva pelo entrecruzamento de diversos demarcadores da Modernidade, como a legitimação do saber-verdade da ciência, a afirmação da individualidade e a institucionalização dos segmentos infanto-juvenis. Partindo dessa premissa, este artigo analisa sentidos produzidos por jovens sobre "sexualidade" em um grupo de discussão sobre saúde, com base em uma pesquisa-intervenção operacionalizada por observações-participantes e pela formação de ofici...

  6. Controversia sobre el origen del anime. Una nueva perspectiva sobre el primer dibujo animado japonés

    OpenAIRE

    Horno López, Antonio

    2012-01-01

    Recientes descubrimientos sobre los orígenes de la animación japonesa muestran indicios consistentes de que la primera animación nipona en formato cinematográfico data de la década de 1900, lo que puede llegar a cuestionar algunos aspectos fundamentales que sustentan la historia de la animación tradicional. En este artículo se realiza un análisis de la documentación existente sobre las primeras animaciones japonesas, demostrando que este peculiar estilo de animación tuvo en realidad un origen...

  7. Integración de las actuales definiciones sobre función ejecutiva

    OpenAIRE

    Cadavid Ruiz, Natalia; Río Pereda, Pablo del; Martínez, R.

    2007-01-01

    Cartel expositivo del curso sobre Integración de las actuales definiciones sobre función ejecutiva realizado por la Universidad de Salamanca en colaboración con la Universidad Carlos III de Madrid.

  8. Apuntes de José Antonio Valverde sobre dientes

    OpenAIRE

    Valverde Gómez, José Antonio, 1926-2003

    2008-01-01

    Apuntes sobre dientes, que el autor utilizó para elaborar su conferencia "L'Evolution Humaine Apercue Generale", impartida en el Musèe de l'Homme de París, y patrocinada por la Société d’Anthropologie de Paris, el 21 de marzo de 1963.

  9. Apuntes de José Antonio Valverde sobre manos

    OpenAIRE

    Valverde Gómez, José Antonio, 1926-2003

    2008-01-01

    Apuntes sobre manos, que el autor utilizó para elaborar su conferencia "L'Evolution Humaine Apercue Generale", impartida en el Musèe de l'Homme de París, y patrocinada por la Société d’Anthropologie de Paris, el 21 de marzo de 1963.

  10. Sobre-educación en el mercado laboral colombiano

    Directory of Open Access Journals (Sweden)

    Jhon James Mora

    2008-12-01

    Full Text Available Este artículo analiza la sobre-educación en Colombia con datos de individuos y empresas compilados por el Servicio Nacional de Aprendizaje de Colombia en 2006, encuentra que la probabilidad de estar sobre-educado es del 14% y que depende de la movilidad entre áreas de desempeño, la experiencia, el género, el tamaño de la empresa y el nivel de educación. Los trabajadores sobre-educados ganan un 2% menos que los trabajadores correctamente educados, conforme al patrón internacional. Los resultados también muestran que la probabilidad de que los profesionales permanezcan en la misma área de desempeño aumenta con la experiencia, que cuanto mayor es la sobre-educación menor es la probabilidad de permanecer en dicha área y que los trabajadores con postgrado tienen menor probabilidad de permanecer en su área de desempeño.

  11. Aspectos sobresalientes del Informe sobre Sostenibilidad de 2012

    OpenAIRE

    Banco Interamericano de Desarrollo (BID)

    2013-01-01

    Este Informe sobre Sostenibilidad abarca el progreso y desempeño del Banco Interamericano de Desarrollo en materia de sostenibilidad durante el ejercicio fiscal de 2012. En este informe nos enfocamos en el tema emergente de la gestión de recursos hídricos.

  12. Reflexiones sobre la dirección de centros

    OpenAIRE

    Felpeto, Ángel

    2004-01-01

    Se presenta una reflexión sobre el modelo de dirección de centros desde la experiencia en la gestión de dos centros educativos de muy diferente tamaño y en diferentes épocas. El autor plantea la necesidad de un director líder, que encabece un proyecto educativo gestionado por un equipo.

  13. Sobre o estilo e o modo de falar e escrever

    Directory of Open Access Journals (Sweden)

    Pedro Caruso

    2001-02-01

    Full Text Available

    Este trabalho apresenta o texto crítico de uma Lei ou Provisão de Filipe I , rei de Portugal, sobre as diversas formas de tratamento no período arcaico da língua portuguesa.

  14. Las competencias sobre cooperativas y econom??a social

    OpenAIRE

    P??rez-Villalobos, M. Concepci??n

    2007-01-01

    El cap??tulo desarrolla la competencia sobre cooperativas y econom??a social de las Comunidades Aut??nomas espa??olas. El t??rmino "econom??a social" es nuevo en los Estatutos de autonom??a, aunque la constituci??n espa??ola apost?? fuerte por ??l como instituci??n que coopera al desarrollo del Estado social

  15. Reflexiones y recomendaciones sobre la poda de frutales

    OpenAIRE

    Urbina Vallejo, Valero; Dalmases Mestre, Josep; Pascual Roca, Miquel

    1999-01-01

    Ante la nueva campaña de poda invernal se plantean una serie de consideraciones que pueden ser de utilidad para el fruticultor a la hora de tomar decisiones en la planificación de la poda y en la ejecución de las diferentes intervenciones que se llevan a cabo sobre el árbol.

  16. Sobre el costo de los protocolos de commitment

    OpenAIRE

    Zanconi, Marcelo; Ardenghi, Jorge Raúl

    1995-01-01

    Se presenta en este trabajo, una evaluación sobre los costos de los protocolos de terminación en dos fases, relacionados con la correctitud y la serializabilidad, considerando los mecanismos de apropiación de recursos basados en locking, time-sta.mping y control optimista.

  17. Construcciones sociales sobre mujeres desde el discurso jurídico en sentencias penales sobre infanticidio

    Directory of Open Access Journals (Sweden)

    María Eugenia Gastiazoro

    2015-12-01

    Full Text Available El infanticidio como figura penal se suprime del Código Penal Argentino en 1994, para ser una figura de homicidio agravado por el vínculo con prisión o reclusión perpetua. Diez años después de su última derogación, el caso Romina Tejerina en Jujuy generó una serie de cuestionamientos respecto de su penalización. Otro caso, que tomó estado público fue el de Eli Díaz en la ciudad de Villa Dolores en Córdoba, juzgada en el 2006, siendo (en contraposición al caso Tejerina absuelta por una mayoría compuesta solo de ciudadanos comunes (jurados. En el presente trabajo se analiza la construcción y la producción que desde el discurso jurídico se hace de las diferentes mujeres en los casos de infanticidio. A su vez, estas imágenes se comparan con las representaciones que los legisladores tuvieron en el debate del Congreso del año 2010 cuando se intentó reponer la figura. La sujeción del género centrada en la buena o mala madre, mujer, esposa, en intersección con otras dimensiones de clase social, y edad, se categoriza en el discurso de los tribunales de acuerdo a imaginarios sociales que sostienen una identidad normativa sobre estas mujeres.

  18. "Meu prazer agora é risco": sentidos sobre sexualidade entre jovens de um grupo sobre saúde

    Directory of Open Access Journals (Sweden)

    João Paulo Pereira Barros

    2013-04-01

    Full Text Available A sexualidade assumiu a condição de centralidade subjetiva pelo entrecruzamento de diversos demarcadores da Modernidade, como a legitimação do saber-verdade da ciência, a afirmação da individualidade e a institucionalização dos segmentos infanto-juvenis. Partindo dessa premissa, este artigo analisa sentidos produzidos por jovens sobre "sexualidade" em um grupo de discussão sobre saúde, com base em uma pesquisa-intervenção operacionalizada por observações-participantes e pela formação de oficinas sobre saúde, em uma escola pública de Fortaleza. Acerca dos sentidos sobre "sexualidade", as articulações entre "sexualidade" e "risco" se sobressaíram em relação às conexões entre "sexualidade" e "prazer". Isso sugere a força de um viés educativo baseado na scientia sexualis, aludido por Michael Foucault, operando com uma visão normativa-prescritiva da sexualidade, reiterando-a, mediante o signo da "prevenção", como tecnologia de governo. Usando como ferramenta o conceito de biopolítica, aponta-se que tais questões remetem à instalação de um paradigma de "gestão do risco" na contemporaneidade.

  19. EL PENSAMIENTO SOCIAL SOBRE EL SUICIDIO EN ESTUDIANTES DE BACHILLERATO

    Directory of Open Access Journals (Sweden)

    Gabriel Montes Sosa

    2009-01-01

    Full Text Available En este estudio se analiza desde el marco de las representaciones sociales cómo los jóvenes preparatorianos manifiestan su pensamiento social sobre el suicidio. Se aplicaron cuestionarios abiertos a 169 jóvenes, mujeres y varones de bachillerato, para conocer la ocurrencia potencial de suicidio, las situaciones a las que se debe y su definición. Los resultados muestran que los jóvenes organizan su idea sobre el suicidio a partir de varios elementos en común: problemas diversos, depresión, baja autoestima y comunicación deficiente. Así, el suicidio se objetiviza en estos esquemas y se ancla en sus relaciones existentes. Para contextualizar el estudio, en la primera parte del trabajo los autores incluyen una somera descripción de los datos estadísticos más importantes respecto del suicidio en el estado de Puebla.

  20. Consenso Cultural sobre el Intento de Suicidio en Adolescentes

    Directory of Open Access Journals (Sweden)

    Javier Eduardo García de Alba García

    2011-01-01

    Full Text Available Este estudio buscó identificar la estructura semántica del dominio cultural, el promedio de conocimiento y el grado de consenso cultural manifestado por los adolescentes sobre el intento de suicidio. Fue un estudio cualitativo de listas libres, con un muestreo propositivo no aleatorizado de 27 adolescentes entre 13 y 18 años. Los resultados evidenciaron un solo modelo semántico. En lo estructural se identificó el problema familiar como una causa importante del intento suicida; las categorías depresión y tristeza se consideraron como signos y síntomas previos a esta tentativa y no como causas. Como estrategias de prevención, se consideró recibir información mediante pláticas o establecer conversaciones sobre los problemas. Este modelo permite proponer estrategias de prevención que privilegien el núcleo familiar.

  1. Passagens sobre o moderno na cidade de Georg Simmel

    Directory of Open Access Journals (Sweden)

    Felipe Ziotti Narita

    2013-07-01

    Full Text Available Este trabalho sugere alguns pontos para reflexão sobre o ensaio “As grandes cidades e a vida do espírito” (publicado em 1903, de Georg Simmel. Trata-se, fundamentalmente, de discutir as principais balizas teóricas e conceituais construídas pelo autor para refletir sobre a vida urbana, analisando, a partir das formas das interações sociais, as próprias especificidades da modernidade. Além do citado ensaio, este artigo discute as análises de Simmel à luz de alguns debates sociológicos de seu tempo, tomando como referência o conjunto mais amplo de seus trabalhos e interlocutores.

  2. Preguntas y consideraciones sobre anestesia en el anciano

    OpenAIRE

    Evangelina Dávila Cabo de Villa

    2011-01-01

    El avance en los conocimientos sobre la fisiopatología de las enfermedades, apoyado por los adelantos científicos ha hecho posible la realización de mayor número de procedimientos quirúrgicos y con más complejidad, bajo la aplicación de métodos anestésicos y con calidad en los desempeños. El empleo juicioso de fármacos, la actualización tecnológica, la preocupación por crear mayores beneficios en los enfermos, conforman objetivos fundamentales en la anestesiología, sobre todo en ancianos. Es...

  3. Teoría sobre la estructura de capital

    Directory of Open Access Journals (Sweden)

    Jorge Alberto Rivera Godoy

    2002-01-01

    Full Text Available Este ensayo presenta las teorías sobre la estructura de capital más difundidas y reconocidas en el mundo financiero desde los años cincuenta hasta nuestros días. Siguiendo una secuencia cronológica, se identifican los representantes y trabajos investigativos más notables, los factores analizados, las hipótesis, los escenarios y teorías económicas anexas que han servido de soporte, como también los puntos más cuestionados, sus resultados se comparan y se analiza la relación entre el endeudamiento, costo de capital y valor de la empresa. Este ensayo permite tener una idea general del estado del arte sobre la estructura de capital de las empresas.

  4. La undécima tesis de Marx sobre Feuerbach

    OpenAIRE

    Federico Camino Macedo

    1993-01-01

    El artículo pretende ser una reflexión libre sobre la legitimidad de la exigencia a la filosofía formulada en la undécima tesis de Marx sobre Feuerbach. Esta, sin embargo,se refiere a un grupo determinado y a una manera de entender la filosofía, los neohegelianos llamados de izquierda y su concepción de la crítica, así como a Feuerbache inclusive a Hegel. Es en este contexto filosófico que hay que entenderla. Pese ala contraposición entre interpretación y tranformación que la tesis parece sug...

  5. Sobre inundaciones y anegamientos / Reflections on floods and flooding

    Directory of Open Access Journals (Sweden)

    Ferrando A., Francisco J.

    2006-11-01

    Full Text Available Respecto a anegamientos e inundaciones, el autor realiza algunas precisiones conceptuales que afectan la gestión de acciones preventivas, la planificación y el ordenamiento territorial; además se ofrece una sistematización del quehacer sobre las inundaciones./ The author punctualizes the concepts regarding preventive actions and territorial planning. Also the article includes a systematized list of actions related to flood management.

  6. El buen vivir repolitiza los debates sobre el desarrollo

    OpenAIRE

    Gudynas, Eduardo

    2014-01-01

    El presente texto relaciona una importante entrevista realizado por Eduardo Gydynas, Investigador en el Centro Latino Americano de Ecología Social (CLAES), de Montevideo, Uruguay, al pensador Arturo Escobar. Se trató de un abierto diálogo donde el entrevistado, comenta algunas vertientes sobre las alternativas al desarrollo y el Buen Vivir. Encuentro personal, realizado en la Universidad de North Carolina, en mayo de 2015.

  7. Indios mayas en Cuba Algunas reflexiones sobre su comercio

    OpenAIRE

    2002-01-01

    Como consecuencia de la Guerra de Castas desatada en Yucatán (1847- 1855) las autoridades locales decidieron «limpiar el territorio de indios» con su venta a los hacendados cubanos faltos de mano de obra para trabajar en sus ingenios. Este artículo es una reflexión sobre los interrogantes y nuevas líneas de investigación que plantea el tema.

  8. BRIOFITAS SOBRE CARPOFOROS DE HONGOS BRYOPHYTES ON CARPOPHORES OF FUNGI

    OpenAIRE

    Victor Ardiles Huerta; Felipe Osorio-Zúñiga; Elizabeth Barrera Moscoso

    2009-01-01

    Se registra el desarrollo de briófitas sobre carpóforos de hongos de estructura coriácea, leñosa y perenne. Los resultados revelan la presencia de siete especies de hepáticas fo liosas: Bazzania peruviana, Heteroscyphus integrifolius, Leiomitria elegans, Lepidozia chordulifem, Plagiochila bispinosa, Porella chilensis, Telaranea blepharostoma y dos musgos: Dicranoloma robustum e Hypnum chrysogaster. Se propone que los hongos de estas características son un apropiado sustrato para el desarrollo...

  9. Los escritos de F. Nietzsche sobre R. Wagner

    OpenAIRE

    Llinares Chover, Joan B.

    2003-01-01

    Exposición general e introductoria al conjunto de textos del legado nietzscheano que hacen referencia a R. Wagner (obras, escritos, fragmentos póstumos y epistolario) con especial atención y comentarios detallados sobre el proceso de gestación y los significados de los 4 escritos que el filósofo consagró al gran compositor, en su juventud y en su madurez.

  10. Dialogos negativos anotaciones sobre el montaje de Medea Okupa

    Directory of Open Access Journals (Sweden)

    Marcelo José Islas

    2013-09-01

    Full Text Available En este texto hablamos de dos temas: la adaptación de una obra de Eurípides, ]Medea, y su montaje en el contexto de un espacio público a partir de un trabajo de investigación en actuación sobre la poética de la tragedia.Estos dos temas, que exponemos por separado una mejor comprensión.

  11. Alguns considerandos sobre o canal do crédito

    OpenAIRE

    José Alberto Fuinhas

    2002-01-01

    Com o presente artigo, tecem-se alguns considerandos sobre o método de avaliação da admissibilidade teórica do canal do crédito, baseando-nos na sua decomposição em condição de existência e condição de eficácia.

  12. Propiedades beneficiosas de los terpenos iridoides sobre la salud

    OpenAIRE

    López-Carreras, Noemi; Miguel, Marta; Aleixandre, Amaya

    2012-01-01

    [ES]: Algunos componentes de los alimentos presentan actividad biológica y pueden producir un efecto beneficioso sobre la salud. Aquellos que provienen de las plantas se conocen con el nombre de fitoquímicos. Muchos de estos compuestos proceden de la condensación del isopreno y presentan la estructura propia de los terpenos. Entre ellos, destacan algunos monoterpenos bicíclicos derivados del geraniol, que se denominan iridoides. Los iridoides pueden encontrarse como estructuras abiertas...

  13. Variações sobre a porta barroca

    Directory of Open Access Journals (Sweden)

    Roger Bastide

    2006-07-01

    Full Text Available Publicado em francês no segundo número da revista Habitat (São Paulo, 1951, com fotografias de Pierre Verger, "Variações sobre a porta barroca" é um ensaio que sintetiza linhas de força da obra de Roger Bastide. Com foco em igrejas da Bahia e de Pernambuco, o autor tece formulações iluminadoras sobre a função sociológica da porta e, por extensão, da ornamentação no barroco brasileiro.First published in French in the second issue of Habitat (São Paulo, 1951, with photographs by Pierre Verger, "Variações sobre a porta barroca" is an essay that is representative of Roger Bastide’s work in Brazil. Taking churches in Bahia and Pernambuco as an example, the author formulates challenging interpretations about the sociologial function of the door and ornaments during Baroque period in Brazil.

  14. Two Twin Judgements of Cienfuegos Dos juicios gemelos sobre Cienfuegos

    Directory of Open Access Journals (Sweden)

    René ANDIOC

    2011-01-01

    Full Text Available Manuel eduardo de Gorostiza, in London after the constitutional triennium, signed four articles about Spanish theatre in The New Monthly Magazine using just the letter «G». At the end of that same year, 1824, an author signing with an «M», in all likelihood Prosper Mérimée, published a set of articles in Le Globe in Paris regarding the same topic. these were literal translations of those written by Gorostiza about cienfuegos, but his authorship is not mentioned.Manuel eduardo de Gorostiza, en Londres después del trienio constitucional, firmó «G» cuatro artículos sobre teatro español moderno en The New Monthly Magazine. Al final del mismo año de 1824, un tal «M», con toda probabilidad el joven Próspero Mérimée, publicó en el periódico Le Globe, de París, otros tantos sobre el propio tema, traduciendo literalmente en particular, sin mención de fuente, lo escrito por Gorostiza sobre cienfuegos.

  15. La red sobre trabajo infantil peligroso (Red Tip

    Directory of Open Access Journals (Sweden)

    Walter Varillas

    2003-01-01

    Full Text Available En el mundo, aproximadamente 351.7 millones de niños entre 5 y 17 años realizaban algún tipo de actividad económica, de ellos 170.5 millones (48.5% realizaban algún tipo de trabajo considerado peligroso. Un alto porcentaje se encuentra en la agricultura, otros en minas, manufacturas, ladrilleras, predominantemente en la economía informal. El Convenio 138 (cobre la edad mínima de admisión en el empleo de la OIT y el Convenio 182 (sobre las peores formas de trabajo infantil, definen como trabajo infantil peligroso el que puede afectar la salud, seguridad y moralidad de los menores. Estudios específicos sobre los menores muestran su susceptibilidad particular frente a los riesgos laborales, aumentando la peligrosidad para su normal desarrollo y crecimiento: "los niños no son adultos pequeños". Los profesionales de la seguridad y salud en el trabajo pueden colaborar con los profesionales y las organizaciones especializadas en el trabajo infantil, en la definición y caracterización de lo que significa el trabajo infantil peligroso. Para ello se ha conformado la Red sobre Trabajo Infantil Peligroso (Red TIP, con la finalidad de articular estos dos espacios, orientados a eliminar el trabajo infantil peligroso y rescatar al menor y devolverle la oportunidad de sonreír ahora y en el futuro.

  16. Hegel sobre Tácito y la libertad teutona

    Directory of Open Access Journals (Sweden)

    Valerio Rocco Lozano

    2015-09-01

    Full Text Available Una investigación sobre la presencia (así como sobre la ausencia de Tácito en Hegel es crucial para entender la posición política y filosófica de este pensador, especialmente en la época de Jena. Tras algunas consideraciones sobre el conocimiento hegeliano de la historia y la cultura romanas, se abordará un análisis de su noción de "libertad teutona": Hegel se opone tanto a la neo-romanidad de los revolucionarios franceses como al esencialismo teutómano de los conservadores alemanes (derivado fundamentalmente de un uso fuertemente ideológico de la "Germania" de Tácito, así como a las caducas instituciones imperiales. Esta doble oposición sitúa a Hegel en medio de dos corrientes políticas (e incluso de dos ejércitos en guerra y se lleva a cabo desde una actitud que puede denominarse como “mediación sin nostalgia”

  17. Sobre os conceitos de risco em Luhmann e Giddens

    Directory of Open Access Journals (Sweden)

    Marília Luz David

    2011-11-01

    Full Text Available http://dx.doi.org/10.5007/1806-5023.2011v8n1p30 O presente artigo discute as contribuições de Anthony Giddens e Niklas Luhmann para uma melhor definição do conceito de risco, tendo em vista o rigor teórico de ambos os autores. Inicialmente é feita uma breve exposição sobre como o conceito de risco passou a ser utilizado na Modernidade e recebeu a atenção de autores das Ciências Sociais, principalmente a partir da abordagem cultura proposta por Mary Douglas. Em seguida, as definições e correspondentes argumentos sobre o conceito de risco em Luhmann e Giddens são apresentados respectivamente. Finalmente, alguns pontos de distanciamento entre os autores são discutidos e de que maneira cada um contribuiu para o debate sobre os riscos na teoria social e para o diagnóstico da Modernidade.

  18. O Impacto do Mobbing sobre o estresse no trabalho

    Directory of Open Access Journals (Sweden)

    Tássia Donadello Ferreira Lima

    2015-07-01

    Full Text Available Definido como um conjunto de ações hostis e antiéticas, desenvolvidas no ambiente de trabalho de forma sistemática e recorrente que deixa o trabalhador em uma posição indefesa, o mobbing tem sido investigado na sua relação com a saúde e qualidade de vida do trabalhador. Neste sentido, o objetivo no presente trabalho foi (1 o desenvolvimento de três instrumentos para mensuração do mobbing, considerando sua prática por chefes, colegas e subordinados e (2 investigar o impacto do mobbing sobre o estresse no trabalho. Participaram do estudo 300 servidores de uma universidade federal do estado do Rio de Janeiro, sendo 157 homens e 143 mulheres. Os participantes preencheram os três instrumentos para mensuração do mobbing e a EET (Escala de Estresse no Trabalho. A análise fatorial exploratória dos principais eixos com rotação promax revelou uma estrutura ideal de dois fatores em cada instrumento, sendo nomeados de (1 comportamento respeitoso e (2 mobbing praticado por chefes, colegas ou subordinados, conforme o caso. A Modelagem por Equações Estruturais revelou um impacto positivo significativo do mobbing sobre o estresse no trabalho. Da mesma maneira, o comportamento respeitoso por parte de chefes, colegas e subordinados teve influência negativa significativa sobre o estresse no trabalho.

  19. Control biológico en el cultivo del arroz en Cuba. (Resultados 1970 – 2005.

    Directory of Open Access Journals (Sweden)

    Rafael Meneses

    2007-12-01

    Full Text Available El cultivo del arroz en Cuba está afectado por diversas plagas, fundamentalmente: Tagosodes orizicolus, Lissorhoptrus brevirostris, Oebalus insularis y Spodoptera frugiperda. A partir de 1970 se iniciaron los estudios sobre los principales controles biológicos de estas plagas. Para T. orizicolus se ha determinado que Paranagrus perforator y Tytthus parviceps son los principales enemigos naturales de esta plaga. El porcentaje de huevos de T. orizicolus parasitados por P. perforator ha llegado al 50.7% en la etapa de germinación a ahijamiento activo de la planta de arroz. Además, a esta plaga se le ha detectado control por los parasitoides Elenchus sp. y Gonatopus sp. L. brevirostris ha sido manejado en los arrozales con los hongos Metarhizium anisopliae y Beauveria bassiana, obteniendo muy buenos resultados, tanto en el control como en las afectaciones ocasionadas por este insecto. La aplicación de M. anisopliae cepa Niña Bonita resulta satisfactorio para el control de O. insularis. Se ha determinado diversos depredadores, parasitoides y hongos que en determinadas épocas del año ejercer buen control de S. frugiperda, destacándose dentro de ellos: Coleomegilla cubensis, Chelonus texanus y Telenomus spp. C. texanus ha presentado un nivel de parasitismo superior al 80.0 % y Telenomus sp. de 93 %, en condiciones de producción arrocera. Con la presencia de arañas en los arrozales se logra disminuir considerablemente las poblaciones de insectos plagas.

  20. Evaluación biológica del manejo de picudos y nematodos fitopatógenos en plátano (Musa AAB

    Directory of Open Access Journals (Sweden)

    Aristizábal Loaiza Manuel

    2009-12-01

    Full Text Available El trabajo se desarrolló en la granja Montelindo, municipio de Palestina (Caldas a 5° 05' N y 75° 40' O, a 1010 m.s.n.m., 23.5 °C, precipitación anual de 2100 mm y humedad relativa de 76%, con el fin de generar información sobre el manejo de picudos y nematodos fitoparásitos del plátano. Se usó un diseño en bloques completos al azar con cuatro tratamientos por bloque, tres repeticiones y 24 plantas por repetición. Para el manejo de los picudos se hicieron aplicaciones de Carbofurán, Beauveria bassiana y Metarhizium anisopliae en trampas tipo columna. Para el control de nematodos se hicieron aplicaciones en el suelo de Carbofurán y dos cepas comerciales de Paecilomyces lilacinus. Se evaluaron el número de adultos de picudos en trampas, la infección de estos por los hongos empleados y la población de nematodos en suelo y raíces. Se encontró que las trampas tratadas con Carbofurán fueron significativamente más efectivas para la captura de insectos. En laboratorio se estableció que M. anisopliae tuvo una mejor capacidad para infectar adultos del insecto en el campo. La población de nematodos fue menor en suelo y raíces de las plantas tratadas con Carbofurán. Paecilomyces lilacinus no fue efectivo para reducir las poblaciones de nematodos. Los géneros de nematodos predominantes fueron Radopholus, Pratylenchus, Meloidogyne y Helicotylenchus.

  1. Evaluación biológica del manejo de picudos y nematodos fitopatógenos en plátano (Musa AAB

    Directory of Open Access Journals (Sweden)

    Carolina González Cardona

    2009-10-01

    Full Text Available El trabajo se desarrolló en la granja Montelindo, municipio de Palestina (Caldas a 5° 05' N y 75° 40' O, a 1010 m.s.n.m., 23.5 °C, precipitación anual de 2100 mm y humedad relativa de 76%, con el fin de generar información sobre el manejo de picudos y nematodos fitoparásitos del plátano. Se usó un diseño en bloques completos al azar con cuatro tratamientos por bloque, tres repeticiones y 24 plantas por repetición. Para el manejo de los picudos se hicieron aplicaciones de Carbofurán, Beauveria bassiana y Metarhizium anisopliae en trampas tipo columna. Para el control de nematodos se hicieron aplicaciones en el suelo de Carbofurán y dos cepas comerciales de Paecilomyces lilacinus. Se evaluaron el número de adultos de picudos en trampas, la infección de estos por los hongos empleados y la población de nematodos en suelo y raíces. Se encontró que las trampas tratadas con Carbofurán fueron significativamente más efectivas para la captura de insectos. En laboratorio se estableció que M. anisopliae tuvo una mejor capacidad para infectar adultos del insecto en el campo. La población de nematodos fue menor en suelo y raíces de las plantas tratadas con Carbofurán. Paecilomyces lilacinus no fue efectivo para reducir las poblaciones de nematodos. Los géneros de nematodos predominantes fueron Radopholus, Pratylenchus, Meloidogyne y Helicotylenchus.

  2. Efectos del D-003 sobre patrones conductuales de roedores

    Directory of Open Access Journals (Sweden)

    Lilia Fernández Dorta

    2005-01-01

    Full Text Available El D-003 es una mezcla de ácidos alifáticos de muy alto peso molecular purificada de la cera de la caña de azúcar con efectos hipocolesterolemizante y antiagregante plaquetario demostrados experimentalmente y en estudios clínicos Fase I y II. Los estudios experimentales y clínicos culminados han mostrado que el D-003 es seguro y bien tolerado. Sin embargo, la farmacología de la seguridad de nuevos medicamentos investiga sus efectos sobre diversos sistemas que pudieran ser blancos potenciales de toxicidad. Teniendo en cuenta que los efectos adversos relacionados con el Sistema Nervioso (SN están entre los más frecuentes para diversas áreas terapéuticas, estos estudios suelen investigar los efectos de las sustancias sobre la función y estructura del SN. La investigación de los efectos sobre patrones conductuales de roedores comúnmente representa la primera etapa de estos estudios. De acuerdo con ello, el presente estudio tuvo como objetivo investigar los efectos del tratamiento oral con D-003 (dosis únicas y repetidas sobre la actividad exploratoria, la respuesta al plato caliente, la sujeción y ejecución en varilla rotatoria y la evitación pasiva de una sola prueba de aprendizaje en ratones. Los animales se distribuyeron aleatoriamente en cinco grupos experimentales (10 animales/grupo: uno control que recibió el vehículo goma acacia-H20 y cuatro tratados con D-003 (5, 25, 100 y 400 mg/kg, respectivamente. El tratamiento oral con dosis únicas y repetidas de D-003 (400 mg/kg aumentó de forma modesta, pero significativa, la actividad exploratoria con respecto al grupo control. Sin embargo, el D-003 no modificó la respuesta en el ensayo de plato caliente, la capacidad de sujeción y ejecución motora en varilla rotatoria ni la retención del aprendizaje en el ensayo de evitación pasiva. Se necesitan estudios ulteriores que diluciden las causas por las cuales el D-003 aumenta la actividad exploratoria en ratones y que

  3. Efecto del D-004 sobre patrones conductuales en roedores

    Directory of Open Access Journals (Sweden)

    Daisy Carbajal Quintana

    2007-01-01

    Full Text Available El D-004 es un extracto lipídico de los frutos de la palma real cubana (Roystonea regia que ha mostrado efectos protectores sobre la hyperplasia prostática (HP inducida en roedores con testosterona, pero no con dihidrotestosterona y que además, antagoniza respuestas mediadas por los ¿1-adrenoreceptores prostáticos. El D-004 mostró una modesta acción antiinflamatoria en el modelo de granuloma por algodón, modelo que se acerca más a la condición de inflamación crónica aparejada a la hiperplasia prostatica benigna (HPB en el hombre, lo que podría contribuir, en alguna medida, a su efecto en los modelos de HP. Teniendo en cuenta que los efectos adversos relacionados con el sistema nervioso (SN están entre los más frecuentes para diversas áreas terapéuticas, es obligado investigar los efectos de las sustancias sobre la función y estructura del SN. La investigación de los efectos sobre patrones conductuales de roedores comúnmente representa la primera etapa de estos estudios. El presente estudio investigó los efectos del tratamiento oral con D-004 (dosis únicas y repetidas sobre la actividad exploratoria, la respuesta al plato caliente y a las contracciones inducidas con ácido acético (200, 400 y 800 mg/kg, así como sobre la sujeción en varilla rotatoria y la fuerza de agarre en ratones (250, 500 y 1 000 mg/kg. El tratamiento oral con D-004 no modificó la actividad exploratoria, la respuesta al plato caliente y a las contracciones inducidas con ácido acético, así como la sujeción en varilla y la fuerza de agarre . El tratamiento oral con D-004 en el intervalo de dosis indicado no indujo efectos neurotóxicos, ya que no modificó ninguna de las conductas estudiadas.

  4. Investigaciones sobre la Producción del Trigo en México y Observaciones sobre su Cultivo en Colombia.

    Directory of Open Access Journals (Sweden)

    Yepes Y. Emilio A.

    1948-04-01

    Full Text Available En seis partes he tratado de enfocar el estudio de los principales factores que gobiernan el trigo. Las cinco primeras comprenden una compilación bibliográfica sobre las investigaciones realizadas acerca de la acción de los factores históricos y económicos, climáticos, edafológicos, fitopatológicos y fitotécnicos, además de las observaciones personales sobre las condiciones especiales de dicho cultivo en México y en Colombia. La sexta parte es descriptiva del estudio experimental que adelanté para determinar la influencia combinada de los factores: agua, fertilidad del suelo, infección de las royas o polvillo, abonos, métodos y densidades de siembra y la mejor época de verificar ésta, sobre una variedad de trigo bajo las condiciones ambientales de una localidad del Valle de México.

  5. Factors affecting fungus-induced larval mortality in Anopheles gambiae and Anopheles stephensi

    Directory of Open Access Journals (Sweden)

    Takken Willem

    2010-01-01

    Full Text Available Abstract Background Entomopathogenic fungi have shown great potential for the control of adult malaria vectors. However, their ability to control aquatic stages of anopheline vectors remains largely unexplored. Therefore, how larval characteristics (Anopheles species, age and larval density, fungus (species and concentration and environmental effects (exposure duration and food availability influence larval mortality caused by fungus, was studied. Methods Laboratory bioassays were performed on the larval stages of Anopheles gambiae and Anopheles stephensi with spores of two fungus species, Metarhizium anisopliae and Beauveria bassiana. For various larval and fungal characteristics and environmental effects the time to death was determined and survival curves established. These curves were compared by Kaplan Meier and Cox regression analyses. Results Beauveria bassiana and Metarhizium anisopliae caused high mortality of An. gambiae and An. stephensi larvae. However, Beauveria bassiana was less effective (Hazard ratio (HR Metarhizium anisopliae. Anopheles stephensi and An. gambiae were equally susceptible to each fungus. Older larvae were less likely to die than young larvae (HR Conclusions This study shows that both fungus species have potential to kill mosquitoes in the larval stage, and that mortality rate depends on fungus species itself, larval stage targeted, larval density and amount of nutrients available to the larvae. Increasing the concentration of fungal spores or reducing the exposure time to spores did not show a proportional increase and decrease in mortality rate, respectively, because the spores clumped together. As a result spores did not provide uniform coverage over space and time. It is, therefore, necessary to develop a formulation that allows the spores to spread over the water surface. Apart from formulation appropriate delivery methods are also necessary to avoid exposing non-target organisms to fungus.

  6. Sequential fungal fermentation-biotransformation process to produce a red pigment from sclerotiorin.

    Science.gov (United States)

    Corrêia Gomes, Dhionne; Takahashi, Jacqueline Aparecida

    2016-11-01

    The fungus Penicillium sclerotiorum produces sclerotiorin, an orange compound closely related to the useful food coloring pigments produced by Monascus species. The high productivity, together with several biological activities reported for sclerotiorin highlights its potential application in food industry. In this work, sclerotiorin was obtained as the major metabolite produced in liquid fermentation by P. sclerotiorum standing for 30% of the fungal dry extract. Modulation of sclerotiorin color was accomplished by biotransformation using Beauveria bassiana generating a red derivative with 13.8% yield. Color modification was caused by fungal-mediated substitution of oxygen by nitrogen in the pyrone ring changing the molecule's chromophore. A derivative, 1-methyl sclerotiorin was synthesized from sclerotiorin using diazomethane and fed to B. bassiana. In this case, substituent at C-1 avoided heteroatom substitution. Sclerotiorin derivatives obtained in the present show the great potential of sclerotiorin derivatives as food colorants. PMID:27211658

  7. Effects of entomopathogenic fungi on different developmental stages of Cotesia flavipes (Cam. a parasitoid of Diatraea flavipennella (Box (Lepidoptera: Crambidae

    Directory of Open Access Journals (Sweden)

    Cinthia Conceição Matias da Silva

    2016-02-01

    Full Text Available Biological control using the parasitoid Cotesia flavipes (Cam. is one of the main components in the integrated management of the sugarcane moth borer Diatraea spp. Besides this parasitoid, the entomopathogenic fungi Beauveria bassiana (Bals. Vuill and Metarhizium anisopliae (Metsch. Sorok. are used to control sugarcane pests, and they can be found naturally parasitizing caterpillars. This study aimed to evaluate the effects of M. anisopliae and B. bassiana on different developmental stages of the C. flavipes parasitoid on Diatraea flavipennella (Box. The experiments were carried at laboratory with isolates PL 43 of M. anisopliae and ESALQ 447 of B. bassiana were applied to the parasitoid at the immature and adult phases. No negative effects were observed on the larval development of C. flavipes, and it could complete its development on caterpillars of D. flavipennella treated with fungi. The fungi did not cause pupal mortality. However, B. bassiana caused high mortality in the adult parasitoid (76%. The fungi had negative effects on parasitoids when applied during certain developmental stages of C. flavipes.

  8. Comparative performance evaluation of multi-metal resistant fungal strains for simultaneous removal of multiple hazardous metals.

    Science.gov (United States)

    Dey, Priyadarshini; Gola, Deepak; Mishra, Abhishek; Malik, Anushree; Kumar, Peeyush; Singh, Dileep Kumar; Patel, Neelam; von Bergen, Martin; Jehmlich, Nico

    2016-11-15

    In the present study, five fungal strains viz., Aspergillus terreus AML02, Paecilomyces fumosoroseus 4099, Beauveria bassiana 4580, Aspergillus terreus PD-17, Aspergillus fumigatus PD-18, were screened for simultaneous multimetal removal. Highest metal tolerance index for each individual metal viz., Cd, Cr, Cu, Ni, Pb and Zn (500mg/L) was recorded for A. fumigatus for the metals (Cd, 0.72; Cu, 0.72; Pb, 1.02; Zn, 0.94) followed by B. bassiana for the metals (Cd, 0.56; Cu, 0.14; Ni, 0.29; Zn, 0.85). Next, the strains were exposed to multiple metal mixture (Cd, Cr, Cu, Ni, Pb and Zn) of various concentrations (6, 12, 18, 30mg/L). Compared to other strains, B. bassiana and A. fumigatus had higher cube root growth (k) constants indicating their better adaptability to multi metal stress. After 72h, multimetal accumulation potential of B. bassiana (26.94±0.07mg/L) and A. fumigatus (27.59±0.09mg/L) were higher than the other strains at initial multimetal concentration of 30mg/L. However, considering the post treatment concentrations of individual metals in multimetal mixture (at all the tested concentrations), A. fumigatus demonstrated exceptional performance and could bring down the concentrations of Cd, Cu, Ni, Pb and Zn below the threshold level for irrigation prescribed by Food and Agriculture Organization (FAO). PMID:27497228

  9. Envejecimiento en red, cauce de información sobre experiencias innovadoras

    OpenAIRE

    Fernández Morales, Isabel

    2015-01-01

    Póster en que se explica el objetivo del portal Envejecimiento En Red: transferir conocimiento sobre envejecimiento y personas mayores, ofreciendo información sobre la investigación que se realiza en los campos de la Gerontología y la Geriatría y sobre recursos de utilidad para profesionales de los servicios sociales y para la sociedad en general.

  10. Confianza como consecuencia del compromiso percibido: Implicaciones sobre el aprendizaje y la innovación

    OpenAIRE

    García Cruz, Joaquín; Real Fernández, Juan Carlos

    2013-01-01

    En este trabajo pretendemos alcanzar un doble objetivo. En primer lugar, estudiamos la influencia del compromiso afectivo de los empleados percibido por el directivo, tanto sobre su nivel de confianza, como sobre la capacidad de aprendizaje organizativo (CAO). Igualmente, analizamos cómo influye sobre la CAO esta predisposición del directivo a confiar en sus empleados. En segundo lugar, examinamos si el compromiso afectivo de los empleados percibido por el directivo, la confianza del directiv...

  11. Estado del arte del conocimiento sobre perifiton en Colombia

    Directory of Open Access Journals (Sweden)

    Yimmy Montoya Moreno

    2013-12-01

    Full Text Available El perifiton es un componente de las comunidades bióticas acuáticas, su estudio es importante tanto desde la perspectiva ecológica, para comprender el funcionamiento de los ecosistemas acuáticos, como desde el punto de vista ambiental, pues su composición y estructura pueden servir como indicadores de la calidad del agua y de procesos que como la contaminación puedan estar afectando a los ecosistemas. La investigación sobre el perifiton es compleja; la definición misma de perifiton aún genera controversias. Sumado a esto, la variedad de metodologías para su estudio integral, la diversidad de arquitecturas de la matriz perifítica, la gran diversidad de ecosistemas y la ausencia de escuelas taxonómicas en el país, contribuyen a que sean pocos los trabajos que se publican sobre el tema, lo que incrementa el valor e importancia de los estudios reseñados en esta revisión. El objetivo de este artículo es dar a conocer el estado del arte en la investigación sobre el perifiton en Colombia, mediante el análisis de diferentes líneas de investigación que se han desarrollado y su grado de avance. Con este fin, se examinaron 84 trabajos a los que los autores tuvieron acceso. La mayoría de investigaciones consultadas en este trabajo (90%, corresponden al estudio de ficoperifiton, el 10% restante incluyó ambos componentes del perifiton y se encontró una dedicada exclusivamente al zooperifiton. Sólo el 10,5% de las investigaciones (8 trabajos se han dedicado al estudio taxonómico detallado, el resto de publicaciones se orientan al estudio de la estructura y dinámica de la comunidad perifítica.

  12. Dos hipótesis sobre el presidencialismo autoritario

    Directory of Open Access Journals (Sweden)

    Soledad Loaeza

    2013-01-01

    Full Text Available El presidencialismo autoritario mexicano ha sido objeto de muchas reflexiones y opiniones. No obstante, se ha impuesto un paradigma presidencialista que privilegia la perspectiva personalizada e idiosincrática del ejercicio del poder, con un importante componente cultu- ralista. Aquí se propone, por una parte, una perspectiva histórica que contextualiza las accio- nes presidenciales en el período 1944-1970; por la otra, se parte de dos presupuestos generales. Uno, sostiene que los presidentes mexicanos actuaban bajo importantes restricciones y según los ritmos de un proceso que avanzó en episodios, más que en forma lineal o acumulativa; el otro destaca la limitación geopolítica que se deriva de la vecindad con Estados Unidos que incidió sobre las acciones presidenciales, pero también sobre el desarrollo institucional del país. La evolución del presidencialismo autoritario lleva la huella de esta influencia. Este artículo introduce elementos para la discusión de las hipótesis. La primera parte hace una revisión crítica del paradigma presidencialista; la segunda expone las restricciones que se derivaban de la vecindad con Estados Unidos. La tercera y última está dedicada a la descripción del tipo de episodios que Pueden servir para ilustrar la evolución del presidencialismo autoritario. Las dos hipótesis que aquí se presentan han guiado una investigación más amplia sobre el impacto de la Guerra Fría en México y el desarrollo del presidencialismo.

  13. Propuesta de programa educativo sobre enfermedades del cuello uterino

    Directory of Open Access Journals (Sweden)

    Grisel Mariela Mass Basulto

    2011-10-01

    Full Text Available Fundamento: El cáncer ginecológico está entre las más frecuentes causas de muerte en la población femenina. En Cuba, el diagnóstico precoz de tal afección está entre los programas priorizados del Sistema de Salud Pública; pero también es necesario enfatizar en la prevención, que puede lograse, sobre todo, desde la atención primaria de salud, mediante la implementación de programas educativos. Objetivo: Diseñar un programa educativo sobre afecciones del cuello uterino. Métodos: Estudio descriptivo y retrospectivo, en el período comprendido del 1 de enero de 2008 al 1 de enero de 2009. Se analizaron variables como edad, escolaridad, primeras relaciones sexuales, número de partos, número de compañeros sexuales, uso de anticonceptivo, antecedentes de infecciones de transmisión sexual, hábitos tóxicos y nivel de conocimiento. Se aplicó el criterio de expertos para la validación de la propuesta educativa. Resultados: La mayoría de las mujeres tuvieron relaciones sexuales precoces, cuatro o más compañeros sexuales y eran fumadoras, mientras que el total de ellas había presentado alguna vez infecciones vaginales. El nivel de conocimiento que predominó fue regular. Conclusiones: Es evidente que en la población estudiada se concentran varios factores de riesgo para el cáncer de cuello uterino. El Programa Educativo sobre enfermedades del cuello uterino, fue validado mediante criterio de expertos, los cuales coincidieron en que tiene gran actualidad científica, congruencia interna y en que favorece el proceso de preparación de la mujer para evitar ese tipo de enfermedades.

  14. Dicty_cDB: Contig-U16183-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available lfnpq**h*ks*tyr*qnlnwyvnyq*ikscfkfyfssy*kski Frame C: pssplllikqliykfqssefiihqvdlllkmenshsqcifknakdfltannaliyqvvva ilsia...... 36 0.93 3 ( EY072266 ) CAZI10125.fwd CAZI Artemisia annua normalized lea... 34 0.96 3 ( BJ375953 ) Dictyostel...676_4502( AM746676 |pid:none) Sorangium cellulosum 'So ce 56'... 184 2e-70 AP006618_4606( AP006618 |pid:none) Nocardia...aldehyde dehydr... 144 3e-51 DQ767721_1( DQ767721 |pid:none) Beauveria bassiana p...489_898( CP001489 |pid:none) Brucella melitensis ATCC 23457 c... 130 1e-48 CP001026_2110( CP001026 |pid:none) Burkholderia ambifaria

  15. Evaluation of Entomopathogenic Fungi Against Chilli Thrips, Scirtothrips dorsalis

    OpenAIRE

    Arthurs, Steven Paul; Aristizábal, Luis Fernando; Avery, Pasco Bruce

    2013-01-01

    Commercial strains of entomopathogenic fungi were evaluated for control of chilli thrips, Scirtothrips dorsalis Hood (Thysanoptera: Thripidae), an invasive pest of ornamental and vegetable plants in the Caribbean and southeastern United States. In laboratory assays, LC50 values against adult S. dorsalis were 5.1 × 104 CFU/mL for Beauveria bassiana GHA, with higher values 3.1 × 105 for Metarhizium brunneum F52 and 3.8 × 105 for Isaria fumosorosea Apopka 97. Second instars were comparatively le...

  16. Desarrollo de un prototipo de formulación con hongos entomopatógenos para el manejo de Demotispa neivai Bondar (Coleoptera: Chrysomelidae) / Development of a prototype of making with entomopathogenic fungi for management of Demotispa neivai Bondar (Coleptera: Chrysomelidae)

    OpenAIRE

    Martínez Castrillón, Luis Carlos

    2010-01-01

    Entre los factores que limita la producción en el cultivo de la palma de aceite se encuentra el insecto Demotispa neivai Bondar, el cual ocasiona daños hasta de un 100% en su superficie. Durante el desarrollo de un prototipo de formulación con hongos entomopatógenos para el manejo de D. neivai fue necesario evaluar la patogenicidad de tres aislamientos de hongos entomopatógenos en adultos del insecto, utilizando como inóculo dos cepas de Beauveria bassiana (B018, B025), y una de Metarhizium a...

  17. Biochemiluminescence of certain fungi

    Directory of Open Access Journals (Sweden)

    Janusz Sławiński

    2014-11-01

    Full Text Available Twelve species of fungi growing on the Sabouraud medium in darkness and illumination in an incubator, were tested to find out their ability to emit the ultra-weak biochemiluminescence. Using a sensitive photon-counling device, it was possible to measure biochemiluminescence intensity during ten days of cultures growth. Boletus edulis, Pestalotia funerea and Microsporum gypseum displayed biochemiluminescence, while Aspergillus nidulans, A. quadrilineatus, Beauveria bassiana, Macrophoma candollei, Mucor lausanensis, Paecilomyces farinosus, Penicillium sp., Trichoderma lignorum and Tricholoma equestre failed to do it. Illumination put down biochemiluminescence and stimulated colour formation in both mycelia and in the medium.

  18. Stimulation of Armillaria rhizomorph growth by oak root fungi

    Directory of Open Access Journals (Sweden)

    Hanna Kwaśna

    2014-08-01

    Full Text Available Thirty one different genera of fungi were isolated from the wood of roots of 5O·year·old oak (Quercus robur. The most frequently isolated fungi were: Mycelium radicis atrovirens alpha (MRAA, Clonostachys sp. and Penicillium daleae, Beauveria bassiana, Clonostachys sp., Cryplosporiopsis rodicicolo, Geotrichum candidum, Mortierella vinacea, MRAA, P. daleae, P. janczewskii P. spinulosum, Sporothrix schenckii and Tolypocladium niveum significantly enhanced Armillaria mellea rhizomorph initiation and growth from oak branch segments in vitro. The biggest stimulation effect was noticed when the dematiaceous hyphomycetes, e.g. MRAA, P. dimorphospora and S. schenckii were studied.

  19. Natural occurrence and distribution of soil borne entomopathogenic fungi in shahrood region, northeast of Iran

    OpenAIRE

    Derakhshan, Ali

    2009-01-01

    The study investigated the occurrence of soil borne entomopathogenic fungi (EPF) in potato, wheat, sugar beet, alfalfa fields and orchards. A total of 150 soil samples were collected and EPF were isolated using Galleria method. Soil pH was rages from 6.8 to 8.1 and soil texture was sandy, loam, sandy- loam, clay and sandy-loam-clay. Soil borne EPF occurred at 78% of soil samples from which 40% Beauveria bassiana, 21% Metarhizium anisopliae and 17% had both species. Occurrence and ...

  20. Entomopathogenic fungi recorded from the harlequin ladybird, Harmonia axyridis

    DEFF Research Database (Denmark)

    Steenberg, Tove; Harding, Susanne

    2009-01-01

    Entomopathogenic fungi were recorded from field samples of the harlequin ladybird Harmonia axyridis, an invasive coccinellid that has recently arrived in Denmark. Larvae, pupae and adults were found to be infected by Isaria farinosa, Beauveria bassiana and species of Lecanicillium. This is the fi...... first record of entomopathogenic fungi infecting larvae and pupae. Winter mortality due to fungal infection reached 17.9% in adults collected at one location. The larval stage was most susceptible to fungal infection, as confirmed through bioassay with I. farinosa....

  1. Spatial and taxonomical overlap of fungi on phylloplanes and invasive alien ladybirds with fungal infections in tree crowns of urban green spaces.

    Science.gov (United States)

    Howe, Andy G; Ravn, Hans Peter; Jensen, Annette B; Meyling, Nicolai V

    2016-09-01

    Occurrence of entomopathogenic fungi on phylloplanes in Tilia × europaea crowns between 1 and 13 m was assessed in urban parks. Prevalence of fungal infections in ladybirds (Coleoptera: Coccinellidae) collected from Tilia × europaea was assessed to determine whether fungi found on phylloplanes also occurred as infections in ladybirds. Isaria spp. was most abundant on phylloplanes (mean colony forming units (CFU) per leaf ± SE, 0.33 ± 0.03) followed by Beauveria spp. (0.22 ± 0.02 CFU per leaf) and Lecanicillium spp. (0.19 ± 0.02 CFU per leaf). Densities of inoculum were higher in inner crowns and decreased with height, although Lecanicillium spp. peaked at 5-7 m. Upper phylloplane surfaces harboured higher densities of Isaria spp. and Beauveria spp. than lower surfaces, whereas Lecanicillium spp. was equally distributed. Most prevalent on ladybirds were Isaria spp. (20.6% Harmonia axyridis; 4.8% natives), Lecanicillium spp. (13.6% H. axyridis; 4.8% natives), with fewer Beauveria spp. infections (2.6% H. axyridis). Molecular identification revealed Beauveria bassiana, B. pseudobassiana, Isaria farinosa and Lecanicillium muscarium among isolates of both tree and ladybird origin. Tilia × europaea phylloplanes support a diverse assemblage of entomopathogenic fungal species with a different prevalence in coccinellids compared to their relative abundance in this habitat. PMID:27353660

  2. Anotaciones sobre la escritura de lo político

    Directory of Open Access Journals (Sweden)

    Markus Schultze-Kraft

    2009-06-01

    Full Text Available Escribir bien sobre lo político es una forma de arte. Hoy, pocos escritores entienden el significado de esta premisa. Constantemente nos enfrentamos a artículos, ensayos, informes y libros mediocres y sesgados que pretenden ser “políticos” y “científicos”, pero que en realidad son expresiones de sensacionalismo y confusión ideológica o de falta de conocimiento empírico del autor, y generalmente de perspectiva.

  3. Sobre la industria ósea de Altamira

    OpenAIRE

    Giménez la Rosa, Marta; Cabrera Valdés, Victoria

    1991-01-01

    Las últimas excavaciones en Altamira ofrecen cierta luz sobre el yacimiento y la probabilidad de interpretaciones que hasta el momento implicaban dificultades en cuanto a la atribución de industria. Con las dos referencias publicadas que ya existen (FREEMAN, L. G., 1988 y GONZÁLEZ ECHEGARAY, J., 1988) esta aportación se suma para completar en lo posible la visión del yacimiento desde el apartado de la industria ósea, con el estudio de la serie de piezas que se obtuvieron en ...

  4. Sobre nuevas miradas del peronismo y la prensa escrita

    OpenAIRE

    Ruvituso, Clara Inés

    2008-01-01

    Antes de que los académicos llenaran las numerosas páginas que almacena el debate sobre los orígenes y desarrollo del peronismo, la prensa fue uno de los ámbitos de producción de diferentes y dicotómicas representaciones, juicios y prejuicios respecto de la naturaleza y accionar del heterogéneo movimiento político liderado por Juan D. Perón. La compilación de artículos realizada por los historiadores Raanan Rein y Claudio Panella es una significativa contribución a la historia de la intrin...

  5. Notas Sobre o Significado Político do Futebol

    Directory of Open Access Journals (Sweden)

    Nildo Viana

    2010-08-01

    Full Text Available

    O presente artigo traz uma breve discussão na forma de notas sobre o significado político do futebol. Neste contexto, mostra o significado conservador do futebol através de vários aspectos: construção de identidade nacional, axiologia, representações ilusórias, evasão e a sua possibilidade de carregar uma potencialidade emancipadora.

  6. Bibliografía selecta sobre otros autores

    OpenAIRE

    Farré Vidal, Judith

    2013-01-01

    TC/12, Patrimonio teatral clásico español. Textos e instrumentos de investigación. Programa Consolider Ingenio CSD 2009-00033, es un macroproyecto de investigación sobre el teatro clásico español que ha sido seleccionado por el programa ministerial Consolider, la punta de lanza del Plan Nacional de I+D+i. El proyecto, con 12 equipos y más de 150 investigadores de 52 universidades y centros de investigación de todo el mundo, está coordinado por el catedrático de la Universitat de València Joan...

  7. Algunas reflexiones metodológicas sobre la Historia Constitucional

    OpenAIRE

    Varela Suanzes-Carpegna, Joaquín Victoriano

    2007-01-01

    En este artículo defino la Historia Constitucional como una rama de la Historia, de marcado contenido jurídico, que se ocupa de la génesis y desarrollo del Estado liberal y liberal-democrático, de acuerdo con un concepto axiológico de Constitución. Conforme a esta definición abordo algun o de los problemas que plantea el estudio histórico de las normas y de las instituciones, así como sobre todo de las doctrinas y de los conceptos constitucionales. A este respecto, insisto en la necesidad de ...

  8. Sociedad posindustrial, memoria e identidad : Sobre Marcelo Cohen

    OpenAIRE

    Chiani, Miriam

    1999-01-01

    "Contra la habitual dicotomía literatura fantástica-literatura realista, reafirmada con el perfil genérico predominante en la novela latinoamericana a partir de los 70, Cohen configura en sus últimos textos -Insomnio, El oído absoluto, El fin de lo mismo, El testamento de O ’Jaral, Inolvidables veladas- un espacio urbano donde se abre una hipótesis sobre el presente en clave anticipatoria”. Al ubicar el momento hipotético en el presente, no en el futuro, la ajustada expresión que Beatriz Sarl...

  9. Percepções da elite sobre pobreza e desigualdade

    OpenAIRE

    Reis Elisa P.

    2000-01-01

    O artigo analisa a visão de setores da elite brasileira sobre a pobreza e a desigualdade. Com base no argumento de que as percepções daqueles que comandam recursos estratégicos afetam diretamente a formulação e implementação de políticas sociais, e amparada por alguns estudos pioneiros realizados na Europa e nos Estados Unidos, a autora se propõe a investigar como as conseqüências da pobreza e da desigualdade são vistas fora do mundo dos pobres. A partir de dados de survey, entrevistas em pro...

  10. Debate propositivo sobre os biossimilares de enoxaparina no Brasil

    OpenAIRE

    Paulo A. S. Mourão; Glauser, Bianca F.; Bruno C. Vairo; Mariana S. Pereira

    2012-01-01

    Algumas patentes das heparinas de baixo peso molecular expiraram e outras estão vencendo. Versões biossimilares desses fármacos estão disponíveis para o uso clínico em vários países. Entretanto, ainda persiste ceticismo sobre a possibilidade de se obter preparações semelhantes ao medicamento original em razão do complexo processo para gerar heparina de baixo peso molecular. Nosso laboratório analisou, nos últimos anos, amostras de enoxaparina disponíveis para uso clínico no Brasil. Já analisa...

  11. Nota sobre el archivo de la familia Pardo Gil Taboada

    Directory of Open Access Journals (Sweden)

    Saurín de la Iglesia, María Rosa

    2007-12-01

    Full Text Available The intention of the bequest of the archives of Pardo Gil-Taboada to the Archive of the Kingdom of Galicia was that of establishing the genealogy of those who were the original source of such document. These notes attempt to sketch the profile of a noble family from they left the first traces of their existence, to well into the XX century. Going beyond the simple enumeration of individuals – “as if the nobility had no other function than the reproductive” – requires the addition of evidence about the way individuals behaved and collective traits and predispositions of the family group. Hence it is hoped that in future researchs this guide will facilitate and provide data about the formation of a family heritage and criteria on its administration, on the role played by women in the accumulation of wealth, attitudes towards life and the participacion by the nobility in the economic development of Galicia, and other aspects which may be of interest to both historians of sociology and economics.

    La donación del archivo Pardo Gil-Taboada al del Reino de Galicia requería establecer la genealogía de quienes originaron tales documentos. Estos apuntes intentan trazar el perfil de una familia hidalga desde que empezó a dejar señales de su existencia hasta bien entrado el siglo XX. Superar la simple enumeración de personas - “como si la nobleza no hubiera tenido más función que la reproductora”, en palabras de Domínguez Ortiz – suponía añadir indicaciones sobre comportamientos individuales y tendencias colectivas del grupo familiar y eso es lo que se ofrece aquí sinteticamente, como una guía de urgencia que anuncie a futuros investigadores lo que podrán hallar en esta documentación: datos sobre la formación de un patrimonio familiar y sobre los criterios de administrarlo, sobre el papel de las mujeres en la acumulación de bienes, actitudes ante la vida, participación de la hidalguía en el crecimiento económico de

  12. Reflexiones Sobre el Contrato en el Derecho Colombiano

    OpenAIRE

    Vargas-Chaves, Ivan

    2015-01-01

    Spanish Abstract: En este capítulo de libro se realiza una aproximación al contrato en el derecho colombiano, a través de una guía de estudio que abarca su conceptualización doctrinal. Ello con el fin de motivar el interés para los estudiosos y estudiantes del derecho comparado iberoamericano, quienes son los destinatarios finales del libro que tiene por título: Reflexiones sobre Derecho Privado Patrimonial (Universidad de Salamanca, 2015). English Abstract: This book chapter makes an approac...

  13. Estudio sobre turbina tubular de pequeña potencia

    OpenAIRE

    Saralegui, Gustavo David; Lopardo, Carlos E.; Sanmarco, Enrique Daniel; Liscia, Sergio O.; Suarez, Victor

    2011-01-01

    La energía eléctrica es una necesidad social básica, muchas veces ausente en comunidades relativamente alejadas de los principales centros urbanos. Es por ello que estudiar la posibilidad de dotar de energía a centros de escaso consumo mediante la construcción de pequeñas o medianas centrales hidroeléctricas resulta de gran interés, sobre todo donde se dispone de un recurso hídrico cercano, pasible de ser aprovechado. La necesidad de este estudio surgió en el marco de una coyuntura nacional, ...

  14. Proceedings XIV Jornadas sobre Programaci\\'on y Lenguajes

    OpenAIRE

    Escobar, Santiago

    2015-01-01

    This volume contains a selection of the papers presented at the XIV Jornadas sobre Programaci\\'on y Lenguajes (PROLE 2014), held at C\\'adiz, Spain, during September 17th-19th, 2014. Previous editions of the workshop were held in Madrid (2013), Almer\\'ia (2012), A Coru\\~na (2011), Val\\'encia (2010), San Sebasti\\'an (2009), Gij\\'on (2008), Zaragoza (2007), Sitges (2006), Granada (2005), M\\'alaga (2004), Alicante (2003), El Escorial (2002), and Almagro (2001). Programming languages provide a con...

  15. Proceedings XV Jornadas sobre Programaci\\'on y Lenguajes

    OpenAIRE

    Navarro, Marisa

    2015-01-01

    This volume contains a selection of the papers presented at the XV Jornadas sobre Programaci\\'on y Lenguajes (PROLE 2015), held at Santander, Spain, during September 15th-17th, 2015. Previous editions of the workshop were held in C\\'adiz (2014), Madrid (2013), Almer\\'ia (2012), A Coru\\~na (2011), Val\\`encia (2010), San Sebasti\\'an (2009), Gij\\'on (2008), Zaragoza (2007), Sitges (2006), Granada (2005), M\\'alaga (2004), Alicante (2003), El Escorial (2002), and Almagro (2001). Programming langua...

  16. Estudios sobre la vegetacion del estado de Parana (Brasil meridional)

    OpenAIRE

    de Bolòs, Oriol; Cervi, Armando Carlos; Hatschbach, G. (Gert)

    1991-01-01

    BOLOS, O. DE, A.C. CERVI & G. HATSCHBACH (1991). Estudios sobre la vegetación del estado de Paraná (Brasil meridional). Collect. Bot. (Barcelona) 20: 79-182. Aportación al conocimiento de la vegetación del estado de Paraná en el Brasil meridional (Serra do Mar, Planaltos, valle del Iguacú). Se describen numerosas asociaciones vegetales agrupadas en las clases siguientes: Pistio-Eichhornietea (comunidades de cormófitas flotantes). Xyrido-Typhetea (vegetación herbácea helofítica). Polypodio-Til...

  17. Los tratados sobre temas agropecuarios en la historia de Inglaterra

    OpenAIRE

    Cerrizuela, Edmundo A.

    2013-01-01

    Los antecedentes más antiguos sobre la agricultura y la ganadería de Inglaterra, se los encuentran en el Domesday Book, un gran libro preparado por los Normandos, en base a una disposición del Rey Guillermo el Conquistador, en el año 1085. Su objetivo fue conocer el estado de la economía del campo, especialmente en lo referente a: superficie de los fundos de cada agricultor, así como los cultivos agrícolas y especies de ganado en cada uno de ellos, cuantos arados tenían, cuantos obreros y esc...

  18. Ensayos sobre la sonrisa de volatilidad en mercados de opciones

    OpenAIRE

    Serna Calvo, Gregorio

    2000-01-01

    La tesis comienza analizando los determinantes de la "sonrisa de volatilidad" en el mercado de opciones sobre el indice IBEX-35,obteniendose evidencia de causalidad lineal en el sentido de Granger de los costes de transacción, representados por el diferencial "bid-ask" relativo, ala forma de la sonrisa. A continuación, se propone un modelo de Black-Scholes ampliando donde la volatilidad depende del precio de ejercicio y del diferencial "bid-ask" relativo, obteniendose que dicho modelo no mejo...

  19. Sobre el amor en Proust: de Stendhal a Ortega

    OpenAIRE

    Julio César Moran

    2002-01-01

    En diversos trabajos y en el desarrollo de un proyecto de investigación he sostenido las siguientes hipótesis sobre la concepción del amor en Marcel Proust: 1) se trata de una construcción ficcional, de un monólogo constituido desde la conciencia; 2) Proust recoge una tradición subjetiva propia de la época moderna que se manifiesta en diferentes artistas y pensadores; 3) se ha establecido una barrera ontológica entre la mujer amada y la mujer real que supuestamente inspira ese amor, a la que ...

  20. Sobre espacios y álgebras de funciones holomorfas

    OpenAIRE

    Sevilla Peris, Pablo

    2001-01-01

    RESUMEN La Tesis Sobre espacios y ´algebras de funciones holomorfas se estructura en tres cap´ýtulos diferentes. En cada uno de ellos se aborda un problema diferente. El primer cap´ýtulo se dedica al estudio de los operadores de composici´on. La idea original es bastante sencilla y natural. Tomamos el disco unidad complejo, que denotamos D, y una funci´on holomorfa : D −! D. Con esto se define un operador f 7! f donde f : D −! C es una funci´on holomorfa. Consideramos el cas...

  1. Apuntes sobre la flora antioqueña

    OpenAIRE

    H. Tomás Alberto

    2012-01-01

    En el presente artículo me propongo informar, a quienes tengan la amabilidad de leer estas líneas, sobre unos pocos de los ejemplares coleccionados y ya debidamente determinados, en especial por los señores Killip, Standly, Trelease y por el Hermano Daniel, para quienes dejo constancia de mi sincero agradecimiento. Dejo así anotadas más de 40 especies de la flora antioqueña, pequeño pero generoso aporte que pongo en manos de quienes con singular acierto levantan actualmente el grandioso ...

  2. Sobre el presente de la Arqueología Púnica

    Directory of Open Access Journals (Sweden)

    Miquel TARRADELL

    2009-10-01

    Full Text Available Notas sobre un viaje a Túnez y Argelia podría titularse también este articulo. En efecto, la información que puede dar y las novedades que para los investigadores que trabajan en el ámbitoi arqueológico peninsular en él se contienen son debidas en gran parte a la estancia que en la primavera de 1951 he podido hacer en estos territorios, aparte de la aportación respecto a Marruecos, fruto de mis propias excavaciones.

  3. ESTUDIO SOBRE LA PERCEPCIONES Y LA EDUCACIÓN AMBIENTAL

    OpenAIRE

    Raúl Calixto Flores; Lucila Herrera Reyes

    2010-01-01

    La educación ambiental como un campo emergente de construcción de nuevas propuestas, demanda de otros campos de estudio, información para comprender el origen de los comportamientos ambientales desfavorables hacia el medio ambiente. Se asume que la forma en que la persona percibe y construye los problemas ambientales, no se sustenta, necesariamente, en una forma neutral de contemplar el mundo; estas percepciones y los sesgos que las llevan a privilegiar ciertos problemas por sobre otros con d...

  4. Sobre los cambios de perspectiva en el conocimiento

    OpenAIRE

    Barreo, Luz Marina

    2008-01-01

    El propósito de este artículo es explorar el significado y los alcances de los cambios de perspectiva que a veces ocurren cuando vemos las cosas desde el punto de vista teórico, al producirse un cambio de paradigma en el conocimiento, o, si las vemos desde el uso práctico de la razón, cuando se produce un cambio en la personalidad o una “conversión”. La mera cuestión sobre la posibilidad de un cambio radical de perspectiva es filosófica en un sentido profundo: sugiere la existencia de un camp...

  5. Notas sobre tres especies de Gigartinaceae (Rhodophyta del litoral peruano

    Directory of Open Access Journals (Sweden)

    Martha Calderón

    2011-05-01

    Full Text Available La gran variabilidad morfológica de la familia Gigartinaceae ha producido constantes cambios taxonómicos en sus especies miembros. Tradicionalmente su taxonomía ha estado basada en caracteres de la morfología externa; sin embargo, recientes estudios morfológicos, respaldados con trabajos moleculares, han delimitado los géneros en base a al desarrollo del cistocarpo y de los tetrasporangios. El presente trabajo revisa y comenta sobre las estructuras morfológicas vegetativas y reproductivas de tres especies presentes en Perú: Chondracanthus chamissoi, Mazzaella denticulata y Chondrus canaliculatus.

  6. Ferropenia: impacto sobre el estado de salud mental

    OpenAIRE

    Sánchez Jiménez, Apolonia

    2015-01-01

    La deficiencia de hierro y la anemia por déficit del mismo, son trastornos nutricionales y hematológicos frecuentes en el mundo y afectan a una población estimada de 2.000.000 de personas. La deficiencia de hierro tiene efectos adversos sobre la actividad de numerosas enzimas y en bebés pueden provocar alteraciones del crecimiento y del desarrollo intelectual. Los aspectos hematológicos de la deficiencia de hierro no son específicos, y con demasiada frecuencia se confunden con otras causas d...

  7. Un estudio de la IV Conferencia Mundial sobre las mujeres.

    OpenAIRE

    Giménez Armentia, Pilar

    2007-01-01

    La IV Conferencia Mundial sobre las Mujeres, celebrada en la ciudad de Pekín, en septiembre de 1995 es hasta el momento la última que Naciones Unidas ha convocado para tratar específicamente los temas referidos a las mujeres. En este artículo se exponen los avances objetivos que se dieron a partir de la Conferencia, como fueron entre otros, el incremento del compromiso de la comunidad internacional en la potenciación del papel de la mujer –el llamado “empowerment”- y la integración sistemátic...

  8. Estudio sobre la presencia de Legionella en agua sanitaria

    OpenAIRE

    Bonet Ivars, Verónica

    2012-01-01

    RESUM: Estudi sobre la variabilitat de la legionel·losi en funció del tamany de la mostra. L'objectiu és, d'una banda, estudiar la presència i concentracions de Legionella a diversos hospitals durant un any, i per un altre, demostrar la variabilitat de l'inòcul segons els punts de mostreig recollits en aquests hospitals. El resultat ha estat que tots els hospitals testats estaven colonitzats per Legionella encara que els inòculs han variat durant un mateix mostreig i amb diferents mostrejos e...

  9. Reflexiones sobre los medios de comunicación de masas en la Europa moderna

    OpenAIRE

    Burke, Peter

    2005-01-01

    Este artículo muestra las reflexiones que Peter Burke se hace sobre los últimos estudios y la más reciente bibliografía aparecidos tras la publicación del libro De Gutenberg a Internet: Una historia social de los medios de comunicación, escrito por el propio Burke y A. Briggs sobre este tema. Sus reflexiones se centran y tratan la comunicación oral, los manuscritos, el debate Eisenstein sobre la revolución de la imprenta y sus consecuencias y la polémica Habermas sobre la esfera pública. Adem...

  10. Apuntes para un debate sobre el impacto cognoscitivo de la televisión

    OpenAIRE

    Orozco-Gómez, Guillermo

    1986-01-01

    Artículo que presenta un análisis sobre el impacto cognoscitivo de la televisión y que sustenta la tesis de que la falta de conocimiento sobre el impacto negativo de este medio es consecuencia de la forma en que los investigadores han abordado el tema. Se habla sobre el libro “Mind and media. The effects of TV, videogames and computers” de Patricia Marks Greenfield, como un buen ejemplo del paradigma de investigación dominante, y porque es uno de los primeros intentos de estudio sobre los efe...

  11. Uma Análise sobre Materialismo Eliminativo a Partir do Pensamento de Nagel

    OpenAIRE

    José Aparecido Pereira

    2015-01-01

    RESUMO:Fazer uma abordagem sobre a análise de Nagel sobre o materialismo eliminativo no âmbito da filosofia da mente e, com base nisso, refletir sobre a relação entre ciência e filosofia constituem o objetivo fundamental desse artigo. A nossa abordagem encontra-se organizada a partir de dois momentos. Em primeiro lugar, pretendemos discorrer sobre o materialismo eliminativo, visto que essa corrente de pensamento, no contexto da filosofia da mente, condensa e circunscreve de modo mais explícit...

  12. El punzante pasado : sobre arte, historia y memoria en el estado español

    OpenAIRE

    Vicente Aliaga, Juan

    2012-01-01

    En el texto se plantea la pregunta, y se trata de ofrecer algunas respuestas, sobre la ausencia durante muchos años de trabajos artísticos surgidos en el estado español sobre el pasado histórico, y concretamente sobre el periodo de la II República, la guerra civil y la dictadura franquista. Asimismo se propone una reflexión sobre la amnesia generada en la etapa de la transición a la democracia tras la muerte de Franco. Se estudian distintas propuestas artísticas que han abordado desde finales...

  13. Socialismo y peronismo en la historiografía sobre el Partido Socialista

    OpenAIRE

    Silvana Ferreyra

    2011-01-01

    Este artículo es un estado de la cuestión sobre el lugar del peronismo en la historiografía sobre el socialismo en la Argentina. Por un lado, analizamos cómo influyó el peronismo en la formulación de los interrogantes que guiaron las investigaciones sobre la historia del Partido Socialista. A tal efecto nos detendremos en los trabajos del revisionismo de izquierda, la historiografía de la transición democrática y el campo de estudio sobre la historia de la izquierda. A continuación analizamos...

  14. La ceguera como motivo en Ensayo sobre la ceguera de José Saramago e Informe sobre ciegos de Ernesto Sábato

    OpenAIRE

    Fonseca, Marco Antonio

    2008-01-01

    El trabajo de investigación, El motivo de la ceguera en el Ensayo sobre la ceguera de José Saramago e Informe sobre ciegos de Ernesto Sábato, analiza desde el área y la metodología de la literatura comparada el uso del motivo literario de la ceguera en los dos textos mencionados, resaltando las similitudes y diferencias del tratamiento del motivo dentro de las dos obras y como éste sostiene una serie de obsesiones e ideas sobre el estado actual del mundo que comparten los autores de las dos n...

  15. Descontruindo mapas, revelando espacializações: reflexões sobre o uso da cartografia em estudos sobre o Brasil colonial

    OpenAIRE

    Tiago Kramer de Oliveira

    2014-01-01

    O artigo discute o uso da cartografia em estudos históricos com base em obras recentes no campo da Cartografia Histórica e da História da Cartografia, em particular nas pesquisas sobre o Brasil Colonial. Na primeira parte refletimos sobre o uso de ferramentas digitais em estudos de cartografia histórica. Na segunda, discutimos algumas definições sobre a "natureza dos mapas" e suas implicações teóricas e metodológicas. Por fim, fazemos um pequeno exercício de interpretação com base em um fragm...

  16. Intervenção sobre intervenção: sobre a transferência em um trabalho social

    Directory of Open Access Journals (Sweden)

    Fabio Azeredo

    2014-05-01

    Full Text Available Este trabalho visa a refletir sobre a relação de trabalho estabelecida entre a família assistida pelo Projeto de Reinserção Familiar (PRF, junto à Fundação para a Infância e Adolescência (FIA, e a equipe técnica de um dispositivo de atenção diária para pessoas com deficiência. Será feita uma exposição da nossa intervenção sobre a intervenção da referida equipe. O PRF destina-se a crianças e adolescentes portadores de necessidades especiais institucionalizados, realizando um acompanhamento psicossocial sistemático aos familiares dos mesmos, mediante visitas domiciliares e contatos de rede, que residem em comunidades carentes do estado do Rio de Janeiro. Um caso será relatado à luz da nossa linha de pesquisa, intitulada A pobreza como direito à exceção. O texto Intervenção sobre a transferência, do psicanalista Jacques Lacan, será utilizado para explicitar as peculiaridades de uma intervenção de orientação psicanalítica em oposição a uma intervenção de cunho assistencialista. Ademais, utilizar-se-á a discussão que o sociólogo francês Serge Paugam propõe no texto A desqualificação social, no intuito de ressaltar as principais diferenças entre a intervenção realizada por uma equipe de trabalhadores sociais e a nossa intervenção, calcada na interpretação psicanalítica, não só junto à família assistida como junto a esta equipe.

  17. El proyecto de reforma constitucional sobre los efectos de las sentencias del Tribunal Constitucional sobre la justicia ordinaria

    OpenAIRE

    José Luis Cea Egaña

    2005-01-01

    El artículo analiza el efecto vinculante y de irradiación de las sentencias del Tribunal Constitucional sobre el conjunto del ordenamiento jurídico y de sus órganos. El autor toma partido por la consideración de la ratio decidendi del fallo como vinculante junto al dictum de la sentencia respectiva. Se plantea la necesidad que la LOC del Tribunal Constitucional explicite los efectos vinculantes de los fallos respecto de los tribunales ordinarios y especiales. Finalmente analiza...

  18. La insolvencia de Lehman Brothers en septiembre de 2008: Sobre su previsibilidad y sobre algunos "profetas a posteriori"

    OpenAIRE

    Fernandez, Pablo; Aguirreamalloa, Javier

    2012-01-01

    Este documento analiza: - 106 informes de analistas sobre Lehman publicados entre enero y septiembre de 2008, - publicaciones de la CNMV - la evolución de la cotización de Lehman - la evolución del rating de la deuda de Lehman. - la evolución del CDS (Credit Default Swap) de Lehman - la evolución de la contabilidad auditada de Lehman, para tratar de dar una respuesta a la pregunta: ¿Era previsible, con la información pública de la que se disponía, predecir la quiebra de Lehman Brothers? Si hu...

  19. A etnografia das ruas: notas sobre estudar e ser estudado

    Directory of Open Access Journals (Sweden)

    Hecht, Tobias

    2002-01-01

    Full Text Available Passeando entre as notas e as lembranças de dois períodos distintos de trabalho de campo, este ensaio "impressionista" trata da dinâmica em mudança de uma relação de pesquisa com crianças de rua. Em 1992-1993, conduzi trabalho de campo para uma dissertação sobre crianças de rua no nordeste brasileiro. Retornando à região seis anos mais tarde, descobri que a maioria das crianças estudadas apenas uma fração de geração antes estavam então mortas. Estas anotações enfocam minhas conversas com um dos sobreviventes e com quem (e sobre quem estou agora escrevendo uma biografia. Esse esforço colaborativo, voltado de certo modo a reconsiderar as implicações éticas da pesquisa com crianças que levam vidas violentas e vulneráveis, levanta uma gama de novos desafios éticos, alguns dos quais inteiramente imprevistos

  20. Puente sobre el río Severn – Inglaterra

    Directory of Open Access Journals (Sweden)

    Editorial, Equipo

    1970-09-01

    Full Text Available The bridge described in this article has solved the increasing traffic problem in the South West of Wales. The total project involves the suspension bridge itself, a second bridge over the river Wye, and a 10 span metal viaduct, which joins both bridges, and runs over the Beachley peninsula. The suspension bridge is outstanding because of its main towers and the compact construction of the main deck, as well as for the oblique positioning of the secondary cables.El puente que se describe en el artículo ha venido a resolver el problema del tráfico creciente en el SO. del País de Gales. La obra completa comprende: el puente colgante propiamente dicho, otro puente sobre el río Wye y un viaducto metálico, de 10 tramos, que une a ambos, sobre la península de Beachley. Se trata de una solución muy interesante, por sus torres de suspensión, por la construcción compacta de su tablero y por la disposición oblicua de los cables, entre otros detalles.

  1. Precisiones sobre la luz en el Pantheon de Roma

    Directory of Open Access Journals (Sweden)

    Oscar Linares de la Torre

    2015-04-01

    Full Text Available El Pantheon de Adriano es una de las obras más celebradas de la historia de la arquitectura. Han sido muchas las cuestiones que han cautivado a cuantos han entrado en él, pero es la luz la que ha acaparado el mayor protagonismo: una vez despojado el edificio de su originaria carga simbólica, la manifestación de su luz interior parece ser el único fin de este inmenso espacio-luz que tanto ha fascinado a arquitectos, historiadores del arte, pintores y fotógrafos. Parece difícil poder aportar nada nuevo. Consciente de ello, el autor del presente artículo sólo pretende apuntar algunas cuestiones sobre distintos aspectos de la luz en el Pantheon que considera que no han sido aún suficientemente desarrolladas: el por qué de la orientación solar y urbana del templo con respecto al eje norte-sur; la reconstrucción de la secuencia de luz y sombra que debió de darse en el recorrido original de acceso al interior del templo; la interpretación del haz de luz ocular como reminiscencia inmaterial del soporte central de las falsas cúpulas etruscas, convertida en una columna de materia sutil que, sin alcanzar nunca la vertical, incide de manera variada sobre los paramentos que conforman el interior.

  2. La undécima tesis de Marx sobre Feuerbach

    Directory of Open Access Journals (Sweden)

    Federico Camino Macedo

    1993-06-01

    Full Text Available El artículo pretende ser una reflexión libre sobre la legitimidad de la exigencia a la filosofía formulada en la undécima tesis de Marx sobre Feuerbach. Esta, sin embargo,se refiere a un grupo determinado y a una manera de entender la filosofía, los neohegelianos llamados de izquierda y su concepción de la crítica, así como a Feuerbache inclusive a Hegel. Es en este contexto filosófico que hay que entenderla. Pese ala contraposición entre interpretación y tranformación que la tesis parece sugerir,el autor desarrolla la idea de que la unidadestá dada por el hombre que interpreta cosas,las ordena en teorías y actúa en el mundo.De allí que si se le pide a la filosofía que transforme el mundo se extralimita su poder,pero sin ella toda transformación es impensable

  3. Percepções da adolescente sobre a maternidade

    Directory of Open Access Journals (Sweden)

    Janice Regina Rangel Porto

    2002-08-01

    Full Text Available O presente estudo tem por objetivo conhecer as percepções da mãe adolescente sobre a maternidade nesta etapa da vida; conhecer a percepção das adolescentes sobre o atendimento de saúde prestado pela equipe hospitalar; e conhecer o modo como gostariam de ser cuidadas no periodo de maternidade. Trata-se de um estudo exploratório descritivo, com abordagem qualitativa, realizado com 11 puérperas adolescentes, na Unidade de Internação Obstétrica de um hospital-ensino. As informações foram coletadas através de entrevistas semi-estruturadas e submetidas à análise de conteúdo temático. As informações obtidas revelam quatro temas: Estou grávida! Agora, é assumir...; Vivenciando o parto; Ser mãe é... e A gente se sente à vontade com os profissionais daqui. A faia destas jovens demonstra que um atendimento humanizado è possível, revelando nesta maternidade, profissionais sensibilizados e comprometidos com a melhoria da saúde materna.

  4. Apontamentos para o debate sobre o pleno emprego no Brasil

    Directory of Open Access Journals (Sweden)

    Fernando Augusto Mansor de Mattos

    2015-08-01

    Full Text Available RESUMOEste artigo analisa a evolução dos indicadores de emprego e de desemprego na economia brasileira desde o início dos anos 2000 até os dados referentes a 2012, tomando como referências teóricas a formulação de Keynes sobre o desemprego involuntário e também os estudos sobre a dinâmica das relações entre setor formal e setor informal dos mercados de trabalho formulados por autores ligados ao Prealc. O artigo apresenta um exercício econométrico (que teve por base a função emprego de Keynes explicada pelo Princípio da Demanda Efetiva que revela que o crescimento do emprego é uma função positiva do crescimento econômico. Dados adicionais mostram que, a despeito do crescimento da ocupação e da formalização do emprego ocorrida no período, com consequente queda da taxa de desemprego para patamares historicamente baixos, a economia brasileira não conseguiu, segundo as referências teóricas adotadas, atingir o pleno emprego ao final do período analisado, devido à persistência de parcela expressiva de mão de obra subutilizada no mercado de trabalho.

  5. Movimientos correctos a la velocidad correcta sobre los ciclos correctos

    Directory of Open Access Journals (Sweden)

    Jorge Enrique Mejía Q.

    2006-05-01

    Full Text Available El propósito del estudio fue explicar cómo una pequeña empresa colombiana compite en el mercado de telecomunicaciones de Estados Unidos. Esto fue posible usando el modelo de la Doble Hélice de Fine, que muestra los ciclos estructurales de cambios tecnológicos, sobre los que la compañía tuvo que tomar las decisiones estratégicas correctas para seguir la dinámica sectorial a la velocidad correcta. El estudio de caso consistió en una síntesis histórica sectorial y de la empresa, incluyendo hitos claves, después, la velocidad fue medida y finalmente una decisión fue recomendada para poder sobrevivir sobre el patrón de movimientos y cambios sectoriales. / The purpose of this study was to explain how a little Colombian company competes in the dynamic US telecomm market. It was possible by using Fine´s Double Helix Model that shows two structural cycles to explain technological movements, in each cycle, the company studied had to do the correct strategic decisions to follow the industrial dynamics at the right clockspeed. The case study consisted of an industrial and a company historical synthesis, including key issues, afterwards, clockspeed is measured and finally a decision is recommended to survive on the pattern of industrial changes and movements.

  6. Percepções de adolescentes sobre sua sexualidade

    Directory of Open Access Journals (Sweden)

    Kelly Ribeiro de Freitas

    2010-01-01

    Full Text Available Es un estudio cualitativo de naturaleza descriptiva, con el objetivo de conocer las percepciones de los adolescentes sobre el desarrollo de su sexualidad. Se utilizó el enfoque del método creativo y sensible que presenta una alternativa a la investigación en enfermería a través de la dinámica de grupos de "creatividad y sensibilidad". Los participantes del estudio son 12 adolescentes de una escuela estatal de Porto Alegre. Para la recolección de los datos se hicieron cuatro talleres. El análisis siguió las etapas del método en el contexto de la pedagogía crítica de Paulo Freire. Tres temas emergieron del análisis: el adolescente: conflictos y dificultades de vida; la sexualidad para los adolescentes; y el acto sexual. Se considera importante hacer hincapié en que las percepciones de los adolescentes sobre su sexualidad surgieron en los debates y la alianza de conocimientos durante las reuniones, lo que contribuyó a la creación de un nuevo ambiente de diálogo en el contexto escolar que promovió y ayudó a la profundización del tema en un lenguaje accesible, en colaboración con los adolescentes.

  7. Patogenicidade de isolados de três fungos entomopatogênicos a soldados de Atta sexdens sexdens (Linnaeus, 1758 (Hymenoptera : Formicidae Pathogenicity of isolates of three entomopathogenic fungi against soldiers of Atta sexdens sexdens (Linnaeus, 1758 (Hymenoptera : Formicidae

    Directory of Open Access Journals (Sweden)

    Elisângela de Souza Loureiro

    2005-08-01

    Full Text Available As formigas cortadeiras atacam diversas culturas agrícolas, pastagens e os reflorestamentos, atuando sobre muitas espécies vegetais. O presente trabalho teve por objetivo avaliar a patogenicidade dos fungos Beauveria bassiana (isolados AM 9 e JAB 06, Metarhizium anisopliae (isolados E 9 e AL e Paecilomyces farinosus (isolados CG 189 e CG 195 a soldados de Atta sexdens sexdens, em condições de laboratório. Após a coleta em formigueiro isento de produtos fitossanitários, exemplares de soldados foram cuidadosamente separados em grupos de oito indivíduos e, a seguir, banhados em suspensões contendo 1,0 x 10(6, 1,0 x 10(7, 1,0 x 10(8 e 1,0 x 10(9 conídios/mL de cada isolado. Em seguida, cada grupo de formigas foi transferido para unidades de câmara úmida e mantido, sem alimentação, a 27 ± 1 ºC. A mortalidade foi verificada diariamente. Os três fungos se mostraram eficientes patógenos, pois provocaram alta mortalidade, matando mais que 80% dos soldados nos quatro primeiros dias após a inoculação. Os melhores isolados foram JAB 06 e AL, na concentração de 1,0 x 10(9 con./mL. Os isolados JAB 06, AL, CG 195 apresentaram maior capacidade de esporular nos cadáveres das formigas e os tempos letais decresceram com o aumento da concentração de conídios usada.Leaf-cutting ants attack several crops, pastures and the planted forests, acting on numerous vegetable species. The present work aimed to evaluate the pathogenicity of the fungi Beauveria bassiana (isolates AM 9 and JAB 06, Metarhizium anisopliae (isolates E 9 and Al and Paecilomyces farinosus (isolates CG 189 and CG 195 against soldiers of Atta sexdens sexdens, in laboratory conditions. These fungi were inoculated on soldiers after collection in nests without pesticides application. Specimens of soldiers were separated in groups of eight insects, which were bathed in suspensions containing 1.0 x 10(6, 1.0 x 10(7, 1.0 x 10(8 and 1.0 x 10(9 conidia/ml. Following the bath, each

  8. Considerações sobre cuidado paliativo e trabalho hospitalar: uma abordagem plural sobre o processo de trabalho de enfermagem

    Directory of Open Access Journals (Sweden)

    Miguel de Simoni

    2003-01-01

    Full Text Available O objetivo deste artigo é apresentar o esforço de síntese dos autores sobre material de pesquisa em cuidados paliativos e bibliografia estudada. Inicialmente, apresentamos algumas considerações sobre cuidado paliativo em dois países estruturalmente distintos, Brasil e França. A discussão está centrada nas experiências de pesquisa dos autores em um serviço de AIDS no Brasil e em um serviço de Medicina Interna na França, que adotava a lógica dos cuidados paliativos e abrigava predominantemente pacientes com AIDS e câncer. Abordamos, em seguida, aspectos referidos à dor e à morte, considerando conceitos da Bioética e a dimensão relacional do cuidado em saúde. Os conceitos assinalados são os de justiça, autonomia, beneficência e não-maleficência. Concluímos, apresentando algumas possíveis contribuições da Ergonomia e da Psicodinâmica do Trabalho na área de Cuidados Paliativos, considerando especialmente a dimensão psicológica deste debate.

  9. Anotaciones sobre patología del esófago

    OpenAIRE

    Ibañez Castro, H.

    2010-01-01

    Actualidad sobre el tratamiento de la patología de esta parte del tubo digestivo. El artículo quiere llamar la atención sobre puntos poco frecuentados en general: Ampula frénica - Hernia diafragmática - Estemosis extrínsecas - Megaesófago - Causas locales - Causas extrínsecas

  10. Estudio muestra importancia de conversaciones tempranas sobre el cuidado en etapa final de la vida

    Science.gov (United States)

    Artículo sobre la importancia de hablar en forma temprana sobre el cuidado paliativo para asegurar que la atención prestada en la etapa final de la vida sea más acorde con las preferencias de los pacientes.

  11. Eflorescencias y costras sobre areniscas de Villamayor. Ensayos de laboratorio

    Directory of Open Access Journals (Sweden)

    Madruga, F.

    1994-06-01

    Full Text Available Accelerated tests carried out in the laboratory allow us to study the crystalline material settled over the surface of the sandstones when in contact with watery solutions of different compositions. Sandstone specimens of three different textures were placed on trays containing watery solutions, putting one surface in contact with the liquid. In order to accelarate the capillary absorption, a flow of air was established over the opposite surfaces. The humidity and dryness cycles were repeated 45 times. The crystallized salts were identified by X-ray diffraction, SEM and chemical microanalysis by X-rays dispersive energy. The following results were obtained: gypsum, hexahydrite, picromerite, natrone, arcanite in saline solutions; trone, aftitalite, and presence of gypsy m in cement solutions; gypsum and syngenite in the guano solution test. These salts are analogous to those found in the superficially damaged stones of the Cathedral of Salamanca.

    Ensayos acelerados realizados en el laboratorio, permiten estudiar el material cristalino depositado sobre la superficie de areniscas cuando están en contacto con disoluciones acuosas de diferente composición. Probetas de areniscas de tres texturas diferentes se colocan sobre bandejas que contienen las disoluciones acuosas, de tal forma que una de las superficies esté en contacto con el líquido. Sobre las superficies opuestas se establece una corriente de aire que acelere la absorción capilar del líquido. Ciclos de humedad y secado se repiten 45 veces. Las sales cristalizadas se identifican por difracción de rayos-X, SEM y microanálisis químico por energía dispersiva de rayos-X. Los resultados son los siguientes; yeso, hexahidrita, picromerita, natrón y arcanita cuando se trata de disoluciones salinas; trona, aftitalita y presencia de yeso cuando la disolución es de cemento; yeso y syngenita en el ensayo con disolución de guano. Estas sales son análogas a las encontradas en las

  12. Say, Sismondi e o debate continental sobre os mercados

    Directory of Open Access Journals (Sweden)

    Rogério Arthmar

    2009-06-01

    Full Text Available O artigo versa sobre o debate travado entre Say e Sismondi a respeito da possibilidade de saturação geral dos mercados. Na primeira seção, descreve-se o contexto histórico da Europa continental nas primeiras décadas do século 19, destacando-se as particularidades da experiência francesa de industrialização ante a liderança britânica nesse campo. A seguir, traça-se breve perfil da formação intelectual de Say a fim de apresentar sua visão sobre o funcionamento dos mercados. Na continuação, examina-se a perspectiva histórica de Sismondi em sua crítica da ortodoxia clássica, bem como sua versão para a tendência do sistema capitalista à superprodução. Nas duas últimas partes, recuperam-se os comentários recíprocos de Say e Sismondi a respeito de suas divergências teóricas sobre os limites da acumulação de capital.This paper deals with the debate happened between Say and Sismondi regarding the possibility of a general glut. The first section describes the historical context of the first decades of nineteenth century continental Europe, focusing on the French industrialization experience vis-à-vis the British leadership in this field. Next, a brief intellectual profile of the evolution of Say's thought is made in order to present his vision about the proper working of markets. After that, the historical approach used by Sismondi in his criticism of classical orthodoxy is examined, as well as his own version to the capitalistic system inner tendency towards overproduction. The last two sections retrieve the exchange between Say and Sismondi over their theoretical disagreements on the limits to capital accumulation.

  13. Estudos sobre a toxicologia da ε-caprolactama

    Directory of Open Access Journals (Sweden)

    Marcus Vinicius Justo Bomfim

    2009-03-01

    Full Text Available A ε-caprolactama (CAP é um monômero precursor de polímeros denominados nylon 6. Esses polímeros destinam-se à produção de tapetes, vestuário e materiais plásticos tais como equipamentos, sistemas e componentes automotivos, conectores, além de embalagens plásticas. Resíduos de CAP podem migrar de embalagens plásticas de nylon 6 para os alimentos. Diante disso, foi de interesse realizar uma revisão dos efeitos relativos à exposição à CAP e o seu impacto sobre a saúde humana. Estudos epidemiológicos indicam a possibilidade da CAP causar inflamações oculares e cutâneas, além de irritações no sistema respiratório. Pode ocorrer ainda hipotensão, taquicardia, palpitações, rinorréia, ressecamento nasal, efeitos geniturinários e sobre a reprodução como distúrbios nas funções menstrual e ovariana, e complicações no parto; além de problemas neurológicos e hematológicos. Estudos com animais são consistentes com tais relatos. Os estudos de genotoxicidade in vitro e in vivo por via oral e intraperitoneal mostram em sua grande maioria, resultados negativos, bem como ausência de efeitos carcinogênicos em ratos e camundongos e sobre o desenvolvimento e reprodução em ratos e coelhos.ε -Caprolactam (CAP is a precursor monomer of nylon 6 polymers. Nylon 6 is used in the manufacture of carpets, clothes and plastic materials, such as equipment, systems and automotive components, connectors and plastic packaging. CAP residues can migrate from nylon 6 plastic packaging to foods. Given this fact, this review was realized concerning the effects of CAP exposure and its impact on human health. Epidemiological studies indicate that CAP could cause ocular, cutaneous and respiratory irritations, as well as hypotension, tachycardia, palpitations, rhinorrhea, nose dryness, neurological and blood problems, and genitourinary and reproductive effects, such as alterations in ovarian-menstrual functions and pregnancy

  14. Perspectivas sobre el proyecto de ley de salud mental

    OpenAIRE

    Luciano N. García

    2009-01-01

    La legislación sobre el campo profesional y disciplinar de la psicología en la Argentina ha sido un asunto espinoso y engorroso desde la constitución misma de las carreras de psicología en el país, hace ya cincuenta años. En ese entonces, el grupo más corporativo de la psiquiatría se oponía a que los psicólogos ejerciesen psicoterapias. Los psicólogos sin embargo trataron pacientes con diversos métodos terapéuticos y consolidaron su profesión dentro de la clínica y la salud mental durante más...

  15. Apuntes para hilvanar una historia sobre las mujeres

    Directory of Open Access Journals (Sweden)

    Teresa Fallas Arias

    2013-11-01

    Full Text Available Para abordar la historia sobre las mujeres debe considerarse que fue escrita por los varones, fuente plagada de prejuicios, de estereotipos y reproductora de la retórica androcéntrica que convirtió la diferencia sexual femenina en desigualdad e inferioridad. En esta indagación se valora la diferencia sexual como complementariedad y riqueza, pues posibilita la puesta en escena de los lenguajes y los saberes menospreciados, invisibilizados o anulados durante milenios. Pensar a la mitad de la humanidad en estos tiempos, implica rechazar la historia unívoca e idéntica que ocultó las experiencias de las mujeres, para contarlas sin intermediarios e intérpretes proclives a la historia institucionalizada.

  16. Teorías sobre cobertura con contratos de futuro

    Directory of Open Access Journals (Sweden)

    Aragó Mananza Vicent

    2009-10-01

    Full Text Available En este trabajo se presenta una revisión de las principales teorías sobre cobertura con contratos de futuro y de los distintos métodos de estimación utilizados para determinar el ratio de cobertura óptimo. La aproximación a la cobertura más utilizada en la literatura especializada es la basada en el modelo de la teoría de carteras. No obstante, debido a sus hipótesis relacionadas con la función de utilidad del inversor y con las propiedades de la función de distribución de los rendimientos, XI han surgido nuevas propuestas (por ejemplo, las construidas a partir del coeficiente de Gini y el concepto de Lower Partial Moments, que intentan reducir dichas restricciones.

  17. Resumen sobre tecnología de suelos

    Directory of Open Access Journals (Sweden)

    Catton, Miles D.

    1962-12-01

    Full Text Available Not availableRecoge las experiencias internacionales de laboratorio y trabajos de campo, durante más de un cuarto de siglo, sobre mezclas controladas científicamente de suelo-cemento, y revisa los conocimientos y principios científicos y tecnológicos propios del tema. Para obtener un material estructural único como el suelo-cemento, puede ser necesario emplear técnicas distintas e independientes. Su empleo incluye los pavimentos baratos para carreteras y caminos, la base y subbase para pistas de aeropuertos y carreteras, las medidas contra la erosión en malecones, diques y terraplenes, los lechos de canales y otras muchas aplicaciones de ingeniería, etc. Este resumen se limita solamente a la aplicación del cemento a suelos de grano fino, principalmente, con el fin de obtener un material estructural barato de suelo-cemento compactado para pavimentos.

  18. Sobre las bases prejurídicas del derecho ambiental

    OpenAIRE

    Souvirón Morenilla, José María

    2015-01-01

    La preocupación por el ambiente, en sí mismo considerado y en su relación con el ser humano, son un fenómeno característico de nuestro tiempo. Sobre este soporte científico y la paralela reflexión ética, el ambiente se ha incorporado de modo progresivo también al campo del Derecho y la protección del ambiente se ha convertido en un título legitimador de la intervención de los poderes públicos decididamente expansivo.Dado el riesgo global que el problema ambiental hoy suscita, n...

  19. Sobre Análise do Relato Verbal

    Directory of Open Access Journals (Sweden)

    Tunes Elizabeth

    1998-01-01

    Full Text Available Neste artigo caracterizamos descritivamente aspectos básicos de um trabalho coordenado pela Professora Carolina Bori, junto ao Ciclo Básico da Universidade Federal de São Carlos, em 1977, trabalho este que desencadeou duas vertentes de pesquisa no Brasil: uma no âmbito do ensino de Química e a outra no âmbito da pesquisa com relatos verbais em Psicologia. Descrevemos, em seguida, as principais características de cada uma dessas vertentes, em termos das questões que as originaram e dos primeiros trabalhos que daí resultaram. Finalmente, contextualizamos a contribuição da abordagem ao relato verbal assim construída para a pesquisa em psicologia, especialmente à luz de colocações de Vygotsky sobre o papel dos relatos verbais na pesquisa experimental.

  20. Sobre el allanamiento al interior de los grupos societarios

    OpenAIRE

    Cubillos Garzón, Camilo

    2014-01-01

    Comprender cómo una teoría jurídica societaria afecta el desarrollo de un fenómeno económico es una tarea compleja, pero si además se considera que esta anomalía se inmiscuye en otro suceso mercantil, como es el de una situación patrimonial de hecho, el asunto aparece aún más confuso; comenzando de esta manera, y a partir de tales supuestos, es un deber concretar el marco sobre el cual girará esta investigación. Los partícipes de una economía perciben separadamente las políticas de crecimi...