WorldWideScience

Sample records for beauveria bassiana para

  1. Evaluación de Beauveria bassiana para el combate de insectos plaga en maíz almacenado

    Directory of Open Access Journals (Sweden)

    Juan Diego Molina

    2000-01-01

    Full Text Available El objetivo de este estudio fue evaluar la patogenicidad de aislamientos de Beauveria bassiana, para controlar los insectos plaga Prostephanus truncatus y Stophilus zeamais, en mazorcas de maíz almacenado. Se evaluó también la patogenicidad del hongo sobre Teritriosoma nigrescens, depredador natural de P. truncatus. Se mezclaron conidios secos del hongo con kaolinita y se aplicaron a trojas de maíz de 450 mazorcas acomodadas en capas de 50. Se montaron dos ensayos, en el primero se evaluaron aplicaciones del hongo al momento de almacenar el maíz, y en el segundo se evaluaron aplicaciones del hongo realizadas después de almacenar el maíz. La mortalidad de P. truncatus fue cuatro veces mayor en el ensayo donde se aplicó el hongo en forma preventiva. La mortalidad de S. zeamais fue el doble en el tratamiento donde se aplicó el hongo al momento de inocular con P. truncatus. Los niveles de mortalidad por B. bassiana fueron mayores en P. truncatus que en S. zeamais, pero S. zeamais, pero este último mostró un 20% más de infección que el primero

  2. Selection of Beauveria bassiana and Metarhizium anisopliae isolates for the control of Blissus antillus (Hemiptera: Lygaeidae Seleção de isolados Beauveria Bassiana e Metarhizium Anisopliae para o controle de Blissus Antillus

    Directory of Open Access Journals (Sweden)

    Richard Ian Samuels

    2004-06-01

    Full Text Available Chinch bugs of the genus Blissus (Hemiptera: Lygaeidae are serious pests of maize, wheat, sorghum and various grasses. This study is the first to screen isolates of Beauveria bassiana and Metarhizium anisopliae against 4th instar and adult Blissus antillus aiming to develop a biological control program for this important pasture pest. Ten fungal isolates were initially screened and three isolates were chosen for further investigation. To determine virulence, insects were inoculated by immersion in concentrations of 5 ´ 10(8 conidia mL-1. Mortality was evaluated for 10 days. B. bassiana ARSEF 792 was the most virulent isolate to both nymphs and adults, causing 53 and 78% infection, respectively, and values for LT50 of 7.8 and 5.0 days, respectively. Germination studies were carried out to confirm viability and determine speed of germination as a pathogenicity factor. The production of conidia on the cadavers of insects infected with the three selected isolates was determined. The production of conidia on rice media was also evaluated. B. bassiana CG 24 produced the highest number of conidia on insects cadavers (14.9 ´ 10(7 conidia per insect and also on rice media (10.6 ´ 10(9 conidia per g.Percevejos do gênero Blissus (Hemiptera: Lygeidae são pragas importantes das plantações de milho, trigo e sorgo e de vários tipos de gramíneos forrageiros. Esse estudo é o primeiro a amostrar isolados de Beauveria bassiana e Metarhizium anisopliae contra aos 4(0 instares e adultos de Blissus antillus com a finalidade de desenvolver um programa de controle biológico dessa importante praga de pastagens. Dez isolados foram inicialmente testados e três foram escolhidos para maiores investigações. Para determinar a virulência, os insetos foram inoculados por imersão em suspensões de conídios a uma concentração de 5 ´ 10(8 conídios mL-1. Mortalidade foi avaliada por 10 dias. B. bassiana ARSEF 792 foi o isolado mais virulento para as ninfas e os

  3. Evaluación de un biorreactor de lecho empacado para el desarrollo del hongo Beauveria bassiana

    Directory of Open Access Journals (Sweden)

    Zapata Zapata Arley David

    2003-06-01

    Full Text Available La evaluación del biorreactor de lecho empacado para el desarrollo del hongo Beauveria bassiana se hizo con base en las variables temperatura y concentración de conidias, utilizando un sustrato sólido constituido por trigo entero. Se tomaron como parámetros de operación, la altura del lecho, el flujo de aire y la posición dentro del biorreactor, siendo el tiempo de fermentación un parámetro predeterminado que permitió monitorear las variables y comparar la productividad en el desarrollo del hongo. Se pudo observar, con ayuda de un diseño de experimentos factorial y una prueba de Tukey, que bajo ciertas condiciones de operación como una relación H/D = 0.9 (H: altura del lecho, D: diametro del biorreactor y un flujo de aire de 12.3 L/min, se incrementó significativamente la productividad del hongo con respecto al método tradicional de producción (botellas bajo la escala ensayada, siendo la posición un factor poco significativo en el proceso. Palabras clave: Fermentación en estado sólido, control biológico.

  4. Estudio de las condiciones de mezclado en fermentador para la producción de blastosporas de Beauveria bassiana

    Directory of Open Access Journals (Sweden)

    Cipriano García Gutiérrez

    2013-12-01

    Full Text Available Título en ingles: Study of the mixing conditions in bioreactor for blastospores production of Beauveria bassiana.Resumen: Se caracterizaron tres fermentadores: New Brunswick M-19 de 14 litros, Applikon Biocontroller 1035 de 7 litros y New Brunswick Bioflo III de 7 litros, determinando el coeficiente volumétrico de transferencia de oxígeno (KLa, la retención de gas (RG y el tiempo de mezclado (tM. El fermentador New Brunswick Bioflo III tuvo los mejores valores con una relación de diámetro del impulsor/diámetro del tanque (DI/DT de 0.43, KLa = 9.5-208 h-1 y tM = 1.0-3.0 s, por lo que fue seleccionado para realizar la producción de blastosporas de Beauveria bassiana, utilizando melaza como fuente de carbono. Se estudiaron las condiciones de mezclado, utilizando diferentes combinaciones de impulsores tipo Rushton, Maxflo y Lightnin, bajo un diseño experimental factorial 32. El tiempo de propagación fue de 4 días, el volumen de trabajo 4 litros, 10% de inóculo (1x106 blastosporas/ml, temperatura 30°C, agitación de 400-500 rpm, aireación de 0.5-1.0 vvm, y pH de 5.4.El hongo se desarrolló mejor utilizando la combinación de impulsores Rushton-Maxflo a 400 rpm y 1.0 vvm (F = 10.324, p £ 0.0123 (DMS=0.585, obteniendo una concentración de 1.2x109 blastosporas/ml, 2.2 g/l de biomasa y 2.48 g/l de consumo de sustrato (Y x/s=0.89. Las condiciones de mezclado y los parámetros obtenidos pueden ser aplicados en otros fermentadores para optimizar la producción de blastosporas de B. bassiana en la elaboración experimental de bioinsecticidas.Palabras clave: fermentación líquida, aireación, agitación, hongo entomopatógeno.Abstract: In this work three fermenters were characterized: New Brunswick M-19 of 14 liters, Biocontroller Applikon 1035 of 7 liters and New Brunswick Bioflo III of 7 liters, determining the volumetric coefficient of oxygen transfer (KLa, gas retention (GH and the mixing time (tM. The fermenter New Brunswick Bioflo III

  5. Production of extracellular proteolytic enzymes by Beauveria bassiana

    OpenAIRE

    Józefa Chrzanowska; Maria Kołaczkowska

    2014-01-01

    The production of proteolytic enzymes by two strains of Beauveria bassiana 278, B. bassiana 446 and one strain of Ascosphera apis 496 was analysed. It was demonstrated that the strain of B. bassiana 278 proved to be the best producer of basic and acid proteases. The influence of different environmental factors such as nitrogen and carbon sources on the production of extracellular hydrolytic enzymes was assessed. In addition the acid protease from B. bassiana was partially characterized.

  6. Production of extracellular proteolytic enzymes by Beauveria bassiana

    Directory of Open Access Journals (Sweden)

    Józefa Chrzanowska

    2014-08-01

    Full Text Available The production of proteolytic enzymes by two strains of Beauveria bassiana 278, B. bassiana 446 and one strain of Ascosphera apis 496 was analysed. It was demonstrated that the strain of B. bassiana 278 proved to be the best producer of basic and acid proteases. The influence of different environmental factors such as nitrogen and carbon sources on the production of extracellular hydrolytic enzymes was assessed. In addition the acid protease from B. bassiana was partially characterized.

  7. Beauveria bassiana: quercetinase production and genetic diversity

    Directory of Open Access Journals (Sweden)

    Eula Maria de M. B Costa

    2011-03-01

    Full Text Available Beauveria bassiana genetic diversity and ability to synthesize quercetin 2,3-dioxygenase (quercetinase were analyzed. B. bassiana isolates, obtained from Brazilian soil samples, produced quercetinase after induction using 0.5 g/L quercetin. B. bassiana ATCC 7159 (29.6 nmol/mL/min and isolate IP 11 (27.5 nmol/ml/min showed the best performances and IP 3a (9.5 nmol/mL/min presented the lowest level of quercetinase activity in the culture supernatant. A high level of polymorphism was detected by random amplified polymorphic DNA (RAPD analysis. The use of internal-transcribed-spacer ribosomal region restriction fragment length polymorphism (ITS-RFLP did not reveal characteristic markers to differentiate isolates. However, the ITS1-5.8S-ITS2 region sequence analysis provided more information on polymorphism among the isolates, allowing them to be clustered by relative similarity into three large groups. Correlation was tested according to the Person's correlation. Data of our studies showed, that lower associations among groups, level of quercetinase production, or geographical origin could be observed. This study presents the production of a novel biocatalyst by B. bassiana and suggests the possible industrial application of this fungal species in large-scale biotechnological manufacture of quercetinase.

  8. Beauveria bassiana: endophytic colonization and plant disease control.

    Science.gov (United States)

    Ownley, Bonnie H; Griffin, Mary R; Klingeman, William E; Gwinn, Kimberly D; Moulton, J Kevin; Pereira, Roberto M

    2008-07-01

    Seed application of Beauveria bassiana 11-98 resulted in endophytic colonization of tomato and cotton seedlings and protection against plant pathogenic Rhizoctonia solani and Pythium myriotylum. Both pathogens cause damping off of seedlings and root rot of older plants. The degree of disease control achieved depended upon the population density of B. bassiana conidia on seed. Using standard plating techniques onto selective medium, endophytic 11-98 was recovered from surface-sterilized roots, stems, and leaves of tomato, cotton, and snap bean seedlings grown from seed treated with B. bassiana 11-98. As the rate of conidia applied to seed increased, the proportion of plant tissues from which B. bassiana 11-98 was recovered increased. For rapid detection of B. bassiana 11-98 in cotton tissues, we developed new ITS primers that produce a PCR product for B. bassiana 11-98, but not for cotton. In cotton samples containing DNA from B. bassiana11-98, the fungus was detected at DNA ratios of 1:1000; B. bassiana 11-98 was detected also in seedlings grown from seed treated with B. bassiana 11-98. Using SEM, hyphae of B. bassiana11-98 were observed penetrating epithelial cells of cotton and ramifying through palisade parenchyma and mesophyll leaf tissues. B. bassiana11-98 induced systemic resistance in cotton against Xanthomonas axonopodis pv. malvacearum (bacterial blight). In parasitism assays, hyphae of B. bassiana 11-98 were observed coiling around hyphae of Pythium myriotylum. PMID:18442830

  9. Safety of Beauveria bassiana (Bals. Vuill. to Gallus domesticus L.

    Directory of Open Access Journals (Sweden)

    Jucelaine Haas-Costa

    2010-04-01

    Full Text Available Beauveria bassiana, an important insect pathogen was used to evaluate its effect on the feeding, behavior, histology of the digestory system and anatomy of Gallus domesticus. The fungus (strain Unioeste 4 was administrated orally treated with chicken food. Chicken feces were collected, and the birds observed for 28 days. Also, were evaluated the weight of the birds, as well as any sign of intoxication or pathological modification. Tissue samples were withdrawn to test lesions with the optic microscope. There was 100% of survival of the birds, and no behavior alteration or external lesion was found. The test group presented the highest weight gain (1383.9±54.4g. Viable conidia were observed in the feces until 24 h after feeding the fungus, indicating that there was no germination inside the digestory system. No tissue lesion was observed, providing overwhelming evidence for the safety of B. bassiana to non-target organism G. domesticus.Beauveria bassiana é um importe entomopatógeno, sendo avaliado seu efeito sobre a alimentação, comportamento e histologia do sistema digestório de Gallus domesticus. O fungo (isolado Unioeste 4 foi administrado oralmente às aves, misturado à ração. Estas foram observadas por 28 dias e as fezes coletadas diariamente para análise. Também foi avaliado o peso das aves, bem como sinais de intoxicação ou modificação patológica. Amostras teciduais foram retiradas para verificar lesões com o microscópico óptico. Houve sobrevivência de 100% das aves avaliadas e nenhuma alteração comportamental ou lesão externa durante o experimento. O grupo teste apresentou o maior ganho de peso (1383,9±54,4g, sendo mais acentuado a partir da segunda semana. Observou-se a presença de conídios viáveis nas fezes somente até 24 horas após a ingestão do fungo, indicando que não houve germinação nas aves. Nenhuma lesão tecidual foi verificada, de forma que B. bassiana mostrou-se seguro para o organismo n

  10. Molecular Genetics of Beauveria bassiana Infection of Insects.

    Science.gov (United States)

    Ortiz-Urquiza, A; Keyhani, N O

    2016-01-01

    Research on the insect pathogenic filamentous fungus, Beauveria bassiana has witnessed significant growth in recent years from mainly physiological studies related to its insect biological control potential, to addressing fundamental questions regarding the underlying molecular mechanisms of fungal development and virulence. This has been in part due to a confluence of robust genetic tools and genomic resources for the fungus, and recognition of expanded ecological interactions with which the fungus engages. Beauveria bassiana is a broad host range insect pathogen that has the ability to form intimate symbiotic relationships with plants. Indeed, there is an increasing realization that the latter may be the predominant environmental interaction in which the fungus participates, and that insect parasitism may be an opportunist lifestyle evolved due to the carbon- and nitrogen-rich resources present in insect bodies. Here, we will review progress on the molecular genetics of B. bassiana, which has largely been directed toward identifying genetic pathways involved in stress response and virulence assumed to have practical applications in improving the insect control potential of the fungus. Important strides have also been made in understanding aspects of B. bassiana development. Finally, although increasingly apparent in a number of studies, there is a need for progressing beyond phenotypic mutant characterization to sufficiently investigate the molecular mechanisms underlying B. bassiana's unique and diverse lifestyles as saprophyte, insect pathogen, and plant mutualist. PMID:27131326

  11. Entomopathogenic fungus \\kur{Beauveria bassiana }- biological characteristics

    OpenAIRE

    PAVLÍČEK, Pavel

    2012-01-01

    This literature compilation focuses on current knowledge in the biological characteristics of the entomopathogenic fungi Beauveria bassiana, with emphasis on the influence of abiotic factors on the development and its effectiveness in selected species of harmful insects. Knowledge of abiotic factors is important for a successful outcome to protect plants against harmful agents this entomopathogen. There are also set out the specifics, benefits and examples of using the aforementioned entomopa...

  12. Plant extracts on Hypothenemus hampei (Coleoptera: Curculionidae and Beauveria bassianaExtratos vegetais sobre Hypothenemus hampei (Coleoptera: Curculionidae e Beauveria bassiana

    Directory of Open Access Journals (Sweden)

    Janaina Zorzetti

    2012-12-01

    (moringa e Tephrosia purpurea (tephrosia (sementes, folhas e raízes e Melia azedarach,(cinamomo Nerium oleander, (espirradeira Azadirachta indica (nim (apenas folhas, na mortalidade e repelência de H. hampei, e sua compatibilidade com Beauveria bassiana, importante inimigo natural desta praga. Para avaliar a mortalidade, ofereceram-se aos adultos, folhas de cafeeiro (Coffea arabica L tratadas por imersão em solução de endosulfan e em extratos vegetais na concentração de 10%. A repelência foi avaliada em testes com e sem chance de escolha, entre frutos de cafeeiro tratados e não tratados. A compatibilidade entre os extratos e Beauveria bassiana (CG 452 foi analisada quantificando a germinação, unidades formadoras de colônias, crescimento vegetativo e produção/produtividade de conídios. As maiores mortalidades foram observadas quando folhas foram tratadas com o extrato etanólico das de T. purpurea (folhas que não diferiu do endosulfan, e de extrato aquoso e etanólico da semente de M. oleifera. Em testes com chance de escolha, todos os extratos etanólicos possuíram ação repelente, sendo que a maior repelência foi causada por M. oleifera (raiz e T. purpurea (semente. Os extratos aquosos de folhas e semente de M. oleifera e de folhas de N. oleander apresentaram a maior repelência. Nos ensaios sem chance de escolha o maior nível de repelência foi para frutos de cafeeiro tratados com A. indica (folhas. O extrato etanólico de folhas de M. oleifera afetou negativamente a germinação. Estes estudos mostraram o potencial desses extratos para uso a campo como uma alternativa ao controle químico, sendo também seletivos para B. bassiana.

  13. Spore production of Beauveria bassiana from agro-industrial residues

    OpenAIRE

    Herta Stutz Dalla Santa; Osmar Roberto Dalla Santa; Débora Brand; Luciana Porto de Souza Vandenberghe; Carlos Ricardo Soccol

    2005-01-01

    The purpose of this work was to produce Beauveria bassiana by Solid-State Fermentation using agro-industrial residues and optimizing the cultivation conditions. Refused potatoes, coffee husks and sugar-cane bagasse were tested. The blend of refused potatoes and sugar-cane bagasse (60-40%) with particle size in the range of 0.8-2 mm was used in the fermentation experiments. In Erlenmeyer flasks the best spore production was achieved with the following conditions: incubation temperature 26º C; ...

  14. Genetic diversity among brazilian isolates of beauveria bassiana: comparisons with non-brazilian isolates and other beauveria species

    Science.gov (United States)

    Fernandes, E.K.K.; Moraes, A.M.L.; Pacheco, R.S.; Rangel, D.E.N.; Miller, M.P.; Bittencourt, V.R.E.P.; Roberts, D.W.

    2009-01-01

    Aims: The genetic diversity of Beauveria bassiana was investigated by comparing isolates of this species to each other (49 from different geographical regions of Brazil and 4 from USA) and to other Beauveria spp. Methods and Results: The isolates were examined by multilocus enzyme electrophoresis (MLEE), amplified fragment length polymorphism (AFLP), and rDNA sequencing. MLEE and AFLP revealed considerable genetic variability among B. bassiana isolates. Several isolates from South and Southeast Brazil had high similarity coefficients, providing evidence of at least one population with clonal structure. There were clear genomic differences between most Brazilian and USA B. bassiana isolates. A Mantel test using data generated by AFLP provided evidence that greater geographical distances were associated with higher genetic distances. AFLP and rDNA sequencing demonstrated notable genotypic variation between B. bassiana and other Beauveria spp. Conclusion: Geographical distance between populations apparently is an important factor influencing genotypic variability among B. bassiana populations in Brazil. Significance and Impact of the Study: This study characterized many B. bassiana isolates. The results indicate that certain Brazilian isolates are considerably different from others and possibly should be regarded as separate species from B. bassiana sensu latu. The information on genetic variation among the Brazilian isolates, therefore, will be important to comprehending the population structure of B. bassiana in Brazil. ?? 2009 The Society for Applied Microbiology.

  15. The use of aggregation pheromone to enhance dissemination of Beauveria bassiana for the control of the banana weevil in Uganda

    NARCIS (Netherlands)

    Tinzaara, W.; Gold, C.S.; Dicke, M.; Huis, van A.; Nankinga, C.M.; Kagezi, G.H.; Ragama, P.E.

    2007-01-01

    Candidate strains of Beauveria bassiana were identified for use in integrated pest management of the banana weevil Cosmopolites sordidus. Horizontal field transmission of B. bassiana between banana weevils using different delivery systems, including aggregation pheromones, was investigated. We obser

  16. Cordyceps bassiana and production of stromata in vitro showing Beauveria anamorph in Korea

    Science.gov (United States)

    A Cordyceps species was found with Beauveria anamorph state on larval insect cadavers on Obong Mountsin in Gangwon Pronvince, Republic of Korea. Cultures from discharged ascospores formed an anamorph identifiable as Beauveria bassiana. This teleomorph-anamorph connection was also confirmed by the in...

  17. RAPD e ITS Detectan Variación Molecular en Poblaciones Chilenea de Beauveria bassiana RAPD and ITS Reveal Molecular Variation of Chilean Populations of Beauveria bassiana

    Directory of Open Access Journals (Sweden)

    Viviana Becerra V

    2007-06-01

    Full Text Available Los hongos entomopatógenos son una alternativa atractiva para el control biológico de insectos plagas. En Chile, el Instituto de Investigaciones Agropecuarias (INIA, Centro Regional de Investigación Quilamapu mantiene aproximadamente 400 aislamientos de Beauveria, colectados a través del país. Esta colección ha sido parcialmente clasificada en base a su morfología y a su eficacia como controlador biológico. Sin embargo, es necesario complementar estos estudios con una caracterización a nivel genético-molecular, para determinar el nivel de diversidad genética de Beauveria bassiana e identificar posibles patrones de bandas que permitan dicriminar entre aislamientos. En este estudio, se analizaron 36 aislamientos de B. bassiana provenientes de diversas regiones geográficas del país. El análisis genético se realizó mediante el ADN Polimórfico Amplificado al Azar (RAPD y la Reacción en Cadena de la Polimerasa-Fragmentos de Restricción Polimórficos (PCR-RFLP de los espaciadores internos transcritos (ITS de las secuencias ribosomales del ADN (ITS-rDNA. El análisis de RAPD indicó una alta diversidad genética entre los aislamientos, con un promedio de 43% de similitud. Por otro lado, el análisis de los ITS determinó una menor diversidad, con un 83% de similitud entre aislamientos. La región ITS 1 mostró un mayor número de sitios de restricción que la región ITS 2. Los RAPD fueron más eficientes para discriminar (o identificar entre cepas debido al bajo número de haplotipos detectados con los ITS. Para los dos marcadores utilizados en este estudio, la diversidad genética no estuvo asociada con el origen geográfico de los aislamientos.Entomopathogenic fungi are an attractive alternative for the biological control of insects. In Chile, the Quilamapu Regional Research Center of the National Agricultural Research Institute (INIA has collected about 400 isolates of the genus Beauveria along the country. A partial

  18. Genes involved in virulence of the entomopathogenic fungus Beauveria bassiana.

    Science.gov (United States)

    Valero-Jiménez, Claudio A; Wiegers, Harm; Zwaan, Bas J; Koenraadt, Constantianus J M; van Kan, Jan A L

    2016-01-01

    Pest insects cause severe damage to global crop production and pose a threat to human health by transmitting diseases. Traditionally, chemical pesticides (insecticides) have been used to control such pests and have proven to be effective only for a limited amount of time because of the rapid spread of genetic insecticide resistance. The basis of this resistance is mostly caused by (co)dominant mutations in single genes, which explains why insecticide use alone is an unsustainable solution. Therefore, robust solutions for insect pest control need to be sought in alternative methods such as biological control agents for which single-gene resistance is less likely to evolve. The entomopathogenic fungus Beauveria bassiana has shown potential as a biological control agent of insects, and insight into the mechanisms of virulence is essential to show the robustness of its use. With the recent availability of the whole genome sequence of B. bassiana, progress in understanding the genetics that constitute virulence toward insects can be made more quickly. In this review we divide the infection process into distinct steps and provide an overview of what is currently known about genes and mechanisms influencing virulence in B. bassiana. We also discuss the need for novel strategies and experimental methods to better understand the infection mechanisms deployed by entomopathogenic fungi. Such knowledge can help improve biocontrol agents, not only by selecting the most virulent genotypes, but also by selecting the genotypes that use combinations of virulence mechanisms for which resistance in the insect host is least likely to develop. PMID:26628209

  19. Spore production of Beauveria bassiana from agro-industrial residues

    Directory of Open Access Journals (Sweden)

    Herta Stutz Dalla Santa

    2005-06-01

    Full Text Available The purpose of this work was to produce Beauveria bassiana by Solid-State Fermentation using agro-industrial residues and optimizing the cultivation conditions. Refused potatoes, coffee husks and sugar-cane bagasse were tested. The blend of refused potatoes and sugar-cane bagasse (60-40% with particle size in the range of 0.8-2 mm was used in the fermentation experiments. In Erlenmeyer flasks the best spore production was achieved with the following conditions: incubation temperature 26º C; initial pH 6.0; inoculum concentration 10(7 spores.g-1.dw and initial moisture 75%. In the column type reactor using forced aeration under the optimized conditions, the maximum production (1.07x10(10spores.g-1.dw was obtained at the 10th day of fermentation. The respirometric analyses of the fermentation showed a strong correlation between fungal growth and spore production.O objetivo deste trabalho foi produzir Beauveria bassiana por fermentação no estado sólido em resíduos agro-industriais e otimizar as condições de cultivo. Batata-refugo, polpa de café e bagaço de cana de açúcar foram testados. A mistura de batata-refugo e de bagaço de cana de açúcar (60:40%, com granulometria de 2 a 0,8 mm foi escolhida como melhor substrato/suporte. Em frascos de Erlenmeyer a produção de esporos foi maior com as seguintes condições: pH 6,0; temperatura de incubação de 26º C; taxa de inóculo de 10(7 esporos.g-1 de matéria seca; e umidade inicial de 75%. Em bioreator do tipo coluna com aeração forçada, as condições otimizadas possibilitaram uma produção máxima de esporos no 10º dia de fermentação, obtendo-se 1,07x10(10 esporos.g-1 de matéria seca. A análise respirométrica desta fermentação permitiu correlacionar o desenvolvimento do fungo com a produção de esporos.

  20. Preservation of Beauveria bassiana (Balsam Vuillemin (moniliales: moniliaceae pathogenicityagainst the coffee borer in different systems

    Directory of Open Access Journals (Sweden)

    T. Bahamón

    2011-12-01

    Full Text Available The objective of this study is to find preservation techniques of Beauveria bassiana pathogenicity in the laboratory. Long term storage of B. bassiana cultures is very important to prepare industrial products. Preservation techniques for pathogenicity would replace the need to pass B. bassiana spores frequently in the target insect. Studies on B. bassiana pathogenicity are almost nonexistent. Viability of B. bassiana was evaluated in comparison with pathogenicity when subjected to different preservation temperatures with various protectors. The most succesful procedures were silica gel and mineral oil in refrigeration; glicerol and dimethilsulfoxide in liquid nitrogen; liophilization with skim milk at 10% and 20% and skim milk with inositol at 5%. The tests were carried our during 24 weeks at 6 weeks intervals. A monosporic B. bassiana culture (Bb. 9620 isolated by Cenicafé research center was used for the study. The mean value for the preservation of pathogenicity was influenced by the protectors used.

  1. Existence of entomopathogen fungi, Beauveria bassiana as an endophyte in cacao seedlings

    Directory of Open Access Journals (Sweden)

    Endang Sulistyowati

    2015-12-01

    Full Text Available Beauveria bassiana is one of the entomopathogen fungi which is known as biological control agent of cocoa pod borer and cocoa mirids (Helopeltis spp.. Because of its effectiveness in the fields is still not consistent, so we conduct a research with the objective to know the possibility of Beauveria bassiana to be established as a endophyte. Various fungal entomopathogens have already been reported as endophytes and the various methods used to inoculate the plants with B. bassiana were partially effective. The research has been conducted in laboratory of Plant Protection, Indonesian Coffee and Cocoa Research Institute by inoculating of cocoa seeds and cocoa nursery with B. bassiana suspension.  The trial was arranged  by randomized complete block design with a factorial arrangement. The factor were spore concentration of B. bassiana (0; 2; and 4 g/ 10 l and cocoa varieties (family of ICS 60, TSH858, and hybrid. The trial were use  four replications. The results showed that the fungal entomopathogen B. bassiana was established as an endophyte in cocoa seedling, both from cocoa seeds and nursery application. Percentage of existence of B. bassiana colonies as endophytes one month after seeds application were ICS 60 amounted to 93.3 % both on concentration treatments, while the families of TSH 858 by 80 % and 86.67 % respectively in 2 g and 4 g per 10 l of B. bassiana spores concentration treament.. The lowest percentage was in hybrids, which amounted to 66.67% and 50%. B. bassiana colonies was exixtence as an endophyte in culture from root, stem and leaves of cocoa seedling up to 5 months post inoculation. While the application on nursery by soil drenshing, leaf spraying, and stem injection , it was known that B. bassiana colonies were found in the tissues of leaves, stems, and roots until two months after application. Colonies of B. bassiana as endophytes still exsist until six weeks after nursery was planted in the field. 

  2. Production of conidia of Beauveria bassiana in solid-state culture: current status and future perspectives.

    Science.gov (United States)

    Lopez-Perez, M; Rodriguez-Gomez, D; Loera, O

    2015-01-01

    Beauveria bassiana is an important entomopathogenic fungus widely commercialized in the world. Recent progress and achievements on conidia production have focused on a yield goal of 10(9) to 10(10) conidia per gram of dry substrate. Due to cost-competitive perspectives, these yields should be associated with better production rates or productivities. This study presents a review of relevant studies of B. bassiana conidia production on solid-state cultures and the parameters that should be taken into account to maintain constant quality in the product to be commercialized. Conditions for maximizing production and infectivity of B. bassiana conidia are also analysed. PMID:24494702

  3. The Existence of Beauveria bassiana in the Third Generation of Corn Seddling

    OpenAIRE

    Diana Daud, Itji; Widiayani, Nuniek

    2015-01-01

    Abstract The fungus Beauveria bassiana can be endophytic in maize. The fungus was recovered in culture from stems, leaves and roots after a month planting. This phenomenon was shown until the third generation of the corn. The result from laboratory shows that B.bassiana appear in F1, F2 and F3 in order 70, 80 and 90% in the roots, 80% in the stems in all generation, 90, 80 and 70% in leaves. In CFU???s ml-1 of B. bassiana in corn seed, show F1 was 8.9 x 106, F2 was 8.1 x 106 a...

  4. Molecular characterization of a novel amalgavirus from the entomopathogenic fungus Beauveria bassiana

    Czech Academy of Sciences Publication Activity Database

    Koloniuk, Igor; Hrabáková, Lenka; Petrzik, Karel

    2015-01-01

    Roč. 160, č. 6 (2015), s. 1585-1588. ISSN 0304-8608 R&D Projects: GA MŠk LH13136; GA MŠk(CZ) EE2.3.30.0032 Institutional support: RVO:60077344 Keywords : Monopartite DsRNA Virus * Beauveria bassiana * amalgaviruses infecting fungi Subject RIV: EE - Microbiology, Virology Impact factor: 2.390, year: 2014

  5. EICOSANOIDS MEDIATE MANDUCA SEXTA CELLULAR RESPONSE TO BEAUVERIA BASSIANA: A ROLE FOR THE LIPOXYGENASE PATHWAY

    Science.gov (United States)

    Many studies have documented the involvement of eicosanoids in insect cellular immune responses to bacteria. The use of Beauveria bassiana as a nodulation elicitor, with inhibition of phospholipase A2 by dexamethasone extends the principal to fungi. This study also provides the first evidence of i...

  6. Comparative impact of artificial selection for fungicide resistance on Beauveria bassiana and Metarhizium brunncum

    Science.gov (United States)

    Hypocreales fungi such as Beauveria bassiana and Metarhizium anisopliae can be negatively affected by fungicides thereby reducing their biocontrol potential. The overall goal of this study was to investigate the impact of artificial selection for fungicide resistance on two commercial entomopathoge...

  7. Improved shelf life of dried Beauveria bassiana blastospores using convective drying and active packaging processes

    Science.gov (United States)

    The yeast form (blastospore) of the dimorphic insect-pathogenic fungus Beauveria bassiana can be rapidly produced using liquid fermentation methods but is generally unable to survive rapid dehydration processes or storage under non-refrigerated conditions. In this study, we evaluated the influence o...

  8. Anopheline and culicine mosquitoes are not repelled by surfaces treated with the entomopathogenic fungi Metarhizium anisopliae and Beauveria bassiana

    NARCIS (Netherlands)

    Mnyone, L.L.; Koenraadt, C.J.M.; Lyimo, I.N.; Mpingwa, M.W.; Takken, W.; Russell, T.L.

    2010-01-01

    Background - Entomopathogenic fungi, Metarhizium anisopliae and Beauveria bassiana, are promising bio-pesticides for application against adult malaria mosquito vectors. An understanding of the behavioural responses of mosquitoes towards these fungi is necessary to guide development of fungi beyond t

  9. Evaluation of Metarhizium anisopliae, Beauveria bassiana and Paecilomyces fumosoroseus as entomopathogens of the cactus moth, Cactoblastis cactorum (Lepidoptera:Pyralidae)

    Science.gov (United States)

    The fungal pathogens Metarhizium anisopliae (Metchnikoff) Sorokin (Hypocreales: Clavicipitaceae), Paecilomyces fumosoroseus (Wize) Brown & Smith (Deuteromycotina: Hyphomycetes), and Beauveria bassiana (Bals.-Criv.) Vuill. (Hypocreales: Clavicipitaceae) were evaluated as potential biological control ...

  10. Isolation and Assessment of Stability of Six Formulations of Entomopathogenic Beauveria bassiana.

    Science.gov (United States)

    Mwamburi, Lizzy A

    2016-01-01

    Beauveria bassiana is the most widely studied and exploited entomopathogen. The development of a suitable formulation for B. bassiana is a critical component in aiding the entomopathogen germinate and infect the host. In addition to being economical to produce, having high residual activity, it is also important that the formulation is easy to handle, stable during storage, and convenient to mix and apply and be consistently effective in controlling the target pest.In this chapter we describe preparation of experimental formulations of conidia of B. bassiana. The formulations are prepared with barley, rice, wheat bran, clay, kaolin, and peat. The protocol for assessing the stability of the formulations of B. bassiana is also described. PMID:27565494

  11. Discovery and demonstration of the teleomorph of Beauve-ria bassiana (Bals.) Vuill. , an important entomogenous fun-gus

    Institute of Scientific and Technical Information of China (English)

    2001-01-01

    A Cordyceps specimen was collected in Anhui, China, a strain of Beauveria bassiana, an important entomopathogenic fungus for biological pest control, was isolated and their relationship was demonstrated by microcycle conidiation. The teleomorph is an undescribed species and is named Cordyceps bassiana.

  12. Screening of liquid media and fermentation of an endophytic Beauveria bassiana strain in a bioreactor

    OpenAIRE

    Lohse, Rieke; Jakobs-Schönwandt, Desiree; Patel, Anant V

    2014-01-01

    A novel approach for biological control of insect pests could be the use of the endophytic entomopathogenic Beauveria bassiana isolate ATP-02. For the utilization of the endophyte as a commercial biocontrol agent, the fungus has to be mass-produced. B. bassiana was raised in shake flask cultures to produce high concentrations of total spores (TS), which include blastospores (BS) and submerged conidiospores (SCS). The highest concentration of 1.33×109 TS/mL and the highest yield of 5.32×1010 T...

  13. PATOGENICIDADE DE BEAUVERIA BASSIANA (BALS.) VUILL. AO ÁCARO Tetranychus urticae KOCH PATHOGENICITY OF BEAUVERIA BASSIANA (BALS.) VUILL. AGAINST Tetranychus urticae KOCH

    OpenAIRE

    Marco Antonio Tamai; Sérgio Batista Alves; Pedro Janeiro Neves

    1999-01-01

    O estudo da patogenicidade de Beauveria bassiana (Bals.) Vuill. ao ácaro Tetranychus urticae Koch foi desenvolvido a 25 ± 2°C, 70 ± 5% UR e 12 horas de fotofase, utilizando-se fêmeas recém-emergidas. Os ácaros foram mantidos durante seis dias em discos de folha de Canavalia ensiformis (L.) DC. inoculadas com B. bassiana, isolado 447, nas concentrações: 5x106, 1x107, 5x107, 1x108, 5x108 e 1x109 conídios/ml. Este isolado mostrou-se patogênico a T. urticae, apresentando aumento nos valores das m...

  14. Use of Beauveria bassiana and Metarhizium anisopliae for fruit fly control: a novel approach

    International Nuclear Information System (INIS)

    The potential of two species of entomopathogenic fungi, Beauveria bassiana (Bals.) and Metarhizium anisopliae (Met.) Sorokin, as practical fruit fly biocontrol agents is studied. These natural inhabitants of soil are found infecting a wide range of insect species that spend at least one stage of their life cycle in the soil. Sterile flies are used as vectors of the infection. A summary of results from different laboratory and field cage experiments is presented. (MAC)

  15. Optimization of Solid-State Fermentation for Improved Conidia Production of Beauveria bassiana as a Mycoinsecticide

    OpenAIRE

    Pham, Tuan Anh; Kim, Jeong Jun; Kim, Keun

    2010-01-01

    The production of conidia of entomopathogenic Beauveria bassiana by solid-state fermentation was studied for the development of a biocontrol agent against aphid Myzus persicae. The optimal conditions for conidia production on polished white rice were 40% moisture content, 25℃ culture temperature, 2-day-old seeding culture grown in 3% corn meal, 2% rice bran, 2% corn steep powder medium, initial conidia concentration of 107 conidia/g in the wet rice, 10% inoculum size, and use of a polyethylen...

  16. Efficacy of Molasses and Beauveria bassiana (Balsamo) Vuill on the Control of Cosmopolites sorditus Germar, 1824

    OpenAIRE

    Flávia Queiroz de Oliveira; José Bruno Malaquias; Luiz Leonardo Ferreira; Thiago de Souza Ribeiro; Alexandre Igor de Azevedo Pereira

    2010-01-01

    This research sought to study the compatibility between the molasses and the entomopathogenic fungi Beauveria bassiana (Balsamo) Vuill on the control of Cosmopolites sorditus Germar, 1824. The study was conducted on the Site Pitiá in a banana plantation of approximately 250 m2, located in the municipality of Areia, state of Paraiba, Brazil. The results showed that the constancy of C. sorditus was significantly higher in traps consisting of molasses+fungi (P

  17. The characteristics of keratomycosis by Beauveria bassiana and its successful treatment with antimycotic agents

    OpenAIRE

    Sonoyama, Hiroko; Araki-Sasaki, Kaoru; Kazama, Shigeyasu; Kawasaki, Tsutomu; Ideta, Hidenao; Sunada, Atsuko; Asari, Seishi; Inoue, Yoshitsugu; Hayashi, Kozaburo

    2008-01-01

    Clinical findings and treatment of keratomycosis caused by Beauveria bassiana, an entomopathogenic filamentous fungus, are described for an 80-year-old woman, who was referred to the hospital for ocular pain and redness on the 9th day after an ocular injury caused by the frame of her glasses. She had a long history of recurrent diabetic iritis and continuously used topical antibiotics and corticosteroids. At her first visit, a slit-lamp examination indicated a corneal ulcer confined within th...

  18. Use of Beauveria bassiana and Metarhizium anisopliae for fruit fly control: a novel approach

    Energy Technology Data Exchange (ETDEWEB)

    Toledo, Jorge; Liedo, Pablo, E-mail: jtoledo@ecosur.m [El Colegio de la Frontera Sur, Chiapas (Mexico). Dept. de Entomologia Tropical; Flores, Salvador; Montoya, Pablo [Secretaria de Agricultura, Ganaderia, Desarrollo Rural, Pesca y Alimentacion (SAGARPA), Chiapas (Mexico). Subdireccion de Desarrollo de Metodos; Campos, Sergio E.; Villasenor, Antonio [Secretaria de Agricultura, Ganaderia, Desarrollo Rural, Pesca y Alimentacion (SAGARPA), Chiapas (Mexico). Programa Moscamed. Direccion de Operaciones de Campo

    2006-07-01

    The potential of two species of entomopathogenic fungi, Beauveria bassiana (Bals.) and Metarhizium anisopliae (Met.) Sorokin, as practical fruit fly biocontrol agents is studied. These natural inhabitants of soil are found infecting a wide range of insect species that spend at least one stage of their life cycle in the soil. Sterile flies are used as vectors of the infection. A summary of results from different laboratory and field cage experiments is presented. (MAC)

  19. Field applications of Beauveria bassiana to control the European cherry fruit fly Rhagoletis cerasi

    OpenAIRE

    Daniel, Claudia; Wyss, Eric

    2010-01-01

    Field experiments with foliar applications of Beauveria bassiana ATCC 74040 (product Naturalis-L) were conducted to control the European cherry fruit fly Rhagoletis cerasi Loew (Diptera: Tephritidae), a major pest of cherries in Europe. Naturalis-L was applied at concentrations of 250 ml per 100 l in 7-day intervals during the flight period of R. cerasi. Flight activity monitored by yellow sticky traps was only slightly affected by treatments. Infection and mycosis of adult cherry fruit fl...

  20. Selection of Beauveria bassiana and Metarhizium anisopliae Isolates to Control Triatoma infestans

    Directory of Open Access Journals (Sweden)

    Luz Christian

    1998-01-01

    Full Text Available Twenty three isolates of Beauveria bassiana and 13 isolates of Metarhizium anisopliae were tested on third instar nymphs of Triatoma infestans, a serious vector of Chagas disease. Pathogenicity tests at saturated humidity showed that this insect is very susceptible to fungal infection. At lower relative humidity (50%, conditions expected in the vector microhabitat, virulence was significantly different among isolates. Cumulative mortality 15 days after treatment varied from 17.5 to 97.5%, and estimates of 50% survival time varied from 6 to 11 days. Maintaining lower relative humidity, four B. bassiana and two M. anisopliae isolates were selected for analysis of virulence at different conidial concentrations and temperatures. Lethal concentrations sufficient to kill 50% of insects (LC50 varied from 7.1x105 to 4.3x106 conidia/ml, for a B. bassiana isolate (CG 14 and a M. anisopliae isolate (CG 491 respectively. Most isolates, particularly B. bassiana isolates CG 24 and CG 306, proved to be more virulent at 25 and 30°C, compared to 15 and 20°C. The differential virulence at 50% humidity observed among some B. bassiana isolates was not correlated to phenetic groups in cluster analysis of RAPD markers. In fact, the B. bassiana isolates analyzed presented a high homogeneity (> 73% similarity.

  1. Selectivity of Beauveria bassiana and Metarrhizium anisopliae to Trichogramma pretiosum Riley (Hymenoptera: Trichogrammatidae); Seletividade de Beauveria bassiana e Metarhizium anisopliae a Trichogramma pretiosum Riley (Hymenoptera: Trichogrammatidae)

    Energy Technology Data Exchange (ETDEWEB)

    Potrich, Michele; Silva, Everton L. da; Neves, Pedro M.O.J. [Universidade Estadual de Londrina (UEL), PR (Brazil). Centro de Ciencias Agrarias], e-mail: profmichele@gmail.com, e-mail: evertonloz@gmail.com, e-mail: pedroneves@uel.br; Alves, Luis F.A.; Daros, Alaxsandra [Universidade do Oeste do Parana (UNIOESTE), Cascavel, PR (Brazil). Centro de Ciencias Biologicas e da Saude. Lab. de Zoologia de Invertebrados], e-mail: lfaalves@unioeste.br; Haas, Jucelaine; Pietrowski, Vanda [Universidade do Oeste do Parana (UNIOESTE), Marechal Candido Rondon, PR (Brazil). Centro de Ciencias Agrarias], e-mail: jubarth@gmail.com, e-mail: vandapietrowski@gmail.com

    2009-07-01

    Trichogramma pretiosum Riley and the entomopathogenic fungi Beauveria bassiana and Metarhizium anisopliae are efficient biological control agents and are thought to be used jointly. In here, we investigated if these entomopathogens could have any side-effects on T. pretiosum. Therefore, 1 x 8 cards containing sterilized eggs of Anagasta kuehniella (Zeller) that were sprayed with 0.2 ml of B. bassiana or M. anisopliae (1.0 X 10{sup 9} conidia/ml) were offered to a T. pretiosum female for 24h (30 cards/fungus = 30 replicates). Afterwards, females were isolated in glass tubes. The control group was sprayed with sterile distillated water + Tween 80 (0.01%). In addition, 60 cards with sterilized eggs of A. kuehniella were submitted to parasitism by females of T. pretiosum for 24h. Of these cards, 30 were sprayed with B. bassiana or M. anisopliae and 30 with distillated water + Tween 80 (0.01%), and observed daily until parasitoid emergence. Metarhizium anisopliae decreased parasitoid emergence and caused confirmed mortality. Therefore, field and semi-field experiments should be conducted for a final assessment of the side-effects of these entomopathogens on Trichogramma as a ways to develop a control strategy in which both can be used. (author)

  2. Compatibility between the entomopathogenic fungus Beauveria bassiana and insecticides used in coffee plantations Compatibilidade entre o fungo entomopatogênico Beauveria bassiana e inseticidas usados na cultura do cafeeiro

    Directory of Open Access Journals (Sweden)

    Carolina Natali de Oliveira

    2003-12-01

    controle, reduzindo assim a quantidade de inseticidas. O efeito fungitóxico in vitro das formulações inseticidas de Tiametoxan, Ciflutrin, Deltametrin, Alfacipermetrina, Triazofos, Clorpirifós, Fenpropatrin e Endosulfan em três concentrações (RC= recomendação média para campo, 0,5 ´ RC e 2 ´ RC, foi avaliado sobre a germinação dos conídios, crescimento vegetativo e produção de conídios no fungo Beauveria bassiana. Apenas cinco formulações inseticidas, na concentração RC, proporcionaram viabilidade dos conídios acima de 60%. A viabilidade deve ser considerada o parâmetro mais importante a ser avaliado por ser o passo inicial no processo de infecção. As formulações de Alfacipermetrina, Tiametoxan e Ciflutrin, nas menores concentrações, causaram a menor inibição da germinação, sem diferença em relação à testemunha. Analisando-se o crescimento vegetativo, observou-se que a formulação de Tiametoxan nas menores concentrações, não inibiu o crescimento radial, sendo o crescimento vegetativo nos demais tratamentos inferior à testemunha. A formulação de Tiametoxan também proporcionou a menor inibição na produção de conídios. Os inseticidas com formulações de Alfacipermetrina e Tiametoxan mostraram-se compatíveis com o fungo Beauveria bassiana (CG 425, importante agente natural de controle da broca do café Hypothenemus hampei e podem ser recomendados para MIP no cafeeiro

  3. Evaluation of kinetic parameters of chitinases produced by Beauveria bassiana (Bals.) Vuill. /
    Avaliação de parâmetros cinéticos de quitinases produzidas por Beauveria bassiana (Bals.) Vuill.

    OpenAIRE

    Cristiane Mita; Vanessa Hitomi Sugahara; Jo I Wu; Pedro Manoel Oliveira Janeiro Neves; Dalva Tomoe Miyagui; Geni Varéa-Pereira; Danieli Cristina Sassá; Evelyn Kamogawa

    2008-01-01

    Entomopathogenic fungus Beauveria bassiana is currently used as a biocontrol agent for agricultural pests. The infection process involves extracellular enzymes such as proteases and chitinases that degrade the cuticle of the insects. The objective of this work was to evaluate kinetic parameters of pH, temperature, ionic concentration and time of reaction on chitinases activity. The fungus B. bassiana CG432 was cultivated on coffee berry borer Hypothenemus hampei (Ferrari) and the conidia grow...

  4. The characteristics of keratomycosis by Beauveria bassiana and its successful treatment with antimycotic agents

    Directory of Open Access Journals (Sweden)

    Hiroko Sonoyama

    2008-10-01

    Full Text Available Hiroko Sonoyama1, Kaoru Araki-Sasaki1, Shigeyasu Kazama1, Tsutomu Kawasaki1, Hidenao Ideta1, Atsuko Sunada2, Seishi Asari2, Yoshitsugu Inoue3, Kozaburo Hayashi41Ideta Eye Hospital, Kumamoto, Kumamoto, Japan; 2Department of Laboratory for Clinical Investigation, Osaka University Hospital, Suita, Osaka, Japan; 3Division of Ophthalmology and Visual Science, Department of Medicine of Sensory and Motor Organ, Tottori University, Yonago, Tottori, Japan; 4Immunology and Virology Section Lab, Immunology, NEI, NIH, Bethesda, MD, USAAbstract: Clinical findings and treatment of keratomycosis caused by Beauveria bassiana, an entomopathogenic filamentous fungus, are described for an 80-year-old woman, who was referred to the hospital for ocular pain and redness on the 9th day after an ocular injury caused by the frame of her glasses. She had a long history of recurrent diabetic iritis and continuously used topical antibiotics and corticosteroids. At her first visit, a slit-lamp examination indicated a corneal ulcer confined within the superficial stromal layer, along with a slight infiltration and edema. Only a very few inflammatory cells were seen in the anterior chamber. Direct microscopic examination of corneal scrapings revealed septate fungal hyphae with zig-zag rachis and budding that was subsequently identified as B. bassiana by slide culture. Topical voriconazole with miconazole, pimaricin and oral itraconazole were effective and the lesion disappeared leaving only a mild scar at 2 months. The sensitivity of B. bassiana to various antimycotic agents was confirmed by broth microdilution, agar dilution with the Clinical Laboratory Standard Institute standard, and a disk method using topically applied concentrations. B. bassiana, which exhibits a characteristic appearance in smears and causes superficial keratomycosis, is sensitive to voriconazole with miconazole, pimaricin, and itraconazole.Keywords: Beauveria bassiana, keratomycosis, filamentous

  5. Lethal effects of a Mexican Beauveria bassiana (Balsamo) strain against Meccus pallidipennis (Stal)

    Science.gov (United States)

    Lino, Zumaquero Rios José; Juventino, López-Tlacomulco José; Raúl, Rojas García; Estibaliz, Sansinenea

    2014-01-01

    The entomopathogenic fungus Beauveria bassiana (Balsamo 1835) Vuillemin is an effective alternative control agent against some agricultural pests and biological vectors of important diseases such as Chagas disease. In this work we studied an isolate of Beauveria bassiana from of the town of San Antonio Rayón, Puebla, Mexico and its entomopathogenic effects on Meccus pallidipennis (Stal 1872). Phylogenetic analysis using molecular comparison of the ITS and EF1α genes, showed that the resulting cladogram places the BUAP 04 strain with a relationship closer to the AFAO 9-6 strain, within the diversity of the B. bassiana sensu lato group. Although there was the possibility that BUAP 04 strain was a direct descendant of strains used in campaigns of biologic control, molecular study allowed us to recognize that it was a different fungus due to numerous inserts. A strain isolated from a T. dimiata was evaluated for pathogenicity against another triatoma (Meccus pallidipennis) species obtaining an LC50 of 4.16 × 106 spores/mL, confirming that the BUAP 04 strain is virulent for M. pallidipennis and could be a good prospect for formulations to control M. pallidipennis. PMID:25242941

  6. Protection of metal artifacts with the formation of metal–oxalates complexes by Beauveria bassiana

    OpenAIRE

    Joseph, Edith; Cario, Sylvie; Simon, Anaële; Wörle, Marie; Mazzeo, Rocco; Junier, Pilar; Job, Daniel

    2013-01-01

    Several fungi present high tolerance to toxic metals and some are able to transform metals into metal-oxalate complexes. In this study, the ability of Beauveria bassiana to produce copper oxalates was evaluated. Growth performance was tested on various copper-containing media. B. bassiana proved highly resistant to copper, tolerating concentrations of up to 20 g L-1, and precipitating copper oxalates on all media tested. Chromatographic analyses showed that this species produced oxalic acid a...

  7. Laboratory evaluation of Beauveria bassiana and Metarhizium anisopliae in the control of Haemaphysalis qinghaiensis in China.

    Science.gov (United States)

    Ren, Qiaoyun; Chen, Ze; Luo, Jin; Liu, Guangyuan; Guan, Guiquan; Liu, Zhijie; Liu, Aihong; Li, Youquan; Niu, Qingli; Liu, Junlong; Yang, Jifei; Han, Xueqing; Yin, Hong; Luo, Jianxun

    2016-06-01

    Haemaphysalis qinghaiensis, a prevalent tick species in China, is an ectoparasite that preferentially infests small ruminants and can transmit Theileria sp. and Babesia sp. In this study, we evaluated the pathogenicity of individual and mixed infections of the fungi Beauveria bassiana and Metarhizium anisopliae to H. qinghaiensis nymphs. The estimated LC50 for ticks immersed in solutions of B. bassiana, M. anisopliae and a mixture thereof were: 5.88056 × 10(4), 2.65 × 10(4), and 2.85 × 10(4) conidia mL(-1) respectively, and the nymphal mortality ranged from 52 to 100 %. Thus, these results suggest a potential approach for the biocontrol of H. qinghaiensis. PMID:27071674

  8. PATOGENICIDADE DE BEAUVERIA BASSIANA (BALS.) VUILL. AO ÁCARO Tetranychus urticae KOCH

    OpenAIRE

    Tamai Marco Antonio; Alves Sérgio Batista; Neves Pedro Janeiro

    1999-01-01

    O estudo da patogenicidade de Beauveria bassiana (Bals.) Vuill. ao ácaro Tetranychus urticae Koch foi desenvolvido a 25 ± 2°C, 70 ± 5% UR e 12 horas de fotofase, utilizando-se fêmeas recém-emergidas. Os ácaros foram mantidos durante seis dias em discos de folha de Canavalia ensiformis (L.) DC. inoculadas com B. bassiana, isolado 447, nas concentrações: 5x106, 1x107, 5x107, 1x108, 5x108 e 1x109 conídios/ml. Este isolado mostrou-se patogênico a T. urticae, apresentando aumento nos valores das m...

  9. THE EFFECT OF SELECTED PESTICIDES ON THE GROWTH OF ENTOMOPATHOGENIC FUNGI HIRSUTELLA NODULOSA AND BEAUVERIA BASSIANA

    Directory of Open Access Journals (Sweden)

    Cezary Tkaczuk

    2015-06-01

    Full Text Available The effect of three pesticides used in corn protection: Targa Super 05 (chizalofop-P-ethyl, Roundup 360SL (glyphosate and Karate Zeon 050CS (lambda-cyhalothrin, on the growth of entomopathogenic fungi Hirsutella nodulosa Petch and Beauveria bassiana (Bals. Vuill. was evaluated under laboratory conditions. Fungi isolates were cultured on Sabouraud’s medium with addition of pesticides at three different concentrations. H. nodulosa was more susceptible to pesticides than B. bassiana. The most inhibitory effect on tested entomopathogenic fungi showed chizalofop-P-ethyl herbicide. Lambda-cyhalothrin at the recommended field dose showed minor toxic effect on entomopathogenic fungi, which suggests the possibility of compatible use of this insecticide with biopesticides based on the tested species.

  10. Effect of Leaf Litters and Soils on Viability of Entomopathogenic Fungi Beauveria bassiana (Bals. Vuill

    Directory of Open Access Journals (Sweden)

    LISDAR IDWAN SUDIRMAN

    2008-09-01

    Full Text Available Viability of Beauveria bassiana is extremely low due to toxic compounds in soils. This research was aimed to study the effect of four groups of media on viability of B. bassiana Bb-Pb2. The first group was leaf litters of onion, flowering white cabbage, cabbage, and chinese mustard, respectively; the second group was the soils containing decomposed residues of each plant of the first group; the third group was the mixtures of each media of both groups above (1:1, and the fourth group was natural top soil as a control. Each plastic bag filled with one kg of each medium was inoculated with ten ml of B. bassiana conidia (106/ml of concentration and incubated in open area for 8 weeks. The results showed that all leaf litters of those plants and their compost soils affected the fungal viability. The highest decreasing number of colony was found on onion’s leaf litters, soil containing of decomposed onion, and the mixtures of both media. The treated B. bassiana showed significant reducing abilities of growth, conidia production and conidia germination on PDA media, except the one of control. It is suggested that the Bb-Pb2 isolate might not be effective as bioinsecticide in the soils containing either those leaf litters or composts.

  11. Efficacy of Molasses and Beauveria bassiana (Balsamo Vuill on the Control of Cosmopolites sorditus Germar, 1824

    Directory of Open Access Journals (Sweden)

    Flávia Queiroz de Oliveira

    2010-06-01

    Full Text Available This research sought to study the compatibility between the molasses and the entomopathogenic fungi Beauveria bassiana (Balsamo Vuill on the control of Cosmopolites sorditus Germar, 1824. The study was conducted on the Site Pitiá in a banana plantation of approximately 250 m2, located in the municipality of Areia, state of Paraiba, Brazil. The results showed that the constancy of C. sorditus was significantly higher in traps consisting of molasses+fungi (P <0.01. And significantly lower in traps without yeast and molasses. The frequency of C. sorditus was classified as accidental in traps with only B. bassiana (23.44% and in traps without the addition of B. bassiana and molasses (10.71%, and being accessory in traps consisting of molasses (28.43% and in traps with molasses+fungi (37.27%. Therefore the food bait molasses along with the fungi B. bassiana, may be used in an integrated control of C. sorditus in banana plantations.

  12. Development of Metarhizium anisopliae and Beauveria bassiana formulations for control of malaria mosquito larvae

    Directory of Open Access Journals (Sweden)

    Takken Willem

    2011-02-01

    Full Text Available Abstract Background The entomopathogenic fungi Metarhizium anisopliae and Beauveria bassiana have demonstrated effectiveness against anopheline larvae in the laboratory. However, utilising these fungi for the control of anopheline larvae under field conditions, relies on development of effective means of application as well as reducing their sensitivity to UV radiation, high temperatures and the inevitable contact with water. This study was conducted to develop formulations that facilitate the application of Metarhizium anisopliae and Beauveria bassiana spores for the control of anopheline larvae, and also improve their persistence under field conditions. Methods Laboratory bioassays were conducted to test the ability of aqueous (0.1% Tween 80, dry (organic and inorganic and oil (mineral and synthetic formulations to facilitate the spread of fungal spores over the water surface and improve the efficacy of formulated spores against anopheline larvae as well as improve spore survival after application. Field bioassays were then carried out to test the efficacy of the most promising formulation under field conditions in western Kenya. Results When formulated in a synthetic oil (ShellSol T, fungal spores of both Metarhizium anisopliae and Beauveria bassiana were easy to mix and apply to the water surface. This formulation was more effective against anopheline larvae than 0.1% Tween 80, dry powders or mineral oil formulations. ShellSol T also improved the persistence of fungal spores after application to the water. Under field conditions in Kenya, the percentage pupation of An. gambiae was significantly reduced by 39 - 50% by the ShellSol T-formulated Metarhizium anisopliae and Beauveria bassiana spores as compared to the effects of the application of unformulated spores. Conclusions ShellSol T is an effective carrier for fungal spores when targeting anopheline larvae under both laboratory and field conditions. Entomopathogenic fungi formulated with

  13. Controle associado de Alphitobius diaperinuse efeito de microrganismos eficazes no desenvolvimento de Beauveria bassiana Associated control of Alphitobius diaperinus and effect of effective microorganisms in the development of Beauveria bassiana

    Directory of Open Access Journals (Sweden)

    Patricia Helena Santoro

    2008-01-01

    Full Text Available O objetivo deste trabalho foi avaliar a eficiência de Beauveria bassiana (Bb, terra diatomácea (TD e microrganismos eficazes (EM-4, associados ou não, no controle de Alphitobius diaperinus, e o efeito de EM-4 no desenvolvimento de B. bassiana. Os agentes de controle (Bb, TD e EM-4, em diferentes concentrações e combinações, foram aplicados em uma mistura de cama-de-frango e ração, em que os insetos foram acondicionados por dez dias. Avaliaram-se, in vitro: a germinação, as unidades formadoras de colônia (UFC, o crescimento vegetativo e a produtividade de conídios de Bb em contato com suspensão aquosa de EM-4 (1% não filtrada e filtrada. Os maiores índices de mortalidade foram observados nos tratamentos TD + Bb + EM-4 e TD + Bb, nas maiores concentrações. Verificou-se efeito não-aditivo sinérgico para TD + Bb nas três concentrações. Nos testes com EM-4 filtrado, não houve diferença em relação à testemunha quanto à germinação e às UFC, entretanto, o crescimento vegetativo e a produtividade de conídios foram negativamente afetados. O uso conjunto de B. bassiana e terra diatomácea, para o manejo de populações de A. diaperinus, pode reduzir o uso de produtos químicos.The objective of this work was to evaluate Beauveria bassiana (Bb, diatomaceous earth (TD and effective microorganisms (EM-4, associated or not, to Alphitobius diaperinus control, and the EM-4 effect on B. bassiana development. The control agents (Bb, TD and EM-4, in different concentrations and combinations, were applied in a mixture of litter and chicken food, where insects had been left per ten days. Conidia germination, colony-forming units (CFU, vegetative growth and the productivity of Bb conidia were evaluated when in contact with a filtered and non filtered watery EM-4 suspension (1%. The highest indices of mortality were observed in the treatments TD + Bb + EM and TD + Bb in the highest concentrations. A synergic non additive effect was

  14. Field evaluation of the efficacy of neem oil (Azadirachta indica A. Juss) and Beauveria bassiana (Bals.) Vuill. in cotton production

    NARCIS (Netherlands)

    Togbe, C.E.; Haagsma, R.; Zannou, E.; Gbehounou, G.; Déguénon, J.M.; Vodouhe, S.; Kossou, D.; Huis, van A.

    2015-01-01

    Neem oil (Azadirachta indica A. Juss) alone and combined with the entomopathogenic fungus Beauveria bassiana (Balsamo) Vuillemin (isolate Bb11) was applied to control cotton pests. The efficacy of these treatments was compared with that of synthetic insecticides applied either in a calendar-based ap

  15. Cellular Immune Reactions of the Sunn Pest, Eurygaster integriceps, to the Entomopathogenic Fungus, Beauveria bassiana and Its Secondary Metabolites

    OpenAIRE

    Zibaee, Arash; Bandani, Ali Reza; Talaei-Hassanlouei, Reza; Malagoli, Davide

    2011-01-01

    In this study, five morphological types of circulating hemocytes were recognized in the hemolymph of the adult sunn pest, Eurygaster integriceps Puton (Hemiptera: Scutelleridae), namely prohemocytes, plasmatocytes, granulocytes, adipohemocytes, and oenocytoids. The effects of the secondary metabolites of the entomopathogenic fungus Beauveria bassiana on cellular immune defenses of Eurygaster integriceps were investigated. The results showed that the fungal secondary metabolites inhibited phag...

  16. Host range findings on Beauveria bassiana and Metarhizium anisopliae (Ascomycota: Hypocreales in Argentina Espectro de hospedadores hallado en Beauveria bassiana y Metarhizium anisopliae (Ascomycota: Hypocreales en Argentina

    Directory of Open Access Journals (Sweden)

    A. V. Toledo

    2008-12-01

    Full Text Available The natural insect host range of the entomopathogenic fungi (EPF Beauveria bassiana (Bb and Metarhizium anisopliae (Ma was investigated in Argentina during the winter of 2003 through spring of 2004. Fungi- infected insect samples (153 were collected from cornfields and the surrounding uncultivated areas in different localities of Buenos Aires (7, Tucumán (2, and Corrientes (3 provinces. The rates of Bb-infected host range varied among the Coleoptera (37%, Hemiptera (27% and Dermaptera (1.3%. While the rates of Ma-infected host range varied between the Coleoptera (0.7% and Hemiptera (34%. The greater host range resulted with B. bassiana found from eight species of Coleoptera (four families, one species of Dermaptera and four species of Hemiptera (three families, than the host range of M. anisopliae found infecting one species of Coleoptera and three species of Hemiptera (two families. We obtained 75 pure fungal isolates (48 Bb-isolates and 27 to Ma-isolates, and 56 of them (33 Bb-isolates and 23 Ma-isolates were morphologically characterized.El espectro natural de hospedadores de los hongos entomopatógenos (HEP Beauveria bassiana (Bb y Metarhizium anisopliae (Ma fue investigado en Argentina desde el invierno de 2003 hasta la primavera de 2004. Las muestras de insectos con infecciones fúngicas (153 fueron recolectadas a partir de campos de maíz y las áreas no cultivadas circundantes a los mismos, en diferentes localidades de las provincias de Buenos Aires (7, Tucumán (2 y Corrientes (3. El espectro de hospedadores infectados con Bb varió entre los Coleoptera (37%, Hemiptera (27% y Dermaptera (1,3%. Mientras que el espectro de hospedadores infectados con Ma varió entre los Coleoptera (0,7% y los Hemiptera (34%. El mayor espectro lo presentó Bb, encontrado en ocho especies de Coleoptera (cuatro familias, una especie de Dermaptera y cuatro especies de Hemiptera (tres familias, mientras que Ma fue encontrado infectando una especie de

  17. Susceptibility of Tetranychus urticae Koch. (Acari: Tetranychidae to Isolates of Entomopathogenic Fungus Beauveria bassiana

    Directory of Open Access Journals (Sweden)

    Slavimira A. Draganova

    2010-01-01

    Full Text Available Bioassays with five isolates of the entomopathogenic fungus Beauveria bassiana (Bals.- Criv. Vuillemin were conducted under laboratory conditions with a goal to estimate their virulence to the two-spotted spider mite Tetranychus urticae Koch. (Acari: Tetranychidae. Common bean plants with mites were treated by spraying conidial suspensions of isolates at concentrations of 106, 107 and 108 conidia/ml. Lethal effects of the fungal isolates wereevaluated as percentages of cumulative daily mortality due to mycoses, corrected for mortality in the control variant. Virulence of the isolates was estimated based on values of the median lethal time (LT50 calculated by probit analysis for the variants treated with conidial suspensions at the concentration of 106 conidia/ml.The two-spotted spider mite was found susceptible to the examined isolates of the entomopathogenic fungus B. bassiana. Mycosis caused to T. urticae by the B. bassiana isolates 444 Bb and 445 Bb had fast lethal effect after treatment with conidial suspensions even at the concentration of 106 conidia/ml. The mean mortality values of host individuals were 83.78 ± 3.62% and 68.49 ± 4.28% on the first day, respectively, and up to 100% in both variants on the fourth day.The isolates 426 Bb, 444 Bb and 445 Bb of B. bassiana were highly virulent to two-spotted spider mites with values of the median lethal time varied within overlapped narrow confidence intervals from 0.122 to 1.084 days (average value 0.162 days, from 0.117 to 1.398 days (average value 0.146 days and from 0.106 to 1.162 days (average value 0.131 days,respectively. Significant differences regarding virulence of the three isolates at p-level < 0.05 could not been proved. The other two examined isolates were distinctly less virulent to T. urticae than these three B. bassiana isolates.

  18. Evaluation of Beauveria bassiana (Hyphomycetes) isolates as potential agents for control of Dendroctonus valens

    Institute of Scientific and Technical Information of China (English)

    Long-Wa Zhang; Yu-Jun Liu; Jian Yao; Bin Wang; Bo Huang; Zeng-Zhi Li; Mei-Zhen Fan; Jiang-Hua Sun

    2011-01-01

    The red turpentine beetle (RTB), Dendroctonus valens LeConte, as a destructive invasive pest, has become one of the most economically important forest pest in China. Effective control measures are desperately needed. Entomopathogenic fungi, such as Beauveria bassiana, have shown great potential for the management of some bark beetle species. In this study, 12 isolates of B. bassiana from bark beetle were examined for biological characteristics and virulence, to assess their potential as biocontrol agents for RTB. There were significant differences (at P = 0.05) in colony growth rate, conidial yield, conidial germination, tolerance to UV light and extracellular proteases activity among the tested B. bassiana isolates. Isolates, including Bbl801, Bbl906, Bb789 and Bb773, exhibited the best characteristics, because they have faster hyphal growth rate, higher spore production and faster spore germination, higher UV tolerance and protease (Prl) production. The results of a pathogenicity test of B. bassiana on RTB larvae showed that most isolates of B. bassiana have demonstrated high efficacy and the highest virulent isolate was Bbl801, which killed 100% of the treated insects and had a median lethal time (LT50) of 4.60 days at a concentration of 1× 107 conidia/mL. Therefore, isolate Bb 1801 has a great potential for sustainable control of RTB in the forest. The correlation between biological characteristics and virulence of the fungal isolates is discussed and the possibility of combination of entomopathogenic fungi with semiochemicals, as one of the promising strategy for RTB control, is considered.

  19. Sensitivity of Beauveria bassiana conidia to abiotic factors after successive in vitro subcultures

    Directory of Open Access Journals (Sweden)

    Janaina Zorzetti

    2014-09-01

    Full Text Available The aim of this study was to evaluate the effect of in vitro successive subcultures of Beauveria bassiana isolates in different nutritional conditions on conidia heat and UV radiation tolerance and on sensitivity to azoxystrobin fungicide. The fungus was initially inoculated in Alphitobius diaperinus (Coleoptera: Tenebrionidae adults and after its development, the conidia were cultivated in PDA (potato dextrose agar and MPE (medium to produce Beauveria spp. conidia originating the first subculture 1st (A conidia, which were successively multiplied in their media until the 20th cultivation. Conidia taken from the 20th subculture were again inoculated in the insect and after sporulation they were once more multiplied in the media, producing the 1st (B conidia. For the tests, 1st (A, 10th, 20th and 1st (B conidia from the CG 152 and Unioeste 40 isolates were used. Successive subcultures and the medium nutritional conditions interfered on the fungus physiology, and the isolates showed different behaviors. The subcultures on PDA showed higher thermotolerance to Unioeste 40 in all subcultures and to CG 152 just after inoculation in the host. B. bassiana was susceptible to UV radiation, and this characteristic was influenced by the subcultures in different media. Both isolates were more tolerant to UV radiation when subcultivated on MPE, while just for the 40 Unioeste this tolerance increased after host inoculation. The B. bassiana sensitivity to azoxystrobin fungicide was affected after successive subcultures in both medium. Conidia originated in MPE were more resistant to fungicide and the host inoculation increased this tolerance. These results show that it is possible to enhance the fungi efficiency to control pests, through the selection of a virulent isolate, and handling their nutritional conditions during cultivation and host inoculation.

  20. Selectivity of Beauveria bassiana and Metarrhizium anisopliae to Trichogramma pretiosum Riley (Hymenoptera: Trichogrammatidae)

    International Nuclear Information System (INIS)

    Trichogramma pretiosum Riley and the entomopathogenic fungi Beauveria bassiana and Metarhizium anisopliae are efficient biological control agents and are thought to be used jointly. In here, we investigated if these entomopathogens could have any side-effects on T. pretiosum. Therefore, 1 x 8 cards containing sterilized eggs of Anagasta kuehniella (Zeller) that were sprayed with 0.2 ml of B. bassiana or M. anisopliae (1.0 X 109 conidia/ml) were offered to a T. pretiosum female for 24h (30 cards/fungus = 30 replicates). Afterwards, females were isolated in glass tubes. The control group was sprayed with sterile distillated water + Tween 80 (0.01%). In addition, 60 cards with sterilized eggs of A. kuehniella were submitted to parasitism by females of T. pretiosum for 24h. Of these cards, 30 were sprayed with B. bassiana or M. anisopliae and 30 with distillated water + Tween 80 (0.01%), and observed daily until parasitoid emergence. Metarhizium anisopliae decreased parasitoid emergence and caused confirmed mortality. Therefore, field and semi-field experiments should be conducted for a final assessment of the side-effects of these entomopathogens on Trichogramma as a ways to develop a control strategy in which both can be used. (author)

  1. Seleção de isolados de Metarhizium anisopliae e Beauveria bassiana patogênicos a soldados de Atta bisphaerica e Atta sexdens rubropilosa em condições de laboratório Selection of Metarhizium anisopliae and Beauveria bassiana isolates pathogenic to Atta bisphaerica and Atta sexdens rubropilosa soldiers under laboratory conditions

    OpenAIRE

    Alzimiro Marcelo Conteiro Castilho; Marcelo Elias Fraga; Elen de Lima Aguiar-Menezes; Carlos Alberto da Rocha Rosa

    2010-01-01

    As formigas do gênero Atta são pragas importantes de diversas culturas agrícolas, pastagens e reflorestamentos. Os fungos entomopatogênicos estão entre os fatores naturais de mortalidade dessas formigas e por isso apresentam potencial para serem usados no controle biológico dessa praga. O presente trabalho teve como objetivo selecionar isolados de Metarhizium anisopliae e Beauveria bassiana patogênicos a soldados de Atta bisphaerica e Atta sexdens rubropilosa em condições de laboratório. Para...

  2. Protection of metal artefacts with the formation of metal-oxalates complexes by Beauveria bassiana.

    Directory of Open Access Journals (Sweden)

    Edith eJoseph

    2012-01-01

    Full Text Available Several fungi present high tolerance to toxic metals and some are able to transform metals into metal-oxalate complexes. In this study, the ability of Beauveria bassiana to produce copper oxalates was evaluated in vitro. Growth performance was tested on various copper-containing media. B. bassiana proved highly resistant to copper, tolerating concentrations of up to 20 g.L-1, and precipitating copper oxalates on all media tested. Chromatographic analyses showed that this species produced oxalic acid as sole metal chelator. The production of metal-oxalates can be used in the restoration and conservation of archaeological and modern metal artefacts. The production of copper-oxalates was confirmed directly using metallic pieces (both archaeological and modern. The conversion of corrosion products into copper oxalates was demonstrated as well. In order to assess whether the capability of B. bassiana to produce metal-oxalates could be applied to other metals, iron and silver were tested as well. Iron appears to be directly sequestered in the wall of the fungal hyphae forming oxalates and probably goethite. However, the formation of a homogeneous layer on the object is not yet optimal. Silver nitrate was extracellularly reduced into nanoparticles of elemental silver by an unknown mechanism. The production of copper oxalates is immediately applicable for the conservation of copper-based artefacts. For iron and silver this is not yet the case. However, the vast ability of B. bassiana to transform toxic metals using different immobilization mechanisms seems to offer considerable possibilities for industrial applications, such as the bioremediation of contaminated soils or the green synthesis of chemicals.

  3. Relationship between Biological Characteristics of Beauveria bassiana (Bals.) Vuill and Pathogenicity to Bombyx mori L.%Relationship between Biological Characteristics of Beauveria bassiana (Bals.) Vuill and Pathogenicity to Bombyx mori L.

    Institute of Scientific and Technical Information of China (English)

    Haiyu LUO; Yecheng DENG; Yongmei LIAO; Ruiyu LI

    2012-01-01

    [Objective] This study was to investigate the relationship between biological characteristics of Beauveria bassiana (Bals.) Vuill and pathogenicity to Bombyx rnori L, with the aim to provide scientific basis for the control of white muscardine in Bombyx mori L. [Method] The strains isolated and purified from the 6 Beauveria bassiana biocontrol agents from all over the country and the 3 white muscardine silkworms collected from Guangxi provincial silkworm rearing areas were identified by the morphological observation and molecular biology technology. The pathogenicity of B. bassaina to silkworms was determined, and the biological characteristics such as growth diameter, sporulation and the extracellular protease activity of the different B. bassiana strains were compared. [Result] The isolated 9 strains were all B. bassaina (Bals.) Vuillemin, and all strains had high pathogenicity to silkworm, but with different pathogenicities. The growth diameter, sporulation and extracellular protease activity of different B. bassiana strains were also different, and showed correlation with the patheogenicity to silkworms. [Conclusion] B. bassiana spores production amount and exocellular protease activity had significant positive correlation with their pathogenicity to silkworm.

  4. Field evaluation of the synergistic effects of neem oil with Beauveria bassiana (Hypocreales: Clavicipitaceae) and Bacillus thuringiensis var. kurstaki (Bacillales: Bacillaceae)

    NARCIS (Netherlands)

    Togbe, C.E.; Zannou, E.; Gbehounou, G.; Kossou, D.; Huis, van A.

    2014-01-01

    In the present study, the synergistic effects of Beauveria bassiana (Bals.-Criv. Vuill.) (isolate Bb11) and Bacillus thuringiensis var. kurstaki (Berliner) with neem oil were evaluated in three agroecological zones in Be´nin. Four bioinsecticide treatments (neem oil, neem oil and B. bassiana used se

  5. Evaluation of the efficacy of beauveria bassiana for the control of the invasive fruit fly bactrocera invadens (Diptera: Tephritidae)

    International Nuclear Information System (INIS)

    Mango production plays an important role in Africa’s economy. However, the African invader fly, Bactrocera invadens is causing high yield losses as an important quarantine pest. Suppression of fruit flies for increased mango production will increasingly rely on management methods which exert low negative environmental impact. Beauveria bassiana is an insect pathogenic fungus used as microbial insecticide because it leaves produce to their fresh state, flavor, colour and texture with no change in the chemical composition of the product and is environmentally friendly. Evaluation of the efficacy of Beauveria bassiana for the control of the invasive Fruit Fly, Bactrocera invadens (Diptera: Tephriitidae) was carried out. The fungus B. bassiana (Botanigard® ES) containing 11.3% Beauveria bassiana GHA strain was applied at concentrations of 106, 53.0, 26.5, 13.3 and 6.65(x 106 spores/ml). When three developmental stages of the fruit fly (larvae, puparia and adults) were treated with Beauveria bassiana, the severity of the damage caused by the fungus increased with increasing fungal concentration. The results show lethal time (LT50) that ranged from 2.8 to 3.6 days for a dose of 106 x 106 spores/ml. Comparing methods of fungal application in the field, the result indicated that applying the fungus in fruit fly traps in mango canopies is the better method for fruit flies control in the field as compared to the soil surface spray method. However, both methods could be employed for better results The study of gamma radiation on the virulence of the fungus showed that the combined effect of the fungus and gamma irradiation gave better result by increasing adult mortality to 100 % within three days at 106 x106 spores/ml irradiated at 150 Gy than applying fungal treatment only. (author)

  6. Susceptibility of Agrilus planipennis (Coleoptera: Buprestidae) to Beauveria bassiana and Metarhizium anisopliae.

    Science.gov (United States)

    Liu, Houping; Bauer, Leah S

    2006-08-01

    The susceptibility of Agrilus planipennis Fairmaire (Coleoptera: Buprestidae) to selected strains of the entomopathogenic fungi Beauveria bassiana (Balsamo) Vuillemin and Metarhizium anisopliae (Metschnikoff) Sorokin was evaluated through bioassays with direct immersion or foliar exposure under laboratory conditions. Results showed that A. planipennis adults were susceptible to B. bassiana and M. anisoplae. Significant time-mortality response was found for each isolates. Isolate B. bassiana GHA killed A. planipennis adults at a faster rate compared with other isolates tested, with the lowest average time-to-death values. The LC50 values estimated under direct immersion method ranged from 1.7 x 10(5) to 1.9 x 10(7), 3.5 x 10(4) to 5.3 x 10(5), and 4.1 x 10(3) to 2.9 x 10(5) conidia/ml for B. basissiana and from 3.2 x 10(6) to 1.1 x 10(7), 4.5 x 10(3) to 4.5 x 10(5), and 1.4 x 10(2) to 1.2 x 10(5) conidia/ml for M. anisopliae at 4, 5, and 6 d after treatment, respectively. By days 5 and 6, B. bassiana GHA outperformed all other isolates tested except ARSEF 7234, followed by ARSEF 7152, 6393, and 7180. Significant concentration-mortality response was also observed for two B. bassiana GHA formulations, BotaniGard ES and Mycotrol O, and M. anisopliae F52 when insects were treated through foliar exposure. The LC50 values ranged from 114.5 to 309.6, 18.4 to 797.3, and 345.3 to 362.0 conidia/cm2 for BotaniGard, Mycotrol, and M. anisopliae F52, respectively. Based on the results of these bioassays, the efficacy of both B. bassiana GHA formulations and M. anisopliae F52 were similar against adult A. planipennis. The potential use of entomopathogenic fungi for management of A. planipennis in North America is discussed. PMID:16937660

  7. Patogenicidade do fungo entomopatogênico Beauveria bassiana sobre o percevejo Collaria scenica (Hemiptera: Miridae / Pathogenicity of entomopathogenic fungus Beauveria bassiana against the grass bug Collaria scenica (Hemiptera: Miridae

    Directory of Open Access Journals (Sweden)

    Marcos Roberto Barboza

    2011-12-01

    Full Text Available O percevejo Collaria scenica (Hemiptera: Miridae é uma praga de cereais cultivados e pastagens, e o controle microbiano é uma alternativa para manter estas populações abaixo do nível de dano econômico. O presente trabalho teve como objetivo avaliar a patogenicidade do isolado CG 460 de Beauveria bassiana sobre este percevejo. Insetos adultos foram inoculados em laboratório com cinco concentrações de conídios (1,0x105; 1,0x106; 1,0x107; 1,0x108 e 1,0x109 conídios.mL-1 e alimentados com folhas de trigo. A mortalidade total e confirmada (conidiogênese sobre os insetos mortos foram avaliadas durante seis dias consecutivos. O isolado apresentou alta capacidade infectiva sobre o mirideo, com mortalidade total variando de 40 a 90%. A mortalidade confirmada apresentou uma correlação linear positiva com a concentração de conídios. A taxa de conidiogênese nas concentrações mais baixas do inoculo foi em torno de 26%, sendo que nas concentrações maiores os valores chegaram a 70%. O tempo letal 50 para a concentração 109 foi de 4,3 dias.AbstractThe grass bug, Collaria scenica (Hemiptera: Miridae, is a pest of cereal crops and pastures, and the microbial control is an alternative to maintain the pest population below economic injury level. The present work had the objective to assess the pathogenicity isolate CG460 of Beauveria bassiana against this grass bug. Adult insects had been inoculated in laboratory with five conidia concentrations (1.0x105, 1.0x106, 1.0x107, 1.0x108, 1.0x109 conidia.mL-1, and fed with wheat leaves. Total and confirmed mortality (sporulation on the dead insects had been assessed during six consecutive days. CG460 showed high virulency on the grass bug, with the total mortality ranged from 40 to 90%. Confirmed mortality presented positive and linear correlation with the conidia concentrations. The conidiogenesis rates in the lowest concentrations of inoculum were around 26%, being that in the highest

  8. Effect of moisture content and inoculum on the growth and conidia production by Beauveria bassiana on wheat bran

    OpenAIRE

    Oscar Nuñez-Gaona; Gerardo Saucedo-Castañeda; Raquel Alatorre-Rosas; Octavio Loera

    2010-01-01

    The aim of the present work was to study the effect of moisture content and inoculum on the growth and conidia production by Beauveria bassiana on wheat bran (WB).The highest growth rate of B. bassiana 885.2 on WB media was obtained at a w=1.0, with no detected growth at a w < 0.97. Solid-state fermentation (SSF) using WB (66% moisture; a w=1.0) achieved a maximal yield of 1.18x10 10 conidia per gram of dry substrate (gds). This yield decreased one order of magnitude with higher moisture cont...

  9. Optimization of Solid-State Fermentation for Improved Conidia Production of Beauveria bassiana as a Mycoinsecticide.

    Science.gov (United States)

    Pham, Tuan Anh; Kim, Jeong Jun; Kim, Keun

    2010-06-01

    The production of conidia of entomopathogenic Beauveria bassiana by solid-state fermentation was studied for the development of a biocontrol agent against aphid Myzus persicae. The optimal conditions for conidia production on polished white rice were 40% moisture content, 25℃ culture temperature, 2-day-old seeding culture grown in 3% corn meal, 2% rice bran, 2% corn steep powder medium, initial conidia concentration of 10(7) conidia/g in the wet rice, 10% inoculum size, and use of a polyethylene bag as a container. The polyethylene bag containing inoculated rice was hand-shaken every 12 hr during fermentation. Using optimal conditions, the maximum conidia production obtained was 4.05 g conidia/100 g dry rice after 14 days of cultivation, a rate 2.83 times higher than conidia yield of pre-optimization. PMID:23956642

  10. Patogenicidade de Beauveria bassiana ao psilídeo Diaphorina citri e compatibilidade do fungo com produtos fitossanitários Beauveria bassiana pathogenicity to Diaphorina citri and compatibility of the fungus with phytosanitary products

    Directory of Open Access Journals (Sweden)

    Ana Paula Ferreira Pinto

    2012-12-01

    Full Text Available O objetivo deste trabalho foi avaliar a patogenicidade de Beauveria bassiana a ninfas de Diaphorina citri (Hemiptera: Psyllidae e verificar a compatibilidade do fungo com produtos fitossanitários e sua persistência em plantas de citros. Ninfas de D. citri foram pulverizadas com B. bassiana, nas concentrações 5x10(6, 1x10(7, 5x10(7, 1x10(8, 5x10(8 e 1x10(9 conídios mL-1, para determinação da concentração letal. Para avaliação da compatibilidade do fungo com produtos fitossanitários, extrato de nim e cinco inseticidas de quatro grupos químicos diferentes foram incorporados individualmente ao meio de cultura BDA em que o fungo foi cultivado. Avaliaram-se o crescimento vegetativo, a esporulação e a viabilidade do entomopatógeno. Plantas de citros, mantidas em casa de vegetação, foram tratadas primeiramente com os produtos fitossanitários e depois com o entomopatógeno. Avaliaram-se os tempos de exposição de 24 horas e de 7 e 14 dias. O fungo foi patogênico às ninfas de D. citri; a CL50 foi de 0,4x10(7 e a CL90 de 6,7x10(7 conidios mL-1, no décimo dia de avaliação. Em laboratório, os produtos fitosssanitários reduzem o crescimento do fungo. Em casa de vegetação, os produtos não afetam a sobrevivência do fungo nas plantas de citros.The objective of this work was to evaluate the pathogenicity of Beauveria bassiana to Diaphorina citri (Hemiptera: Psyllidae nymphs, and to check the compatibility of the fungus with phytosanitary products, and its persistence in citrus plants. Nymphs of D. citri were sprayed with B. bassiana in the concentrations 5x10(6, 1x10(7, 5x10(7, 1x10(8, 5x10(8 and 1x10(9 conidia mL-1 for lethal concentration determination. In order to evaluate the compatibility of the phytosanitary products with the fungus, neem extract and five insecticides of four different chemical groups were individually added to PDA culture medium, in which the fungus was cultivated. Vegetative growth, sporulation and viability

  11. Virulencia de Beauveria bassiana y Metarhizium anisopliae sobre picudo del nopal Metarnasius spinolae

    OpenAIRE

    Orduño Cruz, Nuvia

    2012-01-01

    El picudo del nopal (Metamasius spinolae), es uno de los principales factores limitantes de la producción comercial de nopal en Tlalnepantla Morelos. El control de plagas se basa en insecticidas y el uso de nuevas alternativas como los hongos entomopatógenos ha sido poco estudiada. Con el objeto de seleccionar aislamientos de las especies B. bassiana y M. anisopliae para el control del picudo del nopal se evaluaron seis aislamientos de B. bassiana y dos de M. anisopliae en...

  12. Biological Control of Aphid Using Fungal Culture and Culture Filtrates of Beauveria bassiana.

    Science.gov (United States)

    Kim, Jeong Jun; Jeong, Gayoung; Han, Ji Hee; Lee, Sangyeob

    2013-12-01

    Aphids are one of the most destructive pests in crop production such as pepper, cucumber, and eggplants. The importance of entomopathogenic fungi as alternative pest control agents is increasing. Conidia of entomopathogenic fungi are influenced by environmental conditions, such as temperature and relative humidity, and cause slow and fluctuating mortality. These factors have prevented wider application and use of biocontrol agents. For investigation of means of mitigation of such problems, we conducted bioassays with 47 fungal culture filtrates in order to evaluate the potential of secondary metabolites produced by entomopathogenic fungi for use in aphid control. Among 47 culture filtrates cultured potato dextrose broth, filtrate of Beauveria bassiana Bb08 showed the highest mortality (78%) against green peach aphid three days after treatments. Filtrate of Bb08 cultured in Adamek's medium showed higher toxicity as 100% to third instar nymphs of the aphid compared with seven other filtrates cultured in different broths amended with colloidal chitin or oil. The culture filtrates and fungal cultures from media amended with colloidal chitin or oil had lower control efficacies than filtrates without these additives in three different media. These results indicate that the fungal culture fluid or culture filtrate of B. bassiana Bb08 cultured in Adamek's medium has potential for development as a mycopesticide for aphid control. PMID:24493943

  13. Sterile Males of Ceratitis Capitata (Diptera: Tephritidae) as Disseminators of Beauveria Bassiana Conidia for IPM Strategies

    International Nuclear Information System (INIS)

    Full text: Sterile Mediterranean fruit fly, Ceratitis capitata (Wied.), males were evaluated as vectors to spread Beauveria bassiana (Bals) conidia to wild C. capitata populations under field conditions. The inoculated sterile males were released by air, using the chilled adult technique over 7000 ha of coffee growing in Chimaltenango, Guatemala, Central America. The impact of releases was determined using dry traps baited with a food attractant. The effects of these releases on Apis mellifera, Linnaeus (honey bee), Hypothenemus hampei, Ferrari (coffee berry borer) and the parasitic mite Varroa destructor (Oudeman) were also evaluated. Inoculated sterile males were able to transmit fungal spores to 44% of the wild C. capitata flies captured in traps, which likely were infected through intra- and intersexual interactions during leks, mating or mating attempts. There was no transmission of the fungal spores to non- target insect species such as coffee berry borer, honey bees or varroa. We conclude that sterile males of Mediterranean fruit fly inoculated with B. bassiana can act as effective vectors of conidia to wild populations, constituting a safe, environmentally friendly and selective alternative for suppressing the medfly under a Sterile Insect Technique-based IPM approach. (author)

  14. Beauveria bassiana Lipase A expressed in Komagataella (Pichia pastoris with potential for biodiesel catalysis

    Directory of Open Access Journals (Sweden)

    Ana Claudia Vici

    2015-10-01

    Full Text Available Lipases (EC 3.1.1.3 comprise a biotechnologically important group of enzymes because they are able to catalyze both hydrolysis and synthesis reactions, depending on the amount of water in the system. One of the most interesting application of lipase is in the biofuel industry for biodiesel production by oil and ethanol (or methanol transesterification. Entomopathogenic fungi, which are potential source of lipases, are still poorly explored in biotechnological processes. The present work reports the heterologous expression and biochemical characterization of a novel Beauveria bassiana lipase with potential for biodiesel production. The His-tagged B. bassiana lipase A (BbLA was produced in Komagataella pastoris in Buffered Methanol Medium (BMM induced with 1% methanol at 30 °C. Purified BbLA was activated with 0.05% Triton X-100 and presented optimum activity at pH 6.0 and 50°C. N-glycosylation of the recombinant BbLA accounts for 31.5% of its molecular weight. Circular dichroism and molecular modeling confirmed a structure composed of α-helix and β-sheet, similar to α/β hydrolases. Immobilized BbLA was able to promote transesterification reactions in fish oil, demonstrating potential for biodiesel production. BbLA was successfully produced in Komagataella pastoris and shows potential use for biodiesel production by the ethanolysis reaction.

  15. Beauveria bassiana Lipase A expressed in Komagataella (Pichia) pastoris with potential for biodiesel catalysis

    Science.gov (United States)

    Vici, Ana C.; da Cruz, Andrezza F.; Facchini, Fernanda D. A.; de Carvalho, Caio C.; Pereira, Marita G.; Fonseca-Maldonado, Raquel; Ward, Richard J.; Pessela, Benevides C.; Fernandez-Lorente, Gloria; Torres, Fernando A. G.; Jorge, João A.; Polizeli, Maria L. T. M.

    2015-01-01

    Lipases (EC 3.1.1.3) comprise a biotechnologically important group of enzymes because they are able to catalyze both hydrolysis and synthesis reactions, depending on the amount of water in the system. One of the most interesting applications of lipase is in the biofuel industry for biodiesel production by oil and ethanol (or methanol) transesterification. Entomopathogenic fungi, which are potential source of lipases, are still poorly explored in biotechnological processes. The present work reports the heterologous expression and biochemical characterization of a novel Beauveria bassiana lipase with potential for biodiesel production. The His-tagged B. bassiana lipase A (BbLA) was produced in Komagataella pastoris in buffered methanol medium (BMM) induced with 1% methanol at 30°C. Purified BbLA was activated with 0.05% Triton X-100 and presented optimum activity at pH 6.0 and 50°C. N-glycosylation of the recombinant BbLA accounts for 31.5% of its molecular weight. Circular dichroism and molecular modeling confirmed a structure composed of α-helix and β-sheet, similar to α/β hydrolases. Immobilized BbLA was able to promote transesterification reactions in fish oil, demonstrating potential for biodiesel production. BbLA was successfully produced in K. pastoris and shows potential use for biodiesel production by the ethanolysis reaction. PMID:26500628

  16. Proteins in the Cocoon of Silkworm Inhibit the Growth of Beauveria bassiana.

    Science.gov (United States)

    Guo, Xiaomeng; Dong, Zhaoming; Zhang, Yan; Li, Youshan; Liu, Huawei; Xia, Qingyou; Zhao, Ping

    2016-01-01

    Silk cocoons are composed of fiber proteins (fibroins) and adhesive glue proteins (sericins), which provide a physical barrier to protect the inside pupa. Moreover, other proteins were identified in the cocoon silk, many of which are immune related proteins. In this study, we extracted proteins from the silkworm cocoon by Tris-HCl buffer (pH7.5), and found that they had a strong inhibitory activity against fungal proteases and they had higher abundance in the outer cocoon layers than in the inner cocoon layers. Moreover, we found that extracted cocoon proteins can inhibit the germination of Beauveria bassiana spores. Consistent with the distribution of protease inhibitors, we found that proteins from the outer cocoon layers showed better inhibitory effects against B. bassiana spores than proteins from the inner layers. Liquid chromatography-tandem mass spectrometry was used to reveal the extracted components in the scaffold silk, the outermost cocoon layer. A total of 129 proteins were identified, 30 of which were annotated as protease inhibitors. Protease inhibitors accounted for 89.1% in abundance among extracted proteins. These protease inhibitors have many intramolecular disulfide bonds to maintain their stable structure, and remained active after being boiled. This study added a new understanding to the antimicrobial function of the cocoon. PMID:27032085

  17. Effect of biofertilizers and neem oil on the entomopathogenic fungi beauveria bassiana (Bals.) vuill. and metarhizium anisopliae (Metsch.) sorok.

    OpenAIRE

    Hirose Edson; Neves Pedro M. O. J.; Zequi João A. C.; Martins Luís H.; Peralta Cristiane H.; Moino Jr. Alcides

    2001-01-01

    The in vitro fungitoxic effect of three biofertilizers, E.M.-4, Multibion Ô and Supermagro used in organic agriculture and the neem oil (Azadirachta indica A. Juss) on the entomopathogenic fungi Metarhizium anisopliae and Beauveria bassiana was studied. These products were mixed in a medium where the two fungi were inoculated, and germination, vegetative growth and conidiogenesis were assessed. The biofertilizers Supermagro and E.M.- 4 showed to be less toxic for the two fungi whereas Multibi...

  18. Diversity of Fungi Associated with Atta bisphaerica (Hymenoptera: Formicidae): The Activity of Aspergillus ochraceus and Beauveria bassiana

    OpenAIRE

    Ribeiro, Myriam M. R.; Karina D. Amaral; Vanessa E. Seide; Souza, Bressane M. R.; Della Lucia, Terezinha M. C.; Maria Catarina M. Kasuya; Danival J. de Souza

    2012-01-01

    The grass-cutting ant Atta bisphaerica is one of the most serious pests in several pastures and crops in Brazil. Fungal diseases are a constant threat to these large societies composed of millions of closely related individuals. We investigated the occurrence of filamentous fungi associated with the ant A. bisphaerica in a pasture area of Viçosa, Minas Gerais State, Brazil. Several fungi species were isolated from forager ants, and two of them, known as entomopathogenic, Beauveria bassiana an...

  19. Screening of liquid media and fermentation of an endophytic Beauveria bassiana strain in a bioreactor.

    Science.gov (United States)

    Lohse, Rieke; Jakobs-Schönwandt, Desiree; Patel, Anant V

    2014-01-01

    A novel approach for biological control of insect pests could be the use of the endophytic entomopathogenic Beauveria bassiana isolate ATP-02. For the utilization of the endophyte as a commercial biocontrol agent, the fungus has to be mass-produced. B. bassiana was raised in shake flask cultures to produce high concentrations of total spores (TS), which include blastospores (BS) and submerged conidiospores (SCS). The highest concentration of 1.33×10(9) TS/mL and the highest yield of 5.32×10(10) TS/g sucrose was obtained in the TKI broth with 5% sugar beet molasses which consists of 50% sucrose as a carbon source. In spite of the lower sugar concentration (2.5%) the amount of TS could be increased up to 11-times in contrast to the cultivation with 5% sucrose. The scale-up to a 2 L stirred tank reactor was carried out at 25°C, 200-600 rpm and 1 vvm at pH 5.5. A TS yield of 5.2×10(10) TS/g sucrose corresponding to a SCS yield of 0.2×10(10) SCS/g sucrose was obtained after 216 h. With regards to the culture medium the cost of 10(12) TS amounts to 0.24 €. Plutella xylostella larvae, which were fed with oilseed rape leaves treated with spores from fermentation resulted in 77 ± 5% mortality. Moreover, spores from submerged cultivation were able to colonize oilseed rape leaves via leaf application. This is the first report of fermentation of an endophytic B. bassiana strain in a low-cost culture medium to very high yields of TS. PMID:24949278

  20. RAPD e ITS Detectan Variación Molecular en Poblaciones Chilenea de Beauveria bassiana RAPD and ITS Reveal Molecular Variation of Chilean Populations of Beauveria bassiana

    OpenAIRE

    Viviana Becerra V; Mario Paredes C.; Carmen Rojo M; Andrés France I

    2007-01-01

    Los hongos entomopatógenos son una alternativa atractiva para el control biológico de insectos plagas. En Chile, el Instituto de Investigaciones Agropecuarias (INIA), Centro Regional de Investigación Quilamapu mantiene aproximadamente 400 aislamientos de Beauveria, colectados a través del país. Esta colección ha sido parcialmente clasificada en base a su morfología y a su eficacia como controlador biológico. Sin embargo, es necesario complementar estos estudios con una caracterización a nivel...

  1. External development of the entomopathogenic fungi Beauveria bassiana and Metarhizium anisopliae in the subterranean termite Heterotermes tenuis Desenvolvimento dos fungos entomopatogênicos Beauveria bassiana E Metarhizium anisopliae no cupim subterrâneo Heterotermes tenuis

    Directory of Open Access Journals (Sweden)

    Alcides Moino Jr.

    2002-06-01

    Full Text Available The subterranean termite Heterotermes tenuis is one of the main pests of sugarcane and eucalyptus in Brazil, and the use of entomopathogenic fungi, alone or associated to chemicals, is an efficient and environmentally favorable method for its control. Studies related to the fungal development on these insects are important due to the effect of insect behavior on entomopathogens. The objective of this work was to describe the external development of Beauveria bassiana and Metarhizium anisopliae on H. tenuis using Scanning Electron Microscopy (SEM, determining the duration of the different phases of fungal infection. Two fixation techniques for preparing SEM samples were also evaluated. Worker specimens of H. tenuis were inoculated with a 1 x 10(9 conidia mL-1 suspension of the fungi and maintained at 25±1ºC and 70±10% relative humidity. Insects were collected from 0 to 144 hours after inoculation and prepared on SEM stubs for each of the two fixation techniques. The results obtained with the two techniques were compared and duration of the different phases of the infection process were estimated from SEM observations and compared for three fungal isolates. B. bassiana and M. anisopliae have similar development cycles on the termite, but some important differences exist. The penetration, colonization and conidiogenesis phases are relatively faster for M. anisopliae than for B. bassiana, which results in a faster rate of insect mortality. The fixation technique with OsO4 vapor is suitable for preparation of insects to be used in SEM observation of the developmental stages of entomopathogenic fungi.O cupim subterrâneo Heterotermes tenuis , uma das principais pragas da cana-de-açúcar e eucalipto no Brasil, e o uso de fungos entomopatogênicos, isoladamente ou associados a produtos químicos, é um método eficiente e ambientalmente seguro para seu controle. Estudos relacionados ao desenvolvimento fúngico nestes insetos são importantes devido

  2. Genetic analyses place most Spanish isolates of Beauveria bassiana in a molecular group with word-wide distribution

    Directory of Open Access Journals (Sweden)

    Quesada-Moraga Enrique

    2011-04-01

    Full Text Available Abstract Background The entomopathogenic anamorphic fungus Beauveria bassiana is currently used as a biocontrol agent (BCA of insects. Fifty-seven Beauveria bassiana isolates -53 from Spain- were characterized, integrating group I intron insertion patterns at the 3'-end of the nuclear large subunit ribosomal gene (LSU rDNA and elongation factor 1-alpha (EF1-α phylogenetic information, in order to assess the genetic structure and diversity of this Spanish collection of B. bassiana. Results Group I intron genotype analysis was based on the four highly conserved insertion sites of the LSU (Ec2653, Ec2449, Ec2066, Ec1921. Of the 16 possible combinations/genotypes, only four were detected, two of which were predominant, containing 44 and 9 members out of 57 isolates, respectively. Interestingly, the members of the latter two genotypes showed unique differences in their growth temperatures. In follow, EF1-α phylogeny served to classify most of the strains in the B. bassiana s.s. (sensu stricto group and separate them into 5 molecular subgroups, all of which contained a group I intron belonging to the IC1 subtype at the Ec1921 position. A number of parameters such as thermal growth or origin (host, geographic location and climatic conditions were also examined but in general no association could be found. Conclusion Most Spanish B. bassiana isolates (77.2% are grouped into a major phylogenetic subgroup with word-wide distribution. However, high phylogenetic diversity was also detected among Spanish isolates from close geographic zones with low climatic variation. In general, no correlation was observed between the molecular distribution and geographic origin or climatic characteristics where the Spanish B. bassiana isolates were sampled.

  3. Improving Efficacy of Beauveria bassiana against Stored Grain Beetles with a Synergistic Co-Formulant.

    Science.gov (United States)

    Storm, Clare; Scoates, Freya; Nunn, Adam; Potin, Olivier; Dillon, Aoife

    2016-01-01

    The potential of a dry powder co-formulant, kaolin, to improve the control of storage beetles by the entomopathogenic fungus Beauveria bassiana, isolate IMI389521, was investigated. The response of Oryzaephilus surinamensis adults to the fungus when applied to wheat at 1 × 10(10) conidia per kg with and without kaolin at 1.74 g per kg wheat was assessed. Addition of kaolin increased control from 46% to 88% at day 7 and from 81% to 99% at day 14 post-treatment. Following this the dose response of O. surinamensis and Tribolium confusum to both kaolin and the fungus was investigated. Synergistic effects were evident against O. surinamensis at ≥0.96 g of kaolin per kg of wheat when combined with the fungus at all concentrations tested. For T. confusum, adult mortality did not exceed 55%, however, the larvae were extremely susceptible with almost complete suppression of adult emergence at the lowest fungal rate tested even without the addition of kaolin. Finally, the dose response of Sitophilus granarius to the fungus at 15 and 25 °C, with and without kaolin at 1 g per kg of wheat, was examined. Improvements in efficacy were achieved by including kaolin at every fungal rate tested and by increasing the temperature. Kaolin by itself was not effective, only when combined with the fungus was an effect observed, indicating that kaolin was having a synergistic effect on the fungus. PMID:27571107

  4. Natural Occurrence of Beauveria bassiana (Balsamo Vuillemin (Hyphomycetes: Moniliales on Anticarsia gemmatalis Hübner (Lepidoptera: Noctuidae in the State of Mato Grosso do Sul

    Directory of Open Access Journals (Sweden)

    Camila Rossoni

    2013-07-01

    Resumo. Relata-se a ocorrência natural de um fungo entomopatogênico sobre a lagarta Anticarsia gemmatalis Hübner (Lepidoptera: Noctuidae em uma área de soja convencional situada no município de Dourados, Mato Grosso do Sul. A lagarta foi coletada a campo e levada ao laboratório de microbiologia da Universidade Federal da Grande Dourados (UFGD, onde permaneceu em câmera úmida por aproximadamente 7 dias. Posteriormente, o fungo foi isolado em meio de cultura (BDA para identificação da espécie do entomopatógeno. O fungo foi identificado como Beauveria bassiana (Balsamo Vuillemin (Hyphomycetes: Moniliales e, isso representa o primeiro registro de parasitismo, dessa espécie, sobre a lagarta-da-soja no Estado de Mato Grosso do Sul.

  5. Susceptibility of the Parasitoid Phymastichus coffea LaSalle (Hymenoptera: Eulophidae) to Beauveria bassiana under laboratory conditions; Susceptibilidad del parasitoide Phymastichus coffea LaSalle (Hymenoptera:Eulophidae) a Beauveria bassiana en condiciones de laboratorio

    Energy Technology Data Exchange (ETDEWEB)

    Castillo, Alfredo; Gomez, Jaime; Infante, Francisco [El Colegio de la Frontera Sur (ECOSUR), Chiapas (Mexico). Dept. de Entomologia Tropical], e-mail: acastill@ecosur.mx, e-mail: jgomez@ecosur.mx, e-mail: finfante@ecosur.mx; Vega, Fernando E. [United States Department of Agriculture (USDA), Beltsville, MD (United States). Agricultural Research Service. Sustainable Perennial Crops Lab.], e-mail: fernando.vega@ars.usda.gov

    2009-09-15

    The coffee berry borer, Hypothenemus hampei (Ferrari) (Coleoptera: Curculionidae), is the most important coffee pest worldwide. Beauveria bassiana is a generalist entomopathogenic fungus widely used by coffee farmers to control this pest and Phymastichus coffea LaSalle (Hymenoptera: Eulophidae) is an African endo parasitoid of H. hampei adults, recently imported to several Latin American and Caribbean countries to aid in the coffee berry borer control. The objective of this study was to determine if B. bassiana is detrimental to P. coffea. The susceptibility of the parasitoid was evaluated in terms of adult survivorship, mean lethal concentration (LC{sub 50}), mean lethal time (LT{sub 50}), reproduction and immature mortality. The main effect of the fungus resulted in reduction of adult longevity and mortality of 100% for immature stages of this parasitoid. The LC{sub 50} for adults was 0.11% equivalent to 9.53 x 10{sup 7} conidia/ml of B. bassiana and a LT{sub 50} of 29.4 h, equivalent to reduction of 22% of its normal longevity as an adult. P. coffea was capable of disseminating spores of B. bassiana to non-infected H. hampei adults, which could indirectly cause the death of its own progeny. These results could be valuable when considering the use of both organisms in the field, especially in an integrated pest management program. (author)

  6. Effect of Biofertilizers and Neem Oil on the Entomopathogenic Fungi Beauveria bassiana (Bals. Vuill. and Metarhizium anisopliae (Metsch. Sorok

    Directory of Open Access Journals (Sweden)

    Hirose Edson

    2001-01-01

    Full Text Available The in vitro fungitoxic effect of three biofertilizers, E.M.-4, Multibion Ô and Supermagro used in organic agriculture and the neem oil (Azadirachta indica A. Juss on the entomopathogenic fungi Metarhizium anisopliae and Beauveria bassiana was studied. These products were mixed in a medium where the two fungi were inoculated, and germination, vegetative growth and conidiogenesis were assessed. The biofertilizers Supermagro and E.M.- 4 showed to be less toxic for the two fungi whereas MultibionÔ caused major inhibition on M. anisopliae, with reductions in germination (-37.74%, colony diameter (-30.26% and conidiogenesis (-42.62%. Neem oil promoted a larger negative effect on B. bassiana, inhibiting germination (-45.27%, colony diameter (-36.62% and conidiogenesis (-84.93%.

  7. Susceptibility of the Parasitoid Phymastichus coffea LaSalle (Hymenoptera: Eulophidae) to Beauveria bassiana under laboratory conditions

    International Nuclear Information System (INIS)

    The coffee berry borer, Hypothenemus hampei (Ferrari) (Coleoptera: Curculionidae), is the most important coffee pest worldwide. Beauveria bassiana is a generalist entomopathogenic fungus widely used by coffee farmers to control this pest and Phymastichus coffea LaSalle (Hymenoptera: Eulophidae) is an African endo parasitoid of H. hampei adults, recently imported to several Latin American and Caribbean countries to aid in the coffee berry borer control. The objective of this study was to determine if B. bassiana is detrimental to P. coffea. The susceptibility of the parasitoid was evaluated in terms of adult survivorship, mean lethal concentration (LC50), mean lethal time (LT50), reproduction and immature mortality. The main effect of the fungus resulted in reduction of adult longevity and mortality of 100% for immature stages of this parasitoid. The LC50 for adults was 0.11% equivalent to 9.53 x 107 conidia/ml of B. bassiana and a LT50 of 29.4 h, equivalent to reduction of 22% of its normal longevity as an adult. P. coffea was capable of disseminating spores of B. bassiana to non-infected H. hampei adults, which could indirectly cause the death of its own progeny. These results could be valuable when considering the use of both organisms in the field, especially in an integrated pest management program. (author)

  8. Establishment of fungal entomopathogens Beauveria bassiana and Bionectria ochroleuca (Ascomycota: Hypocreales) as endophytes on artichoke Cynara scolymus.

    Science.gov (United States)

    Guesmi-Jouini, J; Garrido-Jurado, I; López-Díaz, C; Ben Halima-Kamel, M; Quesada-Moraga, E

    2014-06-01

    Entomopathogenic fungi (EPF) are commonly found in diverse habitats and are known to cause mycoses in many different taxa of arthropods. Various unexpected roles have been recently reported for fungal entomopathogens, including their presence as fungal endophytes, plant disease antagonists, rhizosphere colonizers and plant growth promoting fungi. In Tunisia, a wide range of indigenous EPF isolates from different species, such as Beauveria bassiana and Bionectria ochroleuca, were found to occur in the soil, and to be pathogenic against the artichoke aphid Capitophorus elaeagni (Hemiptera: Aphididae). Since endophytic fungi are recently regarded as plant-defending mutualists and their presence in internal plant tissue has been discussed as an adaptive protection against insects, we were interested on elucidating the possible endophytic behavior of B. bassiana and B. ochroleuca on artichoke, Cynara scolymus, after foliar spraying tehcnique. The leaf spray inoculation method was effective in introducing the inoculated fungi into the plant tissues and showed, then, an endophytic activity on artichoke even 10 days later. According S-N-K test, there was significant differences between the two fungal treatments, B. ochroleuca (84% a) and B. bassiana (78% a), and controls (0% b). Likewise, the inoculated entomopathogenic fungi were also isolated from new leaves even though with significant differences respectively between controls (0% c), B. bassiana (56% b) and B. ochroleuca (78% a). These results reveals significant new data on the interaction of inoculated fungi with artichoke plant as ecological roles that can be exploited for the protection of plants. PMID:24681358

  9. [Susceptibility of the parasitoid Phymastichus coffea LaSalle (Hymenoptera: Eulophidae) to Beauveria bassiana under laboratory conditions].

    Science.gov (United States)

    Castillo, Alfredo; Gómez, Jaime; Infante, Francisco; Vega, Fernando E

    2009-01-01

    The coffee berry borer, Hypothenemus hampei (Ferrari) (Coleoptera: Curculionidae), is the most important coffee pest worldwide. Beauveria bassiana is a generalist entomopathogenic fungus widely used by coffee farmers to control this pest and Phymastichus coffea LaSalle (Hymenoptera: Eulophidae) is an African endoparasitoid of H. hampei adults, recently imported to several Latin American and Caribbean countries to aid in the coffee berry borer control. The objective of this study was to determine if B. bassiana is detrimental to P. coffea. The susceptibility of the parasitoid was evaluated in terms of adult survivorship, mean lethal concentration (LC50), mean lethal time (LT50), reproduction and immature mortality. The main effect of the fungus resulted in reduction of adult longevity and mortality of 100% for immature stages of this parasitoid. The LC50 for adults was 0.11% equivalent to 9.53 x 10(7) conidia/ml of B. bassiana and a LT50 of 29.4h, equivalent to reduction of 22% of its normal longevity as an adult. P. coffea was capable of disseminating spores of B. bassiana to non-infected H. hampei adults, which could indirectly cause the death of its own progeny. These results could be valuable when considering the use of both organisms in the field, especially in an integrated pest management program. PMID:19943017

  10. Potential of Metarrhizium anisopliae and Beauveria bassiana isolates and Neem oil to control the aphid Lipaphis erysimi (Kalt.) (Hemiptera: Aphididae)

    International Nuclear Information System (INIS)

    This work aimed to determine the efficiency of the entomopathogenic fungi Metarrhizium anisopliae and Beauveria bassiana to control the aphid Lipaphis erysimi (Kalt.) (Hemiptera:Aphididae) in kale Brassica oleracea var acephala D.C., as well as their compatibility with a neem oil formulation (NeemsetoR). Ten isolates of both fungi were tested and the most pathogenic ones were B. bassiana CG001 and M. anisopliae CG30 with 90% and 4.4 days, and 64% and 3.8 days of mortality and median lethal time, respectively. Bioassays with neem at concentrations of 0.5, 1.0 and 2.0% were done either by leaf discs dipping or spraying the aphids on the leaf discs. The neem spraying treatment at 2.0% provided 90% mortality. The use of B. bassiana isolate CG001 or M. anisopliae isolate CG30 with neem at 0.125, 0.25, and 0.5%, demonstrated that these isolates could have their spore viability or colony growth affected when exposed to neem concentrations higher than 0.25%. In absolute values, the isolates B. bassiana CG001 and M. anisopliae CG30 are the most virulent to L. erysimi, and could be utilized in the management of this pest. (author)

  11. Preservation of beauveria bassiana (balsam) vuillemin (moniliales: moniliaceae) pathogenicityagainst the coffee borer in different systems

    OpenAIRE

    T. Bahamón; E. Aycardi; Orozco, J; Marín, P. (Pedro); Bustillo, A.

    2011-01-01

    Este trabajo tiene como objetivo evaluar técnicas de preservación de patogenicidad en el laboratorio, que permitan almacenar por tiempos prolongados cultivos de B. bassiana de manera que se puedan utilizar en la preparación de un producto industrial sin tener que recurrir tan frecuentemente a pases sobre poblaciones de Hypothenemus hampei (Ferrari) (Coleóptera: Scolytidae) para mantener su efectividad en el control de esta plaga. Existen numerosos trabajos sobre la preservación de la viabilid...

  12. EFEITO ANTAGÔNICO DE Trichoderma sp. NO DESENVOLVIMENTO DE Beauveria bassiana (Bals. Vuill. e Metarhizium anisopliae (Metsch. Sorok ANTAGONISTIC EFFECT OF Trichoderma sp. ON THE DEVELOPMENT OF Beauveria bassiana (Bals. Vuill. AND Metarhizium anisopliae (Metsch. SOROK

    Directory of Open Access Journals (Sweden)

    Alcides Moino Jr.

    1999-01-01

    Full Text Available Este trabalho teve por objetivo avaliar o efeito de Trichoderma sp. no desenvolvimento de Beauveria bassiana e Metarhizium anisopliae. Trichoderma sp., B. bassiana (isolado 634 e M. anisopliae (isolado E-9 foram inoculados em meio BDA, com intervalos de 0, 48, 120 e 168 horas entre a inoculação de Trichoderma sp. e dos entomopatógenos. Avaliou-se o crescimento radial das colônias nos períodos de 48 e 120 horas após a inoculação de Trichoderma sp., sendo que este afetou o desenvolvimento dos entomopatógenos quando inoculado simultaneamente ou após 48 horas. B. bassiana e M. anisopliae desenvolveram-se normalmente quando inoculados 168 horas antes de Trichoderma sp.. Também foi avaliado o efeito de um extrato de Trichoderma sp. sobre os entomopatógenos, com a adição de 0,1; 0,5; 1,0 e 5,0 ml de extrato/100,0 ml de meio, onde foram inoculados os entomopatógenos. Foram medidos os diâmetros de colônias e o número de conídios produzidos por B. bassiana e M. anisopliae na presença do extrato. A concentração de 5,0 ml de extrato/100,0 ml de meio alterou o crescimento e a conidiogênese de B. bassiana. O fungo M. anisopliae foi afetado a partir da adição de 1,0 ml de extrato/100,0 ml de meio.The objective of this work was to evaluate the effect of Trichoderma sp. on the development of Beauveria bassiana and Metarhizium anisopliae. The fungus Trichoderma sp. was inoculated on PDA culture medium, 0, 48, 120 and 168 hours after inoculation of the same plates with either B. bassiana (isolate 634 or M. anisopliae (isolate E-9. The radial growth of fungal colonies was measured 48 and 120 hours after Trichoderma sp. inoculation. Trichoderma sp. affected the development of both entomopathogenic fungi when inoculated simultaneously or 48 hours later. B. bassiana and M. anisopliae had normal development when inoculated 168 hours before Trichoderma sp. The effect of a toxic extract from Trichoderma sp. on the entomopathogenic fungi was also

  13. Selection of Wetting Agent for Dried Conidia of two Beauveria bassiana Strains from Different Production Systems to Control Tarnished Plant Bugs

    Science.gov (United States)

    The hydrophilic–lipophilic balance (HLB) number was used to select surfactant, TDA (polyoxy-ethylene tridecyl ether) with a range of HLB numbers in formulation development of two Beauveria bassiana strains, NI8 and GHA produced from different systems. The results indicated that optimal HLB number of...

  14. Application of hydrophilic-lypophilic balance (HLB) number to optimize a compatible non-ionic surfactant for dried aerial conidia of Beauveria bassiana

    Science.gov (United States)

    The hydrophilic-lipophilic balance (HLB) number system was used to optimize a compatible non-ionic surfactant, TDA(polyoxyethylene tridecyl ether) in formulations for two Beauveria bassiana strains, NI8 and GHA. The optimal HLB number for TDA was determined on the basis of wetting times for conidia...

  15. Field Applications of Entomopathogenic Fungi Beauveria bassiana (Hypocreales: Clavicipitaceae) and Metarhizium anisopliae F52 (Hypocreales: Nectriaceae) for the Control of Ixodes scapularis (Acari: Ixodidae)

    Science.gov (United States)

    Two commercial formulations of Beauveria bassiana (Balsamo-Crivelli) Vuillemin were applied to residential sites in Old Lyme, Connecticut for the control of nymphs of the blacklegged tick, Ixodes scapularis in 1999 and 2000. The pyrethroid bifenthrin was applied to other homes for comparison with B....

  16. Two strains of Pseudomonas fluorscens bacteria differentially affect survivorship of waxworm (Galleria mellonella) larvae exposed to an arthropod fungal pathogen, Beauveria bassiana

    Science.gov (United States)

    Two strains of Pseudomonas fluorescens were found contaminating a biopesticide used in a previous study against Varroa destructor infestations in honey bee hives. In the aforementioned study the biopesticide, a formulation of the arthropod pathogen Beauveria bassiana, failed to have any impact on t...

  17. Integrated applications of Bacillus thuringiensis serovar. tenebrionis and Beauveria bassiana for biologically-based integrated pest management of Colorado potato beetle

    Science.gov (United States)

    Research conducted over the past decade has indicated a low level of synergism and potentially high degree of complementarity between Bacillus thuringiensis (Bt)- and Beauveria bassiana (Bb)-based biopesticides applied for management of the Colorado potato beetle, Leptinotarsa decemlineata. In view...

  18. Impact of two treatments of a formulation of Beauveria bassiana (Deuteromycota: Hyphomycetes) conidia on Varroa mites (Acari: Varroidae) and on honeybee (Hymenoptera: Apidae) colony health

    Science.gov (United States)

    Bee colonies in southern France were treated with conidia from 2 strains of Beauveria bassiana – one commercial (GHA) and the other isolated from Varroa mites in the region (Bb05002). Objectives were to evaluate treatment effect on colony weight, adult bee mass, capped brood, and on Varroa fall onto...

  19. Ação do fungo Beauveria bassiana associado a gel polimerizado de celulose no controle do carrapato Anocentor nitens em teste de campo Action of the fungus Beauveria bassiana associated with cellulose polymerized gel in the control of the tick Anocentor nitens in a field test

    Directory of Open Access Journals (Sweden)

    E.J. Souza

    2009-02-01

    Full Text Available Foram selecionados 20 equídeos naturalmente infestados por Anocentor nitens, dos quais seus pavilhões auriculares foram submetidos a quatro tratamentos distintos: gel associado a Beauveria bassiana, apenas gel, apenas B. bassiana e um grupo-controle. Procederam-se à contagem e ao registro do número total de fêmeas adultas (>3mm em cada pavilhão auricular, nos dias 0, 1, 4, 7, 11, 14, 18, 21, 25 e 28, para cálculo do percentual de controle. Foram coletadas e mantidas em laboratório 20 fêmeas pertencentes a cada tratamento, para cálculo dos períodos de pré-postura, postura, incubação e eclosão, e peso médio das posturas. No grupo tratado com o composto gel associado a B. bassiana, observou-se percentual de controle maior que 50%, entre o 4º e o 25º dia, assim como decréscimo progressivo do peso médio da postura das fêmeas coletadas no período entre o 7º e 14º dia. Para os outros tratamentos, o percentual de controle manteve-se abaixo de 20%, e o peso da postura não apresentou diferença significativa. Os percentuais de controle, assim como as reduções no peso médio da postura, sugerem que a utilização do composto gel associado a B. bassiana potencializou a virulência do entomopatógeno.Twenty horses naturally infected by Anocentor nitens were selected and their auricular pinna were submitted to four treatments: gel associated with Beauveria bassiana, gel only, B. bassiana only, and a control group. The count and the register of the total number of grown up tick females (>3mm were performed in each auricular pinna on days 0, 1, 4, 7, 11, 14, 18, 21, 25, and 28 for the calculus of percentage of control. Twenty females from each treatment were collected and maintained in laboratory, to calculate the periods of pre-oviposition, oviposition, incubation, and hatching and mean weight of oviposition. In the group treated with the gel associated to B. bassiana, it was observed a control percentage higher than 50% from the 4º

  20. Laboratory evaluation of a native strain of Beauveria bassiana for controlling Dermanyssus gallinae (De Geer, 1778) (Acari: Dermanyssidae).

    Science.gov (United States)

    Immediato, Davide; Camarda, Antonio; Iatta, Roberta; Puttilli, Maria Rita; Ramos, Rafael Antonio Nascimento; Di Paola, Giancarlo; Giangaspero, Annunziata; Otranto, Domenico; Cafarchia, Claudia

    2015-09-15

    The poultry red mite, Dermanyssus gallinae (De Geer, 1778) (Acari: Dermanyssidae) is one of the most economically important ectoparasites of laying hens worldwide. Chemical control of this mite may result in environmental and food contamination, as well as the development of drug resistance. High virulence of Beauveria bassiana sensu lato strains isolated from naturally infected hosts or from their environment has been demonstrated toward many arthropod species, including ticks. However, a limited number of studies have assessed the use of B. bassiana for the control of D. gallinae s.l. and none of them have employed native strains. This study reports the pathogenicity of a native strain of B. bassiana (CD1123) against nymphs and adults of D. gallinae. Batches of nymph and adult mites (i.e., n=720 for each stage) for treated groups (TGs) were placed on paper soaked with a 0.1% tween 80 suspension of B. bassiana (CIS, 10(5), 10(7) and 10(9) conidia/ml), whilst 240 untreated control mites for each stage (CG) were exposed only to 0.1% tween 80. The mites in TG showed a higher mortality at all stages (p<0.01) when compared to CG, depending on the time of exposure and the conidial concentration. A 100% mortality rate was recorded using a CIS of 10(9) conidia/ml 12 days post infection (DPI) in adults and 14 DPI in nymphs. B. bassiana suspension containing 10(9) conidia/ml was highly virulent towards nymph and adult stages of D. gallinae, therefore representing a possible promising natural product to be used in alternative or in combination to other acaricidal compounds currently used for controlling the red mite. PMID:26206607

  1. Evaluation of a New Entomopathogenic Strain of Beauveria bassiana and a New Field Delivery Method against Solenopsis invicta

    Science.gov (United States)

    Li, Jun; Guo, Qiang; Lin, Miaofeng; Jiang, Lu; Ye, Jingwen; Chen, Dasong; Li, Zhigang; Dai, Jianqing; Han, Shichou

    2016-01-01

    Solenopsis invicta Buren is one of the most important pests in China, and control measures are mainly based on the use of synthetic pesticides, which may be inadequate and unsustainable. Hence, there is a growing interest in developing biological control alternatives for managing S. invicta, such as the use of entomopathogenic fungi. To facilitate the commercialization of entomopathogenic fungi against S. invicta, 10 Beauveria bassiana isolates originating from different hosts were tested for virulence in laboratory bioassays, and the most pathogenic strain, ZGNKY-5, was tested in field studies using an improved pathogen delivery system. The cumulative mortality rate reached 93.40% at 1×108 mL-1 conidia after 504 h. The germination and invasion of the spores were observed under a scanning electron microscope, and several conidia adhered to the cuticle of S. invicta after 2 h. Furthermore, the germ tubes of the conidia oriented toward the cuticle after 48 h, and the mycelium colonized the entire body after 96 h. Based on the efficacy observed in the laboratory trials, further experiments were performed with ZGNKY-5 strain to evaluate its utility in an injection control technology against S. invicta in the field. We found that three dosage treatments of ZGNKY-5 strain (500 mL, 750 mL, and 1,000 mL per nest) had significant control effects. Our results show that this strain of Beauveria bassiana and our control method were effective against S. invicta in both laboratory and field settings. PMID:27341441

  2. Evaluation of kinetic parameters of chitinases produced by Beauveria bassiana (Bals. Vuill. / Avaliação de parâmetros cinéticos de quitinases produzidas por Beauveria bassiana (Bals. Vuill.

    Directory of Open Access Journals (Sweden)

    Cristiane Mita

    2008-07-01

    Full Text Available Entomopathogenic fungus Beauveria bassiana is currently used as a biocontrol agent for agricultural pests. The infection process involves extracellular enzymes such as proteases and chitinases that degrade the cuticle of the insects. The objective of this work was to evaluate kinetic parameters of pH, temperature, ionic concentration and time of reaction on chitinases activity. The fungus B. bassiana CG432 was cultivated on coffee berry borer Hypothenemus hampei (Ferrari and the conidia grown on insect were used to prepare the inoculum containing 108conídia/mL. These conidia were inoculated at 1% (v/v in culture liquid medium containing D-glucose (10g, yeast extract (5g, NaNO3 (1,58g, Na2HPO4.7H2O (1,05g, KCl (1g, MgSO4.7H2O (0,6g and KH2PO4 (0,36g per liter. The cultivation was carried at 28°C and 180rpm during 5 days. Culture fluid was obtained by filtration and centrifugation at 8.000g, and the chitinases were isolated and concentrated by ultrafiltration using 10 and 100kDa cut off membranes under nitrogen pressure. Chitinase activity was detected and quantified using N-acetylglucosamine released by hydrolysis of colloidal chitin at 40 to 60ºC, at 50, 100 and 200 mM ionic concentrations of buffers sodium acetate (pH 4.0 to 6.0; sodium phosphate (pH 6.0 to 8.0; and Glycine-NaOH (pH 8.0 to 10.0 during 60 minutes. Maximum chitinase activity was at 45ºC and pH 5.5, and was also high at pH 6.0 and pH 8.5 using 50mM buffer. The chitinase activity increased and was stable during an hour at optimum conditions of the reaction, shown the stable nature of this enzyme.Beauveria bassiana é um fungo entomopatogênico utilizado no controle biológico de insetos-praga que infestam produtos agrícolas. O mecanismo de infecção envolve a produção de enzimas extracelulares, como proteases e quitinases que degradam a cutícula dos insetos. O objetivo deste trabalho foi avaliar parâmetros cinéticos de pH, temperatura, concentração iônica e tempo de

  3. Glucose concentration alters dissolved oxygen levels in liquid cultures of Beauveria bassiana and affects formation and bioefficacy of blastospores.

    Science.gov (United States)

    Mascarin, Gabriel Moura; Jackson, Mark A; Kobori, Nilce Naomi; Behle, Robert W; Dunlap, Christopher A; Delalibera Júnior, Ítalo

    2015-08-01

    The filamentous fungus Beauveria bassiana is an economically important pathogen of numerous arthropod pests and is able to grow in submerged culture as filaments (mycelia) or as budding yeast-like blastospores. In this study, we evaluated the effect of dissolved oxygen and high glucose concentrations on blastospore production by submerged cultures of two isolates of B. bassiana, ESALQ1432 and GHA. Results showed that maintaining adequate dissolved oxygen levels coupled with high glucose concentrations enhanced blastospore yields by both isolates. High glucose concentrations increased the osmotic pressure of the media and coincided with higher dissolved oxygen levels and increased production of significantly smaller blastospores compared with blastospores produced in media with lower concentrations of glucose. The desiccation tolerance of blastospores dried to less than 2.6 % moisture was not affected by the glucose concentration of the medium but was isolate dependent. Blastospores of isolate ESALQ1432 produced in media containing 140 g glucose L(-1) showed greater virulence toward whitefly nymphs (Bemisia tabaci) as compared with blastospores produced in media containing 40 g glucose L(-1). These results suggest a synergistic effect between glucose concentration and oxygen availability on changing morphology and enhancing the yield and efficacy of blastospores of B. bassiana, thereby facilitating the development of a cost-effective production method for this blastospore-based bioinsecticide. PMID:25947245

  4. Compatibilidade de isolados de Beauveria bassiana (Ascomycetes: Clavicipitaceae com carrapaticidas químicos utilizados no controle do carrapato dos bovinos Compatibility of Beauveria bassiana (Ascomycetes: Clavicipitaceae with chemicals acaricides used in the control of cattle tick

    Directory of Open Access Journals (Sweden)

    Leila A. G. Barci

    2009-12-01

    Full Text Available O presente trabalho teve como escopo avaliar a compatibilidade dos isolados IBCB66 e IBCB21 de Beauveria bassiana com os carrapaticidas a base de Flumetrina + Coumafós, Deltametrina, Diclorvós + Cipermetrina, Diclorvós + Clorpirifós, Cipermetrina High Cis, Diclorvós + Cipermetrina High Cis, Cipermetrina e Amitraz utilizados no controle do carrapato Rhipicephalus (Boophilus microplus em nosso país. O efeito dos produtos comerciais sobre os isolados foi verificado por meio da observação do crescimento vegetativo, produção de conídios e viabilidade das estirpes do fungo B. bassiana. Com referência ao isolado IBCB66, os produtos Deltametrina, Cipermetrina High Cis e Amitraz foram classificados como compatíveis, não interferindo no desenvolvimento do entomopatógeno. O produto Cipermetrina foi classificado como tóxico e os produtos Flumetrina + Coumafós, Diclorvós + Cipermetrina, Diclorvós + Clorpirifós e Diclorvós + Cipermetrina High Cis, muito tóxicos. Em relação ao isolado IBCB21, os produtos Flumetrina + Coumafós, Diclorvós + Cipermetrina, Diclorvós + Clorpirifós, Cipermetrina High Cis, Diclorvós + Cipermetrina High Cis e Cipermetrina foram classificados como muito tóxicos e o produto Amitraz como tóxico. Entre os carrapaticidas avaliados, o produto Deltametrina foi o único que não produziu efeito tóxico sobre o entomopatógeno.The purpose of the present study was to assess compatibility between IBCB66 and IBCB21 isolates of Beauveria bassiana and acaricides: Flumethrin + Coumaphos, Deltamethrin, Dichlorvos + Cypermethrin, Dichlorvos + Chlorpyrifos, Cypermethrin High Cis, Dichlorvos + Cypermethrin High Cis, Cypermethrin and Amitraz, utilized on the control of Rhipicephalus (Boophilus microplus in our country. The effect of commercial products on the isolates was assayed according to observation of vegetative growth, conidia production, and viability of strains of B. bassiana fungus. With concerning about IBCB66

  5. Metabolic responses of Beauveria bassiana to hydrogen peroxide-induced oxidative stress using an LC-MS-based metabolomics approach.

    Science.gov (United States)

    Zhang, Chen; Wang, Wei; Lu, Ruili; Jin, Song; Chen, Yihui; Fan, Meizhen; Huang, Bo; Li, Zengzhi; Hu, Fenglin

    2016-06-01

    The entomopathogenic fungus, Beauveria bassiana, is commonly used as a biological agent for pest control. Environmental and biological factors expose the fungus to oxidative stress; as a result, B. bassiana has adopted a number of anti-oxidant mechanisms. In this study, we investigated metabolites of B. bassiana that are formed in response to oxidative stress from hydrogen peroxide (H2O2) by using a liquid chromatography mass spectrometry (LC-MS) approach. Partial least-squares discriminant analysis (PLS-DA) revealed differences between the control and the H2O2-treated groups. Hierarchical cluster analysis (HCA) showed 18 up-regulated metabolites and 25 down-regulated metabolites in the H2O2-treated fungus. Pathway analysis indicated that B. bassiana may be able to alleviate oxidative stress by enhancing lipid catabolism and glycometabolism, thus decreasing membrane polarity and preventing polar H2O2 or ROS from permeating into fungal cells and protecting cells against oxidative injury. Meanwhile, most of the unsaturated fatty acids that are derived from glycerophospholipids hydrolysis can convert into oxylipins through autoxidation, which can prevent the reactive oxygen of H2O2 from attacking important macromolecules of the fungus. Results showed also that H2O2 treatment can enhance mycotoxins production which implies that oxidative stress may be able to increase the virulence of the fungus. In comparison to the control group, citric acid and UDP-N-acetylglucosamine were down-regulated, which suggested that metabolic flux was occurring to the TCA cycle and enhancing carbohydrate metabolism. The findings from this study will contribute to the understanding of how the molecular mechanisms of fungus respond to environmental and biological stress factors as well as how the manipulation of such metabolisms may lead to selection of more effective fungal strains for pest control. PMID:27116916

  6. Could Sterile Males be Used to Vector a Microbiological Control Agent? The Case of Rhynchophorus Ferrugineus and Beauveria Bassiana

    International Nuclear Information System (INIS)

    Full text: Rhynchophorus ferrugineus (Coleoptera, Curculionidae) is the most threatening pest of palms worldwide. The potential of gamma-irradiated males to spread a pathogenic strain of the entomopathogenic fungus Beauveria bassiana (Ascomycota: Clavicipitaceae) to control this pest was studied. First, the effects of gamma irradiation (15 and 25 Gy) on the mating success and performance of adult males irradiated at age one day were studied in the laboratory. Although male longevity decreased after irradiation (118.6 vs. 244.7 days for irradiated and control males, respectively) and their testes suffered from the treatment, fecundity of mated females did not depend on the irradiation status of the male (86.8±5.5 eggs in 15 days). However, egg hatching was significantly lower in couples with irradiated males (31.4% vs. 86.5% for irradiated and control couples, respectively), and this value decreased after a second mating (6.1% vs. 85.9%). Therefore, irradiation did not affect male sexual competiveness but sperm quality. Second, a semi-field assay was carried out to evaluate infestation in young Phoenix canariensis caused by different combinations of couples with irradiated and/or B. bassiana-challenged males. The number of immature stages found in infested palms was significantly higher when females mated with untreated males and lower when mated with irradiated males (either B. bassiana-infected or not). Some females from the fungus-challenged treatments showed post-mortem hyphal growth, and this horizontal transmission proves that irradiated males could act as a vector for B. bassiana and should be considered as a new method to improve the biological control of R. ferrugineus. (author)

  7. A molecular tool for detection and tracking of a potential indigenous Beauveria bassiana strain for managing emerald ash borer populations in Canada.

    Science.gov (United States)

    Johny, Shajahan; Kyei-Poku, George

    2014-10-01

    Emerald ash borer is an invasive species from Asia. Beauveria bassiana strain L49-1AA is being tested for the control of emerald ash borer in Canada, using an autocontamination trapping system. We have developed a simplified allele discrimination polymerase chain reaction (PCR) assay to screen B. bassiana strain, L49-1AA from other Beauveria species by targeting the inter-strain genetic differences in 5' end of EF1-α gene of the genus Beauveria. A single nucleotide polymorphism (SNP) site, T→C was identified only in L49-1AA and was used to develop a simplified allele discrimination polymerase chain reaction (PCR) assay based on a modified allelic inhibition of displacement activity (AIDA) approach for distinguishing B. bassiana L49-1AA from all background Beauveria isolates. The SNP site was employed to design inner primers but with a deliberate mismatch introduced at the 3' antepenultimate from the mutation site in order to maximize specificity and detection efficiency. Amplification was specific to L49-1AA without cross-reaction with DNA from other Beauveria strains. In addition, the designed primers were also tested against environmental samples in L49-1AA released plots and observed to be highly efficient in detecting and discriminating the target strain, L49-1AA from both pure and crude DNA samples. This new method can potentially allow for more discriminatory tracking and monitoring of released L49-1AA in our autocontamination and dissemination projects for managing EAB populations. Additionally, the modified-AIDA format has potential as a tool for simultaneously identifying and differentiating closely related Beauveria species, strains/isolates as well as general classification of other pathogens or organisms. PMID:25110340

  8. Patogenicidade de Beauveria bassiana ao psilídeo Diaphorina citri e compatibilidade do fungo com produtos fitossanitários

    Directory of Open Access Journals (Sweden)

    Ana Paula Ferreira Pinto

    2012-12-01

    Full Text Available O objetivo deste trabalho foi avaliar a patogenicidade de Beauveria bassiana a ninfas de Diaphorina citri (Hemiptera: Psyllidae e verificar a compatibilidade do fungo com produtos fitossanitários e sua persistência em plantas de citros. Ninfas de D. citri foram pulverizadas com B. bassiana, nas concentrações 5x10(6, 1x10(7, 5x10(7, 1x10(8, 5x10(8 e 1x10(9 conídios mL-1, para determinação da concentração letal. Para avaliação da compatibilidade do fungo com produtos fitossanitários, extrato de nim e cinco inseticidas de quatro grupos químicos diferentes foram incorporados individualmente ao meio de cultura BDA em que o fungo foi cultivado. Avaliaram-se o crescimento vegetativo, a esporulação e a viabilidade do entomopatógeno. Plantas de citros, mantidas em casa de vegetação, foram tratadas primeiramente com os produtos fitossanitários e depois com o entomopatógeno. Avaliaram-se os tempos de exposição de 24 horas e de 7 e 14 dias. O fungo foi patogênico às ninfas de D. citri; a CL50 foi de 0,4x10(7 e a CL90 de 6,7x10(7 conidios mL-1, no décimo dia de avaliação. Em laboratório, os produtos fitosssanitários reduzem o crescimento do fungo. Em casa de vegetação, os produtos não afetam a sobrevivência do fungo nas plantas de citros.

  9. Diversity of Fungi Associated with Atta bisphaerica (Hymenoptera: Formicidae: The Activity of Aspergillus ochraceus and Beauveria bassiana

    Directory of Open Access Journals (Sweden)

    Myriam M. R. Ribeiro

    2012-01-01

    Full Text Available The grass-cutting ant Atta bisphaerica is one of the most serious pests in several pastures and crops in Brazil. Fungal diseases are a constant threat to these large societies composed of millions of closely related individuals. We investigated the occurrence of filamentous fungi associated with the ant A. bisphaerica in a pasture area of Viçosa, Minas Gerais State, Brazil. Several fungi species were isolated from forager ants, and two of them, known as entomopathogenic, Beauveria bassiana and Aspergillus ochraceus, were tested against worker ants in the laboratory. The two species were highly virulent, achieving 50 percent worker mortality within 4-5 days. It is the first time A. ochraceus, a commonly found fungal species, is reported to infect Atta species at a high prevalence. Possible uses for the fungus within biological control are discussed.

  10. Evaluating the virulence of Metarhizium anisopliae (Deuteromycotina: Hyphomycetes and Beauveria bassiana (Ascomycota: Hypocreales isolates to Arabian rhinoceros beetle, Oryctes agamemnon arabicus

    Directory of Open Access Journals (Sweden)

    M.W. Khudhair

    2015-12-01

    Full Text Available Virulence of entomopathogenic fungi Metarhizium anisopliae and Beauveria bassiana were tested against Arabian Rhinoceros Beetle, Oryctes agamemnon arabicus larvae. Four concentrations (1×105, 1×107, 1×109 and 1×1011 conidia/mL–1 of two locally isolated entomopathogenic fungi spore suspensions were used in this study via larval direct spraying. Results revealed that both isolates can cause high mortality rate reaching 100% after 29 days. However, Beauveria bassiana scored higher mortality rate in short time especially at the concentration of 1×1011 conidia/ mL–1 with lethal time (LT50 12.75 and LT90 20.00; while, Metarhizium anisopliae caused the higher percentage of malformed adults. Moreover, both isolates affected insect’s life cycle particularly in the pupal stage which was reduced remarkably by almost 50% in comparison with the control treatment.

  11. Effect of moisture content and inoculum on the growth and conidia production by Beauveria bassiana on wheat bran

    Directory of Open Access Journals (Sweden)

    Oscar Nuñez-Gaona

    2010-08-01

    Full Text Available The aim of the present work was to study the effect of moisture content and inoculum on the growth and conidia production by Beauveria bassiana on wheat bran (WB.The highest growth rate of B. bassiana 885.2 on WB media was obtained at a w=1.0, with no detected growth at a w < 0.97. Solid-state fermentation (SSF using WB (66% moisture; a w=1.0 achieved a maximal yield of 1.18x10 10 conidia per gram of dry substrate (gds. This yield decreased one order of magnitude with higher moisture contents or the addition of sugarcane bagasse (SCB as a texturiser. In SSF using WB (66% humidity,the time to obtain a yield of 1x10(10 conidia/gds, referred to as t10, could be predicted using a model considering common inoculum levels and maximal yields. For instance, t10 was 285 h with an inoculum of 1x10(6 conidia/gds; however, t10 was reduced to 232 h and 148 for inocula of 7x10(6 and 5x10(7 conidia/gds, respectively. The estimation of t10 values allowed both comparison between the cultures and prediction of harvesting times in production processes. Values for hydrophobicity were within 90 and 92%, whereas viability averages were around 70% for all the cultures

  12. Evaluation of the pathogenicity of multiple isolates of Beauveria bassiana (Hypocreales: Clavicipitaceae) on Rhynchophorus ferrugineus (Coleoptera: Dryophthoridae) for the assessment of a solid formulation under simulated field conditions

    OpenAIRE

    Ricaño, Jorge; Güerri Agulló, Berenice; Serna Sarriás, María José; Rubio Llorca, Germán; Asensio Berbegal, Leticia; Barranco, Pablo; López Llorca, Luis Vicente

    2013-01-01

    A solid state formulation of Beauveria bassiana (Balsamo) Vuillemin has been developed for biological control of the Red Palm Weevil (RPW), Rhynchophorus ferrugineus (Olivier, 1790). Two kinds of bioassays (dry conidia and dipping) using 10 isolates from several coleopterans in Mediterranean environments, identified 2 RPW derived isolates (193 and 203) as most pathogenic to RPW larvae and adults (zero survival within first 4–5 d for dry conidia, and 14 and 23 d for dipping bioassays). Isolate...

  13. An attempt to use the fungus Beauveria bassiana (Bals.) Vuill. in forest protection against the bark beetle Ips typographus (L.) in the field

    OpenAIRE

    Grodzki Wojciech; Kosibowicz Mieczysław

    2015-01-01

    In 2011–2013, trials on the use of the entomopathogenic fungus Beauveria bassiana against bark beetle (Ips typographus) populations were carried out under open field conditions in Norway spruce stands suffering from an outbreak in the Beskid Żywiecki Mts. in Poland. Modified pheromone traps were deployed to capture and thereafter release fungus-infected bark beetles to the forest environment. Infested spruce trees felled next to the traps remained unaffected by the transmission of the fungus ...

  14. Laboratory bioassay of Beauveria bassiana against Tetranychus urticae (Acari: Tetranychidae) on leaf discs and potted bean plants.

    Science.gov (United States)

    Ullah, Mohammad Shaef; Lim, Un Taek

    2015-03-01

    Use of the mycopathogen Beauveria bassiana (strain GHA), marketed as BotaniGard(®) ES, was evaluated as a plant protection strategy against the spider mite Tetranychus urticae Koch, which is considered one of the most economically important and cosmopolitan pests of many crops. Tetranychus urticae were treated with four concentrations of conidia (1 × 10(5), 1 × 10(6), 1 × 10(7), or 1 × 10(8) conidia/ml), and virulence was assessed on mites held at four relative humidity levels (35, 55, 75, and 95 ± 2 % RH) at 25 ± 1 °C. At 1 × 10(8) spores/ml, the LT50 value was 9.7 h at 95 % RH, which was significantly lower than values for other RH levels. At 1 × 10(7) spores/ml, the LT50 value was 43.8 h at 95 % RH, which was significantly different from values at 55 and 35 % RH. The efficacy of B. bassiana product was also verified on mites infesting potted bean plants with a concentration of 1 × 10(8) spores/ml. In double spray treatment where applications were made 2 × on days 5 and 10 after mite infestation, the nymphal and adult population of T. urticae were reduced to zero on days 20 and 15, respectively. With a single spray on day 5, the nymphal population was also greatly reduced, but increased rapidly after day 20. Single and double sprays with B. bassiana reduced leaf damage as measured by image analysis by 33 and 94 % compared to no treatment, respectively. These results suggest that 1 × 10(8) spores/ml was the most effective dose and that two applications, at a 5-day interval, provided control of T. urticae in our laboratory assay. PMID:25500970

  15. Potential of two entomopathogenic fungi, Beauveria bassiana and Metarhizium anisopliae (Coleoptera: Scarabaeidae), as biological control agents against the June beetle.

    Science.gov (United States)

    Erler, Fedai; Ates, A Ozgur

    2015-01-01

    The aim of this study was to evaluate the effectiveness of the entomopathogenic fungi (EPF), Beauveria bassiana (Bals.) Vuill. (Deuteromycotina: Hyphomycetes) strain PPRI 5339 [BroadBand, an emulsifiable spore concentrate (EC) formulation] and Metarhizium anisopliae (Metsch.) Sorokin (Hypocreales: Clavicipitaceae) strain F52 [Met52, both EC and granular (GR) formulations] against the larvae of Polyphylla fullo (L.) (Coleoptera: Scarabaeidae). Larvicidal bioassays were performed in foam boxes (100 by 75 by 50 cm; length by width by height), containing moist soil medium with some humus and potato tubers as food. Although the B. bassiana product (min. 4 × 10(9) conidia/ml) was applied at 100, 150, and 200 ml/100 l water; M. anisopliae strain F52 was applied at 500, 1,000, and 1,500 g/m(3) of moist soil medium for GR (9 × 10(8) cfu/g) and 75, 100, and 125 ml/100 l water for EC (5.5 × 10(9) conidia/ml) formulation. Both fungi were pathogenic to larvae of the pest; however, young larvae (1st and 2nd instars) were more susceptible to infection than older ones (3rd instar). Mortality rates of young and older larvae varied with conidial concentration of both fungi and elapsed time after application. The B. bassiana product was more effective than both of the formulations of the M. anisopliae product, causing mortalities up to 79.8 and 71.6% in young and older larvae, respectively. The highest mortality rates of young and older larvae caused by the M. anisopliae product were 74.1 and 67.6% for the GR formulation, 70.2 and 61.8% for the EC formulation, respectively. These results may suggest that both fungi have potential to be used for management of P. fullo. PMID:25881632

  16. A Distinctive Pattern of Beauveria bassiana-biotransformed Ginsenoside Products Triggers Mitochondria/FasL-mediated Apoptosis in Colon Cancer Cells.

    Science.gov (United States)

    Gum, Sang Il; Rahman, Md Khalilur; Won, Jong Soon; Cho, Min Kyung

    2016-01-01

    Ginseng is one of the most commonly used adaptogens. Transformation into the minor ginsenosides produces compounds with more effective action. Beauveria bassiana, a teleomorph of Cordyceps bassiana, is a highly efficient producer of mammalian steroids and produces large amounts of sugar-utilizing enzymes. However, the fermentation of steroid glycosides in ginseng with B. bassiana has never been studied. Thus, we evaluated the bioconversion of the major ginsenosides in white ginseng by B. bassiana. Interestingly, B. bassiana increased the total amount of protopanaxadiols and hydrolyzed Rb1 into minor ginsenosides, exhibiting high levels of Rd and Rg3, as well as moderate levels of Rb2 and Rc analyzed by high-performance liquid chromatography coupled with evaporative light-scattering detection. The β-glucosidase activity was highly increased, which led to the selective elimination of sugar moiety at the 20-C position of Rb1 to Rd, followed by Rg3. Rb2 and Rc accumulated because of the minimal activities of α-L-arabinopyranosidase and α-L-arabinofuranosidase, respectively. The fermentation product exerted dose-dependent cytotoxicity in HCT-15 cells, which are resistant to ginseng. The product, but not white ginseng, exhibited apoptotic effects via the Fas ligand and caspase 8/9. This study demonstrates for the first time that the B. bassiana-fermented metabolites have potent apoptotic activity in colon cancer cells, linking to a therapeutic use. PMID:26609787

  17. Laboratory and semi-field evaluation of Beauveria bassiana (Ascomycota: Hypocreales) against the lettuce aphid, Nasonovia ribisnigri (Hemiptera: Aphididae)

    DEFF Research Database (Denmark)

    Shrestha, Govinda; Enkegaard, Annie; Steenberg, Tove

    2015-01-01

    The lettuce aphid, Nasonovia ribisnigri (Mosley), is an economically important pest of lettuce worldwide. The entomopathogenic fungus Beauveria bassiana strain GHA has recently been reported as a potential biocontrol candidate for use against the lettuce aphid. This study provides information on...... the mortality inflicted by B. bassiana when applied against different life stages of the lettuce aphid under laboratory conditions and how fungus infection affects the aphid fecundity. In addition, temporal changes in persistence of fungus inoculum applied to foliage of young lettuce plants under semi......-field conditions was analysed. Immature life stages were generally the least susceptible to fungal infection and the susceptibility of all stages was dose-dependent, with the highest mortality occurring at the highest dose. B. bassiana significantly affected the rate of nymph production by the lettuce aphid, with...

  18. Differential metabolic responses of Beauveria bassiana cultured in pupae extracts, root exudates and its interactions with insect and plant.

    Science.gov (United States)

    Luo, Feifei; Wang, Qian; Yin, Chunlin; Ge, Yinglu; Hu, Fenglin; Huang, Bo; Zhou, Hong; Bao, Guanhu; Wang, Bin; Lu, Ruili; Li, Zengzhi

    2015-09-01

    Beauveria bassiana is a kind of world-wide entomopathogenic fungus and can also colonize plant rhizosphere. Previous researches showed differential expression of genes when entomopathogenic fungi are cultured in insect or plant materials. However, so far there is no report on metabolic alterations of B. bassiana in the environments of insect or plant. The purpose of this paper is to address this problem. Herein, we first provide the metabolomic analysis of B. bassiana cultured in insect pupae extracts (derived from Euproctis pseudoconspersa and Bombyx mori, EPP and BMP), plant root exudates (derived from asparagus and carrot, ARE and CRE), distilled water and minimal media (MM), respectively. Principal components analysis (PCA) shows that mycelia cultured in pupae extracts and root exudates are evidently separated and individually separated from MM, which indicates that fungus accommodates to insect and plant environments by different metabolic regulation mechanisms. Subsequently, orthogonal projection on latent structure-discriminant analysis (OPLS-DA) identifies differential metabolites in fungus under three environments relative to MM. Hierarchical clustering analysis (HCA) is performed to cluster compounds based on biochemical relationships, showing that sphingolipids are increased in BMP but are decreased in EPP. This observation further implies that sphingolipid metabolism may be involved in the adaptation of fungus to different hosts. In the meantime, sphingolipids are significantly decreased in root exudates but they are not decreased in distilled water, suggesting that some components of the root exudates can suppress sphingolipid to down-regulate sphingolipid metabolism. Pathway analysis finds that fatty acid metabolism is maintained at high level but non-ribosomal peptides (NRP) synthesis is unaffected in mycelia cultured in pupae extracts. In contrast, fatty acid metabolism is not changed but NRP synthesis is high in mycelia cultured in root exudates

  19. Compatibility of Beauveria bassiana with Neoseiulus barkeri for Control of Frankliniella occidentalis

    Institute of Scientific and Technical Information of China (English)

    WU Sheng-yong; GAO Yu-lin; XU Xue-nong; Mark S Goettel; LEI Zhong-ren

    2015-01-01

    The entomopathogenic fungusBeauveriabassiana (Balsamo) Vuilemin and predatory miteNeoseiulusbarkeri Hughes are effective biological control agents ofFranklinielaoccidentalis Pergande (Thysanoptera: Thripidae), one of the most important pests of ornamentals and vegetables world-wide. Combined application of both may enhance control efifciency. The functional response forN.barkeri on the ifrst instar larvae of western lfower thrips which were infected byB.bassiana for 12 and 24 h in the laboratory ((25±1)°C, (70±5)% RH, L:D=16 h:8 h) was determined. The virulence ofB.bassiana against the second instar and pupae of the thrips attacked byN.barkeri were also tested. The results showed that N.barkeri exhibited a Holing type II functional response on treated thrips. After having been treated with the fungus for 12 h and then offered to the predator, thrips were more vulnerable to be kiled byN.barkeri. The second instar larvae and pupae of the thrips which had been attacked by predatory mites were markedly more susceptible toB.bassiana infection than normal thrips; the cumulative corrected mortality ofB.bassiana of the second instar and pupae which were attacked byN.barkeri were 57 and 94%, respectively, compared to 35 and 80% in controls on the day 8. These ifndings highlight the potential use ofB.bassiana in combination withN.barkeri to controlF. occidentalis.

  20. Estimation of Median Lethal Concentration of Three Isolates of Beauveria bassiana for Control of Megacopta cribraria (Heteroptera: Plataspidae) Bioassayed on Solid Lygus spp. Diet.

    Science.gov (United States)

    Portilla, Maribel; Jones, Walker; Perera, Omaththage; Seiter, Nick; Greene, Jeremy; Luttrell, Randall

    2016-01-01

    The kudzu bug, Megacopta cribraria (F.), is an urban nuisance and significant agricultural pest. The median lethal concentrations of three strains of Beauveria bassiana (Balsamo), including the Mississippi Delta native strain (NI8) isolated from Lygus lineolaris (Palisot de Beauvois), the commercial strain BotaniGard(®) (GHA) (Victor, NY, USA), and the B. bassiana strain isolated from M. cribraria (KUDSC), were estimated on kudzu bug adults. A technique developed to evaluate B. bassiana against L. lineolaris was used. Younger adults (eight days after collection) were treated with NI8 and GHA and older adult (50 days after collection) were treated with NI8, GHA and KUDSC. Higher concentrations (n × 10⁶, n × 10⁷) of NI8 and GHA caused kudzu bug mortality two days after treatment in younger adults and similar concentrations of NI8, GHA, and KUDSC caused mortality one day after treatment in older adults. Lower concentrations (n × 10⁴, n × 10⁵) were not significantly different in mortality between strains. LS50 values of the KUDSC were significantly lower than NI8 and GHA values in older adults. This is the first available information on median lethal concentration of B. bassiana on kudzu bug adults bioassayed on artificial diet. It was determined that B. bassiana (KUDSC and NI8) are highly effective for young adults at very low doses (LC50 1.98-4.98 viable spores per mm²). PMID:27376335

  1. Anopheline and culicine mosquitoes are not repelled by surfaces treated with the entomopathogenic fungi Metarhizium anisopliae and Beauveria bassiana

    Directory of Open Access Journals (Sweden)

    Mnyone Ladslaus L

    2010-08-01

    Full Text Available Abstract Background Entomopathogenic fungi, Metarhizium anisopliae and Beauveria bassiana, are promising bio-pesticides for application against adult malaria mosquito vectors. An understanding of the behavioural responses of mosquitoes towards these fungi is necessary to guide development of fungi beyond the 'proof of concept' stage and to design suitable intervention tools. Methods Here we tested whether oil-formulations of the two fungi could be detected and avoided by adult Anopheles gambiae s.s., Anopheles arabiensis and Culex quinquefasciatus. The bioassays used a glass chamber divided into three compartments (each 250 × 250 × 250 mm: release, middle and stimulus compartments. Netting with or without fungus was fitted in front of the stimulus compartment. Mosquitoes were released and the proportion that entered the stimulus compartment was determined and compared between treatments. Treatments were untreated netting (control 1, netting with mineral oil (control 2 and fungal conidia formulated in mineral oil evaluated at three different dosages (2 × 1010, 4 × 1010 and 8 × 1010 conidia m-2. Results Neither fungal strain was repellent as the mean proportion of mosquitoes collected in the stimulus compartment did not differ between experiments with surfaces treated with and without fungus regardless of the fungal isolate and mosquito species tested. Conclusion Our results indicate that mineral-oil formulations of M. anisopliae and B. bassiana were not repellent against the mosquito species tested. Therefore, both fungi are suitable candidates for the further development of tools that aim to control host-seeking or resting mosquitoes using entomopathogenic fungi.

  2. A protocol for determination of conidial viability of the fungal entomopathogens Beauveria bassiana and Metarhizium anisopliae from commercial products.

    Science.gov (United States)

    Oliveira, Daian Guilherme Pinto; Pauli, Giuliano; Mascarin, Gabriel Moura; Delalibera, Italo

    2015-12-01

    Techniques for directly determining conidial viability have widespread use but also have limitations for quality control assessments of formulated mycoinsecticides, especially in emulsifiable oil. This study proposes a new method based on adaptations of already established protocols that use the direct viability method to make it more economical and accurate, thus enabling its use in the evaluation of formulated products. Appropriate parameters and conditions were defined using products based on Beauveria bassiana and Metarhizium anisopliae in the forms of pure conidia, fungus-colonized rice, ground fungus-colonized rice and oil dispersion. The established protocol, named ESALQ, consists of the transfer of 150 μL of a suspension containing about 0.7 and 1 × 10(6) conidia/mL onto Rodac® plates with 5 mL of potato dextrose agar culture medium + 5 mg/L of Pentabiotic® and 10 μL/L of Derosal® (Carbendazim) and subsequent counting of germinated and non-germinated conidia. For the ground fungus-colonized rice and oil dispersion formulations, prior to transferring the fungal suspension to the medium, rice should be decanted and the oil removed, respectively. This method was compared with another direct viability method and with the Colony-forming unit (CFU) and Fluorescence viability methods, comparing the accuracy obtained using the coefficient of variation (CV) of the analysis of each method. The results showed that in addition to the ease of application, the developed method has higher accuracy than the other methods (with a CV up to seven times lower than in the Standard method and up to 32 times lower than CFU). The CFU method underestimated the concentration of viable conidia in most of the tested fungal forms, and in the emulsifiable oil products, these values were 54% lower for B. bassiana and 84% lower for M. anisopliae. The adaptations and standardizations proposed in the ESALQ method showed effective improvements for routine quality assessment of

  3. Bacillus thuringiensis Cry3Aa toxin increases the susceptibility of Crioceris quatuordecimpunctata to Beauveria bassiana infection

    Science.gov (United States)

    The spotted asparagus beetle, Crioceris quatuordecimpunctata (Coleoptera: Chrysomelidae), is one of the most devastating pests of asparagus in China and elsewhere. In this study, we investigated the interaction of Bacillus thuringiensis (Bt) Cry3Aa toxin and the entomopathogenic fungus Beauveria bas...

  4. The entomopathogenic fungal endophytes Purpureocillium lilacinum (formerly Paecilomyces lilacinus and Beauveria bassiana negatively affect cotton aphid reproduction under both greenhouse and field conditions.

    Directory of Open Access Journals (Sweden)

    Diana Castillo Lopez

    Full Text Available The effects of two entomopathogenic fungal endophytes, Beauveria bassiana and Purpureocillium lilacinum (formerly Paecilomyces lilacinus, were assessed on the reproduction of cotton aphid, Aphis gossypii Glover (Homoptera:Aphididae, through in planta feeding trials. In replicate greenhouse and field trials, cotton plants (Gossypium hirsutum were inoculated as seed treatments with two concentrations of B. bassiana or P. lilacinum conidia. Positive colonization of cotton by the endophytes was confirmed through potato dextrose agar (PDA media plating and PCR analysis. Inoculation and colonization of cotton by either B. bassiana or P. lilacinum negatively affected aphid reproduction over periods of seven and 14 days in a series of greenhouse trials. Field trials were conducted in the summers of 2012 and 2013 in which cotton plants inoculated as seed treatments with B. bassiana and P. lilacinum were exposed to cotton aphids for 14 days. There was a significant overall effect of endophyte treatment on the number of cotton aphids per plant. Plants inoculated with B. bassiana had significantly lower numbers of aphids across both years. The number of aphids on plants inoculated with P. lilacinum exhibited a similar, but non-significant, reduction in numbers relative to control plants. We also tested the pathogenicity of both P. lilacinum and B. bassiana strains used in the experiments against cotton aphids in a survival experiment where 60% and 57% of treated aphids, respectively, died from infection over seven days versus 10% mortality among control insects. Our results demonstrate (i the successful establishment of P. lilacinum and B. bassiana as endophytes in cotton via seed inoculation, (ii subsequent negative effects of the presence of both target endophytes on cotton aphid reproduction using whole plant assays, and (iii that the P. lilacinum strain used is both endophytic and pathogenic to cotton aphids. Our results illustrate the potential of

  5. The effect of Mirabilis jalapa leaves biopesticide treatment on the mycelium growth of entomopathogenic fungi Beauveria bassiana inside the larvae body Crocidolomia binotalis

    Science.gov (United States)

    Pramita, Mia; Anggraeni, Tjandra

    2015-09-01

    Pest control with biological method (biopesticide and entomopathogenic fungi) is an alternative program to reduce application of chemical insecticide. Biopesticide of Mirabilis jalapa leaves has been discovered rich in secondary metabolites which has antifeedant activity that can provide physiological interference in insect larvae and the generation numbers[1]. Entomopathogenic fungi Beauveria bassiana has potential to control pest populations[2]. The growth of mycelium B. bassiana may interfere metabolism process inside the host body. Otherwise, B. bassiana produce toxins such as beauvericin that can increase mortality of pest. Combination of M. jalapa and B. bassiana reduce LT50 on C. binotalis larvae[3]. Thus, this study aims to determine influence of provision of biopesticide M. jalapa leaves on growth of mycelium entomopathogenic fungi B. bassiana inside larvae body C. binotalis and to detect the presence of beauvericin in vivo. Third instar larvae of C. binotalis were divided into a control, fungal and combination group. The combination group was given biopesticide and fungi. The concentration of biopesticide was 0.8% (w/v) and concentration of fungi spores was 107 spores/ml. Spores (vol. 5µl) done topically to larvae in interval 6 hours after treatment of biopesticide on non-pesticide cabbage leaves. Afterwards, histological observations performed at 24, 48, 72, 96 hours after treatment. The result show of emergence hyphae and mycelium growth inside lumen of larvae midgut on combination group faster than fungal group. This is thought to be caused by the influence of secondary metabolites of biopesticide M. jalapa leaves. In addition, beauviricin is detectable both of fungal and combination group. Thus, it can be concluded that treatment of biopesticide from M. jalapa leaves can accelerate on growth of mycelium entomopathogenic fungi B. bassiana inside the larvae body C. binotalis and toxic of B. bassiana such as beauvericin was detected on fungal and

  6. Synergistic interaction between the fungus Beauveria bassiana and desiccant dusts applied against poultry red mites (Dermanyssus gallinae).

    Science.gov (United States)

    Steenberg, Tove; Kilpinen, Ole

    2014-04-01

    The poultry red mite, Dermanyssus gallinae, is a major pest in egg production, feeding on laying hens. Widely used non-chemical control methods include desiccant dusts, although their persistence under field conditions is often short. Entomopathogenic fungi may also hold potential for mite control, but these fungi often take several days to kill mites. Laboratory experiments were carried out to study the efficacy of 3 types of desiccant dusts, the fungus Beauveria bassiana and combinations of the two control agents against D. gallinae. There was significant synergistic interaction between each of the desiccant dusts and the fungus, with observed levels of mite mortality significantly higher than those expected for an additive effect (up to 38 % higher). Synergistic interaction between desiccant dust and fungus was found also when different application methods were used for the fungus and at different levels of relative humidity. Although increased levels of mortality were reached due to the synergistic interaction, the speed of lethal action was not influenced by combining the two components. The persistence of the control agents applied separately or in combination did not change over a period of 4 weeks. Overall, combinations of desiccant dusts and fungus conidia seem to hold considerable promise for future non-chemical control of poultry red mites. PMID:24253584

  7. Optimization of erythritol and glycerol accumulation in conidia of Beauveria bassiana by solid-state fermentation, using response surface methodology.

    Science.gov (United States)

    Tarocco, Federico; Lecuona, Roberto E; Couto, Alicia S; Arcas, Jorge A

    2005-09-01

    Entomopathogenic fungi are widely produced for use as mycoinsecticides. Therefore, improvement of the shelf life of fungal propagules under good and adverse conditions should be a pre-requisite of their production. In order to improve conidial physiology as well as mycoinsecticide efficiency, culture conditions may be varied. The Doehlert design was used to generate response surfaces with an estimation of the parameters of the quadratic model allowing the study of three different factors at a different number of levels. This experimental design was applied to optimize water activity (aw), pH, and fermentation time for Beauveria bassiana conidial production and accumulation of polyols in solid-state fermentation. Thus, it was possible to identify the region in the experimental range in which the optimum values of these parameters were simultaneously achieved. Maximal conidia production was achieved at pH 5-6 and aw=0.999. Under these conditions, polyol accumulation was 3 mg erythritol/g conidia and 29.6 mg glycerol/g conidia. However, maximal polyol accumulation was achieved at pH 4.5 and aw 0.950; erythritol production increased 33-fold and glycerol production 4.5-fold. Under these conditions conidia production was 1,000 times lower. The possibilities of increasing the quality of the biocontrol agent without neglecting yield are discussed. PMID:15731900

  8. Pathogenicity induced by the entomopathogenic fungi Beauveria bassiana and Metarhizium anisopliae in Agrotisipsilon (Hufn.)

    International Nuclear Information System (INIS)

    Scanning electron microscopy (SEM) allowed to observe B. bassiana and M. anisopliae adhesion and penetration structure on A. ipsilon larvae treated with the Lc50 of the fungus, B. bassiana revealed adhesion and penetration structures in the infected larvae. Growth of the fungus on the infected larvae and signs of hyphal penetration of insect cuticle as well as proliferation of the cuticle were also appeared. On the other hand, the fungus, M. anisopliaeas declared by SEM showed a dense network together and caused the green spores on the insect cuticle. Also, SEM allowed observing the spores and hyphae of the fungus in the body cavity of infected larvae. Scanning electron microscopy is convenient tools to observe the mode of action of entomopathogenic fungi and to observe how they are able to colonize and infect the host.

  9. Desenvolvimento dos fungos Metarhizium anisopliae (Metschnikoff, 1879 Sorokin, 1883 E Beauveria bassiana (Balsamo Vuillemin, 1912 sobre Ctenocephalides felis felis (Bouché, 1835 Development of the fungi Metarhizium anisopliae (Metschnikoff, 1879 Sorokin, 1883 and Beauveria bassiana (Balsamo Vuillemin, 1912 on the Ctenophephalides felis felis (Bouché, 1835

    Directory of Open Access Journals (Sweden)

    Denise R. De Melo

    2007-09-01

    Full Text Available A pulga Ctenocephalides felis felis é um parasita causador dermatites alérgicas e também pode transmitir diversos agentes etiológicos aos animais domésticos e aos homens. O objetivo deste trabalho foi verificar o desenvolvimento do fungo sobre a cutícula da pulga, através da microscopia eletrônica de varredura. Os isolados fúngicos testados foram o Metarhizium anisopliae 959 e Beauveria bassiana 986, ambos na concentração 10(8 conídios/ml. Após a exposição dos isolados fúngicos no período de duas, 15, 26 e 96 horas , o material foi processado para a microscopia eletrônica de varredura. Com a obtenção das micrografias, pode-se observar que com 2 horas após exposição aos fungos, os conídios estavam aderidos por toda a cutícula, situando-se preferencialmente nas membranas intersegmentais do abdome. Com 15 horas observou-se a formação do tubo de germinação e a cabeça do apressório e após 26 horas foi possível observar as ramificações e o engrossamento das hifas sobre a cutícula das pulgas. Os resultados indicam que os fungos testados foram capazes de se desenvolver sobre a cutícula de C. f. felis.The flea Ctenocephalides felis felis is a parasite that causes allergic dermatitis and also may transmit etiologic agents to domestic animals and humans. This study investigated by scanning electron microscopy the development of entomopathogenic fungi on flea cuticle. Fleas were exposed to conidia (10(8 ml-1 of Metarhizium anisopliae (isolate 959 or Beauveria bassiana (isolate 986. Following standard protocols for electron microscopy, the specimens were prepared 2, 15, 26 and 96 h after infection. The micrography revealed that 2 h after fungus exposure, conidia attachments encompassed the entire flea cuticle, especially on abdominal intersegmental membranes. The emergence of germ tubes and appressoria formation occurred at 15 h, thickening and branching of hyphae on the flea cuticle was noted at 26 h. Therefore, both of

  10. Ação do fungo Beauveria bassiana, isolado 986, sobre o ciclo biológico do cascudinho Alphitobius diaperinus em laboratório Action of the fungus Beauveria bassiana, strain 986, over the biologic cycle of the Alphitobius diaperinus beetle in laboratory

    Directory of Open Access Journals (Sweden)

    Aleksandro Schafer da Silva

    2006-12-01

    Full Text Available O presente trabalho foi realizado para verificar a eficácia do fungo Beauveria bassiana em todas as etapas de desenvolvimento de Alphitobius diaperinus e assim saber em que fase ele é mais susceptível ao controle biológico. O fungo B. bassiana, isolado 986, foi testado em duas concentrações (3,4 X 10(6 e 3,4 X 10(8 conídios ml-1 mais um grupo controle. Foram realizadas duas leituras, uma sete e outra quatorze dias após a aplicação dos fungos. Na concentração 3,4 X 10(6, 54% dos ovos tratados estavam inférteis, ocorrendo 54% de mortalidade de larvas tratadas nos estádios I, II e III, 22,5% nos estádios IV, V e VI, 9,5% nos estádios VII e VIII e 24,5% de mortalidade das pupas. Na concentração 3,4 X 10(8, 66,8% dos ovos tratados estavam inviáveis, ocorrendo mortalidade de 56% das larvas tratadas nos estádios I, II e III, 34% nos estádios IV, V e VI, 24,5% nos estádios VII e VIII e 49,5% das pupas. Já no grupo controle, 13,3% dos ovos estavam inviáveis, ocorrendo mortalidade de 10% das larvas nos estádios I, II e III, 4% nos estádios IV, V e VI e 0% de mortalidade nos estádios VII, VIII e em pupas. Sobre o cascudinho adulto, o fungo não teve efeito nocivo em nenhum grupo analisado. Com base nesses resultados, observou-se que o fungo nas concentrações testadas apresentou efeito nocivo às fases do ciclo biológico do cascudinho, com exceção do inseto adulto.The present research was carried out to verify the Beauveria bassiana fungus efficacy in all development phases of Alphitobius diaperinus and to know in which phase it is more susceptible for biologic control. The B. bassiana, 986-isolated fungus, was tested in two different concentrations (3.4 x 10(6 and 3.4 x 10(8 conidium ml-1 and a control group. Two readings were realized, one after 7 days of fungus application and the other after 14 days. At concentration of 3.4 x 10(6 conidium ml-1, 54% of treated eggs were infertile, with larva death of 54% at I, II and III

  11. Susceptibilidade de larvas de Cerotoma arcuata Olivier (Coleoptera: Chrysomelidae a Beauveria bassiana (Bals. Vuillemin, Metarhizium anisopliae (Metsch. Sorokin e Bacillus thuringiensis Berliner Susceptibility of Cerotoma arcuata Olivier (Coleoptera: Chrysomelidae larvae to Beauveria bassiana (Bals. Vuillemin, Metarhizium anisopliae (Metsch. Sorokin and Bacillus thuringiensis Berliner

    Directory of Open Access Journals (Sweden)

    Maria Lucia França Teixeira

    2007-02-01

    Full Text Available Larvas de 2° instar de Cerotoma arcuata foram avaliadas em relação à susceptibilidade aos fungos entomopatogênicos Beauveria bassiana, Metarhizium anisopliae e a bactéria Bacillus thuringiensis com as toxinas Cry3. Os insetos adultos foram mantidos em gaiolas e alimentados com plântulas de feijão (Phaseolus vulgaris L. e as larvas em "gerbox" com cotilédones de plântulas de feijão recém-germinadas. Das oito estirpes de B. bassiana avaliadas, CG 156 e CG 213 causaram 100% de mortalidade das larvas, as duas estirpes de M. anisopliae CG 210 e CG 321 foram patogênicas, eliminando 80 e 100% das larvas de C. arcuata, e, das cinco estirpes de B. thuringiensis testadas, o isolado CG 940 causou 70% de mortalidade das larvas.Second instar larvae of Cerotoma arcuata were evaluated concerning the susceptibility to fungi Beauveria bassiana and Metarhizium anisopliae and Bacillus thuringiensis strains containing Cry3 toxin. Adults of C. arcuata were kept in large cages and fed on bean seedlings and the larvae were reared in ‘gearbox’ feeding on germinated Phaseolus bean cotyledons. Strains CG 156 and CG 213 of B. bassiana killed 100% of the insect larvae and strains CG 210 and CG 321 of M. anisopliae killed 80 and 100% of the insect larvae. Strain CG 940 of B. thuringiensis killed 70% of the insect larvae.

  12. Conidia production by Beauveria bassiana (for the biocontrol of a diamondback moth) during solid-state fermentation in a packed-bed bioreactor.

    Science.gov (United States)

    Kang, S W; Lee, S H; Yoon, C S; Kim, S W

    2005-01-01

    Conidia of Beauveria bassiana CS-1, which have the potential for the control of the diamondback moth (Plutella xylostella), were produced by solid-state fermentation (SSF) using a packed-bed bioreactor with rice straw and wheat bran. As the packing density and the bed height were increased, the production of conidia decreased. In a packed-bed bioreactor under no aeration and no addition of polypropylene (PP) foam (control), the total average of conidia was 4.9 x 10(8) g-1. The production of conidia was affected more by the addition of PP foam as an inert support than forced aeration and was approx. 23 times higher than that of the control. The total average of conidia produced by B. bassiana was 1.1-1.2 x 10(10) g-1 . PMID:15703878

  13. Seleção de isolados de Metarhizium anisopliae e Beauveria bassiana patogênicos a soldados de Atta bisphaerica e Atta sexdens rubropilosa em condições de laboratório Selection of Metarhizium anisopliae and Beauveria bassiana isolates pathogenic to Atta bisphaerica and Atta sexdens rubropilosa soldiers under laboratory conditions

    Directory of Open Access Journals (Sweden)

    Alzimiro Marcelo Conteiro Castilho

    2010-06-01

    Full Text Available As formigas do gênero Atta são pragas importantes de diversas culturas agrícolas, pastagens e reflorestamentos. Os fungos entomopatogênicos estão entre os fatores naturais de mortalidade dessas formigas e por isso apresentam potencial para serem usados no controle biológico dessa praga. O presente trabalho teve como objetivo selecionar isolados de Metarhizium anisopliae e Beauveria bassiana patogênicos a soldados de Atta bisphaerica e Atta sexdens rubropilosa em condições de laboratório. Para a avaliação da patogenicidade, foram utilizados oito isolados de M. anisopliae e seis de B. bassiana. O experimento foi conduzido em DIC, sendo a parcela composta por um grupo de 10 soldados por espécie de formiga, sendo utilizadas três repetições por tratamento. Para cada isolado, três grupos de soldados foram pulverizados com suspensão de 1,0 x 10(8 conídios ml-1 e mantidos em câmara úmida (25±1°C, 80±1% de UR e no escuro sem alimentação, sendo a mortalidade verificada diariamente. Dos 14 isolados testados, quatro de M. anisopliae e quatro de B. bassiana foram patogênicos aos soldados de ambas as espécies de formigas. A virulência foi avaliada para os isolados que causaram mortalidade igual ou maior a 50%. Para cada isolado, suspensões contendo 1,0 x 10(6 a 1,0 x 10(11 conídios ml-1 foram pulverizadas sobre três grupos de 10 soldados e igualmente acondicionados como no teste de patogenicidade. A porcentagem de mortalidade foi calculada a cada 24 horas para determinação do TL50. O isolado ENA04 de M. anisopliae foi mais patogênico, causando mais de 80% de mortalidade nos primeiros três dias após a inoculação, apresentou maior capacidade de esporular nos cadáveres dos soldados e foi o mais virulento para os soldados de A. bisphaerica, com um TL50 de 1,15 dias. Todos os isolados patogênicos aos soldados de A. sexdens rubropilosa foram igualmente virulentos.The ants of the genus Atta are important pests of several

  14. Pyrethroid resistance in Anopheles gambiae leads to increased susceptibility to the entomopathogenic fungi Metarhizium anisopliae and Beauveria bassiana

    Directory of Open Access Journals (Sweden)

    Knols Bart GJ

    2010-06-01

    Full Text Available Abstract Background Entomopathogenic fungi are being investigated as a new mosquito control tool because insecticide resistance is preventing successful mosquito control in many countries, and new methods are required that can target insecticide-resistant malaria vectors. Although laboratory studies have previously examined the effects of entomopathogenic fungi against adult mosquitoes, most application methods used cannot be readily deployed in the field. Because the fungi are biological organisms it is important to test potential field application methods that will not adversely affect them. The two objectives of this study were to investigate any differences in fungal susceptibility between an insecticide-resistant and insecticide-susceptible strain of Anopheles gambiae sensu stricto, and to test a potential field application method with respect to the viability and virulence of two fungal species Methods Pieces of white polyester netting were dipped in Metarhizium anisopliae ICIPE-30 or Beauveria bassiana IMI391510 mineral oil suspensions. These were kept at 27 ± 1°C, 80 ± 10% RH and the viability of the fungal conidia was recorded at different time points. Tube bioassays were used to infect insecticide-resistant (VKPER and insecticide-susceptible (SKK strains of An. gambiae s.s., and survival analysis was used to determine effects of mosquito strain, fungus species or time since fungal treatment of the net. Results The resistant VKPER strain was significantly more susceptible to fungal infection than the insecticide-susceptible SKK strain. Furthermore, B. bassiana was significantly more virulent than M. anisopliae for both mosquito strains, although this may be linked to the different viabilities of these fungal species. The viability of both fungal species decreased significantly one day after application onto polyester netting when compared to the viability of conidia remaining in suspension. Conclusions The insecticide

  15. The entomopathogenic fungus Beauveria bassiana reduces instantaneous blood feeding in wild multi-insecticide-resistant Culex quinquefasciatus mosquitoes in Benin, West Africa

    Directory of Open Access Journals (Sweden)

    Howard Annabel FV

    2010-09-01

    Full Text Available Abstract Background Mosquito-borne diseases are still a major health risk in many developing countries, and the emergence of multi-insecticide-resistant mosquitoes is threatening the future of vector control. Therefore, new tools that can manage resistant mosquitoes are required. Laboratory studies show that entomopathogenic fungi can kill insecticide-resistant malaria vectors but this needs to be verified in the field. Methods The present study investigated whether these fungi will be effective at infecting, killing and/or modifying the behaviour of wild multi-insecticide-resistant West African mosquitoes. The entomopathogenic fungi Metarhizium anisopliae and Beauveria bassiana were separately applied to white polyester window netting and used in combination with either a permethrin-treated or untreated bednet in an experimental hut trial. Untreated nets were used because we wanted to test the effect of fungus alone and in combination with an insecticide to examine any potential additive or synergistic effects. Results In total, 1125 female mosquitoes were collected during the hut trial, mainly Culex quinquefasciatus Say. Unfortunately, not enough wild Anopheles gambiae Giles were collected to allow the effect the fungi may have on this malaria vector to be analysed. None of the treatment combinations caused significantly increased mortality of Cx. quinquefasciatus when compared to the control hut. The only significant behaviour modification found was a reduction in blood feeding by Cx. quinquefasciatus, caused by the permethrin and B. bassiana treatments, although no additive effect was seen in the B. bassiana and permethrin combination treatment. Beauveria bassiana did not repel blood foraging mosquitoes either in the laboratory or field. Conclusions This is the first time that an entomopathogenic fungus has been shown to reduce blood feeding of wild mosquitoes. This behaviour modification indicates that B. bassiana could potentially be a new

  16. Endophytic Ability of Different Isolates of Entomopathogenic Fungi Beauveria bassiana (Balsamo) Vuillemin in Stem and Leaf Tissues of Maize (Zea mays L.).

    Science.gov (United States)

    Renuka, S; Ramanujam, B; Poornesha, B

    2016-06-01

    The present study was conducted to examine the ability of six promising indigenous isolates of Beauveria bassiana (NBAII-Bb-5a, 7, 14, 19, 23 and 45) as an endophyte in maize stem and leaf tissues. Maize seedlings (var. Nithyashree) were inoculated with conidial suspensions and were examined for endophytic establishment in leaf and stems at different intervals during 15-90 days after treatment. All six isolates showed colonization in stem and leaf tissues with varying abilities of colonization and persistence. The mean percent colonization ranged from 7.41 to 20.37 % in older stem tissues and 3.70 to 21.29 % in young stem tissues and in leaf, it ranged from 6.46 to 27.78 % in older leaf tissues and 11.11 to 26.85 % in young leaf tissues. Among six isolates tested, Bb-23 isolate recorded the maximum mean colonization in older stem (20.37 %), older leaf (27.78 %) and in young stem (21.29 %). Bb-5a isolate showed maximum mean colonization in young leaf tissues (26.85 %). Persistence of inoculated fungal isolates decreased with increase in age of the plant. No physical symptoms of damage were observed in any of the B. bassiana treated plants. No colonization of B. bassiana was observed in the untreated control maize plants. The results obtained in plating and PCR techniques were similar with regard to the confirmation of endophytic establishment of B. bassiana. This study indicated the possibility of using B. bassiana as an endophyte in maize for management of maize stem borer, Chilo partellus. PMID:27570303

  17. Conclusion on the peer review of the pesticide risk assessment of the active substances Beauveria bassiana strains ATCC-74040 and GHA

    Directory of Open Access Journals (Sweden)

    European Food Safety Authority

    2013-01-01

    Full Text Available The conclusions of the European Food Safety Authority (EFSA following the peer review of the initial risk assessments carried out by the competent authority of the rapporteur Member State Germany, for the pesticide active substances Beauveria bassiana strains ATCC-74040 and GHA are reported. The context of the peer review was that required by Commission Regulation (EC No 2229/2004, as amended by Commission Regulation (EC No 1095/2007 and Commission Regulation (EU No 114/2010. The conclusions were reached on the basis of the evaluation of the representative uses of Beauveria bassiana strains ATCC-74040 and GHA as an insecticide on tomatoes for strain ATCC-74040 and on tomatoes, cucumbers and ornamentals for strain GHA. The reliable endpoints concluded as being appropriate for use in regulatory risk assessment, derived from the available studies and literature in the dossier peer reviewed, are presented. Missing information identified as being required by the regulatory framework is listed. Concerns are identified.

  18. Effect of plant extracts and a disinfectant on biological parameters and pathogenicity of the fungus Beauveria bassiana (Bals.) Vuill. (Ascomycota: Cordycipitaceae).

    Science.gov (United States)

    Martins, C C; Alves, L F A; Mamprim, A P

    2016-06-01

    The fungus Beauveria bassiana is naturally found in poultry houses and causes high rates of mortality in Alphitobius diaperinus. Laboratory and field experiments have shown the potential of this fungus as an insect control agent. However, in poultry houses, bacteria as Salmonella, can be found and have been studied alternative control methods for this pathogen. Thus, this study aimed to evaluate the effect of plant extracts and a disinfectant on the fungus Beauveria bassiana (strain Unioeste 4). Conidial viability, colony-forming unit (CFU) counts, vegetative growth, conidia production, insecticidal activity of the fungus and compatibility were used as parameters in the evaluation of the effect of these products on the fungus. Alcoholic and aqueous extracts of jabuticaba (Myrciaria cauliflora (Mart.), guava (Psidium guajava (L.)), and jambolan (Syzygium cumini (L.), at concentrations of 10% as well as the commercial disinfectant, Peroxitane® 1512 AL, were evaluated at the recommended concentrations (RC), 1:200 (RC), 0.5 RC and 2 RC. There was a negative influence of alcoholic and aqueous extracts of jabuticaba, guava and three dilutions of Peroxitane on the viability of conidia. The CFUs and vegetative growth of the fungus were affected only by the Peroxitane (all dilutions). For conidial production, the aqueous extract of guava had a positive effect, increasing production, while the Peroxitane at the R and RC concentrations resulted in a negative influence. The mortality of A. diaperinus, caused by the fungus after exposure to these products, was 60% for the peracetic acid at 0.5 RC, and above 80% for the extracts. Thus, the results showed that all the extracts and Peroxitane at RC 0.5 are compatible with the fungus B. bassiana Unioeste 4, however only the extracts had a low impact on inoculum potential. PMID:27143049

  19. Populational parameters of Spalangia endius Walker (Hymenoptera: Pteromalidae) on Pupae of Musca domestica L. (Diptera: Muscidae) treated with two strains of Beauveria bassiana (Bals.) Vuil. (Deuteromycetes).

    Science.gov (United States)

    Lecuona, Roberto; Crespo, Diana; La Rossa, Francisco

    2007-01-01

    The parasitoid Spalangia endius Walker is an efficient controller of Dipteran pupae, such as Musca domestica L. The entomopathogenic fungus Beauveria bassiana (Bals.) Vuil. is a regulator of insect populations, including these synanthropic pests. The aim of this work was to explore the possibilities of utilizing both agents in a combined form for the biocontrol of the domestic fly. Recently formed M. domestica pupae were inoculated by immersion in conidia suspension (10(8) conidia/ml) with two strains of B. bassiana (Bb6 and Bb10). The inoculated pupae were offered to the female parasitoid. In one bioassay they were offered pupae inoculated a single day and in other, pupae inoculated the following day as well. In both bioassays non inoculated (control) pupae were offered to the parasitoids until their death. Thirty females of S. endius were used for each strain and bioassay. From the study of the parasitoid offspring, life tables were built and the reproduction net rate (R(0)) and intrinsic natural increase (r(m)) were obtained among other demographic parameters; the parasitism percentages and sex ratios were also analyzed. B. bassiana did not affect significantly the biodemography of the parasitoid when pupae were inoculated a single time. On the other hand the R0 and the rm were smaller than that of the control without the fungus when pupae were inoculated twice, although sporulation was not observed in the cadavers of S. endius. PMID:17934618

  20. Field applications of entomopathogenic fungi Beauveria bassiana and Metarhizium anisopliae F52 (Hypocreales: Clavicipitaceae) for the control of Ixodes scapularis (Acari: Ixodidae).

    Science.gov (United States)

    Stafford, Kirby C; Allan, Sandra A

    2010-11-01

    Two commercial formulations of Beauveria bassiana (Balsamo-Crivelli) Vuillemin were applied to residential sites in Old Lyme, CT, for the control of nymphs of the blacklegged tick, Ixodes scapularis, in 1999 and 2000. The pyrethroid bifenthrin was applied to other premises for comparison with B. bassiana. A wood chip barrier was installed and maintained at six of the treated properties. In 1999, control of I. scapularis nymphs ranged from 74.5 to 83.0% on lawns without wood chips and from 88.9 to 90% on lawns with wood chip barriers. As a control check, no ticks (n = 23) collected at pretreatment or control sites died from B. bassiana, although 15 of 18 nymphs from treated lawns developed mycoses. Control of I. scapularis on the lawns in 2000 with the two B. bassiana products was lower, as follows: 38.0 and 58.7% without the barrier and 56.9 and 55.1% with the wood chip barrier. Posttreatment differences in nymphal numbers between treatments and control were significant (P = 0.005 and P = 0.039, 1999 and 2000, respectively). The bifenthrin provided 86 and 87% control each year, respectively. The application of Metarhizium anisopliae (Metschnikoff) Sorokin strain F52 to 9 residential sites in Westport and Weston, CT, in 2002 provided significant (P = 0.034; P = 0.039) reductions in nymphal tick abundance with 55.6 and 84.6% fewer ticks on lawn and woodland plots, respectively. These results suggest the application of entomopathogenic fungi could provide another approach for the control of I. scapularis nymphs in residential or similar landscapes. PMID:21175060

  1. [Interaction of Metarhizium anisopliae (Metsch.) Sorok., Beauveria bassiana (Bals.) Vuill. and the parasitoid Oomyzus sokolowskii (Kurdjumov) (Hymenoptera: Eulophidae) with larvae of diamondback moth, Plutella xylostella (L.) (Lepidoptera: Plutellidae)].

    Science.gov (United States)

    dos Santos, Hugo J G; Marques, Edmilson J; Barros, Reginaldo; Gondim, Manoel G C

    2006-01-01

    Chemical insecticides are broadly applied to control diamondback moth, Plutella xylostella (L.). Diamondback moth is a major pest of cruciferous worldwide, and resistance of this pest to insecticide has been often reported. Thus, this research investigated the interactions among the fungi Metarhizium anisopliae (Metsch.) Sorok., Beauveria bassiana (Bals.) Vuill., and the larval-pupal parasitoid Oomyzus sokolowskii (Kurdjumov) before and after application of the fungi on DBM larvae offered to the parasitoid. The experiment was carried out at 26+/-l degreeC, 75+/- 5% RH and 12h photophase using a completely randomized design, with eight treatments with six replications each. The isolates E9 of M. anisopliae and ESALQ 447 of B. bassiana, were used at the concentration of 10(7) conidia ml(-1). The results showed that M. anisopliae and B. bassiana reduced the parasitism of P. xylostella by O. sokolowskii. Additive effects were found on the mortality of P. xylostella with the different combinations among the fungi and parasitoid, except for the treatment B. bassiana inoculated 24h before exposition of the larvae to O. sokolowskii. The isolates were more efficacious when applied after exposition of the larvae to the parasitoid. The efficiency of O. sokolowskii was negatively influenced by the presence of the fungi, mainly when the fungi were applied 24h before diamondback's larvae were exposed to the parasitoid. The association of the fungi with the parasitoid presents potential to be tested in field. The use of these natural enemies in the integrated management of P. xylostella may economically improve the cabbage productive system, especially for organic farming. PMID:17348136

  2. Potential of Metarrhizium anisopliae and Beauveria bassiana isolates and Neem oil to control the aphid Lipaphis erysimi (Kalt.) (Hemiptera: Aphididae); Potencial de isolados de Metarhizium anisopliae e Beauveria bassiana e do oleo de Nim no controle do pulgao Lipaphis erysimi (Kalt.) (Hemiptera: Aphididae)

    Energy Technology Data Exchange (ETDEWEB)

    Araujo Junior, Jose M. de; Marques, Edmilson J.; Oliveira, Jose V. de [Universidade Federal Rural de Pernambuco (UFRPE), Recife, PE (Brazil). Dept. de Agronomia - Entomologia], e-mail: jma_junior@yahoo.com.br, e-mail: emar@depa.ufrpe.br, e-mail: vargasoliveira@uol.com.br

    2009-07-15

    This work aimed to determine the efficiency of the entomopathogenic fungi Metarrhizium anisopliae and Beauveria bassiana to control the aphid Lipaphis erysimi (Kalt.) (Hemiptera:Aphididae) in kale Brassica oleracea var acephala D.C., as well as their compatibility with a neem oil formulation (Neemseto{sup R}). Ten isolates of both fungi were tested and the most pathogenic ones were B. bassiana CG001 and M. anisopliae CG30 with 90% and 4.4 days, and 64% and 3.8 days of mortality and median lethal time, respectively. Bioassays with neem at concentrations of 0.5, 1.0 and 2.0% were done either by leaf discs dipping or spraying the aphids on the leaf discs. The neem spraying treatment at 2.0% provided 90% mortality. The use of B. bassiana isolate CG001 or M. anisopliae isolate CG30 with neem at 0.125, 0.25, and 0.5%, demonstrated that these isolates could have their spore viability or colony growth affected when exposed to neem concentrations higher than 0.25%. In absolute values, the isolates B. bassiana CG001 and M. anisopliae CG30 are the most virulent to L. erysimi, and could be utilized in the management of this pest. (author)

  3. Identification of proteases produced by entomopathogenic fungi Beauveria bassiana (Bals) Vuill. strain CG432 previously activated in coffee berry borer alive (Hypothenemus hampei)
    Identificação de proteases produzidas pelo fungo entomopatogênico Beauveria bassiana (Bals) Vuill. Cepa CG432 previamente ativada em insetos vivos de broca do café ((Hypothenemus hampei))

    OpenAIRE

    Luiz Filipe Protásio Pereira; Diogo Maciel de Magalhães; Humberto Josué de Oliveira Ramos; Dalva Trevisan; Eliana Tiemi Ito; Jurandir Pereira Pinto; Vanessa Hitomi Sugahara; Geni Silva Varéa; Jakeliny Akemi Yamamoto Oliveira

    2012-01-01

    Conídios de fungos entomopatogênicos atravessam o exoesqueleto do inseto pela ação mecânica do tubo germinativo e produção de múltiplas isoformas de proteases, quitinases e lipases em resposta à composição da cutícula do inseto. Desta forma o objetivo deste trabalho foi extrair, purificar e caracterizar a estrutura de proteases produzidas em cultivo submerso por Beauveria bassiana CG432 previamente ativada em adultos vivos de broca-do-café (Hypothenemus hampei). Uma suspensão contendo 106 con...

  4. Regulative roles of glutathione reductase and four glutaredoxins in glutathione redox, antioxidant activity, and iron homeostasis of Beauveria bassiana.

    Science.gov (United States)

    Zhang, Long-Bin; Tang, Li; Ying, Sheng-Hua; Feng, Ming-Guang

    2016-07-01

    Multiple glutaredoxins (Grx) and glutathione reductase (Glr) are vital for the thiol-disulfide redox system in budding yeast but generally unexplored in filamentous fungi. Here we characterized the Beauveria bassiana redox system comprising dithiol Grx1, monothiol Grx2-4, Grx-like Grx5, and Glr orthologue. Each grx or glr deletion was compensated by increased transcripts of some other grx genes in normal cultures. Particularly, grx3 compensated the absence of grx1, grx2, grx5, or glr under oxidative stress while its absence was compensated only by undeletable grx4 under normal conditions but by most of other undeleted grx and glr genes in response to menadione. Consequently, the redox state was disturbed in Δglr more than in Δgrx3 but not in Δgrx1/2/5. Superoxide dismutases were more active in normal Δgrx1-3 cultures but less in Δgrx5 or Δglr response to menadione. Total catalase activity increased differentially in all the mutant cultures stressed with or without H2O2 while total peroxidase activity decreased more in the normal or H2O2-stressed culture of Δglr than of Δgrx3. Among the mutants, Δgrx3 showed slightly increased sensitivity to menadione or H2O2; Δglr exhibited greater sensitivity to thiol-oxidizing diamide than thiol-reducing 1-chloro-2,4-dinitrobenzene as well as increased sensitivity to the two oxidants. Intriguingly, all the mutants grew slower in a Fe(3+)-inclusive medium perhaps due to elevated transcripts of two Fe(3+) transporter genes. More or fewer phenotypes linked with biocontrol potential were altered in four deletion mutants excluding Δgrx5. All the changes were restored by targeted gene complementation. Overall, Grx3 played more critical role than other Grx homologues in the Glr-dependent redox system of the fungal entomopathogen. PMID:26969041

  5. 球孢白僵菌液体制剂研究%The Study on A Liquid Preparation of Beauveria Bassiana

    Institute of Scientific and Technical Information of China (English)

    朱天辉; 杨世璋; 李远翔

    2001-01-01

    Effects of different media and fermentative conditions on the production of spores and cumulation of mycelial substence for Beauveria bassiana were studied by means of liquid fermentation. The results show that Beauveria bassiana does not produce blastospores on five media except for the medium (substitute code D) which contains 5% waste sugar, 1% corn abstract, and 0.1% K2HPO4, meanwhile, the D-medium, on which Beauveria bassiana grows well and produces bigger spores, is regarded as a ideal liquid carrier. The optimal fermentative conditions are as follows: temperature 25~30℃, pH6.0~7.0, Vibrating time 96hr, and not excess 1/6 flak volume as ventilation index.%通过液体发酵试验,研究了不同营养基质、不同发酵条件对球孢白僵菌液生分生孢子、芽孢子、干物质积累的影响,结果显示:在5种培养基中,除“糖蜜5%、玉米浸提液1%、K2HPO4 0.1%”(代号D)外,其它均不产生芽孢子,以D配方生物量最高,孢子较大,为本试验选出的液体制剂的理想载体,最佳发酵条件为温度25~30℃,pH6.0~7.0,通气量以瓶装培养液量为指标不超过1/6瓶装量,发酵时间以96小时为佳。白僵菌液体制剂的理想载体与最佳发酵条件的组合可使白僵菌液生分生孢子达2.5×1010左右,超过了目前四川固体发酵的生产水平。

  6. Advances and Perspectives of the use of the entomopathogenic fungi beauveria bassiana and metarhizium anisopliae for the control of arthropod pests in poultry production

    Directory of Open Access Journals (Sweden)

    DGP Oliveira

    2014-03-01

    Full Text Available Global poultry production is plagued by a wide variety of arthropods. The problems associated with their chemical control have led to an increasing search for control alternatives, and entomopathogenic fungi seem to be a promising strategy. Despite the large number of insects and mites considered as important pests in animal production, studies on the use of entomopathogenic fungi for their control are still scarce compared with agricultural pests, particularly in Brazil. This article reviews some damages and control aspects of the main arthropod pests that affect Brazilian poultry production, including house flies, lesser mealworms, and feather mites, by the use of the entomopathogenic fungi Beauveria bassiana and Metarhizium anisopliae. Studies published in the last 20 years were reviewed, and the main problems and limitations of that pest-control strategy are discussed.

  7. Genetic improvement of the nematicidal fungus Lecanicillium attenuatum against Heterodera glycines by expression of the Beauveria bassiana Cdep1 protease gene.

    Science.gov (United States)

    Xie, Ming; Zhang, Yan-Jun; Zhang, Xiao-Lin; Peng, De-Liang; Yu, Wen-Bin; Li, Qian

    2016-07-01

    Lecanicillium attenuatum is an important nematophagous fungus with potential as a biopesticide against plant-parasitic nematodes. The Pr1A-like cuticle-degrading protease (Cdep1) gene originating from the entomopathogenic fungus Beauveria bassiana was transformed into the nematophagous fungus L. attenuatum using a polyethylene-glycol mediated protoplast-based transformation system. Protease activity was increased 0.64- to 1.63-fold 2-10d after growth in the transformed L. attenuatum. Inhibition of egg-hatching and J2 motility of soybean cyst nematodes (Heterodera glycines) by cell-free fungal culture filtrates were enhanced by 17-76% 2-14d and 43-152% 1-13d after incubation, respectively. PMID:27342597

  8. An entomopathogenic strain of Beauveria bassiana against Frankliniella occidentalis with no detrimental effect on the predatory mite Neoseiulus barkeri: evidence from laboratory bioassay and scanning electron microscopic observation.

    Directory of Open Access Journals (Sweden)

    Shengyong Wu

    Full Text Available Among 28 isolates of Beauveria bassiana tested for virulence against F. occidentalis in laboratory bioassays, we found strain SZ-26 as the most potent, causing 96% mortality in adults at 1×10(7 mL(-1conidia after 4 days. The effect of the strain SZ-26 on survival, longevity and fecundity of the predatory mite Neoseiulus (Amblyseius barkeri Hughes were studied under laboratory conditions. The bioassay results showed that the corrected mortalities were less than 4 and 8% at 10 days following inoculation of the adult and the larvae of the predator, respectively, with 1×10(7 conidia mL(-1 of SZ-26. Furthermore, no fungal hyphae were found in dead predators. The oviposition and postoviposition durations, longevity, and fecundity displayed no significant differences after inoculation with SZ-26 using first-instar larvae of F. occidentalis as prey in comparison with untreated predator. In contrast, the preoviposition durations were significantly longer. Observations with a scanning electron microscope, revealed that many conidia were attached to the cuticles of F. occidentalis at 2 h after treatment with germ tubes oriented toward cuticle at 24 h, penetration of the insect cuticle at 36 h, and finally, fungal colonization of the whole insect body at 60 h. In contrast, we never observed penetration of the predator's cuticle and conidia were shed gradually from the body, further demonstrating that B. bassiana strain SZ-26 show high toxicity against F. occidentalis but no pathogenicity to predatory mite.

  9. The effect of leaf biopesticide (Mirabilis jalapa) and entomopathogenic fungi (Beauveria bassiana) combinations to some physiological characters and histology of Crocidolomia pavonana (Lepidoptera: Pyralidae) larvae

    Science.gov (United States)

    Sirajuddin, Nur Tasmiah; Anggraeni, Tjandra

    2014-03-01

    Crocidolomia pavonana is one of the most prominent pest that cause damage to vegetables especially Brassicaceae such us cabbage, broccoli, mustard greens and turnips, these vegetable have been widely consumed and cultivated in Indonesia. The invation of this pest might created high risk of cultivated failure. Enviromentally pest control efforts by utilizing biological control agents such us biopesticides of plants and entomopathogenic fungi have been carried out, but the work was relatively long and strongly influenced by environmental factors. The purpose of this study was to combine biopesticide of Mirabilis jalapa and entomopathogenic fungi Beauveria bassiana to look at mortality of C. pavonana larvae observing by histological incision and scanning electron microscope. Concentration treatments of extracts M. jalapa was (control; 0,1; 0,2; 0,4 and 0,8 gr/ml) and the result showed that the effective concentration was 0,8 g/ml which affect significantly (PHistological incision observed at hour 24, 48, 72 and 96, where the biggest damage occurred at hour 96. Observation by scanning electron microscope showed fungus spores that attach to the body surface of larvae subsequently penetrate into the body. Thus the combination use of biopesticides M. jalapa and fungi B. bassiana, can be used as an alternative pest control C. pavonana.

  10. The effect of leaf biopesticide (Mirabilis jalapa) and entomopathogenic fungi (Beauveria bassiana) combinations to some physiological characters and histology of Crocidolomia pavonana (Lepidoptera: Pyralidae) larvae

    International Nuclear Information System (INIS)

    Crocidolomia pavonana is one of the most prominent pest that cause damage to vegetables especially Brassicaceae such us cabbage, broccoli, mustard greens and turnips, these vegetable have been widely consumed and cultivated in Indonesia. The invation of this pest might created high risk of cultivated failure. Enviromentally pest control efforts by utilizing biological control agents such us biopesticides of plants and entomopathogenic fungi have been carried out, but the work was relatively long and strongly influenced by environmental factors. The purpose of this study was to combine biopesticide of Mirabilis jalapa and entomopathogenic fungi Beauveria bassiana to look at mortality of C. pavonana larvae observing by histological incision and scanning electron microscope. Concentration treatments of extracts M. jalapa was (control; 0,1; 0,2; 0,4 and 0,8 gr/ml) and the result showed that the effective concentration was 0,8 g/ml which affect significantly (P<0,05) in reduce pupa weight, improve pupasi time, lowering percentage of emergence imago and improve the long phase of pupa which differ significantly with control. The combination of biopesticides proved to accelerate the mortality of larvae. Histological incision observed at hour 24, 48, 72 and 96, where the biggest damage occurred at hour 96. Observation by scanning electron microscope showed fungus spores that attach to the body surface of larvae subsequently penetrate into the body. Thus the combination use of biopesticides M. jalapa and fungi B. bassiana, can be used as an alternative pest control C. pavonana

  11. The effect of leaf biopesticide (Mirabilis jalapa) and entomopathogenic fungi (Beauveria bassiana) combinations to some physiological characters and histology of Crocidolomia pavonana (Lepidoptera: Pyralidae) larvae

    Energy Technology Data Exchange (ETDEWEB)

    Sirajuddin, Nur Tasmiah, E-mail: nurtasmiah@yahoo.com; Anggraeni, Tjandra, E-mail: nurtasmiah@yahoo.com [Sekolah Ilmu dan Teknologi Hayati - ITB, Jalan Ganesa 10 Bandung (Indonesia)

    2014-03-24

    Crocidolomia pavonana is one of the most prominent pest that cause damage to vegetables especially Brassicaceae such us cabbage, broccoli, mustard greens and turnips, these vegetable have been widely consumed and cultivated in Indonesia. The invation of this pest might created high risk of cultivated failure. Enviromentally pest control efforts by utilizing biological control agents such us biopesticides of plants and entomopathogenic fungi have been carried out, but the work was relatively long and strongly influenced by environmental factors. The purpose of this study was to combine biopesticide of Mirabilis jalapa and entomopathogenic fungi Beauveria bassiana to look at mortality of C. pavonana larvae observing by histological incision and scanning electron microscope. Concentration treatments of extracts M. jalapa was (control; 0,1; 0,2; 0,4 and 0,8 gr/ml) and the result showed that the effective concentration was 0,8 g/ml which affect significantly (P<0,05) in reduce pupa weight, improve pupasi time, lowering percentage of emergence imago and improve the long phase of pupa which differ significantly with control. The combination of biopesticides proved to accelerate the mortality of larvae. Histological incision observed at hour 24, 48, 72 and 96, where the biggest damage occurred at hour 96. Observation by scanning electron microscope showed fungus spores that attach to the body surface of larvae subsequently penetrate into the body. Thus the combination use of biopesticides M. jalapa and fungi B. bassiana, can be used as an alternative pest control C. pavonana.

  12. Proteomic and Phosphoproteomic Insights into a Signaling Hub Role for Cdc14 in Asexual Development and Multiple Stress Responses in Beauveria bassiana

    Science.gov (United States)

    Wang, Zhi-Kang; Wang, Jie; Liu, Jing; Ying, Sheng-Hua; Peng, Xiao-Jun; Feng, Ming-Guang

    2016-01-01

    Cdc14 is a dual-specificity phosphatase that regulates nuclear behavior by dephosphorylating phosphotyrosine and phosphoserine/phosphothreonine in fungi. Previously, Cdc14 was shown to act as a positive regulator of cytokinesis, asexual development and multiple stress responses in Beauveria bassiana, a fungal insect pathogen. This study seeks to gain deep insight into a pivotal role of Cdc14 in the signaling network of B. bassiana by analyzing the Cdc14-specific proteome and phosphoproteome generated by the 8-plex iTRAQ labeling and MS/MS analysis of peptides and phosphopeptides. Under normal conditions, 154 proteins and 86 phosphorylation sites in 67 phosphoproteins were upregulated in Δcdc14 versus wild-type, whereas 117 proteins and 85 phosphorylation sites in 58 phosphoproteins were significantly downregulated. Co-cultivation of Δcdc14 with NaCl (1 M), H2O2 (3 mM) and Congo red (0.15 mg/ml) resulted in the upregulation / downregulation of 23/63, 41/39 and 79/79 proteins and of 127/112, 52/47 and 105/226 phosphorylation sites in 85/92, 45/36 and 79/146 phosphoproteins, respectively. Bioinformatic analyses revealed that Cdc14 could participate in many biological and cellular processes, such as carbohydrate metabolism, glycerophospholipid metabolism, the MAP Kinase signaling pathway, and DNA conformation, by regulating protein expression and key kinase phosphorylation in response to different environmental cues. These indicate that in B. bassiana, Cdc14 is a vital regulator of not only protein expression but also many phosphorylation events involved in developmental and stress-responsive pathways. Fourteen conserved and novel motifs were identified in the fungal phosphorylation events. PMID:27055109

  13. Proteomic and Phosphoproteomic Insights into a Signaling Hub Role for Cdc14 in Asexual Development and Multiple Stress Responses in Beauveria bassiana.

    Science.gov (United States)

    Wang, Zhi-Kang; Wang, Jie; Liu, Jing; Ying, Sheng-Hua; Peng, Xiao-Jun; Feng, Ming-Guang

    2016-01-01

    Cdc14 is a dual-specificity phosphatase that regulates nuclear behavior by dephosphorylating phosphotyrosine and phosphoserine/phosphothreonine in fungi. Previously, Cdc14 was shown to act as a positive regulator of cytokinesis, asexual development and multiple stress responses in Beauveria bassiana, a fungal insect pathogen. This study seeks to gain deep insight into a pivotal role of Cdc14 in the signaling network of B. bassiana by analyzing the Cdc14-specific proteome and phosphoproteome generated by the 8-plex iTRAQ labeling and MS/MS analysis of peptides and phosphopeptides. Under normal conditions, 154 proteins and 86 phosphorylation sites in 67 phosphoproteins were upregulated in Δcdc14 versus wild-type, whereas 117 proteins and 85 phosphorylation sites in 58 phosphoproteins were significantly downregulated. Co-cultivation of Δcdc14 with NaCl (1 M), H2O2 (3 mM) and Congo red (0.15 mg/ml) resulted in the upregulation / downregulation of 23/63, 41/39 and 79/79 proteins and of 127/112, 52/47 and 105/226 phosphorylation sites in 85/92, 45/36 and 79/146 phosphoproteins, respectively. Bioinformatic analyses revealed that Cdc14 could participate in many biological and cellular processes, such as carbohydrate metabolism, glycerophospholipid metabolism, the MAP Kinase signaling pathway, and DNA conformation, by regulating protein expression and key kinase phosphorylation in response to different environmental cues. These indicate that in B. bassiana, Cdc14 is a vital regulator of not only protein expression but also many phosphorylation events involved in developmental and stress-responsive pathways. Fourteen conserved and novel motifs were identified in the fungal phosphorylation events. PMID:27055109

  14. The Pal pathway required for ambient pH adaptation regulates growth, conidiation, and osmotolerance of Beauveria bassiana in a pH-dependent manner.

    Science.gov (United States)

    Zhu, Jing; Ying, Sheng-Hua; Feng, Ming-Guang

    2016-05-01

    The Pal/Rim pathway essential for fungal adaptation to ambient pH has been unexplored in Beauveria bassiana, a classic fungal entomopathogen. Here, we show the characterized Pal pathway comprising transcription factor PacC and upstream six Pal partners (PalA/B/C/F/H/I) in B. bassiana. Their coding genes were all transcribed most abundantly in standard wild-type culture under the alkaline condition of pH 9. Deletion of pacC or each pal gene resulted in a significant delay of culture acidification in a minimal broth (initial pH = 7.3). This delay concurred with altered accumulation levels of intra/extracellular organic acids and drastically depressed expression of some enzyme genes required for the syntheses of oxalic and lactic acids. Our deletion mutants except ΔpalI showed growth defects and maximal sensitivity to NaCl, KCl, LiCl, or sorbitol at pH 9, an alkaline condition leading to fragmented vacuoles in their hyphal cells exposed to osmotic stress. In these mutants, conidiation was significantly facilitated at pH 3 more than at pH 7 but suppressed slightly at pH 9. Mild virulence defects also occurred in the absence of pacC or any pal gene. These changes were restored by targeted gene complementation. Taken together, PacC and Pal partners regulate the growth, conidiation, and osmotolerance of B. bassiana in a pH-dependent manner, highlighting their vitality for the fungal pH response. PMID:26754817

  15. Interaction between TATA-Binding Protein (TBP and Multiprotein Bridging Factor-1 (MBF1 from the Filamentous Insect Pathogenic Fungus Beauveria bassiana.

    Directory of Open Access Journals (Sweden)

    Chi Song

    Full Text Available TATA-binding protein (TBP is a ubiquitous component of eukaryotic transcription factors that acts to nucleate assembly and position pre-initiation complexes. Multiprotein bridging factor 1 (MBF1 is thought to interconnect TBP with gene specific transcriptional activators, modulating transcriptional networks in response to specific signal and developmental programs. The insect pathogen, Beauveria bassiana, is a cosmopolitan fungus found in most ecosystems where it acts as an important regulator of insect populations and can form intimate associations with certain plants. In order to gain a better understanding of the function of MBF1 in filamentous fungi, its interaction with TBP was demonstrated. The MBF1 and TBP homologs in B. bassiana were cloned and purified from a heterologous E. coli expression system. Whereas purified BbTBP was shown to be able to bind oligonucleotide sequences containing the TATA-motif (Kd ≈ 1.3 nM including sequences derived from the promoters of the B. bassiana chitinase and protease genes. In contrast, BbMBF1 was unable to bind to these same target sequences. However, the formation of a ternary complex between BbMBF1, BbTBP, and a TATA-containing target DNA sequence was seen in agarose gel electrophoretic mobility shift assays (EMSA. These data indicate that BbMBF1 forms direct interactions with BbTBP, and that the complex is capable of binding to DNA sequences containing TATA-motifs, confirming that BbTBP can link BbMBF1 to target sequences as part of the RNA transcriptional machinery in fungi.

  16. Molecular tracing of white muscardine in the silkworm, Bombyx mori (Linn.) II. Silkworm white muscardine is not caused by artificial release or natural epizootic of Beauveria bassiana in China.

    Science.gov (United States)

    Chen, Xue; Huang, Cui; He, Lingmin; Zhang, Shengli; Li, Zengzhi

    2015-02-01

    The fungal pathogen Beauveria bassiana causes serious economic losses in sericulture. Its origin is usually attributed to the release of B. bassiana insecticides against pine caterpillars (Dendrolimus punctuatus). In the present study, 488 B. bassiana isolates obtained from silkworm (Bombyx mori) collected from 13 Chinese provinces, and 327 B. bassiana isolates obtained from D. punctatus collected from 9 provinces, were analyzed for population genetic structure using the ISSR technique based on genetic distance. A UPGMA dendrogram clustered them into three independent clades: two B. mori clades and one D. punctatus clade. A 3-D principal component analysis further divided them into two completely independent host groups, revealing high host-specificity. This suggested that white muscardine occurring in B. mori populations throughout southern China was not caused by any B. bassiana strain either naturally prevailing in D. punctatus populations or by any strain artificially released as a fungal insecticide against D. punctatus. We further investigated the genetic differentiation coefficient Gst and gene flow between B. mori-pathogenic and D. punctatus-pathogenic B. bassiana isolates from across China and from five provinces inhabited by both B. mori and D. punctatus. The Gst value across China was computed as 0.410, while the values of the five provinces ranged from 0.508 to 0.689; all above 0.25, which is the threshold for significant genetic differentiation. This suggests that B. bassiana strains isolated from the two different hosts maintained their respective heredity without a convergent homogenization trend, and reduces the possibility that the host range of the caterpillar isolates could expand and enhance their virulence in B. mori. These findings indicate that the use of B. bassiana does not threaten the safety of sericulture. PMID:25541121

  17. Selection of optimum conditions of medium acidity and aeration for submerget cultivation of Bacillus thuringiensis and Beauveria bassiana

    Directory of Open Access Journals (Sweden)

    O. A. Dregval

    2010-06-01

    Full Text Available The paper deals with the influence of medium pH and aeration rate on growth and sporulation of Bacillus thuringiensis and Вeauveria bassiana, which are main constituents of the complex microbial insecticide. It was established optimal medium pH for B. thuringiensis – 6.0 and for В. bassiana – 6.0–7.0. The maximum productivity of the studied microorganisms was observed in the same range of aeration – 7– 14 mmol O2/l/h. The selected conditions of cultivation are necessary for the production of complex biological insecticide based on the association of B. thuringiensis and B. bassiana.

  18. Phylogeny and systematics of the anamorphic, entomopathogenic genus Beauveria

    Science.gov (United States)

    Beauveria is a cosmopolitan anamorph genus of arthropod pathogens that includes the agronomically important species B. bassiana and B. brongniartii, which are used as mycoinsecticides for the biological control of pest insects. Recent phylogenetic evidence demonstrates that Beauveria is monophyletic...

  19. Identification of proteases produced by entomopathogenic fungi Beauveria bassiana (Bals Vuill. strain CG432 previously activated in coffee berry borer alive (Hypothenemus hampeiIdentificação de proteases produzidas pelo fungo entomopatogênico Beauveria bassiana (Bals Vuill. Cepa CG432 previamente ativada em insetos vivos de broca do café ((Hypothenemus hampei

    Directory of Open Access Journals (Sweden)

    Luiz Filipe Protásio Pereira

    2012-02-01

    Full Text Available Conídios de fungos entomopatogênicos atravessam o exoesqueleto do inseto pela ação mecânica do tubo germinativo e produção de múltiplas isoformas de proteases, quitinases e lipases em resposta à composição da cutícula do inseto. Desta forma o objetivo deste trabalho foi extrair, purificar e caracterizar a estrutura de proteases produzidas em cultivo submerso por Beauveria bassiana CG432 previamente ativada em adultos vivos de broca-do-café (Hypothenemus hampei. Uma suspensão contendo 106 conídios ativados/mL foi inoculada em meio de cultura líquido a 28ºC, 150 rpm por 3 dias. O extrato de proteases (EP foi obtido da centrifugação a 8000 g por 20 minutos, fracionado e concentrado por ultrafiltração em membrana de porosidade controlada 100 kDa e 3 kDa, respectivamente. A cromatografia de gel filtração em Sephadex G-100 separou um pico proteico (Pico II que apresentou 56% de resíduos do aminoácido ácido aspártico quando analisado por HPLC em coluna de fase reversa ODS-C18; atividade específica 43 vezes superior ao EP sobre soro albumina bovina; atividade de protease tipo-subtilisina e uma única banda proteica revelada por nitrato de prata e Coomassie Brilhant Blue em zimograma sobre gelatina por eletroforese PAGE em condições nativas. A homogeneidade do Pico II foi confirmada pela revelação de uma única banda durante a determinação do pH isoelétrico igual a 4,5, porém a determinação da massa molecular separou 2 bandas de 23 e 26 kDa por eletroforese PAGE-2D. As proteases foram caracterizadas como serino proteases com resíduo cisteína importante para a atividade, pois foram inibidas por fluoreto fenil-metil-sufonil e ácido p-cloromercúriobenzóico. As proteases do Pico II apresentaram Km 4x10-4 sobre substrato tipo-subtilisina.

  20. Efeitos de Beauveria bassiana (Bals Vuill e Metarhizium anisopliae (Metsc Sorok sobre fêmeas ingurgitadas de Amblyomma cajennense (Fabricius, 1787 em condições de laboratório Effects of Beauveria bassiana (Bals Vuill and Metarhizium anisopliae (Metsc Sorok on engorged females of Amblyomma cajennense (Fabricius, 1787 in laboratory conditions

    Directory of Open Access Journals (Sweden)

    R.C.S. Reis

    2004-12-01

    Full Text Available The in vitro susceptibility of Amblyomma cajennense engorged females to some isolated of the fungus Beauveria bassiana and Metarhizium anisopliae was verified and lethal concentrations (LC 50 and LC 90 were calculated. The females were dived in conidia suspensions for five minutes, and kept in climatically controlled chambers BOD under 27° C and 80% relative humidity. Each bioassay had four treatments in concentrations of 10(5,10(6,10(7e10(8 conidia/ml. A control group was also used. The following characteristics were evaluated: weight and period of oviposition, indexes of reproductive and nutritional efficiency and percentage of microbiological control. A dose dependent negative effect was observed in ticks treated with the suspension. All isolates tested cause a negative effect on in vitro tests of engorged females of A. cajennense, suggesting its potential for microbiological control of tick's species.

  1. Biological Control of the Chagas Disease Vector Triatoma infestans with the Entomopathogenic Fungus Beauveria bassiana Combined with an Aggregation Cue: Field, Laboratory and Mathematical Modeling Assessment.

    Directory of Open Access Journals (Sweden)

    Lucas Forlani

    2015-05-01

    Full Text Available Current Chagas disease vector control strategies, based on chemical insecticide spraying, are growingly threatened by the emergence of pyrethroid-resistant Triatoma infestans populations in the Gran Chaco region of South America.We have already shown that the entomopathogenic fungus Beauveria bassiana has the ability to breach the insect cuticle and is effective both against pyrethroid-susceptible and pyrethroid-resistant T. infestans, in laboratory as well as field assays. It is also known that T. infestans cuticle lipids play a major role as contact aggregation pheromones. We estimated the effectiveness of pheromone-based infection boxes containing B. bassiana spores to kill indoor bugs, and its effect on the vector population dynamics. Laboratory assays were performed to estimate the effect of fungal infection on female reproductive parameters. The effect of insect exuviae as an aggregation signal in the performance of the infection boxes was estimated both in the laboratory and in the field. We developed a stage-specific matrix model of T. infestans to describe the fungal infection effects on insect population dynamics, and to analyze the performance of the biopesticide device in vector biological control.The pheromone-containing infective box is a promising new tool against indoor populations of this Chagas disease vector, with the number of boxes per house being the main driver of the reduction of the total domestic bug population. This ecologically safe approach is the first proven alternative to chemical insecticides in the control of T. infestans. The advantageous reduction in vector population by delayed-action fungal biopesticides in a contained environment is here shown supported by mathematical modeling.

  2. Targeting of insect epicuticular lipids by the entomopathogenic fungus Beauveria bassiana: hydrocarbon oxidation within the context of a host-pathogen interaction

    Directory of Open Access Journals (Sweden)

    Nicolas ePedrini

    2013-02-01

    Full Text Available Broad host range entomopathogenic fungi such as Beauveria bassiana attack insect hosts via attachment to cuticular substrata and the production of enzymes for the degradation and penetration of insect cuticle. The outermost epicuticular layer consists of a complex mixture of non-polar lipids including hydrocarbons, fatty acids, and wax esters. Long chain hydrocarbons are major components of the outer waxy layer of diverse insect species, where they serve to protect against desiccation and microbial parasites, and as recognition molecules or as a platform for semiochemicals. Insect pathogenic fungi have evolved mechanisms for overcoming this barrier, likely with sets of lipid degrading enzymes with overlapping substrate specificities.. Alkanes and fatty acids are substrates for a specific subset of fungal cytochrome P450 monooxygenases involved in insect hydrocarbon degradation. These enzymes activate alkanes by terminal oxidation to alcohols, which are further oxidized by alcohol and aldehyde dehydrogenases, whose products can enter β-oxidation pathways. B. bassiana contains at least 83 genes coding for cytochrome P450s (CYP, a subset of which are involved in hydrocarbon oxidation, and several of which represent new CYP subfamilies/families. Expression data indicated differential induction by alkanes and insect lipids and 4 CYP proteins have been partially characterized after heterologous expression in yeast. Gene knockouts revealed a phenotype for only one (cyp52X1 out of 6 genes examined to date. CYP52X1 oxidizes long chain fatty acids and participates in the degradation of specific epicuticular lipid components needed for breaching the insect waxy layer. Examining the hydrocarbon oxidizing CYP repertoire of pathogens involved in insect epicuticle degradation can lead to the characterization of enzymes with novel substrate specificities. Pathogen targeting may also represent an important co-evolutionary process regarding insect cuticular

  3. SELECTION OF BEAUVERIA BASSIANA (BALSAMO VUILLEMIN ISOLATES FOR MANAGEMENT OF MYZUS PERSICAE (SULTZAR (HOM.: APHIDAE BASED ON VIRULENCE AND GROWTH RELATED CHARACTERISTICS

    Directory of Open Access Journals (Sweden)

    Mohammad S. Al-alawi

    2014-01-01

    Full Text Available Isolates of the entomopathogenic fungus Beauveria bassiana originated from Jordan were evaluated for their efficacy against the green peach aphid, Myzus persicae under laboratory and greenhouse conditions. Efficacy evaluation involved testing all isolates at a concentration of 1×107 conidia/mL followed by concentration dependent and greenhouse bioassays for the top virulent isolates. Growth characteristics related to virulence were evaluated for high, intermediate and low virulent isolates. Results showed that three isolates namely: BAU004, BAU018 and BAU019 were highly virulent to the aphid in the laboratory causing more than 75% infection. In the greenhouse, the three isolates caused infection from 41.3 to 46.5%. For the growth characteristics, isolate BAU019 produced more spores than the other highly virulent ones including the commercial isolate GHA. Highly virulent isolates also showed faster hyphal growth than low virulent isolates. These findings indicate that isolates BAU004, Bau018 and BAU019 might be developed as commercial microbial insecticides for safe and effective control of green peach aphid.

  4. Impact of two treatments of a formulation of Beauveria bassiana (Deuteromycota: Hyphomycetes) conidia on Varroa mites (Acari: Varroidae) and on honeybee (Hymenoptera: Apidae) colony health.

    Science.gov (United States)

    Meikle, William G; Mercadier, Guy; Holst, Niels; Girod, Vincent

    2008-12-01

    Bee colonies in southern France were treated with conidia (asexual spores) from two strains of Beauveria bassiana, an entomopathogenic fungus. One strain was commercial (GHA) and the other had been isolated from Varroa mites in the region (Bb05002). Objectives were to evaluate treatment effect on colony weight, adult bee mass, capped brood, and on Varroa fall onto sticky boards. Treatments included conidia formulated with either carnauba or candelilla wax powder, candelilla wax powder alone, or control; in two treatment groups formulation was applied a second time after one week. Treatment did not affect colony health. Colonies treated twice with Bb05002 conidia and carnauba wax powder had significantly higher mite fall compared to colonies treated with blank candelilla wax powder. The proportion of fallen mites that were infected in both conidia treatments was higher than controls for 18 days after the second treatment. The number of fungal propagules on the bees themselves remained elevated for about 14 days after the second treatment. These results were compared to published results from previous experiments with regard to infection duration. PMID:18506583

  5. Survival Rate and Transcriptional Response upon Infection with the Generalist Parasite Beauveria bassiana in a World-Wide Sample of Drosophila melanogaster.

    Directory of Open Access Journals (Sweden)

    Francesco Paparazzo

    Full Text Available The ability to cope with infection by a parasite is one of the major challenges for any host species and is a major driver of evolution. Parasite pressure differs between habitats. It is thought to be higher in tropical regions compared to temporal ones. We infected Drosophila melanogaster from two tropical (Malaysia and Zimbabwe and two temperate populations (the Netherlands and North Carolina with the generalist entomopathogenic fungus Beauveria bassiana to examine if adaptation to local parasite pressures led to differences in resistance. Contrary to previous findings we observed increased survival in temperate populations. This, however, is not due to increased resistance to infection per se, but rather the consequence of a higher general vigor of the temperate populations. We also assessed transcriptional response to infection within these flies eight and 24 hours after infection. Only few genes were induced at the earlier time point, most of which are involved in detoxification. In contrast, we identified more than 4,000 genes that changed their expression state after 24 hours. This response was generally conserved over all populations with only few genes being uniquely regulated in the temperate populations. We furthermore found that the American population was transcriptionally highly diverged from all other populations concerning basal levels of gene expression. This was particularly true for stress and immune response genes, which might be the genetic basis for their elevated vigor.

  6. Patogenitas Beberapa Cendawan Entomopatogen (Lecanicillium lecanii, Metarhizium anisopliae, dan Beauveria bassiana)terhadap Aphis glycines pada Tanaman Kedelai

    OpenAIRE

    Widariyanto, Riri

    2016-01-01

    The objectives of the research were to study the effectiveness of entomopatogen’s fungus ( L. Lecanii, M. Anisopliae, and B. bassiana) to Aphis glycines in soybean on field. Research done at Farm of Faculty of Agriculture of University of Sumatera Utara, Medan from December 2015 until Februari 2016. The method used Randomized Block Design by seven treatment that is : P0/control (Instar 4 of Aphis glycines without treatment Entomopathogen), P1 (Instar 2 of Aphis glycines + Lecanicillium lecani...

  7. Soil application of Beauveria bassiana GHA against apple sawfly, Hoplocampa testudinea (Hymenoptera: Tenthredinidae)

    DEFF Research Database (Denmark)

    Świergiel, Weronika; Meyling, Nicolai Vitt; Porcel, Mario;

    2016-01-01

    ) Vuillemin (BotaniGard) against apple sawfly under common organic orchard practices. We also assessed the efficacy of B. bassiana GHA and Metarhizium brunneum Petch (indigenous strain) against sawfly in the laboratory. Larvae treated with either fungus in the laboratory died faster than control larvae and......, but reversion to background levels occurred within a year. It remains to be investigated whether this has a detrimental effect on nontarget organisms. Additional work is needed to bridge the knowledge gap between laboratory and field efficacy in orchards....

  8. A New Dibenz[b,e]oxepine Derivative, 1-Hydroxy-10-methoxy-dibenz[b,e]oxepin-6,11-dione, from a Marine-Derived Fungus, Beauveria bassiana TPU942

    Directory of Open Access Journals (Sweden)

    Michio Namikoshi

    2012-11-01

    Full Text Available 1-Hydroxy-10-methoxy-dibenz[b,e]oxepin-6,11-dione (1 was obtained from the culture broth of a marine-derived fungus, Beauveria bassiana TPU942, isolated from a marine sponge collected at Iriomote Island in Okinawa, together with two known compounds, chrysazin (2 and globosuxanthone A (3. The structure of 1 was elucidated on the basis of its spectroscopic data (HREIMS, 1D and 2D NMR experiments including 1H–1H COSY, HMQC and HMBC spectra. Dibenz[b,e]oxepines are rare in nature, and only six natural products have been reported. Therefore, compound 1 is the seventh natural product in this class. Compounds 2 and 3 showed an antifungal activity against Candida albicans, and 3 inhibited the cell growth against two human cancer cell lines, HCT-15 (colon and Jurkat (T-cell lymphoma. Compound 1 did not show an apparent activity in the same bioassays.

  9. Réponse des stades larvaires de Helicoverpa armigera (Hübner (Lepidoptera : Noctuidae à l'application de champignons entomopathogènes Metarhizium anisopliae et Beauveria bassiana

    Directory of Open Access Journals (Sweden)

    Tamò, M.

    2012-01-01

    Full Text Available Response of the nymphs of Helicoverpa armigera (Hübner (Lepidoptera: Noctuidae to entomopathogenic fungi Metarhizium anisopliae and Beauveria bassiana. Two experiments on dose/mortality response between the instars of Helicoverpa armigera and two strains of entomopathogenic fungi, Metarhizium anisopliae (Met 31 and Beauveria bassiana (Bb 11 were carried out in laboratory conditions. In the first experiment, M. anisopliae Met 31 was tested on the third instar of H. armigera, while in the second experiment, both Met 31 and Bb 11 were tested on the fourth instar. In all the experiments, the following different doses of conidia per insect were used: 104, 105, 106, 107. The following parameters were measured: mortality and sporulation rates, the number of pupae formed and the number of adults that emerged. Abbott's formula was used to correct the treatment mortality rates. LD50 was determined using Cox-regression. For the third instar in experiment one, no significant difference was observed between high doses (106 and 107 conidia per insect. For instar L4, only the dose of 107 conidia per insect showed high mortality rates (74%. For the strain Bb 11, in spite of the variation observed between the mortality rates induced by high doses (106 and 107 conidia per insect, no significant difference was recorded at the 5% level. No mycosis was observed from cadavers resulting from lower doses when tested on L4. The control recorded the highest numbers of pupae and adults. These two parameters were related to the level of dosage: the higher the dose, the lower the numbers of pupae and adults that emerged. For all the strains of fungi used, whatever the larval stage of H. armigera, the dose/mortality response was significant.

  10. Efeito de Beauveria bassiana (Bals. Vuill. e Metarhizium anisopliae (Metsch. Sorok. sobre características biológicas de Diatraea saccharalis F. (Lepidoptera: Crambidae - DOI: 10.4025/actascibiolsci.v30i2.3627 Effect of Beauveria bassiana (Bals. Vuill. and Metarhizium anisopliae (Metsch. Sorok. on Biological Characteristics of Diatraea saccharalis F. (Lepidoptera: Crambidae - DOI: 10.4025/actascibiolsci.v30i2.3627

    Directory of Open Access Journals (Sweden)

    Valéria Wanderley Teixeira

    2008-05-01

    Full Text Available A broca da cana-de-açúcar Diatraea saccharalis F. é considerada uma das principais pragas nas Américas. Entre os métodos de controle, o uso de fungos entomopatogênicos tem sido amplamente recomendado no manejo das pragas da cana-de-açúcar, incluindo outras lepidobrocas. Assim sendo, este estudo investigou os efeitos de diferentes concentrações de Beauveria bassiana (Bals. Vuill. e Metarhizium anisopliae (Metsch. Sorok. sobre parâmetros biológicos da broca da cana-de-açúcar. Larvas de terceiro instar de D. saccharalis foram tratadas com os fungos usando as concentrações de 103, 104 e 105 conídios mL-1. Larvas tratadas com 105 conídios mL-1 de B. bassiana tiveram menor sobrevivência (56,6%, comparadas com lagartas não-tratadas (90%. Adultos originados de larvas tratadas colocaram menor número de ovos, com menor viabilidade, e viveram menos, comparados com adultos originados de larvas não-tratadas. Larvas tratadas com M. anisopliae na concentração de 105 conídios mL-1 e adultos originados destas larvas também exibiram redução no desempenho, comparados aos insetos não-tratados. Os resultados indicam que B. bassiana e M. anisopliae, além de patogênicos às larvas de D. saccharalis, também interferem negativamente na sua biologia, mostrando potencial de uso contra esta praga.The sugarcane borer Diatraea saccharalis F. is considered one of the major sugarcane pests in the American continent. Among control methods, the use of entomopathogenic fungi has been broadly recommended to manage sugarcane pests, including other sugarcane borers. Therefore, this study investigated the effects of different concentrations of Beauveria bassiana (Bals. Vuill and Metarhizium anisopliae (Metch. Sorok on biological characteristics of the sugarcane borer. Third-instar larvae of D. saccharalis were fungi-treated using the concentrations of 103, 104 and 105 conidia mL-1. Larvae treated with 105 conidia mL-1 of B. bassiana showed lower

  11. Antagonism of Beauveria bassiana against Two Fusarium spp.Pathogenic to Cotton%球孢白僵菌对两种植物病原镰孢的拮抗作用

    Institute of Scientific and Technical Information of China (English)

    张胜利; 李增智

    2011-01-01

    体外测定了球孢白僵菌Beauveria bassiana对两种棉花病原镰孢——棉花枯萎病菌Fusarium oxysporium f.sp.vasinfecturn和棉花红腐病菌Fusarium verticillioides的拮抗作用。平板对峙培养时,两种镰孢的生长均受到明显抑制。不同含孢量的球孢白僵菌对两种镰孢的抑制效果不同,且抑制率与孢子浓度成显著的线性量效关系;在接种量为6×107孢子.mL-1时,对两种菌的抑制率均达到90%以上,对红腐病菌的抑制率稍高。白僵菌代谢液对两种植物病原菌也表现出抑菌作%In vitro antagonism of Beauveria bassiana,an entomopathogenic fungus,was tested against Fusarium oxysporium f.sp.vasinfecturn,pathogen of cotton wilt,and F.verticillioides,pathogen of cotton red rot.On dual culture,B.bassiana showed obvious inhibition on the growth of the two pathogens.Different doses of conidia had different inhibitory effects,with inhibition rate linearly correlated to inoculum,suggesting that the antagonism was associated with competition for nutrition and space.The inhibition on the two pathogens was both over 90% at inoculum of 6×107 spores·mL-1,slightly higher on F.verticillioide.The metabolite in SDY shake culture of B.bassiana also displayed inhibition,with inhibition rate linearly correlated to metabolite concentration,suggesting that the antagonism was also associated with antibiotic substances.Based on the comparison of inhibition rates,antibiosis was considered to contribute more than competition.In the analysis on the antibiotic metabolite,none of the lyophilized supernatant extracted by 4 different organic extractants showed obvious inhibition on the Fusarium spp.,while addition of crude extract of either polysaccharide or protein significantly inhibited mycelium growth of the two Fusarium spp.,suggesting that the main inhibitory substances are polysaccharide and protein with high molecular weight.

  12. Evaluacion del efecto de Beauveria bassiana en el control biológico de Varroa destructor, parasito de la abeja melífera (Apis mellifera en la finca Felisa en el municipio de los Patios, Norte de Santander - Evaluacion del efecto de Beauveria bassiana en el control biológico de Varroa destructor, parasito de la abeja melífera (Apis mellifera en la finca Felisa en el municipio de los Patios, Norte de Santander

    Directory of Open Access Journals (Sweden)

    Francy Liliana Duarte

    2013-08-01

    Full Text Available Beekeeping is an activity that produces significant benefits to agriculture and the environment; Through the pollination action of bees helps to increase productivity as well as biodiversity in the ecosystem. In recent years, has significantly increased prevalence of parasites in this species, particularly the Varroasis, a disease caused by the mite Varroa destructor. The causal agent produces losses between 30% and 50% of total production and in turn can cause damage to the quality of honey by the excessive use of chemicals for disease control and the slow and progressive deterioration health of producers. Noting this, we evaluated the incidence of fungus Beauveria bassiana in natural populations of Varroa destructor in acarofauna associated, and the remains of the hive by pathogenicity tests in laboratory conditions to evaluate the effect of the biocontrol entomopathogenic then enter in apiaries infected with the disease. According to the results obtained in the adult infestation of V. destructor in Apis mellifera Africanized sampling Felisa made on the farm in the municipality of Los Patios, recorded rates of infestation in hives from 3.4% to 8.3% on the infection status of breeding was 4.5% to 13.7%. In laboratory tests it was possible to observe thatthe fungus B. bassiana attacked by an effective control mites without harming bees, propolis and honey allowing the insect to continue their normal activities, controlling the disease in a biological, not chemical.

  13. Integrated use of Beauveria bassiana and Bacillus thuringiensis serovar.tenebrionis for microbial biocontrol of colorado potato beetle%球孢白僵菌和苏云金杆菌拟步甲血清亚种联合使用防治马铃薯甲

    Institute of Scientific and Technical Information of China (English)

    斯蒂芬· 瑞特; Mark A Ramos

    2007-01-01

    This paper reviews the potential for using insect pathogens to control the Colorado potato beetle,Leptinotarsa decemlineata,and summarizes results from nearly 10 years of research by USDA-ARS-PPRU scientists aimed at developing methods and strategies for integrated use of Bacillus thuringiensis and Beauveria bassiana for biologically-based management of potato beetles in the northeastern USA.The described studies have resulted in 1) design of a tractor-mounted hydraulic spray system that improved targeting and consequent efficacy of microbial control agents, 2) discovery of synergism between the bacterial pathogen Bacillus thuringiensis (Bt) and the fungal pathogen Beauveria bassiana (Bb),3) findings that substantial mortality of beetle larvae treated with B.bassiana during foliar spray programs did not occur until after they entered the soil to pupate, and 4) observations that spray applications made in the evening (at sunset) were significantly, but not substantially, more effective than applications made during the morning hours.These findings have led to development of a bio-based pest management system based on three spray applications made in the following order at 3-5-day intervals:Bt alone,Bt and Bb mixed,and Bb alone.This spray program,with the applications initiated at 50% egg hatch,is intended to control the actively feeding larval stages (providing protection from defoliation) and reduce survivorship to the adult stage (providing long-term control by reducing populations of overwintering adults). In the initial test of the integrated management system,beetle control and potato yields were statistically equivalent to those in plots in which the beetles were controlled with chemical insecticides.Demonstration of the effectiveness of this program will continue over the next 2-3 field seasons.

  14. Rosalia longicorn Rosalia alpina (LINNAEUS, 1758 (Coleoptera: Cerambycidae as a host of the entomopathogenic fungus Cordyceps bassiana LI, LI, HUANG

    Directory of Open Access Journals (Sweden)

    Bartnik Czesław

    2016-06-01

    Full Text Available The paper describes, for the first time, the occurrence of the entomopathogenic fungus Cordyceps bassiana (anamorph: Beauveria bassiana on the imago of the endangered beetle Rosalia longicorn Rosalia alpina from the Low Beskid Mountains (the Carpathians, SE Poland. Furthermore, an isolate of the saprotrophic fungus Hypoxylon fragiforme was obtained as a result of laboratory tests on R. alpina specimens. Relationships between the identified fungi and R. alpina are discussed.

  15. USO DE BIOINSECTICIDAS PARA EL CONTROL DE PLAGAS DE HORTALIZAS EN COMUNIDADES RURALES

    OpenAIRE

    Cipriano García-Gutiérrez; María Berenice González-Maldonado

    2010-01-01

    Se evaluó el uso de bioinsecticidas elaborados a base de hongos entomopatógenos (Beauveria bassiana, Metarhizium anisopliae y Paecilomyces fumosoroseus); la producción se hizo de manera artesanal en comunidades rurales y se utilizaron para el control de plagas de hortalizas. Los productos fueron formulados con celite® y se usaron a dosis de 240g (1.2x1012 esporas/ha), para el control de plagas sobre plantaciones de lechuga Lactuca sativa L., rábano Rhapanus sativus, cebolla Allium cepa L., re...

  16. Effects of multiple applications of a Beauveria based biopesticide on Varroa destructor (Acari: Varroidae) densities in honey bee (Hymenoptera: Apidae) colonies

    Science.gov (United States)

    A biopesticide, formulated with a strain of Beauveria bassiana isolated from varroa mites, was tested in an experiment in southern France and the results were were compared to published results from previous experiments with the same biopesticide. Bee colonies were treated either with biopesticide, ...

  17. Desarrollo de un prototipo de formulación con hongos entomopatógenos para el manejo de Demotispa neivai Bondar (Coleoptera: Chrysomelidae) / Development of a prototype of making with entomopathogenic fungi for management of Demotispa neivai Bondar (Coleptera: Chrysomelidae)

    OpenAIRE

    Martínez Castrillón, Luis Carlos

    2010-01-01

    Entre los factores que limita la producción en el cultivo de la palma de aceite se encuentra el insecto Demotispa neivai Bondar, el cual ocasiona daños hasta de un 100% en su superficie. Durante el desarrollo de un prototipo de formulación con hongos entomopatógenos para el manejo de D. neivai fue necesario evaluar la patogenicidad de tres aislamientos de hongos entomopatógenos en adultos del insecto, utilizando como inóculo dos cepas de Beauveria bassiana (B018, B025), y una de Metarhizium a...

  18. Selección de Aislamientos de Hongos Entomopatógenos para el Control de Huevos de la Polilla del Tomate, Tuta absoluta Meyrick (Lepidoptera: gelechiidae) Entomopathogenic Fungi Isolates Selection for Egg Control of Tomato Moth Tuta absoluta Meyrick (Lepidoptera: gelechiidae) Eggs

    OpenAIRE

    Marta Rodríguez S.; Marcos Gerding P.; Andrés France

    2006-01-01

    Se realizó un estudio en laboratorio sobre la patogenicidad de 64 aislamientos de Metarhizium anisopliae var. anisopliae y 70 de Beauveria bassiana, en huevos de polilla del tomate Tuta absoluta. La primera evaluación se realizó por aplicación directa de suspensiones de 10(7) conidias mL-1 para cada aislamiento, con el sistema de pulverización de la torre de Potter. La mortalidad y esporulación sobre huevos fueron significativamente mayores con los aislamientos M. anisopliae Qu-M558 y B. bass...

  19. Selection of Entomopathogenic Fungi to Control Varroa destructor (Acari: Varroidae Selección de Hongos Entomopatógenos para el Control de Varroa destructor (Acari: Varroidae

    Directory of Open Access Journals (Sweden)

    Marta Rodríguez

    2009-12-01

    Full Text Available The aim of this work was select entomopathogenic fungi tolerant to temperatures inside the brood area of honey bees (Apis mellifera for to control Varroa destructor. For this purpose, 50 Beauveria bassiana (Balsamo Vuillemin and 48 Metarhizium anisopliae (Metschn. Sorokin isolates were evaluated at 30 and 35 ºC. For each isolate, colony discs of 5 mm with mycelium were placed in the center of a Petri dish with Sabouraud dextrose agar (SDA medium. The dishes were incubated at 30 and 35 °C, without light. Radial growth of each colony was measured daily. All the B. bassiana and M. anisopliae isolates presented a lineal growth rate at a temperature of 30 ºC. However, at 35 ºC, most of the isolates did not grow, except three B. bassiana and 14 M. anisopliae isolates (P El objetivo de este trabajo fue seleccionar hongos entomopatógenos tolerantes a las temperaturas del nido de cría de las abejas (Apis mellifera, para ser utilizados en el control de Varroa destructor. Se evaluaron 50 aislamientos de Beauveria bassiana (Balsamo Vuillemin y 48 de Metarhizium anisopliae (Metschn. Sorokin a temperaturas de 30 y 35 ºC. Discos de agar de 5 mm de diámetro con micelio de colonias de cada aislamiento, se depositaron en el centro de placas Petri con medio agar Sabouraud dextrosa (ASD. Las placas fueron incubadas a 30 y 35 °C y oscuridad y diariamente se midió el radio de cada colonia. Todos los aislamientos de B. bassiana y M. anisopliae var. anisopliae presentaron una tendencia lineal a través del tiempo a temperaturas de incubación de 30 °C. A 35 °C la mayoría de los aislamientos no crecieron, excepto tres aislamientos de B. bassiana y 14 de M. anisopliae (p < 0,001. Estos aislamientos fueron seleccionados para realizar pruebas de patogenicidad sobre V. destructor, aplicando una suspensión de 10(7 conidias mL-1. El aislamiento más efectivo fue Qu-M845 de M. anisopliae (p = 0,0033, produjo una mortalidad de 85%. La capacidad patogénica de este

  20. Selección de Aislamientos de Hongos Entomopatógenos para el Control de Huevos de la Polilla del Tomate, Tuta absoluta Meyrick (Lepidoptera: gelechiidae Entomopathogenic Fungi Isolates Selection for Egg Control of Tomato Moth Tuta absoluta Meyrick (Lepidoptera: gelechiidae Eggs

    Directory of Open Access Journals (Sweden)

    Marta Rodríguez S.

    2006-06-01

    Full Text Available Se realizó un estudio en laboratorio sobre la patogenicidad de 64 aislamientos de Metarhizium anisopliae var. anisopliae y 70 de Beauveria bassiana, en huevos de polilla del tomate Tuta absoluta. La primera evaluación se realizó por aplicación directa de suspensiones de 10(7 conidias mL-1 para cada aislamiento, con el sistema de pulverización de la torre de Potter. La mortalidad y esporulación sobre huevos fueron significativamente mayores con los aislamientos M. anisopliae Qu-M558 y B. bassiana Qu-B911, Qu-B912 y Qu-B928. Estos aislamientos fueron evaluados nuevamente en suspensiones crecientes de 0 a 10(8 conidias mL-1. Los aislamientos Qu-M558 y Qu-B912, produjeron los mayores porcentajes de mortalidad sobre la base del cálculo del área bajo la curva del progreso de mortalidad de huevos, 80 y 60%, respectivamente.A pathogenicity study of 64 Metarhizium anisopliae var. anisopliae and 70 Beauveria bassiana isolates against tomato moth Tuta absoluta eggs, was carried out under laboratory conditions. The first evaluation was accomplished by spraying suspensions of 10(7 conidias mL-1 of each isolate directly on eggs, through a Potter tower. Mortality and conidia production on the eggs were significantly higher with the isolates M. anisopliae Qu-M558 and B. bassiana Qu-B911, Qu-B912 and Qu-B928. These isolates were newly evaluated using increasing conidia concentrations (0 to 10(8 conidia mL-1 of each of the five selected isolates. The isolates Qu-B912 and Qu-M558 produced the highest mortality percentages based on the area under mortality progress curve for each concentration, 80 and 60%, respectively.

  1. Development of a method for detection and quantification of B. brongniartii and B. bassiana in soil.

    Science.gov (United States)

    Canfora, L; Malusà, E; Tkaczuk, C; Tartanus, M; Łabanowska, B H; Pinzari, F

    2016-01-01

    A culture independent method based on qPCR was developed for the detection and quantification of two fungal inoculants in soil. The aim was to adapt a genotyping approach based on SSR (Simple Sequence Repeat) marker to a discriminating tracing of two different species of bioinoculants in soil, after their in-field release. Two entomopathogenic fungi, Beauveria bassiana and B. brongniartii, were traced and quantified in soil samples obtained from field trials. These two fungal species were used as biological agents in Poland to control Melolontha melolontha (European cockchafer), whose larvae live in soil menacing horticultural crops. Specificity of SSR markers was verified using controls consisting of: i) soil samples containing fungal spores of B. bassiana and B. brongniartii in known dilutions; ii) the DNA of the fungal microorganisms; iii) soil samples singly inoculated with each fungus species. An initial evaluation of the protocol was performed with analyses of soil DNA and mycelial DNA. Further, the simultaneous detection and quantification of B. bassiana and B. brongniartii in soil was achieved in field samples after application of the bio-inoculants. The protocol can be considered as a relatively low cost solution for the detection, identification and traceability of fungal bio-inoculants in soil. PMID:26975931

  2. 不同温度下白僵菌Bb04菌株对红火蚁工蚁的致病力%Pathogenicity of strain Bb04 of Beauveria bassiana (Bals) Vuill. to red imported fire ant workers under different temperatures

    Institute of Scientific and Technical Information of China (English)

    刘晓燕; 吕利华; 何余容

    2014-01-01

    Red imported fire ant ( RIFA) , Solenopsis invicta Buren, is one of the most devastating pests in the world . Entomopathengenic fungi have been applied to control many crops insect pests successfully worldwide and may be a promising control for RIFA.The effect of temperature on pathogenicity of strain Bb 04 of Bearveria bassiana, a suitable candidate to the RIFA workers , was studied in the laboratory .[Method]The RIFA workers were infected with two concentrations of B.bassiana spore suspension (1 ×105 conidia· mL-1 and 1 ×108 conidia· mL-1 ) and kept under 17, 21, 25, 29 and 33 ℃ conditions.[Result]The results showed there were significant differences in virulence of Bb 04 to RIFA under different temperatures .When workers of RIFA were treated with 1 ×108 conidia· mL-1 , the total mortality of infected RIFA after 15 days reached as high as 100%under 21℃, 25℃and 29 ℃.Total mortality was 99.36%at 17 ℃and 98.74%at 33 ℃.However, after 15 days with an infection rate of 1 ×105 conidia/mL, total mortalities of treated workers at 17 ℃, 21 ℃, 25 ℃, 29 ℃and 33 ℃were only 16.83%, 29.42%,36.18%, 33.17%and 27.21%, respectively .At 17, 21 and 25 ℃, LT50 values of Bb04 against RIFA decreased from 5.41 at 17℃to 3.88 at 21 ℃and then 2.57 days at 25℃.LT50 increased again to 2.97 at 29℃and 5.11 at 33℃.[Conclusion and significance]25 ℃was the most effective temperature to promote infection of RIFA by Bb 04 and should be applied in both spring and autumn in the field .%【背景】白僵菌是一种应用最广泛的虫生真菌,已被用于工厂化大量生产,可防治多种农林害虫。【方法】试验设置17、21、25、29和33℃5个温度水平,采用喷雾法,将浓度为1×105和1×108个· mL-1的白僵菌孢子悬浮液分别感染红火蚁工蚁,以测试不同温度下白僵菌菌株对红火蚁工蚁的致病力。【结果】当浓度为1×108个· mL-1时,在21、25和29℃条件下,红火蚁工蚁在15 d

  3. 75 FR 10186 - Beauveria bassiana HF23; Amendment of Exemption from the Requirement of a Tolerance

    Science.gov (United States)

    2010-03-05

    ... evaluated whether there is any potential for residues of the pesticide to result in or on meat, milk... requirement for a tolerance (the legal limit for a pesticide chemical residue in or on a food) only if EPA... exposure of infants and children to the pesticide chemical residue in ] establishing a tolerance and...

  4. The characteristics of keratomycosis by Beauveria bassiana and its successful treatment with antimycotic agents

    OpenAIRE

    Hiroko Sonoyama; Kaoru Araki-Sasaki; Shigeyasu Kazama; Tsutomu Kawasaki; Hidenao Ideta; et al

    2008-01-01

    Hiroko Sonoyama1, Kaoru Araki-Sasaki1, Shigeyasu Kazama1, Tsutomu Kawasaki1, Hidenao Ideta1, Atsuko Sunada2, Seishi Asari2, Yoshitsugu Inoue3, Kozaburo Hayashi41Ideta Eye Hospital, Kumamoto, Kumamoto, Japan; 2Department of Laboratory for Clinical Investigation, Osaka University Hospital, Suita, Osaka, Japan; 3Division of Ophthalmology and Visual Science, Department of Medicine of Sensory and Motor Organ, Tottori University, Yonago, Tottori, Japan; 4Immunology and Virology Section Lab, Immunol...

  5. Imbibitional damage in conidia of the entomopathogenic fungi Beauveria bassiana, Metarhizium anisopliae, and Metarhizium acridum

    Science.gov (United States)

    When dried organisms are immersed in water, rapid imbibition may cause severe damage to plasma membranes; in unicellular organisms, such damage is usually lethal. This study investigated effects of pre-immersion moisture levels and immersion temperature on imbibitional damage in three insect pathoge...

  6. Associação de pós inertes com fungo entomopatogênico para o controle do cascudinho (Alphitobius diaperinus Association of inert powders with the entomopathogenic fungi for darkling beetle (Alphitobius diaperinus control

    Directory of Open Access Journals (Sweden)

    Patricia Helena Santoro

    2010-06-01

    Full Text Available O objetivo deste trabalho foi avaliar a eficiência de Beauveria bassiana (Bb, da terra diatomácea (TD e dos pós de rocha Protesyl e Rocksil, isoladamente ou em associações, para o controle de Alphitobius diaperinus. Os agentes de controle foram aplicados na forma sólida misturados à cama de frango. A concentração de conídios de Bb foi de 0,08% e, para os pós inertes, as concentrações foram de 0,5; 1,0 e 1,5%. Testaram-se 20 tratamentos, com cinco repetições de 200 insetos, por 10 dias. Os tratamentos que apresentaram maior eficiência foram TD 1,5% e Bb 0,08% + TD 1,5%, com 60,2 e 57,8% de mortalidade, respectivamente. Protesyl e Rocksil, nas três concentrações, e TD 0,5% não diferiram da testemunha. Na interação entre os agentes de controle, ocorreu efeito aditivo para Bb + TD e Bb + Rocksil, nas três concentrações, e para Bb + Protesyl a 1,5%. A eficiência do fungo foi reduzida na associação com Protesyl, com efeito não aditivo antagônico nas concentrações de 0,5 e 1,0%. A terra diatomácea, isolada ou associada à B. bassiana, apresenta-se como boa alternativa para controle de A. diaperinus. Já os pós de rocha Protesyl e Rocksil não foram eficientes para o controle da praga.The objective of this study was to evaluate the efficacy of Beauveria bassiana (Bb of diatomaceous earth (TD and the dust of rock Protesyl and Rocksil, alone or in combinations, for Alphitobius diaperinus to control. The control agents were applied in dried by mixing with the poultry liter. The concentration of Bb conidia was 0.08% on the weight of the substrate, and for the dust inert were 0.5, 1.0 and 1.5%. Twenty treatments with five repetitions of 200 insects were tested for 10 days. The treatments with highest efficiency were TD 1.5% and Bb 0.08% + TD 1.5%, with 60.2 and 57.8%, respectively. Protesyl and Rocksil in the three concentrations and TD 0.5% did not differ from control. For the interaction between control agents no advantage

  7. Compatibility between the entomopathogenic fungus Beauveria bassiana and insecticides used in coffee plantations Compatibilidade entre o fungo entomopatogênico Beauveria bassiana e inseticidas usados na cultura do cafeeiro

    OpenAIRE

    Carolina Natali de Oliveira; Pedro Manuel Oliveira Janeiro Neves; Lídio Sueki Kawazoe

    2003-01-01

    Microbial control in integrated pest management (IPM) programs of coffee plantations is an important factor for the reduction of pest population densities. The use of selective pesticides can be associated with entomopathogens, increasing the efficiency of the control and reducing the use of required insecticides. The in vitro fungitoxic effect of insecticide formulations of Thiamethoxam, Cyfluthrin, Deltamethrin, Alpha-Cypermethrin, Triazophos, Chlorpyrifos, Fenpropathrin and Endosulfan and ...

  8. In vitro compatibility between three bacterial sugarbeet disease-control agents and the entomopathogenic fungi, Metarhizium anisopliae and Beauveria bassiana

    Science.gov (United States)

    The rhizosphere is the primary arean for entomopathogenic fungi (EPF) deployed against soil-dwelling pests, and is also the site of action of biological agents used against root pathogens. Interactions between EPF and soil microbes, much less biofungicidal agents, have been barely studied, however, ...

  9. Determination of the median lethal concentration (LC50 of mycoinsecticides for the control of Ceratitis capitata (Diptera: Tephritidae Determinación de la concentración letal media (CL50 de micoinsecticidas para el control de Ceratitis capitata (Diptera: Tephritidae

    Directory of Open Access Journals (Sweden)

    FLÁVIA QUEIROZ DE OLIVEIRA

    2010-12-01

    Full Text Available The aim of this study was to determine the median lethal concentration (LC50 of the commercial products Boveril WP® (Beauveria bassiana and Metarril WP® (Metarhizium anisopliae on the larvae and pupae of the fruit fly, Ceratitis capitata. Insects used in this study came from a laboratory colony. The evaluated product concentrations were 10.00, 15.00, 20.00 and 25.00 g/L of water, which correspond, respectively, to 5.00x10(9, 7.50x10(9, 10.00x10(9 and 12.50x10(9 viable conidia/L of water for the two products, and in the control only water was applied. Third instar larvae and pupae of C. capitata were used in this study. Results showed an overall mortality of larvae with all conidial concentrations of M. anisopliae. The LC50 values for larvae were 2.99 and 2.97 g/L for Boveril® and Metarril®, respectively, while for pupae they were 3.12 and 4.74 g/L for Boveril® and Metarril®, respectively. The high pathogenicity demonstrated by lower conidial concentrations of the tested products may mean greater efficiency from both economic and environmental points of view.El objetivo de este estudio fue determinar la concentración letal media (CL50 de los productos comerciales Boveril WP® (Beauveria bassiana y Metarril WP® (Metarhizium anisopliae para el control de larvas y pupas de la mosca mediterránea de la fruta, Ceratitis capitata. Los insectos utilizados en el experimento provinieron de una cría de laboratorio. Las concentraciones de los productos evaluados fueron: 10,00; 15,00; 20,00 y 25,00 g/L de agua, lo que corresponde, respectivamente, a 5,00x10(9; 7,50x10(9; 10,00x10(9; 12,50x10(9 conidias viables/L de agua para los dos productos; en el control sólo se aplicó agua. Se usaron larvas de tercer estadio y pupas de C. capitata. Se registró la mortalidad general de las larvas de tercer instar en todas las concentraciones de conidios de M. anisopliae. Los valores de CL50 para las larvas fueron 2,99 y 2,97 g/L para Boveril® y Metarril

  10. Selección de cepas de hongos entomopatógenos para el manejo de anastrepha obliqua (macquart, 1835) (diptera: tephritidae) en colombia

    OpenAIRE

    Osorio-Fajardo, Armando; Nelson A Canal

    2011-01-01

    Se evaluaron 15 cepas de los hongos entomopatógenos Beauveria bassiana y Metarhizium anisopliae sobre adultos de un día de edad de la mosca de la fruta Anastrepha obliqua. El trabajo se realizó con el fin de seleccionar las cepas más virulentas al insecto y estudiar el efecto sobre los adultos jóvenes cuando el hongo era aplicado antes de la emergencia. Mediante un screening con una concentración de 1x107 conidias/mL se seleccionaron las tres cepas más virulentas, siendo dos de ellas de Beauv...

  11. Development of a CO2 releasing co-formulation 1 based on starch, Saccharomyces cerevisiae and Beauveria bassiana attractive towards western corn rootworm larvae

    Science.gov (United States)

    CO2 is known as an attractant for many soil-dwelling pests. To implement an attract-and-kill strategy for soil pest control, CO2 emitting formulations need to be developed. This work aimed at the development of a slow release bead system in order to bridge the gap between application and hatching of...

  12. The entomopathogenic fungus Beauveria bassiana reduces instantaneous blood feeding in wild multi-insecticide-resistant Culex quinquefasciatus mosquitoes in Benin, West Africa

    NARCIS (Netherlands)

    A.F.V. Howard; R. N'Guessan; C.J.M. Koenraadt; A. Asidi; M. Farenhorst; M. Akogbeto; M.B. Thomas; B.G.J. Knols; W. Takken

    2010-01-01

    Background: Mosquito-borne diseases are still a major health risk in many developing countries, and the emergence of multi-insecticide-resistant mosquitoes is threatening the future of vector control. Therefore, new tools that can manage resistant mosquitoes are required. Laboratory studies show tha

  13. DEVELOPMENT OF A BIOASSAY SYSTEM FOR THE PREDATOR XYLOCORIS FLAVIPES (REUTER) AND ITS USE IN SUBCHRONIC TOXICITY/PATHOGENICITY STUDIES OF BEAUVERIA BASSIANA (BALS.) VUILL. STRAIN GHA.

    Science.gov (United States)

    Microbial biocontrol agents are useful commercially only if they do not harm other natural biocontrol organisms, at recommended use rate in the environment where the microorganism is being used. To test the hypothesis that the predatory warehouse pirate bug, Xylocoris flavipes (Reuter), is not adve...

  14. Caracterización molecular de 15 aislamientos de Beauveria bassiana asociados con Cosmopolites y Metamasius en plátano y banano en tres regiones de Colombia

    Directory of Open Access Journals (Sweden)

    Muñoz Flórez Jaime Eduardo

    2008-09-01

    Full Text Available Se colectaron picudos de Cosmopolites y Metamasius en municipios del Valle del Cauca, Caldas y Quindío. Se obtuvieron cultivos monospóricos con diluciones de 10-10 y 10-11. Los aislamientos fueron almacenados a -80°C con glicerol al 10% y el ADN a –20°C. Los marcadores moleculares RAM generaron 82 fragmentos de los cuales 67% fueron polimórficos con una heterocigocidad de 0.24, que indica diversidad media a alta. A un índice de similitud 0.84 se formaron 5 grupos: uno con 11 aislamientos y 4 con un solo aislamiento. En el gran grupo se detectó un duplicado y se encontró diversidad del hongo en los sitios muestreados. No se encontró relación entre aislamientos sobre Cosmopolites y Metamasius o zona geográfica en la formación de grupos genéticos.

  15. Synergistic interaction between the fungus Beauveria bassiana and desiccant dusts applied against poultry red mites (Dermanyssus gallinae)

    DEFF Research Database (Denmark)

    Steenberg, Tove; Kilpinen, Ole Østerlund

    2014-01-01

    The poultry red mite, Dermanyssus gallinae, is a major pest in egg production, feeding on laying hens. Widely used non-chemical control methods include desiccant dusts, although their persistence under field conditions is often short. Entomopathogenic fungi may also hold potential for mite contro...

  16. Assessing deposition and persistence of Beauveria bassiana GHA (Ascomycota: Hypocreales) applied for control of emerald ash borer, Agrilus planipennis (Coleoptera: Buprestidae), in a commercial tree nursery

    Science.gov (United States)

    Determining the deposition and field persistence of mycoinsecticides is essential in the development of effective and economical application strategies, including specifically the timing and frequency of spray applications. In this study we used three methods to evaluate the persistence of Beauveri...

  17. Tri-Tek (Petroleum Horticultural Oil) and Beauveria bassiana: Use in Eradication Strategies for Bemisia tabaci Mediterranean Species in UK Glasshouses

    OpenAIRE

    Cuthbertson, Andrew G. S.; Collins, Debbie A.

    2015-01-01

    The sweetpotato whitefly Bemisia tabaci (Gennadius) (Hemiptera: Aleyrodidae) is a pest of global importance on both outdoor and glasshouse crops. To date, B. tabaci has not become established in the UK. The UK holds Protected Zone status against this pest and, as a result, B. tabaci entering on plant material is subjected to a policy of eradication. Mediterranean species is now the most prevalent Bemisia species entering the UK. Increasing neonicotinoid resistance is becoming increasingly wid...

  18. Metabolic profiles and free radical scavenging activity of Cordyceps bassiana fruiting bodies according to developmental stage.

    Directory of Open Access Journals (Sweden)

    Sun-Hee Hyun

    Full Text Available The metabolic profiles of Cordyceps bassiana according to fruiting body developmental stage were investigated using gas chromatography-mass spectrometry. We were able to detect 62 metabolites, including 48 metabolites from 70% methanol extracts and 14 metabolites from 100% n-hexane extracts. These metabolites were classified as alcohols, amino acids, organic acids, phosphoric acids, purine nucleosides and bases, sugars, saturated fatty acids, unsaturated fatty acids, or fatty amides. Significant changes in metabolite levels were found according to developmental stage. Relative levels of amino acids, purine nucleosides, and sugars were higher in development stage 3 than in the other stages. Among the amino acids, valine, isoleucine, lysine, histidine, glutamine, and aspartic acid, which are associated with ABC transporters and aminoacyl-tRNA biosynthesis, also showed higher levels in stage 3 samples. The free radical scavenging activities, which were significantly higher in stage 3 than in the other stages, showed a positive correlation with purine nucleoside metabolites such as adenosine, guanosine, and inosine. These results not only show metabolic profiles, but also suggest the metabolic pathways associated with fruiting body development stages in cultivated C. bassiana.

  19. Drug: D09176 [KEGG MEDICUS

    Lifescience Database Archive (English)

    Full Text Available bassiana Vuillemin.; Standards for non-pharmacopoeial crude drugs Crude drugs [BR:br08305] Animals Insects D09176 Stiff silkworm PubChem: 96025856 ... ...91], Beauveria bassiana [TAX:176275] Same as: E00308 Bombycidae Silkworm infected Cordycepitaceae Beauveria

  20. Optimization of cyclosporin A production by Beauveria nivea in continuous fed-batch fermentation

    Directory of Open Access Journals (Sweden)

    Dong Huijun

    2011-01-01

    Full Text Available To develop the effective control method for fed-batch culture of cyclosporin A production, we chose fructose, L-valine and (NH42HPO4 as feeding nutrients and compared their productivities in relation to different concentrations. The feeding rate of three kinds of feeding materials was controlled to maintain the suitable residual concentration. The fed-batch fermentation results indicated that the optimal concentrations of fructose, L-valine and (NH42HPO4 were about 20 g/L, 0.5 g/L and 0.6 g/L for cyclosporin A production, respectively. The cultivation of Beauveria nivea could produce cyclosporin A up to 6.2 g/L for 240 hrs through a continuous feeding-rate-controlled-batch process under the optimal feeding conditions.

  1. Beauveria brongniartii Sacc. (Petch) against Melolontha spp. white grubs in forest nurseries with different soil pH

    OpenAIRE

    Sierpińska Alicja; Popowska-Nowak Elżbieta; Bednarek Andrzej

    2015-01-01

    In 2011, the General Directorate of State Forests in Poland managed 669 forest nurseries on the total area of 2411 ha that produced forest tree seedlings bare root systems, hence vulnerable to Melolontha spp. white grubs. Up to date, no chemical or biological plant protection product for control of cockchafer grubs in forests has been registered in Poland. The study was carried out with the aim to evaluate the efficacy of a biocontrol product Bovecol with BP strain of Beauveria brongniartii o...

  2. Cyclodepsipeptides and Other O-Containing Heterocyclic Metabolites from Beauveria felina EN-135, a Marine-Derived Entomopathogenic Fungus

    Directory of Open Access Journals (Sweden)

    Feng-Yu Du

    2014-05-01

    Full Text Available Bioassay-guided fractionation of a culture extract of Beauveria felina EN-135, an entomopathogenic fungus isolated from a marine bryozoan, led to the isolation of a new cyclodepsipeptide, iso-isariin D (1; two new O-containing heterocyclic compounds that we have named felinones A and B (2 and 3; and four known cyclodepsipeptides (4–7. The structures were elucidated via spectroscopic analysis, and the absolute configurations of 1 and 2 were determined using single-crystal X-ray diffraction and CD, respectively. All isolated compounds were evaluated for antimicrobial activity and brine-shrimp (Artemia salina lethality.

  3. A multi-screening approach for marine-derived fungal metabolites and the isolation of cyclodepsipeptides from Beauveria felina

    International Nuclear Information System (INIS)

    Extracts obtained from 57 marine-derived fungal strains were analyzed by HPLC-PDA, TLC and 1H NMR. The analyses showed that the growth conditions affected the chemical profile of crude extracts. Furthermore, the majority of fungal strains which produced either bioactive of chemically distinctive crude extracts have been isolated from sediments or marine algae. The chemical investigation of the antimycobacterial and cytotoxic crude extract obtained from two strains of the fungus Beauveria felina have yielded cyclodepsipeptides related to destruxins. The present approach constitutes a valuable tool for the selection of fungal strains that produce chemically interesting or biologically active secondary metabolites. (author)

  4. A multi-screening approach for marine-derived fungal metabolites and the isolation of cyclodepsipeptides from Beauveria felina

    Energy Technology Data Exchange (ETDEWEB)

    Vita-Marques, Aline Maria de; Lira, Simone P.; Berlinck, Roberto G.S. [Universidade de Sao Paulo (USP), Sao Carlos, SP (Brazil). Inst. de Quimica]. E-mail: rgsberlinck@iqsc.usp.br; Seleghim, Mirna H.R. [Universidade Federal de Sao Carlos (UFSCAR), SP (Brazil). Dept. de Ecologia e Biologia Evolutiva; Sponchiado, Sandra R.P. [UNESP, Araraquara, SP (Brazil). Inst. de Quimica. Dept. de Bioquimica e Tecnologia Quimica; Tauk-Tornisielo, Samia M. [UNESP, Rio Claro, SP (Brazil). Centro de Estudos Ambientais; Barata, Margarida [Faculdade de Ciencias de Lisboa (Portugal). Centro de Biologia Ambiental. Dept. de Biologia Vegetal; Pessoa, Claudia; Moraes, Manoel O. de; Cavalcanti, Bruno Coelho [Universidade Federal do Ceara (UFC), Fortaleza, CE (Brazil). Dept. de Fisiologia e Farmacologia; Nascimento, Gislene G.F. [Universidade Metodista de Piracicaba (UNIMEP), SP (Brazil). Faculdade de Ciencias da Saude; Souza, Ana O. de [Instituto Butantan, Sao Paulo, SP (Brazil); Galetti, Fabio C.S.; Silva, Celio L. [Universidade de Sao Paulo (USP), Ribeirao Preto, SP (Brazil). Faculdade de Medicina. Dept. de Bioquimica e Imunologia; Silva, Marcio; Pimenta, Eli F.; Thiemann, Otavio [Universidade de Sao Paulo (USP), Sao Carlos, SP (Brazil). Inst. de Fisica; Passarini, Michel R.Z.; Sette, Lara D. [Universidade Estadual de Campinas (UNICAMP), Campinas, SP (Brazil). Centro Pluridisciplinar de Pesquisas Quimicas, Bioligicas e Agricolas. Div. de Recursos Microbianos

    2008-07-01

    Extracts obtained from 57 marine-derived fungal strains were analyzed by HPLC-PDA, TLC and {sup 1}H NMR. The analyses showed that the growth conditions affected the chemical profile of crude extracts. Furthermore, the majority of fungal strains which produced either bioactive of chemically distinctive crude extracts have been isolated from sediments or marine algae. The chemical investigation of the antimycobacterial and cytotoxic crude extract obtained from two strains of the fungus Beauveria felina have yielded cyclodepsipeptides related to destruxins. The present approach constitutes a valuable tool for the selection of fungal strains that produce chemically interesting or biologically active secondary metabolites. (author)

  5. A multi-screening approach for marine-derived fungal metabolites and the isolation of cyclodepsipeptides from Beauveria felina

    Directory of Open Access Journals (Sweden)

    Aline Maria de Vita-Marques

    2008-01-01

    Full Text Available Extracts obtained from 57 marine-derived fungal strains were analyzed by HPLC-PDA, TLC and ¹H NMR. The analyses showed that the growth conditions affected the chemical profile of crude extracts. Furthermore, the majority of fungal strains which produced either bioactive of chemically distinctive crude extracts have been isolated from sediments or marine algae. The chemical investigation of the antimycobacterial and cytotoxic crude extract obtained from two strains of the fungus Beauveria felina have yielded cyclodepsipeptides related to destruxins. The present approach constitutes a valuable tool for the selection of fungal strains that produce chemically interesting or biologically active secondary metabolites.

  6. Selection, Identification and Culture Characteristics of a Highly Virulent Strain of Beauveria towards Sympiezomias citri%柑橘灰象甲一株高毒力白僵菌菌株的筛选鉴定及培养特性

    Institute of Scientific and Technical Information of China (English)

    王定锋; 黎健龙; 王庆森; 李慧玲; 吴光远

    2014-01-01

    %, highest muscardine rates of 97.78%and shortest LT50 of 3.77 d after fungal inoculation at a concentration of 1.0×108 spores/mL (7 d, 26 ℃). The LC50 value was 4.55×104 spores/mL at 26 ℃. According to culture characteristics, morphology feature and rDNA ITS sequence analysis, the strain Bb2-1 was identified to be Beauveria bassiana. The effect of five medium types (PDA, PPDA, 1/4 SDAY, SDAY, and Czapek), five temperature gradient (15, 20, 25, 30 and 35 ℃), seven different pH value (pH 4.0—10.0) and seven different illumination periods (0L:24D, 24L:0D, 18L:6D, 12L:12D, 6L:18D, dark in the first 7 days and light in the last 7 days, and light in the first 7 days and dark in the last 7 days) on colony growth and sporulation of the strain Bb2-1 were evaluated through the determination of colony diameter and sporulation. The results showed that SDAY medium at pH 7.0 was the most optimal medium for the colony growth and sporulation of the strain Bb2-1 at 25 ℃, and photoperiod didn’t pose any obvious effects on colony growth, but prolonging illumination time was benefit to the sporulation. In this study, the selection of a highly virulent B. bassiana (Bb2-1) towards S. citri and the evaluation of culture characteristics of Bb2-1 would provide reference for large scale production of the fungi to control this beetle.

  7. Selection and characterization of Beauveria spp. isolates to control the broad mite Polyphagotarsonemus latus (Banks, 1904) (Acari: Tarsonemidae).

    Science.gov (United States)

    Martins, C C; Alves, L F A; Mamprim, A P; Souza, L P A

    2016-01-01

    This study was performed under laboratory conditions to identify isolates of the fungus Beauveria spp. that can control Polyphagotarsonemus latus in the greenhouse and field. Thirty Beauveria spp. isolates were tested by spraying 1 mL conidia (1 × 108 conidia/mL) on pepper leaf discs containing 15 mites. Evaluations were performed on the 3rd and 6th day post application by counting the number of dead mites. Vegetative growth and conidial production were measured from the selected isolates, and bioassays were conducted in the greenhouse on bean seedlings in plastic pots. The isolate Unioeste 53 was selected, and a conidial suspension (1 × 108 conidia/mL) was applied with a backpack sprayer. The evaluation consisted of pre- and post-treatment counts of the number of live mites on ten leaflets in both the plots treated with the fungus and control plots, and the same procedure was followed for the field experiment. In the laboratory, the Unioeste 53 isolate resulted in total and confirmed mortality rates of 70% and 57.7%, respectively. In the greenhouse, the population decreased by 76.71% by the 16th day after application. In the field, the population decreased by 66% by the 12th day after application, demonstrating the potential of this fungus for mite management. PMID:27332672

  8. Selection of Native Fungi Strains Pathogenic to Vespula germanica (Hymenoptera: Vespidae Selección de Aislamientos Nativos de Hongos Patogénicos a Vespula germanica (Hymenoptera: Vespidae

    Directory of Open Access Journals (Sweden)

    Loreto Merino

    2007-12-01

    Full Text Available The yellowjacket wasp, Vespula germanica F., is considered a serious pest of productive and recreational activities worldwide. A pathogenicity study was carried out with 29 strains of Metarhizium anisopliae and 30 of Beauveria bassiana against worker and male wasps. Wasps of the same age were fed with liquid sugar baits containing 1 x 10(8 conidia mL-1 suspensions of each strain. The highest mortality and sporulation were obtained with the strains Qu-B941 and Qu-B933 of Beauveria bassiana, reaching 79 and 95% mortality for workers and 66 and 73% for males, respectively. The strains were tested on workers of V. germanica with increasing amounts of bait from 0 to 1 x 10(8 conidia mL-1. The results also showed that 1 x 10(8 conidia mL-1 increased up to 90 and 97% the mortality of workers with Qu-B941 and Qu-B933 strains, respectively.La avispa chaqueta amarilla, Vespula germanica F., es una especie cosmopolita, considerada en muchos países como un problema serio para el desarrollo de actividades productivas y recreativas. Entre las nuevas alternativas para el control de la plaga está el uso de hongos entomopatógenos. Se estudió la patogenicidad de 29 aislamientos de Metarhizium anisopliae y 30 de Beauveria bassiana, sobre obreras y machos de la avispa. La evaluación se realizó sobre adultos de igual edad, administrando dosis de 1 x 10(8 conidia mL-1 de cada aislamiento, en cebos líquidos azucarados. La mortalidad y esporulación de los aislamientos de Beauveria bassiana Qu-B941 y Qu-B933 fueron significativamente mayores, alcanzando porcentajes de mortalidad de 79 y 95% para obreras y de 66 y 73% para machos, respectivamente. Estos aislamientos fueron evaluados en cebos con suspensiones crecientes de 0 a 1 x 10(8 conidia mL-1 sobre obreras de V. germanica. Los resultados obtenidos muestran que mayores concentraciones de inóculo incrementan significativamente los índices de mortalidad, alcanzando 90 y 97% para Qu-B941 y Qu-B933

  9. Baeuveria bassiana (BalsVuill and Metarhizium anisioplae (Metsch. Sorokin in the pupas control of Prodiplosis longifila Gagné on asparagus crop

    Directory of Open Access Journals (Sweden)

    Carolina Cedano

    2012-03-01

    Full Text Available The objective of the present work was to evaluate the effect of the entomopathogen fungi Baeuveria bassiana and Metarhizium anisioplae of the Prodiplosis longifila pupas, in order to reduce the adult population of this insect. The treatments consisted on the application of two different propagel concentrations (mycel and conidia of each entomopathogen. One of these concentration was 1x106 propagels/ml (obtained from the total amount of conidia collected of 25 kg of rice colonized by the entomopathogen; and the other one, was 1x107 propagels/ml (obtained from the total amount of conidia collected of 40 kg of rice colonized by the entomopathogen. As a check a non application treatment was considered. The applications were trough the irrigation system and started 15 days after the end of harvest and were repeated each five days during a month, coincident with the period of most falls of pupas of the soil. As a result Baeuveria bassiana at 1x107 propagels/ml shown 53.4 % of the total pupas colonized by the entomopathogen, which allows indicating B. bassiana as a promissory biocontrol of this specie

  10. Efectividad de Aislamientos de Hongos Entomopatógenos Sobre Larvas de Polilla del Tomate Tuta absoluta Meyrick (Lepidoptera: Gelechiidae) Effectivity of Entomopathogenic Fungus Strains on Tomato Moth Tuta absoluta Meyrick (Lepidoptera: Gelechiidae) Larvae

    OpenAIRE

    Marta Rodríguez; Marcos Gerding; Andrés France

    2006-01-01

    La polilla del tomate, Tuta absoluta Meyrick, es una plaga importante en el cultivo del tomate (Lycopersicon esculentum L.) en Chile. Estudios de laboratorio fueron realizados para evaluar la virulencia y efectividad de Qu-M558 de Metarhizium anisopliae var. anisopliae y Qu-B912 de Beauveria bassiana. La primera evaluación fue realizada aplicando concentraciones de 0 a 10(8) conidia mL-1 directamente sobre larvas de tercer estadio mediante el sistema de pulverización torre Potter. Las compara...

  11. Cotton in Benin: governance and pest management

    NARCIS (Netherlands)

    Togbe, C.E.

    2013-01-01

    Key words: cotton, synthetic pesticides, neem oil (Azadirachta indica), Beauveria bassiana, Bacillus thuringiensis, field experiment, farmers’ participation   Pests are one of the main factors limiting cotton production worldwide. Most of the pest control strategies in cotton producti

  12. Mass production of fungal entomopathogens

    Science.gov (United States)

    Hypocrealean fungi encompassing Beauveria bassiana, B. brongniartii, Isaria fumosorosea, I. farinosa, several Lecanicillium spp., Nomuraea rileyi, and Metarhizium spp. are being increasingly exploited worldwide for insect pest management because of the ease with which they can be produced in contras...

  13. Optical and structural properties of plasma-treated Cordyceps bassiana spores as studied by circular dichroism, absorption, and fluorescence spectroscopy

    Science.gov (United States)

    Lee, Geon Joon; Sim, Geon Bo; Choi, Eun Ha; Kwon, Young-Wan; Kim, Jun Young; Jang, Siun; Kim, Seong Hwan

    2015-01-01

    To understand the killing mechanism of fungal spores by plasma treatment, the optical, structural, and biological properties of the insect pathogenic fungus Cordyceps bassiana spores were studied. A nonthermal atmospheric-pressure plasma jet (APPJ) was used to treat the spores in aqueous solution. Optical emission spectra of the APPJ acquired in air indicated emission peaks corresponding to hydroxyl radicals and atomic oxygen. When the APPJ entered the aqueous solution, additional reactive species were derived from the interaction of plasma radicals with the aqueous solution. Fluorescence and absorption spectroscopy confirmed the generation of hydroxyl radicals and hydrogen peroxide in the plasma-activated water (PAW). Spore counting showed that plasma treatment significantly reduced spore viability. Absorption spectroscopy, circular dichroism (CD) spectroscopy, and agarose gel electrophoresis of the DNA extracted from plasma-treated spores showed a reduction in spore DNA content. The magnitude of the dip in the CD spectrum was lower in the plasma-treated spores than in the control, indicating that plasma treatment causes structural modifications and/or damage to cellular components. Tryptophan fluorescence intensity was lower in the plasma-treated spores than in the control, suggesting that plasma treatment modified cell wall proteins. Changes in spore viability and DNA content were attributed to structural modification of the cell wall by reactive species coming from the APPJ and the PAW. Our results provided evidence that the plasma radicals and the derived reactive species play critical roles in fungal spore inactivation.

  14. Optical and structural properties of plasma-treated Cordyceps bassiana spores as studied by circular dichroism, absorption, and fluorescence spectroscopy

    Energy Technology Data Exchange (ETDEWEB)

    Lee, Geon Joon, E-mail: gjlee@kw.ac.kr; Sim, Geon Bo; Choi, Eun Ha [Plasma Bioscience Research Center/Department of Electrical and Biological Physics, Kwangwoon University, Seoul 139-701 (Korea, Republic of); Kwon, Young-Wan [KU-KIST Graduate School of Converging Science and Technology, Korea University, Seoul 136-701 (Korea, Republic of); Kim, Jun Young; Jang, Siun; Kim, Seong Hwan, E-mail: piceae@naver.com [Department of Microbiology and Institute of Basic Sciences, Dankook University, Cheonan 330-714 (Korea, Republic of)

    2015-01-14

    To understand the killing mechanism of fungal spores by plasma treatment, the optical, structural, and biological properties of the insect pathogenic fungus Cordyceps bassiana spores were studied. A nonthermal atmospheric-pressure plasma jet (APPJ) was used to treat the spores in aqueous solution. Optical emission spectra of the APPJ acquired in air indicated emission peaks corresponding to hydroxyl radicals and atomic oxygen. When the APPJ entered the aqueous solution, additional reactive species were derived from the interaction of plasma radicals with the aqueous solution. Fluorescence and absorption spectroscopy confirmed the generation of hydroxyl radicals and hydrogen peroxide in the plasma-activated water (PAW). Spore counting showed that plasma treatment significantly reduced spore viability. Absorption spectroscopy, circular dichroism (CD) spectroscopy, and agarose gel electrophoresis of the DNA extracted from plasma-treated spores showed a reduction in spore DNA content. The magnitude of the dip in the CD spectrum was lower in the plasma-treated spores than in the control, indicating that plasma treatment causes structural modifications and/or damage to cellular components. Tryptophan fluorescence intensity was lower in the plasma-treated spores than in the control, suggesting that plasma treatment modified cell wall proteins. Changes in spore viability and DNA content were attributed to structural modification of the cell wall by reactive species coming from the APPJ and the PAW. Our results provided evidence that the plasma radicals and the derived reactive species play critical roles in fungal spore inactivation.

  15. Antiproliferative and Apoptosis-Inducing Activities of 4-Isopropyl-2,6-bis(1-phenylethylphenol Isolated from Butanol Fraction of Cordyceps bassiana

    Directory of Open Access Journals (Sweden)

    Ji Hye Kim

    2015-01-01

    Full Text Available The Cordyceps species have been widely used for treating various cancer diseases. Although the Cordyceps species have been widely known as an alternative anticancer remedy, which compounds are responsible for their anticancer activity is not fully understood. In this study, therefore, we examined the anticancer activity of 5 isolated compounds derived from the butanol fraction (Cb-BF of Cordyceps bassiana. For this purpose, several cancer cell lines such as C6 glioma, MDA-MB-231, and A549 cells were employed and details of anticancer mechanism were further investigated. Of 5 compounds isolated by activity-guided fractionation from BF of Cb-EE, KTH-13, and 4-isopropyl-2,6-bis(1-phenylethylphenol, Cb-BF was found to be the most potent antiproliferative inhibitor of C6 glioma and MDA-MB-231 cell growth. KTH-13 treatment increased DNA laddering, upregulated the level of Annexin V positive cells, and altered morphological changes of C6 glioma and MDA-MB-231 cells. In addition, KTH-13 increased the levels of caspase 3, caspase 7, and caspase 9 cleaved forms as well as the protein level of Bax but not Bcl-2. It was also found that the phosphorylation of AKT and p85/PI3K was also clearly reduced by KTH-13 exposure. Therefore, our results suggest KTH-13 can act as a potent antiproliferative and apoptosis-inducing component from Cordyceps bassiana, contributing to the anticancer activity of this mushroom.

  16. Crescimento, esporulação e viabilidade de fungos entomopatogênicos em meios contendo diferentes concentrações do óleo de nim (Azadirachta indica Growth, esporulation and viability of entomopathogenic fungi under mediums with differents Nim oil (Azadirachta indica concentrations

    Directory of Open Access Journals (Sweden)

    Renata Paro Marques

    2004-12-01

    Full Text Available A associação de extratos de origem vegetal com fungos entomopatogênicos pode aumentar a eficiência do controle biológico de pragas, reduzir custos e impactos ambientais. No presente trabalho, avaliou-se, através da concentração inibitória mínima, o efeito do óleo de nim (NIM-I-GO sobre o crescimento, esporulação e viabilidade de Metarhizium anisopliae, Beauveria bassiana e Paecilomyces farinosus. Utilizou-se o meio BDA, contendo diferentes concentrações de óleo de nim (C1: 5% de óleo de nim, e sucessivamente concentrações iguais a ½ da concentração anterior, até C11: 0,0048% de óleo de nim. O óleo de nim reduziu o crescimento de colônias de B. bassiana e P. farinosus, que não diferiram significativamente do controle apenas na concentração C11, mas para M. anisopliae o mesmo efeito foi observado com 0,039% de óleo de nim (C8. A esporulação também foi significativamente reduzida pelo óleo de nim, exceto na concentração C11 para B. bassiana; contudo, não se verificou efeito do óleo na viabilidade de esporos dos fungos.The association of vegetable extracts with entomopathogenic fungi can increase the efficiency of biological control of pests, to reduce costs and environmental impacts. The present work aimed to evaluate, through minimal inibitory concentration, the effect of the neem oil (NIM-I-GO on the growth, esporulation and viability of Metarhizium anisopliae, Beauveria bassiana and Paecilomyces farinosus. For this purpose the PDA medium was used containing different concentrations of neem oil (C1: 5% of neem oil, and successively concentrations ½ of the previous concentration, until the concentration C11:0,0048% of neen oil. The neen oil reduced the growth of B. bassiana and P. farinosus, which didn’t differ significantly of the control at the concentration C11. Similar effect was observed for M. anisopliae with 0,039% of neem oil (C8. The esporulation was also significantly reduced by the neem oil

  17. Evaluation of Some Biocontrol Agents/Antagonistic Microbes Against Pastule Development of Leaf Rust of Wheat Caused by Puccinia recondita f. sp. Tritici Roberge ex. Desmaz (Erikson and Henn D.M. Henderson

    Directory of Open Access Journals (Sweden)

    A. Sheroze

    2002-01-01

    Full Text Available Out of five biocontrol agents/antagonistic microbes viz., Verticillium lecanii, Paecilomyces fumosoroseus, Beauveria bassiana, Cladosporium cladosporiodes and Metarrhizium anisopliae, Beauveria bassiana proved the best in retarding the postulation/rust development in wheats. When the microbes tested alone against leaf rust development, B. bassiana proved excellent and in combination with Verticillium lecanii and Paecilomyces furnosoroseus. Although there was an increase in colony diameter after 2nd week but the pattern of growth was the same as after one week of incubation of bio-control agents application.

  18. Ecological aspects of a Cosmopolites sordidus (Germar (Coleoptera: Curculionidae population in São Miguel do Iguaçu, PR./ Aspectos ecológicos da população de Cosmopolites sordidus, (Germar (Coleoptera: Curculionidae em São Miguel do Iguaçu, PR

    Directory of Open Access Journals (Sweden)

    Cristiane Rohde

    2006-06-01

    Full Text Available The population dynamics of Cosmopolites sordidus (Germar was studied in banana crops (cultivar Nanicão at São Miguel do Iguaçu, PR, using roof-tile-like baits, between June/2003 and May/2004. Adults infected by entomopathogenic fungi were recorded, and predators were also found on the baits. A comparative bioassay was carried out between the Beauveria bassiana isolate obtained from the experiment area and from other regions in Brazil against C. sordidus adults. The population peaks of C. sordidus adults occurred in June and July, a period with mild temperatures and low precipitation. The population of C. sordidus larvae, however, was concentrated in December. The insect predators found in the area were insects of the following orders: Coleoptera (Carabidae, Dermaptera (Forficulidae, Hemiptera (Reduviidae, Hymenoptera (Formicidae, and spiders of the families Ctenidae, Clubionidae, and Lycosidae, with a population peak two months after the pest population peak. A low number of C. sordidus adults infected by B. bassiana was found, with an annual mean of 0.44%. In the laboratory, the B. bassiana isolates were pathogenic to the insects.Estudou-se a dinâmica populacional de Cosmopolites sordidus (Germar em cultivo de banana(cultivar Nanicão, em São Miguel do Iguaçu, PR, através de iscas do tipo telha, entre junho/2003 a maio/2004. Atribuiu-se conceito ao estado de conservação da isca, visando observar sua durabilidade e atratividade. Registraram-se adultos infectados por fungos entomopatogênicos, sendo também encontrados predadores nas iscas. Realizou-se um bioensaio com isolados de Beauveria bassiana da área experimental e de Centros de Pesquisa do Brasil, para avaliar a patogenicidade em C. sordidus. Verificou-se que os picos populacionais de adultos de C. sordidus ocorreram em junho e julho, período de temperaturas amenas e baixas precipitações, enquanto que as larvas foram mais abundantes em dezembro. Os insetos predadores

  19. Cloning and sequence analysis of cDNA and upstream sequence of Bbhsp70 gene from Beauveria bassiana%球孢白僵菌热休克蛋白基因Bbhsp70的cDNA及上游序列克隆与分析

    Institute of Scientific and Technical Information of China (English)

    谢翎; 陈红梅; 蒲顺昌; 汤强; 李增智; 黄勃

    2009-01-01

    运用SMART RACE RT-PCR技术与DNA步移技术,首次从球孢白僵菌中克隆出完整的热休克蛋白基因Bbhsp70编码区序列及上游序列.该基因cDNA全长2405bp,5'端非翻译区171bp,3'端非翻译区263bp,开放阅读框(ORF)1971bp,编码656个氨基酸.成熟蛋白理论分子量为71.3kDa,理论等电点为4.92.上游序列长度3559bp,其中有305bp序列与cDNA序列重叠.分析表明,上游序列中没有明显的TAYA-盒和CAAT-盒,但含有CCAAT-binding factor、GC-box等重要的转录因子结合位点,以及热激应答元件(HSE)和GATA元件等启动子顺式调控元件.

  20. Compatibility of Encarsia formosa (Hymenoptera: Aphelinidae with Commercial Products Under Laboratory Conditions

    Directory of Open Access Journals (Sweden)

    Jennifer Barrera Mojica

    2013-04-01

    Full Text Available The greenhouse white fly, Trialeurodes vaporariorum one of the major pests of tomatoes under greenhouse conditions, but, Its mainly controlled with chemical insecticides. However, there are alternative control strategies as entomopathogens fungi and parasitoids (Encarsia formosa. In this study we evaluated the compatibility of commercial product with adults and pupae of E. formosa under laboratory conditions. Eight treatments were evaluated for adults and pupae of the parasitoid, including two concentrations of the entomopathogenic fungus Beauveria bassiana (5 x 107 and 5 x 109 conidia/ml, commercial doses of four chemical products commonly used to control pests on tomato crops and two controls. These treatments were applied directly on parasitoids, and their mortality rate on adults and pupae were recorded daily. There was no difference in E. formosa pupae among relative with the Bacillus thuringiensis products (p > 0.05, indicating that its compatible with the parasitoid pupae under laboratory conditions. Finally, it was found that products with active ingredients of Tiocyclam hidrogenoxalato and B. thuringiensis are incompatibles with E. formosa adults under laboratory conditions.COMPATIBILIDAD DE Encarsia formosa (HYMENOPTERA: APHELINIDAE CON PRODUCTOS COMERCIALES EN CONDICIONES DE LABORATORIO La mosca blanca de los invernaderos, Trialeurodes vaporariorum, es una de las principales plagas de cultivos de tomate bajo invernadero y es controlada principalmente con insecticidas químicos. Sin embargo, existen estrategias alternativas de control como hongos entomopatógenos (Beauveria bassiana y enemigos naturales como parasitoides (Encarsia formosa. En el presente estudio se evaluó la compatibilidad de productos comerciales con adultos y pupas de E. formosa bajo condiciones de laboratorio. Se evaluaron ocho tratamientos para pupas y adultos del parasitoide, incluyendo dos concentraciones del hongo entomopatógeno Beauveria

  1. 4-Isopropyl-2,6-bis(1-phenylethylaniline 1, an Analogue of KTH-13 Isolated from Cordyceps bassiana, Inhibits the NF-κB-Mediated Inflammatory Response

    Directory of Open Access Journals (Sweden)

    Woo Seok Yang

    2015-01-01

    Full Text Available The Cordyceps species has been a good source of compounds with anticancer and anti-inflammatory activities. Recently, we reported a novel compound (4-isopropyl-2,6-bis(1-phenylethylphenol, KTH-13 with anticancer activity isolated from Cordyceps bassiana and created several derivatives to increase its pharmacological activity. In this study, we tested one of the KTH-013 derivatives, 4-isopropyl-2,6-bis(1-phenylethylaniline 1 (KTH-13-AD1, with regard to anti-inflammatory activity under macrophage-mediated inflammatory conditions. KTH-13-AD1 clearly suppressed the production of nitric oxide (NO and reactive oxygen species (ROS in lipopolysaccharide (LPS and sodium nitroprusside- (SNP- treated macrophage-like cells (RAW264.7 cells. Similarly, this compound also reduced mRNA expression of inducible NO synthase (iNOS and tumor necrosis factor-α (TNF-α, as analyzed by RT-PCR and real-time PCR. Interestingly, KTH-13-AD1 strongly diminished NF-κB-mediated luciferase activities and nuclear translocation of NF-κB family proteins. In accordance, KTH-13-AD1 suppressed the upstream signaling pathway of NF-κB activation, including IκBα, IKKα/β, AKT, p85/PI3K, and Src in a time- and dose-dependent manner. The autophosphorylation of Src and NF-κB observed during the overexpression of Src was also suppressed by KTH-13-AD1. These results strongly suggest that KTH-13-AD1 has strong anti-inflammatory features mediated by suppression of the Src/NF-κB regulatory loop.

  2. Antimicrobial properties of nest volatiles in red imported fire ants, Solenopsis invicta (hymenoptera: formicidae)

    Science.gov (United States)

    Wang, Lei; Elliott, Brad; Jin, Xixuan; Zeng, Ling; Chen, Jian

    2015-12-01

    The antimicrobial property of volatiles produced by red imported fire ants, Solenopsis invicta, against Beauveria bassiana, a common entomopathogenic fungus, was demonstrated. The germination rate of B. bassiana spores was significantly reduced after they were exposed to volatiles within an artificial ant nest. Since the air that contained the same level of O2 and CO2 as that in artificial fire ant nests did not suppress the germination rate of B. bassiana, the observed reduction of germination rate must be caused by the toxicity of nest volatiles. Nest fumigation may be an important component of the social immune system in S. invicta.

  3. Inactivation of certain insect pathogens by ultraviolet radiation

    International Nuclear Information System (INIS)

    The UV-sensitivity of two baculoviruses (granulosis virus, nuclear polyhedrosis virus) and two entomopathogenic microorganisms (Bacillus thuringiensis, Beauveria bassiana) was determined by radiation tests. In the far UV (254 nm) the stability, measured at an inactivation rate of 99%, was in declining order: nuclear polyhedra >= conidia of B. bassiana > granula > spores of B. thuringiensis >= vegetative cells of B. thuringiensis. In the near UV (285-380 nm) the following order could be found: conidia of B. bassiana >= nuclear polyhedra > spores of B. thuringiensis >= granula > vegetative cells of B. thuringiensis. Far UV had a much higher germicidal effect for all pathogens tested than near UV. (orig.)

  4. Sweet pepper seed responses to inoculation with microorganisms and coating with micronutrients, aminoacids and plant growth regulators Tratamento de sementes de pimentão com microrganismos, micronutrientes, aminoácidos e reguladores de crescimento

    Directory of Open Access Journals (Sweden)

    Kênia Almeida Diniz

    2009-06-01

    Full Text Available Small sized seeds, such as the horticultural species, have limited quantities of reserves that can be balanced by coating then with essential nutrients for their initial development. In addition, inoculation of the seeds with microorganisms may protect the plants against phytopathogens, thus enhancing their growth. The present work had the objective of evaluate the physiological quality and seedling development of sweet pepper seeds and seedlings coated with several kind of films. Seeds were first coated with polymers and then with antagonistic microorganisms (Trichoderma viride, Trichoderma polysporhum, Trichoderma stromaticum, Beauveria bassiana, Metarhizium anisopliae, mycorrhizas, aminoacids, micronutrients and plant growth regulators. Evaluation was performed for percentage of germination and for seedling emergence, speed of emergence index, number of plants, dry mass of the aerial and root parts and height of the seedlings. Inoculation with Trichoderma viride increased the percentage and rate of the seedlings emergence Inoculation with Trichoderma viride, Metarhizium anisopliae and mycorrhizas promote better seedling development; seed microbiolization with microorganisms Trichoderma viride, T. polysporhum, T. stromaticum, Beauveria bassiana, Metarhizium anisopliae. Mycorrhizas mixture negatively affected seeds and seedling quality. Seed covering with plant growht regulator, at a 5 mL kg-1 dose increased the roots dry matter.Em sementes pequenas, como as de espécies hortícolas, as limitadas quantidades de reservas podem ser equilibradas por meio do seu recobrimento com nutrientes essenciais para o seu desenvolvimento inicial. Além disso, a inoculação dessas sementes com microrganismos, além de proteger as plantas contra fitopatógenos, pode promover o seu crescimento. Assim, objetivo do presente trabalho foi avaliar o efeito de tipos de revestimentos na qualidade de sementes e mudas de pimentão (Capsicum annum. Para tanto, as

  5. El liberalsocialismo para Bobbio y para nosotros

    OpenAIRE

    Bovero, Michelangelo

    2006-01-01

    Partiendo de las ideas sobre el liberalsocialismo en el pensamiento de Norberto BOBBIO y hallando en el ámbito del constitucionalismo el terreno propicio, no ya para un compromiso, sino para una forma de reconciliación entre la tradición liberal y la socialista, el autor propone una caracterización del liberalsocialismo articulada en dos niveles: en un “liberalsocialismo mínimo” (o liberalsocialismo para la democracia), entendido como un “mínimo indispensable para la democracia”, y en un “lib...

  6. Susceptibility of entomopathgenic fungi to OMRI certified surfactants for biopesticide applications

    Science.gov (United States)

    Three entomopathgenic fungi, Beauveria bassiana, Metarhizium brunneum,and Isaria fumosorosea were evaluated for their compatibility with six surfactants. The surfactants are certified to comply with the U.S. National organic standards and are permitted to be used in organic production systems. The f...

  7. Formulating entompathogens for control of boring beetles in avocado orchards

    Science.gov (United States)

    A foam formulation of Beauveria bassiana was adapted to control boring beetles in avocado orchards. The two geographically independent avocado growing areas in the United States are threatened by emerging diseases vectored by boring beetles. In the California growing region, Fusarium dieback is vect...

  8. Entomopathogenic fungi isolates to control the borer of yerba mate (Hedypathes betulinus Kluger (Coleoptera; CerambycidaeIsolados de fungos entomopatogênicos visando ao controle da broca da erva-mate (Hedypathes betulinus Kluger (Coleoptera; Cerambycidae

    Directory of Open Access Journals (Sweden)

    André Luis Pereira Fanti

    2013-09-01

    ênico Beauveria bassiana (Bals. Vuill. e 18 isolados de Metarhizium anisopliae (Metsch. Sorok.. Inicialmente, avaliou-se a virulência dos isolados imergindo adultos da broca da erva-mate em suspensão fungica contendo 1×108 conídios mL-1, e posteriormente os que obtiveram maior mortalidade confirmada, foram selecionados para segunda etapa, na qual avaliou-se a virulência e crescimento vegetativo, produção de conídios em meio de cultura, arroz e em cadáveres de broca. Destacaram-se três isolados de B. bassiana (UNIOESTE 4, UNIOESTE 52 e UNIOESTE 64, e um de M. anisopliae (IBCB 352, atingindo mortalidade confirmada igual ou superior a 90% na primeira etapa, sendo estes selecionados para etapa posterior, juntamente com isolado padrão, CG 716. O isolado IBCB 352 de M. anisopliae, apesar de ser o único da espécie a ser selecionado para a segunda etapa, provocou a maior mortalidade confirmada e conidiogênese em cadáveres de broca, indicando uma elevada produção de inóculo, sendo este, o indicado para a campo.

  9. Normas para vivienda

    OpenAIRE

    Coupé, Françoise

    1990-01-01

    El Seminario Taller Normas para Vivienda, analiza los efectos de las normas vigentes en el país, sobre el desarrollo urbano, la vivienda y la calidad de vida, para participar en la discusión del Estatuto Metropolitano de Usos del Suelo, Urbanismo y Construcción. Se presenta en este Boletín algunos resultados del trabajo realizado.

  10. Leer para Sophia

    OpenAIRE

    Cassany, Daniel

    2009-01-01

    Leer para Sophia re??ne algunos de mis trabajos m??s recientes sobre la lectura, desde perspectivas complementarias, te??ricas y pr??cticas, destacando el tema de futuro de la lectura electr??nica o en l??nea. El t??tulo de este volumen tiene un doble sentido : primero apela al significado griego del vocablo sophia (sabidur??a), para iluminar uno de los prop??sitos esenciales de la lectura: aprender y comprender; luego quiere agradecer ...

  11. Toxicity of natural insecticides on the larvae of wheat head armyworm, Dargida diffusa (Lepidoptera: Noctuidae).

    Science.gov (United States)

    Reddy, Gadi V P; Antwi, Frank B

    2016-03-01

    The wheat head armyworm, Dargida (previously Faronta) diffusa (Walker) (Lepidoptera: Noctuidae), is widely distributed in North American grasslands and is most common on the Great Plains, where it is often a serious pest of corn and cereal crops. Six commercially available botanical or microbial insecticides used against D. diffusa were tested in the laboratory: Entrust(®) WP (spinosad 80%), Mycotrol(®) ESO (Beauveria bassiana GHA), Aza-Direct(®) (azadirachtin), Met52(®) EC (Metarhizium brunneum F52), Xpectro(®) OD (Beauveria bassiana GHA+pyrethrins), and Xpulse(®) OD (Beauveria bassiana GHA+azadirachtin). Concentrations of 0.1, 0.5, 1.0 and 2.0 fold the lowest labelled rates of formulated products were tested for all products, while for Entrust WP additional concentrations of 0.001 and 0.01 fold the label rates were also assessed. Survival rates were determined from larval mortality at 1-9 days post treatment application. We found that among the tested chemicals, Entrust(®) (spinosad) was the most effective, causing 83-100% mortality (0-17% survival rate) at day 3 across all concentrations. The others, in order of efficacy from most to least, were Xpectro(®) (B. bassiana GHA+pyrethrins), Xpulse(®)OD (B. bassiana GHA+azadirachtin), Aza-Direct(®) (azadirachtin), Met52(®) EC (M. brunneum F52), and Mycotrol(®) ESO (B. bassiana GHA). These products and entomopathogenic fungi caused 70-100% mortality (0-30% survivability) from days 7 to 9. The tested products and entomopathogenic fungi can be used in management of D. diffusa. PMID:26855414

  12. 4-Isopropyl-2,6-bis(1-phenylethyl)aniline 1, an Analogue of KTH-13 Isolated from Cordyceps bassiana, Inhibits the NF-κB-Mediated Inflammatory Response.

    Science.gov (United States)

    Yang, Woo Seok; Ratan, Zubair Ahmed; Kim, Gihyeon; Lee, Yunmi; Kim, Mi-Yeon; Kim, Jong-Hoon; Cho, Jae Youl

    2015-01-01

    The Cordyceps species has been a good source of compounds with anticancer and anti-inflammatory activities. Recently, we reported a novel compound (4-isopropyl-2,6-bis(1-phenylethyl)phenol, KTH-13) with anticancer activity isolated from Cordyceps bassiana and created several derivatives to increase its pharmacological activity. In this study, we tested one of the KTH-013 derivatives, 4-isopropyl-2,6-bis(1-phenylethyl)aniline 1 (KTH-13-AD1), with regard to anti-inflammatory activity under macrophage-mediated inflammatory conditions. KTH-13-AD1 clearly suppressed the production of nitric oxide (NO) and reactive oxygen species (ROS) in lipopolysaccharide (LPS) and sodium nitroprusside- (SNP-) treated macrophage-like cells (RAW264.7 cells). Similarly, this compound also reduced mRNA expression of inducible NO synthase (iNOS) and tumor necrosis factor-α (TNF-α), as analyzed by RT-PCR and real-time PCR. Interestingly, KTH-13-AD1 strongly diminished NF-κB-mediated luciferase activities and nuclear translocation of NF-κB family proteins. In accordance, KTH-13-AD1 suppressed the upstream signaling pathway of NF-κB activation, including IκBα, IKKα/β, AKT, p85/PI3K, and Src in a time- and dose-dependent manner. The autophosphorylation of Src and NF-κB observed during the overexpression of Src was also suppressed by KTH-13-AD1. These results strongly suggest that KTH-13-AD1 has strong anti-inflammatory features mediated by suppression of the Src/NF-κB regulatory loop. PMID:26819495

  13. New solid-state fermentation chamber for bulk production of aerial conidia of fungal biocontrol agents on rice.

    Science.gov (United States)

    Ye, S D; Ying, S H; Chen, C; Feng, M G

    2006-06-01

    A novel solid-state fermentation apparatus, namely an upright multi-tray conidiation chamber, was developed to facilitate the production of aerial conidia of fungal biocontrol agents, such as Beauveria bassiana. The chamber with 25 bottom-meshed metal trays had a capacity of > or =50 kg rice with each tray holding > or =2 kg. In repeated trials, a mean yield of 2.4 (1.8-2.7) x 10(12) conidia kg(-1) rice was harvested from the 7-day cultures of B. bassiana in a fully loaded chamber. The new apparatus has a high potential for bulk production of fungal conidia. PMID:16786244

  14. Transcriptional control of fungal cell cycle and cellular events by Fkh2, a forkhead transcription factor in an insect pathogen

    OpenAIRE

    Wang, Juan-juan; Qiu, Lei; Cai, Qing; Ying, Sheng-Hua; Feng, Ming-Guang

    2015-01-01

    Transcriptional control of the cell cycle by forkhead (Fkh) transcription factors is likely associated with fungal adaptation to host and environment. Here we show that Fkh2, an ortholog of yeast Fkh1/2, orchestrates cell cycle and many cellular events of Beauveria bassiana, a filamentous fungal insect pathogen. Deletion of Fkh2 in B. bassiana resulted in dramatic down-regulation of the cyclin-B gene cluster and hence altered cell cycle (longer G2/M and S, but shorter G0/G1, phases) in unicel...

  15. Integrated pest management and entomopathogenic fungal biotechnology in the Latin Americas: II key research and development prerequisites

    International Nuclear Information System (INIS)

    In the first part of this review article (Valencia and Khachatourians, 1998) we presented the special opportunity that entomopathogenic fungi (EPF) offer for integrated pest management (IPM) in the Latin Americas. As expected, along with the opportunities, there are challenges for the use of EPF. First that there are only two fungi, Beauveria bassiana and Metarhizium anisopliae, for which some prerequisite knowledge of basic and applied mycology for industrial research and development (R and D) are in place. Because of precedent setting leadership in the development of certain EPF, e.g., B. bassiana in IPM, Latin America stands to contribute to and gain from future

  16. Entomopathogenic fungi for control of arthropod pests in egg production facilities

    DEFF Research Database (Denmark)

    Steenberg, Tove; Kilpinen, Ole

    Beauveria bassiana and other species of entomopathogenic fungi are potential candidates for microbial control of major pests in egg layers, e.g. the poultry red mite (Dermanyssus gallinae), the housefly (Musca domestica) and the darkling beetle (Alphitobius diaperinus). We have selected an isolate...... of B. bassiana with high efficacy against all target pests in laboratory assays, and will review the existing information on the natural occurrence of these fungi in farms with confined animals and discuss the possibilities and constraints for exploitation of entomopathogenic fungi as control agents...

  17. Tiempo para un cambio

    Science.gov (United States)

    Woltjer, L.

    1987-06-01

    En la reunion celebrada en diciembre dei ano pasado informe al Consejo de mi deseo de terminar mi contrato como Director General de la ESO una vez que fuera aprobado el proyecto dei VLT, que se espera sucedera hacia fines de este aAo. Cuando fue renovada mi designacion hace tres aAos, el Consejo conocia mi intencion de no completar los cinco aAos dei contrato debido a mi deseo de disponer de mas tiempo para otras actividades. Ahora, una vez terminada la fase preparatoria para el VLT, Y habiendose presentado el proyecto formalmente al Consejo el dia 31 de marzo, y esperando su muy probable aprobacion antes dei termino de este ano, me parece que el 10 de enero de 1988 presenta una excelente fecha para que se produzca un cambio en la administracion de la ESO.

  18. Combinatoria para la escuela

    OpenAIRE

    Sarmiento, Benjamín; Fernández, Felipe

    2014-01-01

    Con este cursillo se pretende mostrar a los asistentes que el análisis combinatorio no es una temática exclusiva para los que se inician en el estudio de las probabilidades y que no se requiere llegar a ese nivel, para empezar a conocer los principios combinatorios y las reglas básicas de esta rama. Por eso se ha seleccionado un conjunto de problemas y situaciones que se puedan llevar a la escuela. A lo largo del cursillo se propondrán situaciones clásicas relacionadas con los principios y re...

  19. Instalaciones para hotel rural

    OpenAIRE

    Roig Riera, José Antonio

    2015-01-01

    El presente proyecto cuenta con la información necesaria para el desarrollo de las instalaciones de un hotel rural. Dichas instalaciones son; la eléctrica, la de agua caliente sanitaria, las telecomunicaciones y la climatización. En el apartado de la instalación eléctrica, se han calculado todos los cables necesarios para el correcto funcionamiento del hotel, partiendo de las potencias demandadas en cada punto de consumo. Se ha calculado la línea general de alimentación, acomet...

  20. Instrucciones para autores

    OpenAIRE

    Cramer, Thomas

    2012-01-01

    Instrucciones para autoresNota preliminar: ¡Es de suma importancia que antesde enviar cualquier documento a la Revista GeologíaColombiana, lea y cumpla cuidadosamente cada uno delos subíndices de las Normas para autores!A partir del Volumen 35 (2010) recibimos artículosprincipalmente a través del sistema digital enhttp://www.revistas.unal.edu.co/index.php/geocol/index.Si quiere enviar un artículo, por favor regístrese comoAutor en el menú INGRESAR (aquí pueden registrarsetambién evaluadores u...

  1. Planta fotovoltaica para vivienda rural

    OpenAIRE

    Tartaglia, Morgana; Magariello, Antonio

    2009-01-01

    El presente proyecto se pone el objetivo de satisfacer la necesidad de suministro eléctrico para una vivienda rural. Se supone que dicha vivienda no tenga enlace a la red eléctrica, y por lo tanto se ha optado para un sistema de generación alternativo: una planta fotovoltaica. Para implementar los cálculos se han utilizado tres software: Excell y Matlab, para los estudios de funciones, y foto-RED para la simulación del comportamiento energético de la vivienda y para el cálcu...

  2. Tempo para aprender vs tempo para brincar

    OpenAIRE

    Correia, Ana Rita Coelho

    2016-01-01

    Relatório de Estágio apresentado à Escola Superior de Educação de Paula Frassinetti para a obtenção de grau de Mestre em Educação Pré-Escolar e Ensino do 1º Ciclo do Ensino Básico Esta investigação surge da reflexão sobre a urgência atual, generalizada por parte de muitos pais e encarregados de educação, bem como de algumas instituições, no sentido de escolarizar as crianças precocemente, com vista a que estas possam chegar ao ensino básico “mais preparadas”, esquecendo-se muitas ...

  3. Aprendizaje cooperativo para ELE

    OpenAIRE

    Cassany, Daniel

    2004-01-01

    Presentación sucinta para docentes de español como lengua extranjera del conjunto de propuestas metodológicas conocidas bajo la denominación aprendizaje cooperativo : origen, fundamentación, principales principios psicopedagógicos y algunas propuestas prácticas.

  4. Effects of biorational pesticides on four coccinellid species (Coleoptera: Coccinellidae) having potential as biological control agents in interiorscapes.

    Science.gov (United States)

    Smith, S F; Krischik, V A

    2000-06-01

    The direct toxicity of insecticidal soap, horticultural oil, Azatin, an extract from the Neem tree containing azadiractin, and BotainiGard, a commercial formulation of the entomopathogenic fungus Beauveria bassiana, was assessed on adults of four species of coccinellids--Hippodamia convergens (Guérin-Ménéville), Coleomegilla maculata (DeGeer), Harmonia axyridis Pallas, and Cryptolaemus montrouzieri Mulsant. All biorationals caused less mortality than a conventional pesticide, carbaryl (Sevin). Horticultural oil (Sunspray ultrafine oil) consistently had no effect on beetle survivorship. Insecticidal soap (M-Pede) significantly reduced survival in all replicates for C. maculata and in at least one of the three replicates for the other three coccinellid species. Beauveria bassiana (BotaniGard) significantly reduced survival of C. montrouzieri at 72 h after spray in all three replicates. Azatin reduced survivorship in only one species, C. maculata, in only one of the three replicates. PMID:10902323

  5. Consejos para pacientes

    OpenAIRE

    M. Eulalia Lucio-Villegas Menéndez; Laura López González; M. Isabel Gutiérrez Pérez; Natalia Aresté Lluch; M. Luisa Morató Agustí; Santiago Pérez Cachafeiro

    2014-01-01

    En el cuidado de las heridas es tan importante saber qué hacer como saber qué no hacer. Lo primero es valorar la gravedad de la lesión y saber si es necesario acudir a un centro sanitario o no. Si la herida es simple, lo más recomendable es hacer una buena limpieza con suero o agua tras lavado de manos, realizando la desinfección de esta con el antiséptico más adecuado. Los antisépticos no deben usarse para la limpieza de las heridas (usar suero fisiológico o agua del grifo) ni para la cur...

  6. Educando para la ignorancia

    Directory of Open Access Journals (Sweden)

    Miguel Durán

    1996-06-01

    Full Text Available Más que describir una situación particular, los autores buscan con este escrito motivar al estudiante para que asuma posiciones críticas; así como dar un campanazo de alerta a los profesores, en relación a los conocimientos que transmiten a sus alumnos y la forma en que lo hacen; todo con el ánimo de generar verdaderos espacios de reflexión en la universidad.

  7. Arquitectura para el conocimiento

    OpenAIRE

    Moreno-Torres Sánchez, Rosario; Sánchez Relinque, Javier

    2011-01-01

    La Málaga del siglo XXI se prepara para hacer de la investigación y de la innovación su nuevo sello. Entrevista a tres de los artífices de la urbanización y la edificación de la ampliación de Teatinos, clave en el eje sociocultural, científico y empresarial que conforman ya la capital, UMA y Parque Tecnológico.

  8. INICIATIVAS PARA EL CAMBIO

    Directory of Open Access Journals (Sweden)

    César Alfonso Defrancisco-Larrañaga

    2013-07-01

    Full Text Available El planeta no atraviesa por su mejor momento en materia de conservación y renovación de sus recursos naturales. Claramente en los últimos tiempos los recursos hídricos han venido haciéndose cada vez menores; el hombre ha notado con preocupación y vivido en carne propia este fenómeno, que de no ser tratado a tiempo, podría atentar contra la existencia misma. Esto lo ha alentado a buscar métodos que sirvan como solución para contrarrestar éste mal y crear conciencia entre sus iguales, para así poder garantizar su permanencia y la de su entorno durante muchas generaciones. En países desarrollados del continente europeo y en algunos lugares de América del norte, el uso de sistemas de reutilización y tratamiento de aguas grises y aprovechamiento de las aguas lluvias se ha convertido en una constante y nos están dando las pautas para poder seguir el ejemplo y así de esta manera poder aportar a la causa ambiental y a su vez crear un ahorro en nuestros gastos mensuales de consumo.

  9. Desarrollo de una metodología de crianza en laboratorio del gusano cogollero del maíz Spodoptera frugiperda (Smith (Lepidoptera: Noctuidae como posible hospedante de insectos biocontroladores de interés agrícola

    Directory of Open Access Journals (Sweden)

    Yerlin Chacón Castro

    2009-11-01

    Full Text Available Con el fin de desarrollar una metodología de crianza en laboratorio que permitala producción masiva de organismos biocontroladores de Spodopterafrugiperda, se colectó ejemplares en estado larval en cultivares de maíz de diferentes localidades de Costa Rica. Dichas larvas fueron transportadas hasta el Laboratorio de Biocontroladores del CIB-ITCR, Cartago.Al inicio del ensayo, las larvas fueron alimentadas con hojas tiernas demaíz por espacio de dos meses. Luego se evaluó la dieta artificial BIO-MIX H-89,modificada para el desarrollo de huevo hasta pupa y durante la fase de adulto,se utilizó una solución de miel de abeja al 10% (v/v como fuente de alimento.Se aplicó un ANOVA para medir las diferencias entre cada etapa del ciclo devida con ambas dietas y se encontró que al implementar la dieta artificial, se redujo elciclo de vida de esta especie a 45,10±1,20 días, y se prolongó el periodo larval a 26,80±1,41 días. Asimismo, se identificó el hongo entomopatógeno Beauveria bassiana como controlador biológico de esta especie.

  10. Bacillus thuringiensis: una aplicación de la ciencia

    Directory of Open Access Journals (Sweden)

    Ninfa María Rosas García

    2014-12-01

    Full Text Available Decía Louis Pasteur “Il n’y a pas des sciences appliquées…mais il y a des applications de la science” que significa “No hay ciencias aplicadas…sino aplicaciones de la ciencia”. Desde el siglo antepasado el uso de herramientas biológicas para el control de plagas de insectos, empezó a comprenderse como una posibilidad de contrarrestar el efecto nocivo de las plagas en los cultivos, sin embargo fueron necesarios casi dos siglos para que sus ventajas así como su eficiencia y eficacia fueran realmente aprovechadas. Recordando un poco de historia en 1835 Agostino Bassi, científico italiano, descubrió una enfermedad infecciosa en Bombix mori, mejor conocido como el gusano de seda, causada por la muscardina blanca, Beauveria bassiana, lo que le valió una inmensa notoriedad. Varias décadas después Pasteur y Koch redescubrieron sus principios y Eli Metchnikoff en 1878 puso en práctica el uso de la muscardina verde, Metarhizium anisopliae, contra larvas del escarabajo Anisoplia austriaca.

  11. Cotton in Benin: governance and pest management

    OpenAIRE

    Togbe, C.E.

    2013-01-01

    Key words: cotton, synthetic pesticides, neem oil (Azadirachta indica), Beauveria bassiana, Bacillus thuringiensis, field experiment, farmers’ participation   Pests are one of the main factors limiting cotton production worldwide. Most of the pest control strategies in cotton production rely heavily on the application of synthetic pesticides. The recurrent use of synthetic pesticides has large consequences for the environment (air, water, fauna, and flora) and human health. In cott...

  12. Method To Enhance Growth and Sporulation of Pelletized Biocontrol Fungi †

    OpenAIRE

    Knudsen, G R; Eschen, D. J.; Dandurand, L. M.; Wang, Z. G.

    1991-01-01

    The biocontrol fungi Trichoderma harzianum, used to control soilborne plant pathogens, and Beauveria bassiana, used to control insect pests, were formulated as mycelial biomass in alginate pellets with wheat bran added. After drying for 0, 4, or 16 h, pellets were placed in water or in aqueous solutions of polyethylene glycol (PEG) 8000 for 4 to 24 h and then allowed to continue drying. PEG-treated pellets containing T. harzianum showed significantly greater proliferation of hyphae in soil th...

  13. Evolution in biocontrol strains: insight from the harlequin ladybird Harmonia axyridis

    OpenAIRE

    Tayeh, Ashraf; Estoup, Arnaud; Laugier, Guillaume; Loiseau, Anne; Turgeon, Julie; Toepfer, Stefan

    2012-01-01

    After being used as a biocontrol agent against aphids for decades without harmful consequences, the Asian harlequin ladybird Harmonia axyridis has suddenly become an invasive pest on a worldwide scale. We investigate the impact of captive breeding on several traits of this ladybird such as genetic diversity, fecundity, survival and pathogen resistance. We conducted an experiment in the laboratory to compare the fecundity and the susceptibility to the entomopathogenic fungus Beauveria bassiana...

  14. Biochemiluminescence of certain fungi

    OpenAIRE

    Janusz Sławiński; Danuta Sławińska; Irena Majchrowicz

    2014-01-01

    Twelve species of fungi growing on the Sabouraud medium in darkness and illumination in an incubator, were tested to find out their ability to emit the ultra-weak biochemiluminescence. Using a sensitive photon-counling device, it was possible to measure biochemiluminescence intensity during ten days of cultures growth. Boletus edulis, Pestalotia funerea and Microsporum gypseum displayed biochemiluminescence, while Aspergillus nidulans, A. quadrilineatus, Beauveria bassiana, Macrophoma candoll...

  15. S-(−)-10,11-Dihydroxyfarnesoic Acid Methyl Ester Inhibits Melanin Synthesis in Murine Melanocyte Cells

    OpenAIRE

    Seung-Hwa Baek; Jun-Won Ahn; Sung-Hee Nam; Cheol-Sik Yoon; Jae-Cheon Shin; Sang-Han Lee

    2014-01-01

    The development of antimelanogenic agents is important for the prevention of serious aesthetic problems such as melasmas, freckles, age spots, and chloasmas. In the course of screening for melanin synthesis inhibitors, we found that the culture broth from an insect morphopathogenic fungus, Beauveria bassiana CS1029, exhibits potent antimelanogenic activity. We isolated and purified an active metabolite and identified it as S-(−)-10,11-dihydroxyfarnesoic acid methyl ester (dhFAME), an insect j...

  16. Efficacy of Entomopathogenic Nematodes and Entomopathogenic Fungi against Masked Chafer White Grubs, Cyclocephala spp. (Coleoptera: Scarabaeidae)

    OpenAIRE

    Wu, ShaoHui

    2013-01-01

    Entomopathogenic nematodes (EPN) (Heterorhabditis bacteriophora and H. megidis) and entomopathogenic fungi (EPF) (Metarhizium anisopliae and Beauveria bassiana) were evaluated for efficacy against masked chafer white grub, Cyclocephala spp., under laboratory and greenhouse conditions, as well as their efficacy against various grub stages in the field.  Under both laboratory and greenhouse conditions, additive interactions were found between EPN and EPF in their combined application against Cy...

  17. para mejorar el %R

    Directory of Open Access Journals (Sweden)

    Alfredo Díaz Mata

    2001-01-01

    Full Text Available En este trabajo se revisan dos indicadores técnicos bursátiles que están estrechamente relacionados, el oscilador estocástico %K de Lane y el oscilador %R de Williams; asimismo, se evalúa el uso de dos mecanismos asociados con el primero y que no suelen utilizarse con el %R: el proceso de frenado (slowing y el uso de un promedio móvil del propio oscilador estocástico como disparadores de señales de compra y de venta. Realizando simulaciones con 27 acciones y el Índice de Precios y Cotizaciones de la Bolsa Mexicana de Valores se verifica la hipótesis principal y se comprueba que, efectivamente, en muchos casos, el uso del proceso de frenado con el oscilador %R de Williams permite tomar mejores decisiones. Por otro lado, se concluye que de los dos disparadores de señales el que mejor funciona, tanto para %K como para %R es el uso de cotas inferior y superior. Este artículo surgió en el curso de una investigación sobre el análisis técnico bursátil de acciones que se puede realizar en su totalidad por computadora y que, esencialmente, excluye el análisis gráfico. Uno de los propósitos del estudio es determinar si es posible, y bajo qué mecanismos, establecer un sistema de análisis bursátil que le permita al inversionista tomar decisiones de inversión en acciones en la Bolsa Mexicana de Valores sin tener que emplear la considerable cantidad de tiempo que es necesario para el análisis gráfico tradicional. Durante este estudio se realizó un análisis preliminar de unos 120 indicadores técnicos para, por un lado, conocerlos con cierto detalle y, por otra parte, aislar aquellos que prometían ser de utilidad para el objetivo de la investigación. Fue en este proceso cuando se detectó que existen dos indicadores que están relacionados y que permiten un análisis por separado que tiene, cuando menos, dos ventajas. En primer lugar está el placer que da a quien gusta de estos temas encontrarse con indicadores que, de acuerdo

  18. Comunicar para la salud

    OpenAIRE

    Lic. Eva Bocco

    1998-01-01

    Con este trabajo quiero plantearles una inquietud en torno al rol que nos cabe a los comunicadores en el área de la salud desde la perspectiva de la comunicación para la salud. ¿Se puede pensar la salud pública desvinculada de la comunicación? ¿La comunicación es posible sin la existencia de salud en la comunidad? ¿Qué puede hacer un comunicador en el ministerio de salud? ¿Puede un estado desarrollar políticas de salud sin la presencia de la comunicación?

  19. Instrucciones para los autores

    OpenAIRE

    Ana Silvia Bermúdez

    2011-01-01

    La Revista Colombiana de Química es una publicación científica, arbitrada del Departamento de Química, Facultad de Ciencias, Universidad Nacional de Colombia que acepta contribuciones provenientes de investigación en las diversas áreas de la química. El contenido de los artículos debe ser original, inédito y no debe haber sido enviado, total o parcialmente, para publicación a otra revista. La redacción asume el derecho de reproducción de los trabajos aceptados. Su publicación en otro medio re...

  20. Evaluación del riesgo ambiental de carbofurano en bioensayos con organismos no blanco

    Directory of Open Access Journals (Sweden)

    José Alberto Iannacone

    2011-06-01

    Full Text Available El carbofurano es uno de los plaguicidas más empleado en la agricultura peruana. El objetivo de este trabajo fue evaluar el riesgo ambiental del carbofurano en bioensayos de toxicidad, sobre once especies no destinatarias. La siguiente secuencia relativa de mayor a menor cocientes de riesgo (CR del carbofurano para los 19 puntos finales de efecto en once especies fue encontrada: Daphnia magna (mortalidad > Lemna minor (inhibición de formación de las hojas > Paracheirodon innesi (nado extraño = P. innesi (incremento del movimiento opercular > Chironomus calligraphus (mortalidad > L. minor (necrosis > P. innesi (mortalidad > L. minor (clorosis > Tetrapygus niger (inhibición de la fecundación > Coturnix japonica (mortalidad > Oncorhynchus mykiss (incremento de coloración > Ceraeochrysa cincta (no eclosión de huevos > O. mykiss (mortalidad con oxígeno > O. mykiss (mortalidad sin oxígeno > Trichogramma pretiosum (mortalidad > C. cincta (mortalidad > T. pretiosum (no emergencia de adultos > Trichogramma pintoi (mortalidad > Beauveria bassiana (inhibición del crecimiento. Los cocientes de riesgo (CR indicaron en todos los casos un alto riesgo del carbofurano principalmente en el ambiente acuático en comparación con el terrestre.Carbofuran is one of the most employed pesticides in Peruvian agriculture. This research aimed to evaluate the risk assessment in bioassays of carbofuran on eleven non-target species. The following relative sequence in decreasing ecotoxicity order in terms of RQ (Risk quotient to carbofuran to 19 end points on 11 species was found: Daphnia magna (mortality > Lemna minor (inhibition of new fronds > Paracheirodon innesi (strange swim = P. innesi (increase of opercula movement > Chironomus calligraphus (mortality > L. minor (necrosis > P. innesi (mortality > L. minor (chlorosis > Tetrapygus niger (inhibition of fertilization> Coturnix japonica (mortality > Oncorhynchus mykiss (increase of coloration > Ceraeochrysa

  1. "Colaborar para Competir"

    Directory of Open Access Journals (Sweden)

    Martha Liliana Hijuelos-Cárdenas

    2016-08-01

    Full Text Available De acuerdo con Michael Porter, los Clusters se definen como “Una agrupación de empresas e instituciones relacionadas entre sí, pertenecientes a un mismo sector o segmento de mercado, que se encuentran próximas geográficamente y que colaboran para ser más competitivas”. Los Clusters son en última instancia una herramienta de competitividad basada en la cooperación de sus miembros, y es una de las estrategias recientes, en el país, para incrementar la productividad y competitividad y las apuestas productivas desde el nivel local. Y es precisamente esta cercanía geográfica de las empresas de un mismo sector, lo que a la vez que genera la competencia entre ellas, también les facilita el acceso a insumos y a conocimientos específicos y en última instancia les permite promover la innovación.

  2. Colapso: algunas cuestiones para Teotihuacan

    OpenAIRE

    Moragas Segura, Natàlia

    2009-01-01

    En la literatura arqueológica, el uso del término Estdo para las sociedades antiguas se aplica profusamente desde la segunda mitad del siglo XIX. Alrededor de ello la academia de investigaciones ha desarrollado diversos modelos para comprender el modo de organización de dichas sociedades atentiendo a cuestiones políticas, económicas, medioambientales e ideológicas. La bibliogradia es ingente e inabarcable para un artículo, y tal vez incluso para un libro; por lo que no deben de tomarse estas ...

  3. Influence of culture media in viability test of conidia of entomopathogenic fungi Influência de meios de cultura em teste de viabilidade de fungos entomopatogênicos

    Directory of Open Access Journals (Sweden)

    Edimara Aparecida Francisco

    2006-08-01

    Full Text Available This work aimed at investigatimg whether the culture medium used in viability tests affects the conidial germination of Lecanicillium lecanii, Beauveria bassiana and Paecilomyces fumosoroseus isolates. The tests were performed on microscope slides containing one of the culture media: agar-water (AW, minimal medium (MM, potato-dextrose agar (PDA, potato-dextrose-1% yeast extract agar (PDAY, Sabouraud-dextrose-yeast extract agar (SDAY, and complete medium (CM. Three areas per slide were delimited and 0.05ml of a 5.5 x 105 conidia ml-1 suspension was applied to each area. One bioassay was performed for each isolate. Germination was determined after 15 hours of incubation at 26±0.5°C. The culture media influenced the germination of the species studied, verifying within and inter specific variations. CM and PDA provided the highest germination of L. lecanii isolates and the lowest was obtained on SDAY and AW. The germination of B. bassiana isolates was favoured by CM, PDA and PDAY media, a fact not observed in AW and MM. P. fumosoroseus isolates showed the highest germination on CM and PDA media and the lowest on SDAY. However, some isolates presented high germination on nutrient-poor media (AW and MM.O presente trabalho objetivou investigar se meios de cultura utilizados em teste de viabilidade afetam a germinação de conídios de cinco isolados de Lecanicillium lecanii, cinco de Beauveria bassiana e quatro de Paecilomyces fumosoroseus. Os testes foram realizados em lâminas de microscopia contendo um dos seguintes meios de cultura: Ágar-água (AA, Meio Mínimo (MM, Batata, dextrose e ágar (BDA, Batata, dextrose, ágar e 1% de extrato de levedura (BDAL, Sabouraud, dextrose, ágar e extrato de levedura (SDAL e Meio Completo (MC. Delimitaram-se três áreas por lâmina e em cada uma aplicou-se 0,05mL de uma suspensão com concentração de 5,5 x 105 conídios ml-1. Para cada isolado foi realizado um bioensaio, com seis tratamentos e cinco repeti

  4. Contratados peninsulares para Cuba

    Directory of Open Access Journals (Sweden)

    Iglesias García, Fe

    1994-12-01

    Full Text Available Not available.

    Ante las presiones británicas, la metrópoli española y los ideólogos de los hacendados cubanos tuvieron que dar, desde la tercera década del siglo XIX, una respuesta a la previsible escasez de mano de obra esclava. El artículo estudia los sistemas de contrata implantados en la isla para abastecer de mano de obra blanca y barata a Cuba, deteniéndose particularmente la autora en el estudio de las condiciones de semiesclavitud que se escondían en las mencionadas contratas y en el perfil de los inmigrantes (profesiones, sexo, edad, procedencia....

  5. Requerimientos para aplicaciones web

    OpenAIRE

    Oliveros, Alejandro; Wehbe, Ricardo; Rojo, Silvana del Valle; Rousselot, Julián

    2011-01-01

    El objetivo del presente proyecto es la elaboración de un conjunto de políticas, estándares, procesos, metodologías, técnicas, herramientas y métricas para aplicar en el desarrollo de aplicaciones Web, específicamente en la obtención y representación de los requerimientos que debe satisfacer el sistema o aplicación Web. Estos distintos elementos se desarrollarán en forma gradual y eventualmente se integrarán en un sitio Web que centralice toda la información. Hay varias líneas de investigació...

  6. Pequenos para idade gestacional: fator de risco para mortalidade neonatal

    OpenAIRE

    Almeida Márcia Furquim de; Jorge Maria Helena Prado de Mello

    1998-01-01

    OBJETIVO: Estudar as variáveis contempladas na Declaração de Nascimento (DN) como possíveis fatores de risco para nascimentos pequenos para a idade gestacional (PIG) e o retardo de crescimento intra-uterino como fator de risco para a mortalidade neonatal. MATERIAL E MÉTODO: As variáveis existentes na DN foram obtidas diretamente de prontuários hospitalares. Os dados referem-se a uma coorte de nascimentos obtida por meio da vinculação das declarações de nascimento e óbito, correspondendo a 2.2...

  7. Leer para Creer

    Directory of Open Access Journals (Sweden)

    Roberto Polanco-Carrasco

    2011-12-01

    Full Text Available Más allá de los prejuicios que se puedan alimentar en las aulas por -en ocasiones- brillantes exponentes de la clínica psicológica, resultaría difícil creer que exista hoy en día un profesional que se atreva a sostener que el ser humano es sólo mente, o argumentar que lo corporal o cerebral es secundario e incluso irrelevante en los pacientes con los que habitualmente se deberá tratar. De hacerlo simplemente sería un acto de ignorancia, sobretodo en un momento en que disponemos de evidencias diarias desde las neurociencias que dan para sostener la unidad mente-cuerpo como nunca antes en la historia del estudio de “lo psicológico”. La convicción de que los estudiantes deberán ser nutridos con las nociones básicas de los modernos estudios del cerebro debería reflejarse en la bibliografía de diversas asignaturas y estar presente en el espíritu central del quehacer académico como una manera de prevenir esta viciosa tendencia a ningunear aquello que se desconoce y que finalmente cegará a la hora de probar nuevas formas de ver “el síntoma”.

  8. para promover la salud

    Directory of Open Access Journals (Sweden)

    Ma. del Consuelo Chapela

    2002-01-01

    Full Text Available Hablar de educación a distancia sustentada en el desarrollo de la cibernética obliga a reflexionar sobre sus definiciones, objetivos y medios, especialmente si pensamos en las necesidades de la fracción de población que no tiene acceso a las posibilidades que ofrece el desarrollo tecnológico. En este trabajo se presenta e ilustra con un ejemplo práctico, una perspectiva sobre las posibilidades de la educación a distancia desde las necesidades de la promoción de la salud entre grupos de población marginada en el mundo virtual. Se propone la creación de bibliotecas itinerantes regionales que pongan a disposición de la población con acceso limitado a la información, la tecnología comunicativa necesaria para apoyar los trabajos de promoción de la salud.

  9. Para-equilibrium phase diagrams

    International Nuclear Information System (INIS)

    Highlights: • A rapidly cooled system may attain a state of para-equilibrium. • In this state rapidly diffusing elements reach equilibrium but others are immobile. • Application of the Phase Rule to para-equilibrium phase diagrams is discussed. • A general algorithm to calculate para-equilibrium phase diagrams is described. - Abstract: If an initially homogeneous system at high temperature is rapidly cooled, a temporary para-equilibrium state may result in which rapidly diffusing elements have reached equilibrium but more slowly diffusing elements have remained essentially immobile. The best known example occurs when homogeneous austenite is quenched. A para-equilibrium phase assemblage may be calculated thermodynamically by Gibbs free energy minimization under the constraint that the ratios of the slowly diffusing elements are the same in all phases. Several examples of calculated para-equilibrium phase diagram sections are presented and the application of the Phase Rule is discussed. Although the rules governing the geometry of these diagrams may appear at first to be somewhat different from those for full equilibrium phase diagrams, it is shown that in fact they obey exactly the same rules with the following provision. Since the molar ratios of non-diffusing elements are the same in all phases at para-equilibrium, these ratios act, as far as the geometry of the diagram is concerned, like “potential” variables (such as T, pressure or chemical potentials) rather than like “normal” composition variables which need not be the same in all phases. A general algorithm to calculate para-equilibrium phase diagrams is presented. In the limit, if a para-equilibrium calculation is performed under the constraint that no elements diffuse, then the resultant phase diagram shows the single phase with the minimum Gibbs free energy at any point on the diagram; such calculations are of interest in physical vapor deposition when deposition is so rapid that phase

  10. Marcadores para la Realidad Aumentada para fines educativos

    Directory of Open Access Journals (Sweden)

    María Reina Zarate Nava

    2013-12-01

    Full Text Available La Realidad Aumentada (AR es considerada por algunos expertos como la tecnología en crecimiento para el 2014, en diferentes sectores: ingeniería, educación, juegos y negocios, siendo este último el más usado en él 2013. Sin embargo en el sector educativo la AR se presenta en algunos proyectos que se han desarrollado para diferentes áreas de las ciencias, como Química, Física y Matemáticas, lo anterior con el objetivo de facilitar el proceso de Enseñanza-Aprendizaje. En el presente artículo se presenta el modelo de patrones utilizado para un Proyecto AR enfocado en Química, el cual presenta un conjunto de patrones que fueron valorados para facilitar el rastreo de los objetos y a su vez el entendimiento de algunos materiales de los laboratorios de Química I.

  11. Plataforma VMware para academia virtual

    OpenAIRE

    Martínez Sánchez, José María

    2014-01-01

    Este PFC surge para dar respuesta a los problemas que se presentan en una unidad educativa a la hora de diseñar y crear una nueva infraestructura de red, servidores y equipos de trabajo que se presenta en el diseño y puesta en marcha de una nueva entidad educativa. Se proyecta la creación y configuración de una infraestructura virtual que aborde todos estos problemas, ofreciendo la solución mediante un único nodo virtual. Para ello, utilizamos sw de VMware para la creación de dicho nodo virtu...

  12. Evaluación biológica del manejo de picudos y nematodos fitopatógenos en plátano (Musa AAB

    Directory of Open Access Journals (Sweden)

    Aristizábal Loaiza Manuel

    2009-12-01

    Full Text Available El trabajo se desarrolló en la granja Montelindo, municipio de Palestina (Caldas a 5° 05' N y 75° 40' O, a 1010 m.s.n.m., 23.5 °C, precipitación anual de 2100 mm y humedad relativa de 76%, con el fin de generar información sobre el manejo de picudos y nematodos fitoparásitos del plátano. Se usó un diseño en bloques completos al azar con cuatro tratamientos por bloque, tres repeticiones y 24 plantas por repetición. Para el manejo de los picudos se hicieron aplicaciones de Carbofurán, Beauveria bassiana y Metarhizium anisopliae en trampas tipo columna. Para el control de nematodos se hicieron aplicaciones en el suelo de Carbofurán y dos cepas comerciales de Paecilomyces lilacinus. Se evaluaron el número de adultos de picudos en trampas, la infección de estos por los hongos empleados y la población de nematodos en suelo y raíces. Se encontró que las trampas tratadas con Carbofurán fueron significativamente más efectivas para la captura de insectos. En laboratorio se estableció que M. anisopliae tuvo una mejor capacidad para infectar adultos del insecto en el campo. La población de nematodos fue menor en suelo y raíces de las plantas tratadas con Carbofurán. Paecilomyces lilacinus no fue efectivo para reducir las poblaciones de nematodos. Los géneros de nematodos predominantes fueron Radopholus, Pratylenchus, Meloidogyne y Helicotylenchus.

  13. Evaluación biológica del manejo de picudos y nematodos fitopatógenos en plátano (Musa AAB

    Directory of Open Access Journals (Sweden)

    Carolina González Cardona

    2009-10-01

    Full Text Available El trabajo se desarrolló en la granja Montelindo, municipio de Palestina (Caldas a 5° 05' N y 75° 40' O, a 1010 m.s.n.m., 23.5 °C, precipitación anual de 2100 mm y humedad relativa de 76%, con el fin de generar información sobre el manejo de picudos y nematodos fitoparásitos del plátano. Se usó un diseño en bloques completos al azar con cuatro tratamientos por bloque, tres repeticiones y 24 plantas por repetición. Para el manejo de los picudos se hicieron aplicaciones de Carbofurán, Beauveria bassiana y Metarhizium anisopliae en trampas tipo columna. Para el control de nematodos se hicieron aplicaciones en el suelo de Carbofurán y dos cepas comerciales de Paecilomyces lilacinus. Se evaluaron el número de adultos de picudos en trampas, la infección de estos por los hongos empleados y la población de nematodos en suelo y raíces. Se encontró que las trampas tratadas con Carbofurán fueron significativamente más efectivas para la captura de insectos. En laboratorio se estableció que M. anisopliae tuvo una mejor capacidad para infectar adultos del insecto en el campo. La población de nematodos fue menor en suelo y raíces de las plantas tratadas con Carbofurán. Paecilomyces lilacinus no fue efectivo para reducir las poblaciones de nematodos. Los géneros de nematodos predominantes fueron Radopholus, Pratylenchus, Meloidogyne y Helicotylenchus.

  14. Anestesia espinal para colecistectomia

    Directory of Open Access Journals (Sweden)

    Nayibe Salamanca R

    2009-10-01

    Full Text Available Introducción: La anestesia espinal o subaracnoidea brinda al paciente calidad y múltiples ventajas. Sin embargo, en procedimientos quirúrgicos que comprometen al abdomen superior ha sido poco empleada, como en la colecistectomía. En estas cirugías, ya sean laparoscópicas o abiertas, se ha empleado de forma rutinaria la anestesia general. Objetivo: Describir la aplicación de anestesia espinal para la realización de colecistectomía abierta. Materiales y métodos: Es un estudio retrospectivo, serie de casos, que evaluó 32 pacientes ASA I y II a los que se les realizó colecistectomía abierta, bajo anestesia espinal, en el tiempo comprendido entre junio de 2002 y junio de 2004, en un Hospital Nivel II de la ciudad de Popayán, previo consentimiento aprobado por el Comité Científico del Hospital. Resultados: En 25 mujeres y 7 hombres, con edad media de 33,6 años, se observó que la frecuencia cardiaca y la presión arterial sistólica, diastólica y media disminuyeron durante los primeros 20 minutos; luego, sus valores se incrementaron hasta estabilizarse por debajo de los parámetros iniciales respectivos. El 34,3% de la población presentó eventos transoperatorios como hipotensión, bradicardia, náusea, vómito, dolor en hombro o dolor torácico. En dos de estos Caucapacientes fue necesario cambiar a anestesia general. En el postoperatorio, 21,7% de los pacientes presentaron efectos adversos: náusea, vómito y cefalea. El 90 % egresaron del hospital en las primeras 48 horas. No se reportó mortalidad intra o postoperatorio inmediata. Conclusiones: La anestesia espinal es una alternativa a tener en cuenta para procedimientos como la colecistectomía abierta.Introduction: Spinal anaesthesia offers patients quality as well as several advantages; however in surgical procedures which involve the upper abdomen it had been less employed in procedures such as cholecistectomy by laparoscopic technique or via opening the abdomen where the

  15. Una agenda para educadores

    Directory of Open Access Journals (Sweden)

    Robert O. McClintock

    2007-01-01

    Full Text Available Las instituciones educativas constituyen los principales factores en la construcción social de un nuevo sistema educativo. Las escuelas y los educadores controlan y producen propiedad intelectual de una extraordinaria profundidad y amplitud. Los cambios producidos por las tecnologías digitales están consiguiendo que el acceso y la producción de conocimiento sea más accesible y universal. Lo que es, a la vez, un gran logro de apertura curricular, pero también un grave peligro de perder la perspectiva eminentemente “educativa” de la transmisión del conocimiento en la escuela. Los nuevos recursos permiten a los educadores romper el ciclo de reproducción en los logros educativos, acercarse al medio y a la familia y transformar la escuela. Los educadores y las escuelas deben asumir el reto de constituir comunidades de aprendizaje. Así como de atreverse a producir y difundir ese conocimiento con soporte digital. Lo contrario sería una terrible abdicación. El artículo traza un recorrido histórico sobre esta función de la escuela y su adaptación a los medios y recursos de cada época. Tras lo cual, aboga por asumir el desafío actual de las TICs, para renovar el vínculo progresista con la posteridad y construir un mejor futuro. Los nuevos recursos permiten a los educadores romper el ciclo de reproducción en los logros educativos, acercarse al medio y a la familia y transformar la escuela.

  16. Proyecto de red para ONG

    OpenAIRE

    Ruiz López, David

    2013-01-01

    Proyecto de una red de comunicaciones para una ONG en la Comunidad de Madrid. Projecte d'una xarxa de comunicacions per a una ONG a la Comunidad de Madrid. Bachelor thesis for the Telecommunication Technologies program on Telematics.

  17. Planar Para Algebras, Reflection Positivity

    CERN Document Server

    Jaffe, Arthur

    2016-01-01

    We define the notion of a planar para algebra, which arises naturally from combining planar algebras with the idea of $\\Z_{N}$ para symmetry in physics. A subfactor planar para algebra is a Hilbert space representation of planar tangles with parafermionic defects, that are invariant under isotopy. For each $\\Z_{N}$, we construct a family of subfactor planar para algebras which play the role of Temperley-Lieb-Jones planar algebras. The first example in this family is the parafermion planar para algebra. Based on this example, we introduce parafermion Pauli matrices, quaternion relations, and braided relations for parafermion algebras which one can use in the study of quantum information. Two different reflections play an important role in the theory of planar para algebras. One is the adjoint operator; the other is the modular conjugation in Tomita-Takesaki theory. We use the latter one to define the double algebra and to introduce reflection positivity. We give a new and geometric proof of reflection positivi...

  18. Instrucciones para los Autores

    Directory of Open Access Journals (Sweden)

    Departamento de Investigaciones

    2012-12-01

    Full Text Available INFORMACIÓN PARA AUTORESREVISTA CIENCIAS BIOMÉDICAS (Rev.cienc.biomed. está incluida en: IMBIOMED,GOOGLE ACADÉMICO, ENCOLOMBIA.COM, GOOGLE SCHOLAR, DOAJ, PUBLINDEX.Recibe artículos científicos originales sobre temas diversos que guarden relación con lasciencias de la salud, tanto de aplicación básica como clínica. Estos temas deben estar alinterior de áreas de conocimiento que puedan interesar tanto a estudiantes de pregradocomo de postgrado y profesionales del área de las ciencias de la salud. Se deben tenerpresente las siguientes recomendaciones.1. AutoríaCada autor debe haber contribuido sustancialmente al desarrollo exitoso del procesode investigación. Según estándares internacionales, los criterios que cada autor debecumplir son:• Contribuciones sustanciales a la concepción, diseño, adquisición de datos, ó análisis einterpretación de los datos.• Escribir el artículo y revisarlo por contenido intelectualmente importante.• Aprobación final de la versión a publicar. No se aceptarán identificaciones odesignaciones como: “autores por cortesía”, sin que el investigador haya cumplidocon los criterios delineados (Ej: jefatura del instituto/ departamento/grupo deinvestigación que presenta el manuscrito.2. Conflictos de intereses y financiaciónEl autor de un artículo a considerar puede incurrir en dos tipos de conflictos de interés.El primero se relaciona directamente con los autores del trabajo y las relacionesfinancieras y personales que puedan influir o sesgar el manuscrito en cualquier forma.El segundo tipo de conflicto de interés es el relacionado con el/los financiadores deltrabajo de investigación. Los autores deberán admitir y decir en el momento del envíodel manuscrito cualquier injerencia o limitación del financiador con respecto al análisise interpretación de datos, escritura o sometimiento a publicación del manuscrito. Laexistencia o ausencia de conflictos de intereses debe estar

  19. Marcadores para la Realidad Aumentada para fines educativos

    OpenAIRE

    María Reina Zarate Nava; Cecilio Francisco Mendoza González; Honorato Aguilar Galicia; Juan Manuel Padilla Flores

    2013-01-01

    La Realidad Aumentada (AR) es considerada por algunos expertos como la tecnología en crecimiento para el 2014, en diferentes sectores: ingeniería, educación, juegos y negocios, siendo este último el más usado en él 2013. Sin embargo en el sector educativo la AR se presenta en algunos proyectos que se han desarrollado para diferentes áreas de las ciencias, como Química, Física y Matemáticas, lo anterior con el objetivo de facilitar el proceso de Enseñanza-Aprendizaje. En el presente artículo s...

  20. Instrucciones para los Autores

    Directory of Open Access Journals (Sweden)

    Revista Ciencias Biomedicas

    2014-04-01

    intereses debe estar especificada al final del artículo. También debe especificarse si se ha recibido dinero por concepto de financiación, especificando los orígenes y los códigos de las convocatorias donde se obtuvieron los recursos. De ser pertinente inmediatamente después pueden darse los agradecimientos respectivos a instituciones o personal que de otra manera aportaron al artículo y/o la investigación. 3. Políticas de arbitraje por pares. Los originales serán sometidos a un proceso de evaluación editorial que se cumplen en varias fases. Inicialmente los artículos recibidos son sometidos a un estudio preliminar por parte del director, editor o comité editorial quienes determinan la adecuada estructuración del manuscrito y su pertinencia con las políticas de la revista y de la institución. Si el artículo es aceptado por cumplir los requisitos formales y de contenido presentes en estas instrucciones, es enviado a dos pares académicos externos quienes de forma anónima realizan sugerencias y correcciones. Los pares evaluadores realizan su veredicto de la siguiente manera. (1 Publicar sin cambios. (2 publicar cuando se hayan cumplido las correcciones menores. (3 publicar cuando se hayan realizados correcciones de fondo y contenido. (4 no publicable. En caso de discrepancia en las opiniones será enviado a un tercer arbitro, de ser pertinente se solicitará la opinión a los miembro del comité científico. Los autores serán informados oportunamente de las diferentes fases que se cumplen en el proceso de evaluación editorial. Ellos recibirán las opiniones que han dado los pares evaluadores externos y siempre de forma anónima. También serán sometidos a evaluación por lingüística en español y en inglés. Al ser aprobada la publicación inmediatamente serán notificados los autores y se expedirá la certificación respectiva. Al estar disponibles las galeradas serán enviadas a los autores para evaluación y aprobación final.

  1. Drupal para bibliotecas y archivos

    OpenAIRE

    Tramullas, Jesús

    2010-01-01

    Drupal: fundamentos técnicos 7 Tomás Saorín Drupal: módulos para bibliotecas, archivos y servicios de información y documentación 21 Jesús Tramullas y Piedad Garrido Experiencia de recbib – recursos bibliotecarios con Drupal: del texto plano a la gestión de contenidos 29 Julián Marquina “www.liberadosdelolvido.org” Servicio de información sobre la memoria histórica en Aragón 43 Julián Moyano Desarrollo de un gestor de contenidos para la administración del c...

  2. Interfaces no convencionales para juegos

    OpenAIRE

    Castro, Silvia Mabel; Larrea, Martín Leonardo; Martig, Sergio R.

    2005-01-01

    Además de los juegos para PCs de escritorio y consolas, hay numerosos juegos desarrollados para dispositivos móviles, tales como los celulares y las PALMs. Sin embargo, sólo unos pocos pueden sentir el ambiente físico. La mayoría de los juegos están atados al escritorio o a los dispositivos en los que el juego se ejecuta y son raros los que salen de allí, sin siquiera pensar en una experiencia que extienda considerablemente el área de juego. Esto plantea el desafío de nuevas tecnologías o ...

  3. Espacio de trabajo colaborativo para emprendedores, Pinedo

    OpenAIRE

    FERRIZ NAVARRO, ANDRÉS

    2016-01-01

    Espacio de trabajo colaborativo (CoWorking) para emprendedores en Pinedo. Ferriz Navarro, A. (2014). Espacio de trabajo colaborativo para emprendedores, Pinedo. http://hdl.handle.net/10251/67050. Archivo delegado

  4. MODELO PARA ESTABLECER SANCIONES PECUNIARIAS PARA DELITOS AMBIENTALES

    Directory of Open Access Journals (Sweden)

    LUIS DIEGO VÉLEZ GÓMEZ

    2012-01-01

    Full Text Available Este artículo pretende exponer el modelo básico que sustenta el desarrollo de multas óptimas; en él se muestra la forma de desincentivar los intereses del violador de la normatividad ambiental, e igualmente el método para alcanzar efectos compensatorios sobre los daños cometidos al medio ambiente. El desarrollo del tema sobre sanciones pecuniarias (multas y penalidades (encarcelamiento toma la relación contractual entre el agente (la empresa y el principal (La entidad reguladora para, a través de esta relación, entrar en la determinación de un diseño eficaz de sanciones. Se utilizara el modelo de agente-principal para examinar los efectos de las sanciones corporativas e individuales sobre los incentivos de cumplimiento en el contexto ambiental; además se emplearán los conceptos de bienes públicos, bienes comunes y externalidades como categorías de análisis que permiten la identificación y valoración de daños ambientales.

  5. Uma taxonomia para modelos multiparadigma

    OpenAIRE

    Barbosa, Jorge L. V.; Geyer, Cláudio Fernando Resin

    1998-01-01

    Desde os primórdios da humanidade a raça humana busca compreender. A ciência, como instrumento de descobrimento do universo, vem alcançando contínuos sucessos. As descobertas científicas permitiram ao Homem criar um modelo bastante estável e previsível para a realidade na qual está inserido. Em grande parte, o sucesso da ciência basea-se na estratégia de fragmentação do conhecimento, ou seja, na criação de diversas áreas de especialização. A fragmentação é uma solução natural para resolver pr...

  6. Separating Para and Ortho Water

    CERN Document Server

    Horke, Daniel A; Długołęcki, Karol; Küpper, Jochen

    2014-01-01

    Water exists as two nuclear-spin isomers, para and ortho, determined by the overall spin of its two hydrogen nuclei. For isolated water molecules the conversion between these isomers is forbidden and they act as different molecular species. Yet, these species are not readily separable, and little is known about their specific physical and chemical properties, conversion mechanisms, or interactions. Here we demonstrate the production of isolated samples of both spin isomers in pure beams of para and ortho water, with both species in their respective absolute ground state. These single-quantum-state samples are ideal targets for unraveling spin-conversion mechanisms, for precision spectroscopy and fundamental-symmetry-breaking studies, and for spin-enhanced applications, e. g., laboratory astrophysics and -chemistry or hypersensitized NMR experiments.

  7. Estrategia para la sustentabilidad ambiental

    Directory of Open Access Journals (Sweden)

    Cecilia Erbiti

    2006-01-01

    Full Text Available En el contexto de los postulados conceptuales y metodológicos de la planificación estratégica y de sustentabilidad ambiental, el objetivo de esta investigación es describir el proceso de formulación del Plan de Ordenamiento Territorial del Municipio de Tandil (POTM y analizar su potencialidad para avanzar hacia la sustentabilidad ambiental del sistema. Los resultados de la misma muestran que el POTM no sólo prioriza principios, objetivos y estrategias que materializan las diferentes manifestaciones de la sustentabilidad (económica, social, ecológica y política, sino que la totalidad del Plan se fundamenta en el concepto de desarrollo sostenible y, con ello, se establecen prioridades de actuación que posibilitarán la gestión ambiental urbana. Si bien el POTM muestra una gran potencialidad para avanzar hacia la sustentabilidad del territorio, la implementación y cumplimiento del mismo constituye un fuerte desafío para las autoridades de aplicación.

  8. para asegurar un hijo sano

    Directory of Open Access Journals (Sweden)

    Carmen Amarilis Guerra de Castillo

    2006-01-01

    Full Text Available Esta investigación etnográfica focalizada exploró las creencias, los valores, los hábitos y los padrones comportamentales de las embarazadas diabéticas atendidas en el Hospital Doctor Enrique Tejera, quienes residen en tres comunidades urbanas pobres de la ciudad de Valencia - Venezuela, con el objetivo de encontrar el significado del cuidado de si para dichas grávidas. Se utilizó como referencial teórico el Modelo del Análisis de la Salud y la Teoría Antropológica de la Salud, siendo fundamentales para revelar aquello que estaba implícito en el comportamiento de las mujeres con relación a su cuidado. Surgieron tres temas: la salud y la enfermedad - valores culturales del cuidado de si; las prácticas del cuidado de la salud y cuidándose en el embarazo garantiza tener un hijo más saludable. Los temas culturales revelaron que las creencias, los valores, los hábitos y los patrones culturales comportamentales, conforme las tres maneras de acción identificadas, pueden ser preservadas, acomodadas y re-estructuradas para proporcionar un cuidado culturalmente congruente.

  9. (Para-)Hermitian and (para-)K\\"ahler Submanifolds of a para-quaternionic K\\"ahler manifold

    CERN Document Server

    Vaccaro, Massimo

    2012-01-01

    On a para-quaternionic K\\"ahler manifold $(\\widetilde M^{4n},Q,\\widetilde g)$, which is first of all a pseudo-Riemannian manifold, a natural definition of (almost) K\\"ahler and (almost) para-K\\"ahler submanifold $(M^{2m},\\mathcal{J},g)$ can be given where $\\mathcal{J}=J_1|_M$ is a (para-)complex structure on $M$ which is the restriction of a section $J_1$ of the para-quaternionic bundle $Q$. In this paper, we extend to such a submanifold $M$ most of the results proved by Alekseevsky and Marchiafava, 2001, where Hermitian and K\\"ahler submanifolds of a quaternionic K\\"ahler manifold have been studied. Conditions for the integrability of an almost (para-)Hermitian structure on $M$ are given. Assuming that the scalar curvature of $\\widetilde M$ is non zero, we show that any almost (para-)K\\"ahler submanifold is (para-)K\\"ahler and moreover that $M$ is (para-)K\\"ahler iff it is totally (para-)complex. Considering totally (para-)complex submanifolds of maximal dimension $2n$, we identify the second fundamental for...

  10. PLATAFORMA PARA LA VENTA DE VIDEOJUEGOS DIGITALES PARA PC

    OpenAIRE

    Gómez-Eguílar, Javier

    2013-01-01

    A lo largo del trabajo vamos a exponer nuestra propia idea de negocio de una nueva empresa, llamada GAMERINET, que se dedique a la venta de videojuegos de ordenador en descarga digital a través de nuestra web. Para ello vamos a ver una breve introducción a este sector de negocio y su historia, haremos un análisis de las condiciones actuales del sector, a través del análisis del entorno específico (5 Fuerzas de Porter) y del análisis del entorno general (Análisis PEST). Posterio...

  11. Aprender para ensinar e ensinar para que os alunos aprendam

    OpenAIRE

    Pessoa Carvalho, A.

    2009-01-01

    A parceria colaborativa desenvolvida entre o Laboratório de Ensino de Física e uma Escola Municipal sustenta-se por meio de práticas colaborativas buscando soluções para os problemas de ensino apontados pelos professores. O problema que mobiliza o grupo de professoras é como alfabetizar cientificamente os alunos. Tanto a formação dos professores quanto a realização do ensino de ciências são orientadas em uma perspectiva investigativa, procurando estabelecer, assim, coerência entre o “como apr...

  12. Redes Sociales para Bibliotecas Universitarias

    Directory of Open Access Journals (Sweden)

    Anna Kawalec

    2013-05-01

    Full Text Available La popularidad de las redes sociales y otras herramientas de Web 2.0 obliga a las bibliotecas a ir acorde a los tiempos y adaptarse a las novedades que ofrece el mundo de Internet. Este trabajo tiene por objetivo estudiar las diversas aplicaciones existentes en las redes sociales y evaluar su posible utilización en el diseño de una red social para bibliotecas universitarias. Como resultado pretende construir un modelo de prototipo completo para ser implantado en una biblioteca. El trabajo consta de tres partes. La primera de ellas es una introducción a las redes sociales que menciona aspectos como idea, historia y desarrollo, contenidos y elementos y analiza distintos ejemplos de redes sociales. La siguiente parte es un análisis de presencia de bibliotecas en las redes sociales. Se habla de la posibilidad de crear redes sociales para las bibliotecas, ventajas y desventajas para éstas, presentando ejemplos de bibliotecas que participan en redes o intentan crear sus propias redes. También se analiza aplicaciones que usan las bibliotecas presentes en redes sociales. A continuación se propone el proyecto de red social para una biblioteca universitaria. El proyecto está basado en la investigación sobre los potenciales usuarios. Se ha realizado una encuesta a nivel internacional a un grupo de estudiantes, personal de bibliotecas y profesionales de documentación, con el objetivo de recoger sus opiniones, conocer sus necesidades y escuchar sus propuestas en lo referente a las redes sociales para bibliotecas. Abstract The popularity of social networking and other Web 2.0 tools requires libraries to adapt to the new world offered by the Internet. This work studies the various existing applications of social networks and assesses their possible use in designing a social network for university libraries. As a result seeks to build a complete prototype model to be implemented in a library. The work consists of three parts. The first is an

  13. Tendiendo puentes para la convivencia

    OpenAIRE

    Marcos Aranda, Rafael

    2006-01-01

    El Foro Iberoamericano sobre Seguridad Ciudadana, Violencia Social y Políticas Públicas, que se celebró en Madrid y Alcalá de Henares, entre los días 19 y 23 de junio del presente año, concluyó con la presentación de un documento de compromiso titulado «Tendiendo puentes para la convivencia». Dicho documento puede calificarse de mínimos, aunque en él se establecen una serie de consensos básicos, los cuales nos invitan a reflexionar sobre una realidad terriblemente complej...

  14. Manual de mercadeo para pymes

    OpenAIRE

    Botero Ardila, José Luis

    2012-01-01

    Este texto presenta las definiciones y lineamientos a seguir por parte de los empresarios, con el fin de hacerlos más competitivos a la hora de enfrentar las variaciones del mercado o del entorno competitivo. Su diseño tiene en cuenta al empresario que no dispone de mucho tiempo para aplicar el mercadeo en su empresa, por lo cual incluye la posibilidad de diagnosticar de manera autónoma el estado de la misma. Entre los temas que encontrará el lector se encuentran: ¿qué es mercadeo, investigac...

  15. Recomendaciones para desarrollar software internacionalizado

    OpenAIRE

    Payán Goméz, Ricardo; Barbosa, Julián; Torres Moreno, Miguel E.

    2011-01-01

    El presente artículo tiene como objetivo exponer una serie de recomendaciones que deberían ser tomadas en cuenta al construir software internacionalizado, es decir aquel que está libre de toda dependencia cultural y está optimizado para ser localizado posteriormente a una región geográfica específica. Inicialmente se presenta una introducción al tema y se describe la estrecha relación entre la internacionalización y la localización de software y posteriormente se describen 19 recomendacion...

  16. Bombas extractoras para lactancia materna

    OpenAIRE

    Rozas García, M. Rosa

    1997-01-01

    Durante la lactancia materna pueden utilizarse diferentes accesorios para complementarla, entre los cuales se encuentran las bombas extractoras de leche materna. Describiremos las características generales de los diferentes tipos de bombas extractoras, de modo que el profesional de enfermería conozca no sólo el funcionamiento de los aparatos, sino que también adquiera unos conocimientos acerca de sus indicaciones, manipulación, ventajas e inconvenientes, y pueda asesorar en todo momento a la ...

  17. Ambiente Java para sistemas embedded

    OpenAIRE

    Silva, Valter Filipe Miranda Castelão da

    2002-01-01

    Os sistemas integrados, ou genericamente os sistemas com reduzida capacidade de processamento e pouca memória, são actualmente sistemas economicamente acessíveis e muito divulgados. Os seus sistemas operativos estão, no entanto, ainda bastante dependentes do hardware o que faz que cada aplicação seja especialmente desenvolvida para cada tipo de sistema. Neste documento discute-se a aplicabilidade de uma máquina virtual Java em equipamentos com estas restrições. É proposta a ...

  18. Control biológico en el cultivo del arroz en Cuba. (Resultados 1970 – 2005.

    Directory of Open Access Journals (Sweden)

    Rafael Meneses

    2007-12-01

    Full Text Available El cultivo del arroz en Cuba está afectado por diversas plagas, fundamentalmente: Tagosodes orizicolus, Lissorhoptrus brevirostris, Oebalus insularis y Spodoptera frugiperda. A partir de 1970 se iniciaron los estudios sobre los principales controles biológicos de estas plagas. Para T. orizicolus se ha determinado que Paranagrus perforator y Tytthus parviceps son los principales enemigos naturales de esta plaga. El porcentaje de huevos de T. orizicolus parasitados por P. perforator ha llegado al 50.7% en la etapa de germinación a ahijamiento activo de la planta de arroz. Además, a esta plaga se le ha detectado control por los parasitoides Elenchus sp. y Gonatopus sp. L. brevirostris ha sido manejado en los arrozales con los hongos Metarhizium anisopliae y Beauveria bassiana, obteniendo muy buenos resultados, tanto en el control como en las afectaciones ocasionadas por este insecto. La aplicación de M. anisopliae cepa Niña Bonita resulta satisfactorio para el control de O. insularis. Se ha determinado diversos depredadores, parasitoides y hongos que en determinadas épocas del año ejercer buen control de S. frugiperda, destacándose dentro de ellos: Coleomegilla cubensis, Chelonus texanus y Telenomus spp. C. texanus ha presentado un nivel de parasitismo superior al 80.0 % y Telenomus sp. de 93 %, en condiciones de producción arrocera. Con la presencia de arañas en los arrozales se logra disminuir considerablemente las poblaciones de insectos plagas.

  19. Pequenos para idade gestacional: fator de risco para mortalidade neonatal

    Directory of Open Access Journals (Sweden)

    Almeida Márcia Furquim de

    1998-01-01

    Full Text Available OBJETIVO: Estudar as variáveis contempladas na Declaração de Nascimento (DN como possíveis fatores de risco para nascimentos pequenos para a idade gestacional (PIG e o retardo de crescimento intra-uterino como fator de risco para a mortalidade neonatal. MATERIAL E MÉTODO: As variáveis existentes na DN foram obtidas diretamente de prontuários hospitalares. Os dados referem-se a uma coorte de nascimentos obtida por meio da vinculação das declarações de nascimento e óbito, correspondendo a 2.251 nascimentos vivos hospitalares, de mães residentes, ocorridos no Município de Santo André, Região Metropolitana de São Paulo, no período de l/1 a 30/6/1992, e aos óbitos neonatais verificados nessa coorte. RESULTADOS: Obteve-se a proporção de 4,3% de nascimentos PIG, significativamente maior entre os recém-nascidos de pré-termo e pós-termo, entre os nascimentos cujas mães tinham mais de 35 anos de idade e grau de instrução inferior ao primeiro grau completo. Os recém-nascidos PIG apresentam maior risco de morte neonatal que aqueles que não apresentavam sinais de retardo de crescimento intra-uterino. CONCLUSÕES: Em áreas com menor freqüência de baixo peso ao nascer, é importante investigar a presença de retardo de crescimento intra-uterino entre os nascimentos prematuros e não apenas nos nascimentos de termo. O registro da data da última menstruação (ou da idade gestacional em semanas não agregadas na DN facilitaria a detecção de PIGs na população de recém-nascidos.

  20. Edificio para viviendas, en Barcelona

    Directory of Open Access Journals (Sweden)

    Barba Corsini, F.

    1967-05-01

    Full Text Available This building has a garage basement, a ground floor with a communed playing zone for all the children of the block, and the entrance vestibule. The rest of the building is occupied with apartments, of about 200 m2 each, which are functionally designed, and are suitable for medium sized average income families. Special attention has been given to the external facades, which, among other things, are of extremely simple design.El edificio contiene: en el sótano, un guardacoches; en la planta baja, una zona de juegos común para los niños de todas las viviendas, además de los vestíbulos. El resto de la superficie edificada está destinado a viviendas, de unos 200 m2, construidos con distribución funcional y adecuada para familias medias ya constituidas. Fue dedicada una especial atención a la composición de las fachadas, que ofrecen, entre otros atractivos, el de su elegante sencillez.

  1. Inteligencia Emocional para tiempos de crisis

    OpenAIRE

    Fernandez-Berrocal, Pablo

    2014-01-01

    La Inteligencia Emocional se concibe como un conjunto de habilidades, tanto básicas como complejas, dirigidas a “unificar las emociones y el razonamiento”, esto es, usar las emociones para facilitar el razonamiento y los procesos de pensamiento, y usar nuestro razonamiento para pensar de forma inteligente acerca de nuestras emociones (Mayer y Salovey, 1997). En concreto, la IE se define como una habilidad mental que incluye “la capacidad para percibir, valorar y expresar las emociones con...

  2. Educación para la paz

    OpenAIRE

    Federico Mayor Zaragoza

    2014-01-01

    La educación para la paz ha experimentado un desarrollo importante en los últimos 20 años, y el 2000 ha sido declarado Año Internacional para la Cultura de Paz. Exige un esfuerzo de pariicipación y una capacidad crítica para facilitar el paso de una cultura de guerra a un cultura de paz. Se trata de ayudar a todos los ciudadanos a observar y reflexionar sobre el conjunto de la tierra y de quienes la habitan. De escuchar a los jóvenes y ser escuchado. La educación para la paz ha de ser conside...

  3. Paisajes para un desarrollo sustentable y participativo

    Directory of Open Access Journals (Sweden)

    Rafael Mata Olmo

    2014-11-01

    Para terminar, el texto recoge una experiencia de proyecto territorial de paisaje, la del Plan Insular de Menorca (Islas Baleares, España, aprobado en 2003. Se sintetizan sus determinaciones sobre la protección de determinados terrenos por sus altos valores paisajísticos, sus directrices para que las políticas sectoriales (turismo, agricultura, infraestructuras, etc. incorporen criterios paisajísticos, y sus iniciativas para la gestión y mejora del paisaje y para el fomento del acceso público a su contemplación y disfrute.

  4. Adesao ao guia alimentar para populacao brasileira

    Directory of Open Access Journals (Sweden)

    Eliseu Verly Junior

    2013-12-01

    Full Text Available OBJETIVO : Analisar a adesão ao Guia Alimentar para População Brasileira. MÉTODOS : Amostra composta por participantes do Inquérito de Saúde de São Paulo (n = 1.661 que preencheram dois recordatórios de 24 horas. Foi utilizado modelo bivariado de efeito misto para a razão entre o consumo de energia do grupo de alimentos e o consumo calórico total. A razão estimada foi utilizada para calcular o percentual de indivíduos com consumo abaixo ou acima da recomendação. RESULTADOS : Pelo menos 80,0% da população consome abaixo do recomendado para: leite e derivados; frutas e sucos de frutas; e cereais, tubérculos e raízes; aproximadamente 60,0% para legumes e verduras; 30,0% para feijões; e 8,0% para carnes e ovos. Adolescentes apresentaram a maior inadequação para legumes e verduras (90,0%, e o estrato de maior renda foi associado à menor inadequação para óleos, gorduras e sementes oleaginosas (57,0%. CONCLUSÕES : Foi observado consumo inadequado dos grupos de alimentos relacionados com aumento do risco de doenças crônicas.

  5. Sistema de realidad aumentada para aplicaciones Android

    OpenAIRE

    Fernández Sánchez, Natalia Mercedes

    2012-01-01

    El objetivo principal de este proyecto es la creación de un sistema de realidad aumentada para el sistema operativo Android con idea de que sea utilizado para la creación de un videojuego, pero que a su vez sea lo suficientemente versátil como para poder utilizarse en otro tipo de aplicaciones. De este objetivo principal podemos obtener los objetivos secundarios: - Conocer las características que ofrecen los teléfonos móviles y como éstas pueden ser aprovechadas para la crea...

  6. Efectividad de Aislamientos de Hongos Entomopatógenos Sobre Larvas de Polilla del Tomate Tuta absoluta Meyrick (Lepidoptera: Gelechiidae Effectivity of Entomopathogenic Fungus Strains on Tomato Moth Tuta absoluta Meyrick (Lepidoptera: Gelechiidae Larvae

    Directory of Open Access Journals (Sweden)

    Marta Rodríguez

    2006-06-01

    Full Text Available La polilla del tomate, Tuta absoluta Meyrick, es una plaga importante en el cultivo del tomate (Lycopersicon esculentum L. en Chile. Estudios de laboratorio fueron realizados para evaluar la virulencia y efectividad de Qu-M558 de Metarhizium anisopliae var. anisopliae y Qu-B912 de Beauveria bassiana. La primera evaluación fue realizada aplicando concentraciones de 0 a 10(8 conidia mL-1 directamente sobre larvas de tercer estadio mediante el sistema de pulverización torre Potter. Las comparaciones fueron realizadas calculando el área bajo la curva del progreso de la mortalidad a través del tiempo. No se observaron diferencias en las áreas entre aislamientos (P = 0,384. La CL50 y CL90 para Qu-B912 fue de 10(4,4 y 10(7,6 conidias mL-1, y para Qu-M558 de 10(5,4 y 10(9,1 conidias mL-1,respectivamente. Un segundo estudio fue realizado aplicando sobre hojas de tomate suspensiones de 0 a 10(8 conidias mL-1 del aislamiento Qu-B912, a través de la torre de pulverización Potter. Larvas del tercer estadio de T. absoluta fueron alimentadas con estas hojas infectadas. Trece días después de la inoculación los porcentajes de mortalidad alcanzaron un 68% a la máxima concentración de inóculo.The tomato moth, Tuta absoluta Meyrick, is a serious pest on tomatoes (Lycopersicon esculentum L. crops in Chile. Laboratory studies were conducted to evaluate the virulence and effectiveness of the isolates Metarhizium anisopliae var. anisopliae isolate Qu-M558 and Beauveria bassiana isolate Qu-B912, on third instar of T. absoluta larvae. The first evaluation was carried out spraying directly on third instar larvae, spore suspensions (0 to 10(8 conidia mL-1 of each isolate through a Potter tower. Comparisons were made by calculating the area under a mortality progress curve. Differences were not observed in the areas between isolates (P = 0.384. The LC50 and LC90 for Qu-B912 were 10(4.4 and 10(7.6 conidia mL-1, and for Qu-M558 were 10(5.4 and 10(9.1 conidia mL-1

  7. Factors affecting fungus-induced larval mortality in Anopheles gambiae and Anopheles stephensi

    Directory of Open Access Journals (Sweden)

    Takken Willem

    2010-01-01

    Full Text Available Abstract Background Entomopathogenic fungi have shown great potential for the control of adult malaria vectors. However, their ability to control aquatic stages of anopheline vectors remains largely unexplored. Therefore, how larval characteristics (Anopheles species, age and larval density, fungus (species and concentration and environmental effects (exposure duration and food availability influence larval mortality caused by fungus, was studied. Methods Laboratory bioassays were performed on the larval stages of Anopheles gambiae and Anopheles stephensi with spores of two fungus species, Metarhizium anisopliae and Beauveria bassiana. For various larval and fungal characteristics and environmental effects the time to death was determined and survival curves established. These curves were compared by Kaplan Meier and Cox regression analyses. Results Beauveria bassiana and Metarhizium anisopliae caused high mortality of An. gambiae and An. stephensi larvae. However, Beauveria bassiana was less effective (Hazard ratio (HR Metarhizium anisopliae. Anopheles stephensi and An. gambiae were equally susceptible to each fungus. Older larvae were less likely to die than young larvae (HR Conclusions This study shows that both fungus species have potential to kill mosquitoes in the larval stage, and that mortality rate depends on fungus species itself, larval stage targeted, larval density and amount of nutrients available to the larvae. Increasing the concentration of fungal spores or reducing the exposure time to spores did not show a proportional increase and decrease in mortality rate, respectively, because the spores clumped together. As a result spores did not provide uniform coverage over space and time. It is, therefore, necessary to develop a formulation that allows the spores to spread over the water surface. Apart from formulation appropriate delivery methods are also necessary to avoid exposing non-target organisms to fungus.

  8. Ética para gobernar. lecciones básicas para un gobierno justo

    OpenAIRE

    Diego Bautista, Oscar

    2013-01-01

    Ética para gobernar. Lecciones básicas para un gobierno justo. Tiene por propósito fomentar una cultura ética en os servidores públicos que contribuya a un cambio de conducta hacia un buen gobierno y que siente las bases para prevenir y controlar la corrupción

  9. Sequential fungal fermentation-biotransformation process to produce a red pigment from sclerotiorin.

    Science.gov (United States)

    Corrêia Gomes, Dhionne; Takahashi, Jacqueline Aparecida

    2016-11-01

    The fungus Penicillium sclerotiorum produces sclerotiorin, an orange compound closely related to the useful food coloring pigments produced by Monascus species. The high productivity, together with several biological activities reported for sclerotiorin highlights its potential application in food industry. In this work, sclerotiorin was obtained as the major metabolite produced in liquid fermentation by P. sclerotiorum standing for 30% of the fungal dry extract. Modulation of sclerotiorin color was accomplished by biotransformation using Beauveria bassiana generating a red derivative with 13.8% yield. Color modification was caused by fungal-mediated substitution of oxygen by nitrogen in the pyrone ring changing the molecule's chromophore. A derivative, 1-methyl sclerotiorin was synthesized from sclerotiorin using diazomethane and fed to B. bassiana. In this case, substituent at C-1 avoided heteroatom substitution. Sclerotiorin derivatives obtained in the present show the great potential of sclerotiorin derivatives as food colorants. PMID:27211658

  10. Entre velos: Maya para contrabajo

    Directory of Open Access Journals (Sweden)

    Rosa María Rodríguez Hernández

    2014-01-01

    Full Text Available Maya para contrabajo se materializa a partir de una imagen de Pepe Romero, cuyo texto interpreta a La decadencia de la mentira de Oscar Wilde. La estructura de Maya es binaria, especular y asimétrica; su poética obedece al juego verdad/mentira que subyace en la obra artística y en la vivencia del artista. Maya trae a la memoria las voces de los Upanishad, Schopenhauer, Shakespeare y Beethoven, influencias éstas en la obra de Wagner y, todas ellas, en la de Eliot. Los aspectos gestuales y visuales de Maya entrelazan con la danza de Pina Bausch y con la retórica (hypotiposis.

  11. para su puesta en marcha

    Directory of Open Access Journals (Sweden)

    Sergio Franco Maass

    2004-01-01

    Full Text Available Los sistemas de información geográfica (SIG tienen una gran aplicación en la gestión municipal; permiten cumplir con dos objetivos fundamentales: el registro de información territorial y el análisis de problemas territoriales específicos. Con el fin de determinar la viabilidad de este tipo de tecnologías en el ámbito municipal, se enfrentó el problema de la localización de instalaciones para la disposición final de residuos sólidos urbanos en el municipio de Toluca, Estado de México. Se identifican ciertos aspectos que limitan la práctica de los SIG: la diversidad entre los municipios, los problemas administrativos, las deficiencias de la información y la carencia de recursos humanos, técnicos y financieros.

  12. Una minga para el posdesarrollo

    Directory of Open Access Journals (Sweden)

    Arturo Escobar

    2011-01-01

    Full Text Available El artículo sintetiza algunas conclusiones a las que han llegado movimientos sociales y académicos en las últimas dos décadas al reflexionar sobre la globalización y sus implicaciones; el modelo dominante, basado en las nociones de "desarrollo" y "modernidad", ha entrado en crisis. Por lo tanto, se hace necesario avanzar en una transición cultural que se pueda comprender como un cambio de época y no sólo como una época de cambios. Para llevar a cabo esta transformación, se deben resolver las con-tradicciones existentes entre el neodesarrollismo y el postdesarrollo, por supuesto, a favor de éste último.

  13. McPhone para iPhone

    OpenAIRE

    Beristain Villar, Iker

    2013-01-01

    Diseño e implementación de una aplicación "McPhone" para dispositivos móviles, que mejora y evoluciona el sistema de realizar pedidos en un restaurante de comida rápida. Un desarrollo para dispositivos Apple, es decir, Iphone bajo iOS. Idioma Español.

  14. The para-HK/QK correspondence

    CERN Document Server

    Dyckmanns, Malte

    2016-01-01

    We generalise the hyper-Kahler/quaternionic Kahler (HK/QK) correspondence to include para-geometries, and present a new concise proof that the target manifold of the HK/QK correspondence is quaternionic Kahler. As an application, we construct one-parameter deformations of the temporal and Euclidean supergravity c-map metrics and show that they are para-quaternionic Kahler.

  15. Effects of entomopathogenic fungi on different developmental stages of Cotesia flavipes (Cam. a parasitoid of Diatraea flavipennella (Box (Lepidoptera: Crambidae

    Directory of Open Access Journals (Sweden)

    Cinthia Conceição Matias da Silva

    2016-02-01

    Full Text Available Biological control using the parasitoid Cotesia flavipes (Cam. is one of the main components in the integrated management of the sugarcane moth borer Diatraea spp. Besides this parasitoid, the entomopathogenic fungi Beauveria bassiana (Bals. Vuill and Metarhizium anisopliae (Metsch. Sorok. are used to control sugarcane pests, and they can be found naturally parasitizing caterpillars. This study aimed to evaluate the effects of M. anisopliae and B. bassiana on different developmental stages of the C. flavipes parasitoid on Diatraea flavipennella (Box. The experiments were carried at laboratory with isolates PL 43 of M. anisopliae and ESALQ 447 of B. bassiana were applied to the parasitoid at the immature and adult phases. No negative effects were observed on the larval development of C. flavipes, and it could complete its development on caterpillars of D. flavipennella treated with fungi. The fungi did not cause pupal mortality. However, B. bassiana caused high mortality in the adult parasitoid (76%. The fungi had negative effects on parasitoids when applied during certain developmental stages of C. flavipes.

  16. Comparative performance evaluation of multi-metal resistant fungal strains for simultaneous removal of multiple hazardous metals.

    Science.gov (United States)

    Dey, Priyadarshini; Gola, Deepak; Mishra, Abhishek; Malik, Anushree; Kumar, Peeyush; Singh, Dileep Kumar; Patel, Neelam; von Bergen, Martin; Jehmlich, Nico

    2016-11-15

    In the present study, five fungal strains viz., Aspergillus terreus AML02, Paecilomyces fumosoroseus 4099, Beauveria bassiana 4580, Aspergillus terreus PD-17, Aspergillus fumigatus PD-18, were screened for simultaneous multimetal removal. Highest metal tolerance index for each individual metal viz., Cd, Cr, Cu, Ni, Pb and Zn (500mg/L) was recorded for A. fumigatus for the metals (Cd, 0.72; Cu, 0.72; Pb, 1.02; Zn, 0.94) followed by B. bassiana for the metals (Cd, 0.56; Cu, 0.14; Ni, 0.29; Zn, 0.85). Next, the strains were exposed to multiple metal mixture (Cd, Cr, Cu, Ni, Pb and Zn) of various concentrations (6, 12, 18, 30mg/L). Compared to other strains, B. bassiana and A. fumigatus had higher cube root growth (k) constants indicating their better adaptability to multi metal stress. After 72h, multimetal accumulation potential of B. bassiana (26.94±0.07mg/L) and A. fumigatus (27.59±0.09mg/L) were higher than the other strains at initial multimetal concentration of 30mg/L. However, considering the post treatment concentrations of individual metals in multimetal mixture (at all the tested concentrations), A. fumigatus demonstrated exceptional performance and could bring down the concentrations of Cd, Cu, Ni, Pb and Zn below the threshold level for irrigation prescribed by Food and Agriculture Organization (FAO). PMID:27497228

  17. Dicty_cDB: Contig-U16183-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available lfnpq**h*ks*tyr*qnlnwyvnyq*ikscfkfyfssy*kski Frame C: pssplllikqliykfqssefiihqvdlllkmenshsqcifknakdfltannaliyqvvva ilsia...... 36 0.93 3 ( EY072266 ) CAZI10125.fwd CAZI Artemisia annua normalized lea... 34 0.96 3 ( BJ375953 ) Dictyostel...676_4502( AM746676 |pid:none) Sorangium cellulosum 'So ce 56'... 184 2e-70 AP006618_4606( AP006618 |pid:none) Nocardia...aldehyde dehydr... 144 3e-51 DQ767721_1( DQ767721 |pid:none) Beauveria bassiana p...489_898( CP001489 |pid:none) Brucella melitensis ATCC 23457 c... 130 1e-48 CP001026_2110( CP001026 |pid:none) Burkholderia ambifaria

  18. Evaluation of Entomopathogenic Fungi Against Chilli Thrips, Scirtothrips dorsalis

    OpenAIRE

    Arthurs, Steven Paul; Aristizábal, Luis Fernando; Avery, Pasco Bruce

    2013-01-01

    Commercial strains of entomopathogenic fungi were evaluated for control of chilli thrips, Scirtothrips dorsalis Hood (Thysanoptera: Thripidae), an invasive pest of ornamental and vegetable plants in the Caribbean and southeastern United States. In laboratory assays, LC50 values against adult S. dorsalis were 5.1 × 104 CFU/mL for Beauveria bassiana GHA, with higher values 3.1 × 105 for Metarhizium brunneum F52 and 3.8 × 105 for Isaria fumosorosea Apopka 97. Second instars were comparatively le...

  19. Biochemiluminescence of certain fungi

    Directory of Open Access Journals (Sweden)

    Janusz Sławiński

    2014-11-01

    Full Text Available Twelve species of fungi growing on the Sabouraud medium in darkness and illumination in an incubator, were tested to find out their ability to emit the ultra-weak biochemiluminescence. Using a sensitive photon-counling device, it was possible to measure biochemiluminescence intensity during ten days of cultures growth. Boletus edulis, Pestalotia funerea and Microsporum gypseum displayed biochemiluminescence, while Aspergillus nidulans, A. quadrilineatus, Beauveria bassiana, Macrophoma candollei, Mucor lausanensis, Paecilomyces farinosus, Penicillium sp., Trichoderma lignorum and Tricholoma equestre failed to do it. Illumination put down biochemiluminescence and stimulated colour formation in both mycelia and in the medium.

  20. Stimulation of Armillaria rhizomorph growth by oak root fungi

    Directory of Open Access Journals (Sweden)

    Hanna Kwaśna

    2014-08-01

    Full Text Available Thirty one different genera of fungi were isolated from the wood of roots of 5O·year·old oak (Quercus robur. The most frequently isolated fungi were: Mycelium radicis atrovirens alpha (MRAA, Clonostachys sp. and Penicillium daleae, Beauveria bassiana, Clonostachys sp., Cryplosporiopsis rodicicolo, Geotrichum candidum, Mortierella vinacea, MRAA, P. daleae, P. janczewskii P. spinulosum, Sporothrix schenckii and Tolypocladium niveum significantly enhanced Armillaria mellea rhizomorph initiation and growth from oak branch segments in vitro. The biggest stimulation effect was noticed when the dematiaceous hyphomycetes, e.g. MRAA, P. dimorphospora and S. schenckii were studied.

  1. Natural occurrence and distribution of soil borne entomopathogenic fungi in shahrood region, northeast of Iran

    OpenAIRE

    Derakhshan, Ali

    2009-01-01

    The study investigated the occurrence of soil borne entomopathogenic fungi (EPF) in potato, wheat, sugar beet, alfalfa fields and orchards. A total of 150 soil samples were collected and EPF were isolated using Galleria method. Soil pH was rages from 6.8 to 8.1 and soil texture was sandy, loam, sandy- loam, clay and sandy-loam-clay. Soil borne EPF occurred at 78% of soil samples from which 40% Beauveria bassiana, 21% Metarhizium anisopliae and 17% had both species. Occurrence and ...

  2. Entomopathogenic fungi recorded from the harlequin ladybird, Harmonia axyridis

    DEFF Research Database (Denmark)

    Steenberg, Tove; Harding, Susanne

    2009-01-01

    Entomopathogenic fungi were recorded from field samples of the harlequin ladybird Harmonia axyridis, an invasive coccinellid that has recently arrived in Denmark. Larvae, pupae and adults were found to be infected by Isaria farinosa, Beauveria bassiana and species of Lecanicillium. This is the fi...... first record of entomopathogenic fungi infecting larvae and pupae. Winter mortality due to fungal infection reached 17.9% in adults collected at one location. The larval stage was most susceptible to fungal infection, as confirmed through bioassay with I. farinosa....

  3. Spatial and taxonomical overlap of fungi on phylloplanes and invasive alien ladybirds with fungal infections in tree crowns of urban green spaces.

    Science.gov (United States)

    Howe, Andy G; Ravn, Hans Peter; Jensen, Annette B; Meyling, Nicolai V

    2016-09-01

    Occurrence of entomopathogenic fungi on phylloplanes in Tilia × europaea crowns between 1 and 13 m was assessed in urban parks. Prevalence of fungal infections in ladybirds (Coleoptera: Coccinellidae) collected from Tilia × europaea was assessed to determine whether fungi found on phylloplanes also occurred as infections in ladybirds. Isaria spp. was most abundant on phylloplanes (mean colony forming units (CFU) per leaf ± SE, 0.33 ± 0.03) followed by Beauveria spp. (0.22 ± 0.02 CFU per leaf) and Lecanicillium spp. (0.19 ± 0.02 CFU per leaf). Densities of inoculum were higher in inner crowns and decreased with height, although Lecanicillium spp. peaked at 5-7 m. Upper phylloplane surfaces harboured higher densities of Isaria spp. and Beauveria spp. than lower surfaces, whereas Lecanicillium spp. was equally distributed. Most prevalent on ladybirds were Isaria spp. (20.6% Harmonia axyridis; 4.8% natives), Lecanicillium spp. (13.6% H. axyridis; 4.8% natives), with fewer Beauveria spp. infections (2.6% H. axyridis). Molecular identification revealed Beauveria bassiana, B. pseudobassiana, Isaria farinosa and Lecanicillium muscarium among isolates of both tree and ladybird origin. Tilia × europaea phylloplanes support a diverse assemblage of entomopathogenic fungal species with a different prevalence in coccinellids compared to their relative abundance in this habitat. PMID:27353660

  4. El Ensayo, Para Formar Profesionales Reflexivos

    Directory of Open Access Journals (Sweden)

    Nestor Perico-Granados

    2015-07-01

    Full Text Available El presente artículo es producto de investigación, como resultado de la reflexión hecha a lo largo de muchos años de experiencia profesional y docente en diferentes universidades estudiando, redactando y evaluando ensayos. Presenta la importancia del ensayo como instrumento y dispositivo de la formación en la educación y especialmente se hace hincapié en la incidencia que tiene cuando se trabaja de manera apropiada, para prestar un servicio en la formación reflexiva. Se dan unas pautas para una aproximación a su definición y precisa los elementos fundamentales y otros complementarios para su elaboración. Desarrolla un primer proceso para escribir un ensayo, a través de la jerarquización de las ideas. Finalmente, se proponen unas conclusiones que pueden ser útiles para quienes quieran escribir ensayos.

  5. Sensibilidade de fungos entomopatogênicos a agroquímicos usados no manejo da cana-de-açúcar

    Directory of Open Access Journals (Sweden)

    Aline Aparecida Alves Botelho

    2011-01-01

    Full Text Available Os agroquímicos empregados no manejo da cana-de-açúcar podem afetar a ação de fungos entomopatogênicos usados no controle biológico de pragas da cultura. Este trabalho teve por objetivo investigar se os inseticidas, herbicidas e maturadores utilizados no manejo da cana-de-açúcar têm efeito tóxico sobre os fungos Beauveria bassiana e Metarhizium anisopliae. Foram utilizados os inseticidas thiametoxan, aldicarbe e fipronil, os herbicidas imazapir, diuron, metribuzin, hexazinone+diuron, clomazone+ametrina, 2,4 diclorofenoxiacético e glifosato, e os maturadores etil-trinexapac, sulfometurom-metílico e glifosato também. Os fungos foram cultivados em meio de cultura batata-dextrose-ágar contendo os agroquímicos. Avaliou-se o crescimento micelial, a produção e viabilidade dos conídios, e fez-se a avaliação da toxicidade dos agroquímicos. O inseticida à base de thiametoxan foi considerado compatível, pois não afetou o crescimento micelial, a produção e a viabilidade dos conídios dos dois fungos. O inseticida formulado com fipronil se mostrou parcialmente tóxico para os fungos, sendo considerado moderadamente compatível, enquanto o aldicarbe foi considerado tóxico. Os herbicidas avaliados afetaram o crescimento micelial, a produção e a viabilidade dos conídios dos entomopatógenos e foram classificados como tóxicos, mas aqueles formulados com imazapir, glifosato e metribuzim foram considerados compatíveis. Entre os agroquímicos usados como maturadores apenas o glifosato foi classificado como compatível. Os agroquímicos usados no manejo da cana-de-açúcar, e que foram testados neste estudo, têm majoritariamente efeito tóxico sobre B. bassiana e M. anisopliae podendo comprometer sua ação como bioagentes de controle de pragas da cultura.

  6. Trabalhar para estudar/estudar para trabalhar: realidade e possibilidades

    Directory of Open Access Journals (Sweden)

    Janes Teresinha fraga Siqueira

    2011-01-01

    Full Text Available O trabalho que apresentamos é parte da pesquisa, ainda não concluída, com os estudantes das licenciaturas e da pedagogia da Universidade de Santa Cruz do Sul- UNISC-RS-Brasil. Este está inserido na linha de pesquisa: educação, trabalho e emancipação do mestrado em educação desta Universidade. Queremos compreender, à luz do materialismo histórico e dialético e das categorias da crítica da economia política, os significados atribuídos pelos estudantes universitários ao fenômeno trabalho e estudo. É uma pesquisa preferentemente qualitativa de natureza dialética. Para Marx, a essência da realidade humana reside no trabalho, mas a fonte de toda a riqueza está na natureza. Logo trabalho, natureza e sociedade estão em relação dialética. Trabalho, portanto, é a ideia central articuladora, e natureza e sociedade devem ser estudadas em conexão com o trabalho. Marx trata o trabalho, no modo de produção capitalista, como um impedimento ao desenvolvimento humano. Propõe omesmo como um ato de criação e auto-expressão humana que não deve ter um valor. A compreensão dessa premissa é necessária para que os trabalhadores possam significar e ressignificar o trabalho para além da ideologia dominante. Algumas categorias aparecem como relevantes para a análise: condições de trabalho e de estudo, necessidade de formação, predominância do trabalho sobre o estudo, dificuldade deconciliar tempo de estudo e de trabalho. Na relação com o objeto de estudo, ressaltaremos a crise estrutural do capital, a desregulamentação das leis do trabalho e sua flexibilização e as contradições entre trabalho e estudo bem como quais possibilidades emancipatórias são visualizadas ou sonhadas pelos trabalhadores estudantes.Resume Ce travail constitue une partie de la recherche entreprise avec les étudiants du cours de pédagogie de l´Universidade de Santa Cruz do Sul – UNISC – RS – Brésil. Il est intégré dans le champ de

  7. Recursos para un aprendizaje significativo

    Directory of Open Access Journals (Sweden)

    Juan LARA GUERRERO

    2009-11-01

    Full Text Available RESUMEN: Partimos del supuesto de que una de las cuestiones que más preocupa al profesorado en su práctica educativa radica en que el aprendizaje de sus alumnos sea significativo. Somos conscientes de que, para conseguir este tipo de aprendizaje, es necesario introducir una serie de cambios en la dinámica de la clase. Comenzamos diferenciando el aprendizaje maquinal del significativo. Continuamos aclarando una confusión muy extendida entre muchos educadores, que creen que el aprendizaje por recepción es repetitivo y que el efectuado por descubrimiento es forzosamente significativo. Posteriormente, planteamos una serie de interrogantes para aclarar algunas cuestiones que le pueden ser útiles a los educadores en su práctica cotidiana. Terminamos presentando la estrategia de organización, que cuenta con dos instrumentos, a nuestro juicio muy eficaces, para ayudar a los estudiantes, a aprender de manera significativa: los mapas conceptuales y la técnica heurística V.ABSTRACT: We start from the assumption that one of the questions that most worry the teaching staff in its educational practice consists in that its pupils' learning is significant. We are aware that, to obtain this kind of learning, it is necessary to introduce a series of changes in the classroom dynamics. We begin by making a distinction between mechanical and significant learning. We continué making clear a very extended confusión amongst many teachers, who believe that learning by reception is repetitive and that the one done by serendipity is necessarily significant. Afterwards, we créate a series of questions to clarify with some answers that can be useful to teachers in their everyday practice. We finish showing the organization strategy, which has two instruments, that in our opinión are very effective, to help students learning in a significant way: conceptual maps and the V heuristic technique.RÉSUMÉ: Nous partons de la supposition de qu'une des questions que

  8. Una red para la gente

    Directory of Open Access Journals (Sweden)

    Raúl Trejo Delarbre

    2004-02-01

    Full Text Available La próxima Cumbre Mundial de la Sociedad de la Información ha revitalizado, en numerosos países, el debate acerca de las nuevas tecnologías de la comunicación y los usos que pueden tener. Lamentablemente en México hemos estado casi del todo ajenos a esa intensa, extensa y en otras latitudes fructífera discusión. Ni los especialistas interesados en estos temas, ni la sociedad que es a la postre beneficiaria o damnificada según sea el empleo de tales tecnologías, ni los organismos del Estado a cargo de tales asuntos, han propiciado la reflexión colectiva que nos podría permitir tanto afinar las posiciones de nuestro país rumbo a la cumbre de Ginebra y Túnez como deliberar, en ese contexto, acerca de lo mucho que nos falta para tener un país auténticamente imbricado en la construcción de una auténtica Sociedad de la Información.

  9. Resdencia para ciegos en Unterdambach

    Directory of Open Access Journals (Sweden)

    Staber, Johann

    1978-08-01

    Full Text Available This building is composed in different bodies, each performing a distinct function, situated in a beautiful wooded landscape. The four storeys above ground, plus one basement of the main building, enclose the rooms for the blind residents, the common areas and mechanical installations. The front of this body, directly accesible from the road, contains a large meeting hall that opens to a tiered terrace providing stepped sitting in the outdoors, towards the back of the building. Between the latter and the main body, a small chapel completes the facilities. The construction in reinforced concrete in sober lines is harmonically integrated into the surrounding environment.

    Este edificio está constituido por diversos cuerpos de distintas funciones, enclavados en un hermoso y arbolado paisaje. El volumen principal alberga, en sus cuatro plantas sobre rasante, más un sótano, las habitaciones para los invidentes, los locales comunes y las instalaciones del edificio. En la parte anterior, directamente accesible desde la calle, se ha dispuesto un amplio salón de actos que tiene su complemento en una terraza, con gradas de asientos al aire libre, situada en la zona trasera. Entre esta última y el cuerpo principal, una pequeña capilla completa el número de las instalaciones. La construcción, de hormigón armado, queda armónicamente integrada, por su sobriedad de líneas, en el ambiente que la rodea.

  10. Estereoscopio com tela holografica para ver tomografias

    CERN Document Server

    Lunazzi, J J; Magalhaes, D S F

    2010-01-01

    A estereoscopia eh uma tecnica que permite a observacao de imagens tridimensionais, mas estah sempre associada com o uso de algum equipamento especial para visualizacao, como oculos bicolores ou polarizados. Para o uso em aplicacoes medicas o emprego de tais equipamentos pode inviabilizar sua utilizacao durante procedimentos cirurgicos, por exemplo. Neste trabalho apresentamos um novo tipo de estereoscopio que utiliza uma tela holografica para geracao de imagens tridimensionais sem o uso de qualquer equipamento adicional. Apresentamos a descricao do equipamento utilizado e resultados das imagens visualizadas.

  11. Una arquitectura unificada para el razonamiento borroso

    OpenAIRE

    Rafael Bello Pérez; Carlos Morell Pérez

    2011-01-01

    Se presenta una arquitectura para desarrollar de forma unificada tanto el razonamiento basado en reglas como el basado en casos considerando rasgos borrosos. El modelo permite usar varios de los procedimientos desarrollados para el razonamiento borroso basado en reglas en el razonamiento borroso basado en casos. Además, se proponen varias funciones de semejanza y funciones de comparación de rasgos para realizar la recuperación de casos con rasgos borrosos. Se muestra la aplicación del modelo ...

  12. Inferencia bayesiana para algunas leyes de Lanchester

    OpenAIRE

    Wiper, Michael P.; Pettit, L. I.; Young, K. D. S.

    2000-01-01

    Lanchester (1916) introdujo una serie de ecuaciones o leyes determinísticas para modelar los números de bajas en un combate sin refuerzos. Un inconveniente de estos modelos es que no son útiles ni para la inferencia ni para la predicción, ya que el resultado de una batalla viene determinado por los parámetros del sistema y los tamaños iniciales de cada ejército. Se han propuesto varias versiones estocásticas de las ecuaciones de Lanchester. En este artículo, se resumen algunos de estos modelo...

  13. Los videojuegos: conectar alumnos para aprender

    OpenAIRE

    José Antonio Valderrama Ramos

    2012-01-01

    Este artículo explora la utilidad que presentan los videojuegos comerciales actuales para educar a los jugadores y ayudarlos a adquirir habilidades necesarias para desempeñarse mejor en nuestra sociedad. Aborda el problema de la educación formal, la cual no está respondiendo a la situación de complejidad de nuestro entorno y usa el paradigma del pensamiento complejo y siete saberes para la educación propuestas por Edgar Morin. También, describe algunas ideas que le pueden ser de utilidad a do...

  14. Asistente para consultas espaciales en Hive

    OpenAIRE

    Maldonado Muñoz, José Emilio

    2015-01-01

    El trabajo descrito y desarrollado a lo largo de esta memoria tiene como objetivo principal establecer un esquema de decisiones básicas para realizar consultas sobre datos espaciales en Hadoop/Hive. Dicho esquema servirá de asistente y soporte para usuarios nuevos en Hive, que teniendo nociones mínimamente básicas sobre el lenguaje de consultas estándar SQL, quieran trabajar en un ámbito Big Data sobre datos espaciales. En definitiva, este trabajo sirve para facilitar y asistir la primera tom...

  15. Nuevos registros de clorofitas marinas para Cuba

    OpenAIRE

    A. Moreira; Fujii, M.T.; Suárez, A. M.; Wynne, M.J.

    2013-01-01

    A partir de muestras colectadas en la bahía de Cienfuegos y de Santa Lucía (Pinar del Río), se identificaron dos nuevos registros de macroalgas marinas (clorofitas) para Cuba: Cladophora blomquistii C. Hoek y Udotea fibrosa D. S. Littler & M. M. Littler. C. blomquistii se registra por primera vez para la región del Caribe ya que se había consignado solo para lagunas costeras de la Florida, y la parte noreste del golfo de México. Se ofrecen además comentarios sobre la taxonomía, ...

  16. Domótica para viviendas construidas

    OpenAIRE

    Beaskoetxea Gartzia, Unai

    2011-01-01

    El objeto de este proyecto fin de carrera es mostrar las distintas tecnologías disponibles para la domótica actual, y cómo se podría aplicarlas en una vivienda ya construida, incidiendo en el uso de la tecnología ZigBee, aunque también se combinará con el uso de KNX, RF, etc. Este proyecto presentará 3 niveles de domótica: un primer nivel para personas sin discapacidad, un segundo nivel para personas de edad avanzada, y un tercer nivel adaptado a personas con discapacidad. Se indicará...

  17. Test para la profilaxis de la prematuridad

    OpenAIRE

    Cruz Laguna, Gladys María

    2008-01-01

    La prematuridad constituye un problema mundial de salud, la comunidad científica busca predictores para disminuir su incidencia. La investigación persiguió obtener una escala de puntuación que modele las características cervicales y permita diagnosticar la condición de riesgo de las gestantes para extender el período de gestación y lograr nacimientos al término. Se realizó un cuasiexperimento en gestantes con factores de riesgo para la prematuridad del municipio Holguín. La muestra fue confor...

  18. Biocomercio: una alternativa para el desarrollo sostenible

    OpenAIRE

    Murillo R., Carlos; Arias Ramírez, Rafael

    2008-01-01

    El desarrollo sostenible en países ricos en biodiversidad dependerá de la capacidad de los gobiernos de implementar los arreglos institucionales necesarios para conciliar la preservación de los recursos naturales con el uso de los mismos para la producción de bienes y servicios que puedan potenciar el crecimiento económico y un mayor bienestar para las comunidades locales donde estos recursos se encuentren. Este es el objetivo de la Iniciativa de Biocomercio que ha venido impulsando la Confer...

  19. pipetas usadas para I. A.

    Directory of Open Access Journals (Sweden)

    J. Castañeda

    2004-01-01

    Full Text Available La vagina y cerviz de las cerdas son estimuladas físicamente durante la inseminación. Este contacto puede afectar características reproductivas tales como el transporte espermático y el proceso de ovulación. En el presente trabajo se evaluaron desde el punto de vista económico y reproductivo, tres tipos de pipetas utilizadas para I. A. de cerdas de diferente material y forma. Se utilizaron 120 animales multíparos asignados de acuerdo a su orden de entrada al celo, en forma sucesiva a uno de tres grupos experimentales: 1 I. A. mediante pipeta reusable de hule tipo Melrose ( Medata, 2 I. A. con pipeta desechable de punta plástica en espiral y 3 I. A. con pipeta desechable con punta de poliestireno redonda (Medi chimica. No se encontró diferencia (P>0.05 entre los porcentajes de gestación, parición y promedio de lechones nacidos vivos por parto, en el tiempo de aplicación del semen, ni en el volumen del mismo, arrojado por las cerdas en los 10 min. posteriores a la I. A. Los valores promedio fueron de: 91.7%, 86.7%, 10.4 ± 2.8, 7.8 ± 2.6 min. y 10.4 ± 11.3 ml, respectivamente. El análisis de regresión, no mostró significancia en cuanto a paridad en ninguna de las variables estudiadas (P>0.05. Se concluye que las pipetas evaluadas no difieren en su efecto sobre el desarrollo reproductivo de la piara. Sin embargo, la pipeta reusable tipo Melrose ofrece ventaja económica bajo las condiciones del presente estudio

  20. Hypersurfaces with Isotropic Para-Blaschke Tensor

    Institute of Scientific and Technical Information of China (English)

    Jian Bo FANG; Kun ZHANG

    2014-01-01

    Let Mn be an n-dimensional submanifold without umbilical points in the (n+1)-dimen-sional unit sphere Sn+1. Four basic invariants of Mn under the Moebius transformation group of Sn+1 are a1-form Φ called moebius form, a symmetric (0, 2) tensor A called Blaschke tensor, a symmetric (0, 2) tensor B called Moebius second fundamental form and a positive definite (0, 2) tensor g called Moebius metric. A symmetric (0, 2) tensor D = A+μB called para-Blaschke tensor, where μ is constant, is also an Moebius invariant. We call the para-Blaschke tensor is isotropic if there exists a function λ such that D = λg. One of the basic questions in Moebius geometry is to classify the hypersurfaces with isotropic para-Blaschke tensor. When λ is not constant, all hypersurfaces with isotropic para-Blaschke tensor are explicitly expressed in this paper.

  1. Actitud Positiva: la base para la competitividad

    Directory of Open Access Journals (Sweden)

    Marco Anderson Espinoza

    2008-04-01

    Full Text Available Una estrategia empresarial enfocado en el mejoramiento continuo de la productividad para la competitividad, depende significativamente del manejo inteligente de tres variables visibles:Calidad, Entrega oportuna y Costo. No obstante, estas tres variables no suelen sersuficientes. La estrategia debe ser complementada con el manejo adecuado de variables intangibles como la Motivación y las Condiciones de Trabajo, con la aplicación de Tecnología Ambientalmente Amigable, en un marco de Actitud Positiva.A final de cuentas, la Actitud Positiva es fundamental para el recurso humano de cualquier organización, a fin de construir una plataforma sólida y estable que sirva de base para soportar un proceso sostenible de mejoramiento de la productividad, para aumentar la competitividad como estrategia empresarial exitosa.

  2. Kehidupan Sosial Para Homeless di Jepang

    OpenAIRE

    Handayani, Savitri

    2015-01-01

    Homuresu berasal dari bahasa Inggris yaitu homeless yang artinya tidak memiliki rumah. Tapi masyarakat Jepang dahulu menyebutnya furosha yang berarti gelandangan atau tunawisma. Pertumbuhan homeless pertama kali meningkat pada tahun 1960-an setelah perang dunia II. Homeless muncul akibat resesi ekonomi yang melanda Jepang. Para homeless tersebut berasal dari kaum buruh yoseba, para pekerja reguler dan non reguler. Yoseba adalah sebutan untuk tempat jasa bantuan untuk menunggu lowongan pekerja...

  3. Tableros para actividades plásticas

    OpenAIRE

    Alcante, Ariana; Debenedeto, Martín; Defeo, Emiliano; Truchi, Julieta; Wild, Diego

    2014-01-01

    Las características de este proyecto se desprenden de una necesidad real del Departamento de Plástica de la FBA: equipar algunas aulas para actividades plásticas con tableros o con atriles que puedan utilizarse en forma vertical, horizontal y, eventualmente, que sirvan para exponer trabajos. Además, tenían que tener un bajo costo de producción. (Párrafo extraído del texto a modo de resumen)

  4. Neurocisticercosis: Afiches para Capacitación

    Directory of Open Access Journals (Sweden)

    MARCELO ROJAS C

    2007-02-01

    Full Text Available En el sistema universitario (me atrevo a decir, de todo el mundo, es poco el contenido educativo relativo a la Transferencia tecnológica para efectos de la capacitación de la sociedad sobre problemas de salud (claros ejemplos desafiantes para los veterinarios son la hidatidosis y cisticercosis y otros; manejados en términos de cambios de conducta. Los términos de control y prevención están dados en un lenguaje académico, muy abstracto y obviamente intrascedente en la comunidad. Al punto que que las recomendaciones que manejan los Profesionales, resultan imprácticos en el ámbito social. Cada vez que voy a Provincias (interior del país y tengo la oportunidad de hablar sobre el control de las citadas metocestodiadis: mis auditorios quedan impactado y entendiendo la gravedad del Problema, y la tarea para solucionarlo. Los Técnicos Agropecuarios, los de las ONGs, los mismos Profesionales del Ministerio de Agricultura (SENASA, quedan impresionados del mensaje y contenido de los Afiches. Muchísimas veces me las han pedido (los afiches, pero les ofrecí publicarlos; porque considero que tiene gran creatividad y propiedad intelectual. He visto muchísimas imágenes de Capacitación; que en lugar de simplificar el mensaje, los complican. Es pues, una herramienta de trabajo para los capacitadores, para Veterinarios jóvenes e inexpertos, para la gente que está en contacto directo con el problema (pobladores; pero también lo será para tantos nuevos Profesores universitarios, sin experiencia de campo. Puede que impresione negativamente el lenguaje de los afiches; pero casualmente está hecho en el lenguaje popular que conoce la comunidad rural. La publicación persigue entregar a usarios capacitadores de una herramienta para publicitarlos masivamente.

  5. Un almuerzo para llevar saludable (Packing Smart)

    Centers for Disease Control (CDC) Podcasts

    2011-08-22

    En este podcast para niños, los chicos de Kidtastics hablan sobre almuerzos creativos para llevarse a la escuela, que ayuden a mantenerse con energía el resto del día.  Created: 8/22/2011 by National Center for Emerging and Zoonotic Infectious Diseases (NCEZID).   Date Released: 1/3/2012.

  6. Learning Parallel Computations with ParaLab

    OpenAIRE

    Kozinov, E.; Shtanyuk, A.

    2015-01-01

    In this paper, we present the ParaLab teachware system, which can be used for learning the parallel computation methods. ParaLab provides the tools for simulating the multiprocessor computational systems with various network topologies, for carrying out the computational experiments in the simulation mode, and for evaluating the efficiency of the parallel computation methods. The visual presentation of the parallel computations taking place in the computational experiments is the key feature ...

  7. Utilidades del Repositorio UJI para los investigadores

    OpenAIRE

    París-Folch, María-Lidón

    2015-01-01

    La finalidad de la presente comunicación es reflexionar sobre la visibilidad y utilidad del Repositorio UJI para los investigadores de la Universitat Jaume I, principales usuarios de este instrumento. Los objetivos son: evaluar las funcionalidades actuales del Repositorio UJI y planificar nuevas funcionalidades para adaptarse a las demandas e intereses de los investigadores. El Repositorio UJI es el repositorio institucional de la Universitat Jaume I de Castellón. Gestionado por la Bibliot...

  8. Plan de negocios para Telepresencia Business

    OpenAIRE

    Villamil Rincón, Elizabeth; Vargas Cómbita, Paula Citlalli

    2013-01-01

    El trabajo contiene el plan de negocios y mercadeo para la determinación de las condiciones óptimas bajo las cuales es viable ofrecer el servicio de préstamo, instalación y configuración de equipos para telepresencia, inicialmente a clientes corporativos de empresas ubicadas en la ciudad de Bogotá, clasificadas como medianas como grandes y finalizando con la viabilidad financiera del proyecto

  9. Framework para implementar pruebas de usabilidad flexibles para aplicaciones móviles

    OpenAIRE

    Enriquez, Juan G.; Casas, Sandra

    2014-01-01

    Al realizar pruebas de usabilidad en aplicaciones móviles, dos de los factores a considerar son el contexto móvil de uso y la variabilidad del hardware de los dispositivos móviles. Este trabajo propone un framework para implementar pruebas de usabilidad que sean flexibles para los desarrolladores al encontrarse con diferente hardware, no intrusivas para la aplicación que se quiere probar y que recolecten, además de las métricas de usabilidad, información relacionada al contexto de uso. Para l...

  10. Fatores de risco para nascimento de crianças pequenas para idade gestacional

    OpenAIRE

    Zambonato Ana Maria Krusser; Pinheiro Ricardo Tavares; Horta Bernardo Lessa; Tomasi Elaine

    2004-01-01

    OBJETIVO: Determinar os fatores de risco para o nascimento de crianças pequenas para a idade gestacional. MÉTODOS: Nos meses de outubro a dezembro de 1996, cinco maternidades de Pelotas, RS, foram visitadas diariamente para entrevistar puérperas. O peso ao nascer foi obtido do registro dos berçários. A idade gestacional foi calculada a partir da data da última menstruação. Considerou-se como pequena para a idade gestacional (PIG) aquelas crianças cujo peso ao nascer, de acordo com o sexo e a ...

  11. Arrendamiento y préstamo para equipo: Guía para el microfinanciamiento

    OpenAIRE

    Glenn D. Westley

    2003-01-01

    En este trabajo se describe la manera de otorgar financiamiento para equipo --arrendamiento y préstamo-- para los microempresarios objeto del estudio, es decir, los que necesitan aproximadamente entre 50 y 2.500 dólares para adquirir equipo. El trabajo examina los pro y los contra de las dos principales alternativas de financiamiento: préstamos y arrendamientos. También proporciona una serie de recomendaciones en cuanto a las mejores prácticas para que las instituciones microfinancieras (IMF)...

  12. Conceptos para pensar lo urbano

    Directory of Open Access Journals (Sweden)

    Marta Rizo

    2006-03-01

    Full Text Available Identidad, habitus y representaciones sociales son tres conceptos de procedencia disciplinar distinta: los dos primeros han sido abordados por la sociología, mientras que el tercero es de corte psico-social. El presente artículo explora las posibilidades de diálogo conceptual que existen entre los tres términos, y concretamente, sus posibles aportaciones al abordaje de la ciudad y lo urbano. El texto se estructura en tres grandes partes: en la primera se presenta una revisión de cada uno de los tres conceptos eje de la reflexión; en la segunda se establecen los vínculos conceptuales posibles entre ellos; y en la tercera, más que presentar conclusiones cerradas, se sugieren algunas líneas de reflexión teórica para penar la relación entre identidad, representaciones sociales y habitus en el contexto específico de las ciudades. Se señalan asimismo algunas líneas de investigación posibles, y finalmente, se exploran algunas reflexiones ya realizadas desde la sociología, la psicología social y la ciencia de la comunicación. --- Identity, habitus and social representations are concepts that a have different disciplinary origin: the first and the second one have been covered by sociology, while the third one has a psycho-social feature. This article explores the possibilities of conceptual dialogue among these three terms, and in particular, their possible contributions to approaching both the city and the urban. The text is organized in three main parts. In the first one, a review of each one of these concepts is presented. In the second one, possible conceptual links among them are established. In the third one, and more than presenting closed conclusions, some theoretical reflection lines are suggested, aimed to think the relation among identity, social representations and habitus , in the specific context of the cities. At the same time, some possible research lines are indicated, and reflections already carried out by sociology

  13. Alimentos balanceados para perros en Costa Rica

    Directory of Open Access Journals (Sweden)

    Ruth Vargas

    2001-01-01

    Full Text Available Diagnóstico de la comercialización de alimentos balanceados para perros en Costa Rica. Para ampliar los reportes oficiales de la comercialización de alimentos para perros se creó una base de datos que incluyó cantidad, costo, empaque y formulación durante el período 1998 a agosto del 2000. De 1995 a 1998 y de 1996 a 1999 la producción nacional incrementó un 90,4% y la importación un 42,56% respectivamente, ocupando los alimentos nacionales un 72% del tonelaje y un 70% del valor en dólares americanos. No fue posible determinar cuál es el empaque más comercializado, pero si que los alimentos extrusados son los que ocupan el primer lugar y que los alimentos recomendados para cachorros y adultos son los que más se comercializan. La ausencia de datos en las declaraciones sugiere la necesidad de incrementar el control en las mismas en caso de requerirse un estudio de mercado, ya que contrariamente a esta situación el mayor número de garantías inscritas corresponden separadamente para las fases de cachorros y adultos. Merece también atención que las garantías indican mayores porcentajes de proteína cruda que los recomendados por la AAFCO y que al menos 36 fórmulas son recomendadas para estados sanitarios específicos (p.e. para perros con problemas de alergias, cálculos renales, pérdidas de pelo, etc. sin que oficialmente se encuentre registrada ninguna fórmula medicada

  14. Patogenicidade de isolados de três fungos entomopatogênicos a soldados de Atta sexdens sexdens (Linnaeus, 1758 (Hymenoptera : Formicidae Pathogenicity of isolates of three entomopathogenic fungi against soldiers of Atta sexdens sexdens (Linnaeus, 1758 (Hymenoptera : Formicidae

    Directory of Open Access Journals (Sweden)

    Elisângela de Souza Loureiro

    2005-08-01

    Full Text Available As formigas cortadeiras atacam diversas culturas agrícolas, pastagens e os reflorestamentos, atuando sobre muitas espécies vegetais. O presente trabalho teve por objetivo avaliar a patogenicidade dos fungos Beauveria bassiana (isolados AM 9 e JAB 06, Metarhizium anisopliae (isolados E 9 e AL e Paecilomyces farinosus (isolados CG 189 e CG 195 a soldados de Atta sexdens sexdens, em condições de laboratório. Após a coleta em formigueiro isento de produtos fitossanitários, exemplares de soldados foram cuidadosamente separados em grupos de oito indivíduos e, a seguir, banhados em suspensões contendo 1,0 x 10(6, 1,0 x 10(7, 1,0 x 10(8 e 1,0 x 10(9 conídios/mL de cada isolado. Em seguida, cada grupo de formigas foi transferido para unidades de câmara úmida e mantido, sem alimentação, a 27 ± 1 ºC. A mortalidade foi verificada diariamente. Os três fungos se mostraram eficientes patógenos, pois provocaram alta mortalidade, matando mais que 80% dos soldados nos quatro primeiros dias após a inoculação. Os melhores isolados foram JAB 06 e AL, na concentração de 1,0 x 10(9 con./mL. Os isolados JAB 06, AL, CG 195 apresentaram maior capacidade de esporular nos cadáveres das formigas e os tempos letais decresceram com o aumento da concentração de conídios usada.Leaf-cutting ants attack several crops, pastures and the planted forests, acting on numerous vegetable species. The present work aimed to evaluate the pathogenicity of the fungi Beauveria bassiana (isolates AM 9 and JAB 06, Metarhizium anisopliae (isolates E 9 and Al and Paecilomyces farinosus (isolates CG 189 and CG 195 against soldiers of Atta sexdens sexdens, in laboratory conditions. These fungi were inoculated on soldiers after collection in nests without pesticides application. Specimens of soldiers were separated in groups of eight insects, which were bathed in suspensions containing 1.0 x 10(6, 1.0 x 10(7, 1.0 x 10(8 and 1.0 x 10(9 conidia/ml. Following the bath, each

  15. Modelo para el análisis de una aptitud cognitiva para el aprendizaje

    Directory of Open Access Journals (Sweden)

    Clara Cecilia Uribe Hernández

    2009-01-01

    Full Text Available La investigación en el campo de las aptitudes cognitivas para el aprendizaje requiere una forma de abordarlas y definir sus características y componentes. A su vez, esta definición debe conducir al investigador a la creación de pruebas de medición que ayuden al análisis de este tipo de aptitudes y su relación con otras variables del aprendizaje. Para dar respuesta a esas necesidades, el objetivo de este artículo es proponer la creación de un modelo para el análisis de una aptitud cognitiva para el aprendizaje, cuya estructura conste de cuatro elementos principales. Dos de ellos relacionados con los enfoques y consideraciones para emprender su estudio; los otros dos, con la definición de la aptitud, a través de sus características y sus componentes.

  16. The ParaScope parallel programming environment

    Science.gov (United States)

    Cooper, Keith D.; Hall, Mary W.; Hood, Robert T.; Kennedy, Ken; Mckinley, Kathryn S.; Mellor-Crummey, John M.; Torczon, Linda; Warren, Scott K.

    1993-01-01

    The ParaScope parallel programming environment, developed to support scientific programming of shared-memory multiprocessors, includes a collection of tools that use global program analysis to help users develop and debug parallel programs. This paper focuses on ParaScope's compilation system, its parallel program editor, and its parallel debugging system. The compilation system extends the traditional single-procedure compiler by providing a mechanism for managing the compilation of complete programs. Thus, ParaScope can support both traditional single-procedure optimization and optimization across procedure boundaries. The ParaScope editor brings both compiler analysis and user expertise to bear on program parallelization. It assists the knowledgeable user by displaying and managing analysis and by providing a variety of interactive program transformations that are effective in exposing parallelism. The debugging system detects and reports timing-dependent errors, called data races, in execution of parallel programs. The system combines static analysis, program instrumentation, and run-time reporting to provide a mechanical system for isolating errors in parallel program executions. Finally, we describe a new project to extend ParaScope to support programming in FORTRAN D, a machine-independent parallel programming language intended for use with both distributed-memory and shared-memory parallel computers.

  17. Instrumento para o gerenciamento de riscos ambientais

    Directory of Open Access Journals (Sweden)

    Thaiza Clemente Couto Bissacot

    2016-01-01

    Full Text Available RESUMO: Embora existam normas e metodologias padronizadas para a análise de riscos ambientais dentro de uma organização, os mecanismos e/ou instrumentos disponíveis estão sujeitos à subjetividade, não são automatizados, não estabelecem critérios técnicos e, de maneira geral, não apresentam mecanismos de priorização para a tomada de decisão. Com base nas lacunas observadas, a presente nota técnica apresenta as premissas de um Instrumento de Gestão para a Identificação e o Gerenciamento de Riscos Ambientais (IGIGRA. O dashboard consolidado pelo IGIGRA permitirá a visualização consolidada dos riscos ambientais do empreendimento, proporcionando comparações entre diferentes operações e períodos de avaliação, fornecendo base técnica para a priorização de ações e alocação de recursos para o controle dos riscos dentro da organização.

  18. LITERATURA PARA JOVENS LEITORES: UMA PROPOSTA

    Directory of Open Access Journals (Sweden)

    Gizelle Kaminski Corso

    2011-08-01

    Full Text Available Percebendo que o público-alvo das adaptações de textos clássicos não é tão somente a criança e o adolescente – leitores jovens, aos quais supostamente destinam-se as literaturas “infantil” e “infantojuvenil”, proponho neste texto uma nova classificação para as adaptações literárias, vendo-as não mais apenas como “adaptações para a literatura infantojuvenil”, mas como “literatura para jovens leitores”. Como tais textos são também lidos por adultos, por propósitos diversos, reconheço que o conceito proposto abrange um número maior de leitores. Para tanto, faço um breve percurso histórico-crítico acerca do aparecimento das adaptações no cenário literário brasileiro com a finalidade de corroborar e justificar a pertinência da classificação sugerida para as adaptações.

  19. Los videojuegos: conectar alumnos para aprender

    Directory of Open Access Journals (Sweden)

    José Antonio Valderrama Ramos

    2012-01-01

    Full Text Available Este artículo explora la utilidad que presentan los videojuegos comerciales actuales para educar a los jugadores y ayudarlos a adquirir habilidades necesarias para desempeñarse mejor en nuestra sociedad. Aborda el problema de la educación formal, la cual no está respondiendo a la situación de complejidad de nuestro entorno y usa el paradigma del pensamiento complejo y siete saberes para la educación propuestas por Edgar Morin. También, describe algunas ideas que le pueden ser de utilidad a docentes interesados en usar videojuegos como herramientas pedagógicas en el salón de clases.

  20. Estrategias de mercado para el frijol centroamericano

    Directory of Open Access Journals (Sweden)

    Lourdes Mart\\u00EDnez

    2004-01-01

    Full Text Available Estrategias de mercado para el frijol centroamericano. En los últimos años, el sub-sector de frijol en Centro América ha sido testigo de varios cambios dinámicos. Si no se encuentran medidas para incrementar la competitividad regional de este sub-sector, los países centroamericanos experimentarán impactos negativos en las áreas sociales y económicas de considerable magnitud, especialmente ahora que Centro América necesita ajustar su economía a los nuevos requerimientos de mercados mas abiertos, como el Tratado Centroamericano de Libre Comercio con USA (TLC. Vendedores de frijoles a nivel intermediario y de consumo final, así como técnicos de oficinas gubernamentales dedicadas al mercadeo de frijoles en Centro América fueron entrevistados para documentar los cambios experimentados, identificar los obstáculos que frenan la viabilidad del sub-sector e identificar las oportunidades de incremento de mercados en el futuro para los productores y vendedores de frijol. Los resultados muestran que para que continúen siendo competitivos, los países centroamericanos deben incrementar la productividad a través del apoyo a las investigaciones para el mejoramiento de variedades de frijol, especialmente aquellas que los consumidores prefieren por características específicas (e.g. color. También es imprescindible el fortalecimiento de los programas de distribución de variedades mejoradas a los productores; las mejoras en la transmisión de información de mercado a los productores; el fortalecimiento de los contactos entre productores, comercializadores a nivel mayorista y supermercados; y una política más específica de apertura de mercados de exportación, especialmente con los Estados Unidos.

  1. Espacio urbano para el desarrollo sostenible

    Directory of Open Access Journals (Sweden)

    Guillermo Malca Obregoso

    2004-01-01

    Full Text Available Este artículo ilustra una Metodología de Análisis-Propuesta Urbana Sostenible para la enseñanza-aprendizaje del diseño urbano-arquitectónico conciente de su entorno socio-cultural-ambiental. Se presenta como alternativa a los métodos convencionales de intervención urbana. Pretende, a partir de la visión dialéctica, entender los problemas originados por el crecimiento de las ciudades de modo INTEGRAL, sin segmentarlos para su estudio parcializado y parcelado.

  2. "mbigoo!", la red social para foodies.

    OpenAIRE

    García Pumar, Javier

    2016-01-01

    Este trabajo fin de grado consiste en la elaboración de la web de una red social para aficionados a la gastronomía, englobando todo el ciclo de procesos de creación y siguiendo los principios del diseño centrado en el usuario (DCU), para obtener un primer prototipo con unas funcionalidades mínimas, que sea flexible y ampliable en el futuro, y que represente una opción de negocio. A partir de analizar las tendencias actuales, surge la gastronomía como un campo en plena ebullición, ...

  3. Desarrollo de entornos interactivos para usuarios sordos

    OpenAIRE

    Valenzuela, Adriana; Agüero, Hugo E.; Beguerí, Graciela

    2011-01-01

    Este trabajo expone los resultados de la experiencia alcanzada en el desarrollo de aplicaciones para personas sordas a través del uso de la tecnología de Servicios Web. Construido el servicio Web Lengua_de_Señas_Argentina (LSA), se desarrollaron dos sistemas interactivos que consumen el mismo; uno corresponde a una aplicación de escritorio que tiene como propósito realizar una primera experiencia en el desarrollo de entornos interactivos para usuarios sordos y el otro propone una aplicación p...

  4. Nuevas perspectivas para entender el emprendimiento empresarial

    OpenAIRE

    Alfonso Rodríguez Ramírez

    2009-01-01

    El propósito de este artículo es construir de manera ecléctica y holística las bases de un marco teórico que describa, analice e interprete el fenómeno del emprendimiento empresarial desde el punto de vista interdisciplinario. Se busca que éste sea el fundamento para responder a la pregunta ¿cómo entender el emprendimiento?, y para construir, a partir de su evolución, diversas perspectivas que enriquezcan su análisis y estudio. De esta manera el emprendimiento es comprendido como un fenómeno ...

  5. Espacio urbano para el desarrollo sostenible

    Directory of Open Access Journals (Sweden)

    Guillermo Malca Obregoso

    2015-04-01

    Full Text Available Este artículo ilustra una Metodología de Análisis-Propuesta Urbana Sostenible para la enseñanza-aprendizaje del diseño urbano-arquitectónico conciente de su entorno socio-cultural-ambiental. Se presenta como alternativa a los métodos convencionales de intervención urbana. Pretende, a partir de la visión dialéctica, entender los problemas originados por el crecimiento de las ciudades de modo INTEGRAL, sin segmentarlos para su estudio parcializado y parcelado.

  6. Arquitectura Organizacional para Soluciones Empresariales de Software

    OpenAIRE

    Solangel Rodríguez Vázquez

    2013-01-01

    La arquitectura organizacional para soluciones empresariales de software es un modelo organizativo que tiene como objetivo contribuir a elevar la productividad de los procesos y el empleo adecuado de los recursos humanos de una organización productiva de software. Para la elaboración de la arquitectura se tuvo en cuenta los problemas en el flujo de trabajo actual, las deficiencias referentes a la distribución de roles, la inadecuada gestión del tiempo y la escasa utilización de componentes de...

  7. Aprender ciencias en y para la comunidad

    OpenAIRE

    Roth, Wolff-Michael

    2002-01-01

    Durante algún tiempo, he afirmado que la educación científica necesita ser desinstitucionalizada para superar la profunda crisis que atraviesa actualmente. En este artículo describo formas en las cuales se puede pensar y poner en práctica esta desinstitucionalización en la enseñanza de las ciencias y en la práctica del diseño del currículo de ciencias. Se propone la teoría de la actividad como marco para conceptualizar diferentes sistemas de actividad y sus contradicciones. Proporciono ejempl...

  8. T I C : Trayectos Interactivos para Compartir

    OpenAIRE

    Rodríguez Carracedo, María del Carmen

    2012-01-01

    Las tecnologías y sus acelerados desarrollos han tenido un considerable impacto social. La condición de nativos digitales –cada vez más presente- de nuestros alumnos, hace que espontáneamente convivan con esas herramientas y este mundo revolucionariamente cambiante. Sin embargo, no los convierte en innatos poseedores de habilidades para resolver conflictos cotidianos ni para el aprovechamiento apropiado de aquellas. Los sistemas educativos evolucionaron a un ritmo mucho más lento, pero ...

  9. Imaging of limbic para-neoplastic encephalitis

    International Nuclear Information System (INIS)

    Para-neoplastic limbic encephalitis is a rare syndrome mostly associated with small cell lung cancer. We present the case of a 69-year-old man with selective amnesia suggesting limbic encephalitis. A neuroendocrine cell lung cancer was found, confirming the diagnostics of para-neoplastic limbic encephalitis. Contrast-enhanced cerebral CT was normal whether magnetic resonance imaging showed signal abnormalities of the medial part of temporal lobes and hippocampal regions. Because neurologic improvement may follow treatment of the primary tumor, early diagnosis is important. (authors)

  10. Propuestas para combatir la contabilidad creativa

    Directory of Open Access Journals (Sweden)

    Oriol Amat Salas

    2004-01-01

    Full Text Available Los escándalos contables han reavivado el interés en combatir la contabilidad creativa. Este artículo analiza la naturaleza de esta problemática y los aspectos de la normativa que la afectan. Incluye el ejemplo de una empresa real para visualizar los efectos que los maquillajes contables, amparados en la normativa contable española y en las Normas Internacionales de Contabilidad, pueden provocar en el resultado. Al final, se proponen medidas para mejorar la credibilidad de la información financiera.

  11. Neurocisticercosis: Afiches para Capacitación

    OpenAIRE

    MARCELO ROJAS C

    2007-01-01

    En el sistema universitario (me atrevo a decir, de todo el mundo), es poco el contenido educativo relativo a la Transferencia tecnológica para efectos de la capacitación de la sociedad sobre problemas de salud (claros ejemplos desafiantes para los veterinarios son la hidatidosis y cisticercosis) y otros; manejados en términos de cambios de conducta. Los términos de control y prevención están dados en un lenguaje académico, muy abstracto y obviamente intrascedente en la comunidad. Al punto que...

  12. Herramientas de software para OAI-PMH

    OpenAIRE

    Bueno-de-la-Fuente, Gema; Rodríguez-Mateos, David

    2007-01-01

    Tanto para poner en marcha proveedores de datos como proveedores de servicios o agregadores, es importante conocer cuáles son las alternativas de software entre las que elegir. Aunque en los capítulos anteriores se dan algunas indicaciones, se ha considerado oportuno dedicar el capítulo 8, “Herramientas de software para OAI-PMH”, a elaborar una descripción de las principales aplicaciones empleadas en la actualidad. Tras una primera introducción sobre la diferencia entre software libre, softwa...

  13. Acessibilidade de museus europeus para deficientes visuais

    OpenAIRE

    Mesquita, Susana Maria Vasconcelos

    2011-01-01

    As pessoas portadoras de deficiência (física, auditiva, mental ou visual) têm as mesmas necessidades e desejos de participar e praticar turismo que o público dito normal. No entanto, esta tarefa, representa para este grupo um desafio acrescido, já que a nossa sociedade está pensada para a maioria das pessoas, que não são portadoras destas deficiências. Num mundo com imensos estímulos visuais existe necessidade de implementar estratégias que permitam às pessoas com deficiênci...

  14. Star Wars: fuga para o mito

    OpenAIRE

    Sousa, Marco António Couto

    2012-01-01

    Esta tese propõe-se a procurar explicações para a popularidade da saga de filmes levando em linha de conta o contexto cultural e histórico no qual A Guerra das Estrelas encontrou a sua génese. Desde os primeiros anos de vida do mentor da saga, George Lucas, fontes de inspiração para a série de filmes são exploradas, e ligações são estabelecidas com outros objectos culturais previamente existentes ou posteriores à saga. Premissa central a esta tese é a de que A Guerra das Estrelas veicula, ...

  15. Share!: Sistema para compartir contenidos multimedia

    OpenAIRE

    Cimas Bravo, Eduardo

    2015-01-01

    Este trabajo consiste en un sistema informático destinado a la compartición de contenidos multimedia entre grupos restringidos de usuarios. Los contenidos pueden ser imágenes, vídeos y audios. Este sistema se compone de dos aplicaciones, una aplicación web y una aplicación móvil para dispositivos Android. La esencia del sistema es proporcionar un mecanismo para compartir rápidamente contenidos multimedia entre usuarios. Los contenidos pueden estar ya en sus dispositivos móviles o ser capturad...

  16. Esquemas de incentivos para la Carrera Docente.

    OpenAIRE

    Claudia Marcela UMAÑA

    2004-01-01

    El esquema tradicional de remuneración a la carrera docente se ha basado en un sistema de categorías salariales en las cuales los únicos requisitos para ascender son los años de experiencia y la acumulación de créditos educativos1 sin que esta remuneración este ligada a los resultados laborales o a la productividad de los docentes. Como alternativa a este sistema, diversos países han empezado a implementar durante la última década programas o esquemas de incentivos para docentes con el fin de...

  17. IR & FX Linked Note para inversionistas colombianos

    OpenAIRE

    Restrepo Montoya, Julián Esteban

    2015-01-01

    Los Productos Estructurados son instrumentos financieros que son construidos para cumplir ciertas condiciones y objetivos de rentabilidad y riesgo que tenga su operador o inversionista -- Este documento presenta la construcción de un producto estructurado de tasas de interés y tasa de cambio (IR & FX por sus siglas en inglés) para inversionistas Colombianos, que maximiza la rentabilidad y garantiza la protección del capital -- La construcción de este instrumento se realiza a través de la inve...

  18. Sistemas de labranza para suelos salinos

    OpenAIRE

    Hervé, Dominique; Mita, V.; Paz, B.

    2001-01-01

    Mejorar los sistemas de labranza para cultivar suelos salinos es un reto para el sur del Altiplano boliviano. Se comparo durante dos anos (1994-95 y 1995-96) el surcado en faja con discos, practicado por los campesinos de la provincia Villarroel, y el subsolado a 50 cm de profundidad solo o combinado con el surcado. Se buscaba asi romper la costra en suelos muy arcillosos y llevar las sales a mayor profundiad que los horizontes colonizados por las raices de los cultivos de quinua (raiz pivota...

  19. Indicadores de calidad para evaluar repositorios institucionales

    OpenAIRE

    Barrionuevo Almuzara, Leticia

    2010-01-01

    Se presentan una serie de indicadores útiles para garantizar la calidad de los repositorios institucionales en abierto. Evaluar o medir el valor de un producto, servicio, actividad u objeto es necesario para saber si éste está funcionando de acuerdo a unos criterios preestablecidos o por el contrario se deben corregir errores. Se puede hablar de una clara tendencia o moda de evaluación en los sistemas bibliotecarios, quizás por el carácter tan crítico de los clientes/usuarios, quienes desean ...

  20. Valores de referência para carboxiemoglobina

    Directory of Open Access Journals (Sweden)

    Siqueira Maria Elisa P. B. de

    1997-01-01

    Full Text Available INTRODUÇÃO: Os valores de referência de indicadores biológicos são utilizados como parâmetros para interpretação de resultados de valores obtidos em indivíduos expostos ocupacionalmente aos agentes químicos. O Grupo Brasileiro para Estabelecimento dos Valores de Referência tem se dedicado a estas determinações objetivando estabelecer valores de referência para os diferentes bioindicadores em diversas regiões do País. Determinaram-se os valores de referência para a carboxiemoglobina (COHb no Sul de Minas Gerais. MATERIAL E MÉTODO: A COHb foi analisada pelo método espectrofométrico, otimizado no laboratório de análises toxicológicas. Em todas as amostras também foram realizadas análises de alguns parâmetros bioquímicos e hematológicos para atestar o estado de saúde da população, constituída de 200 voluntários não-fumantes e não-expostos, por motivo profissional, ao monóxido de carbono. Cada indivíduo respondeu um questionário para levantamento de dados relevantes à interpretação dos resultados. Os valores de referência foram expressos em termos da média ± desvio-padrão, intervalo de confiança 95% e valor de referência superior. A distribuição estatística dos resultados obtidos foi realizada para possibilitar sua comparação com grupos de trabalhadores, preferentemente à avaliação individual. RESULTADOS E CONCLUSÕES: O valor médio ± desvio-padrão para a carboxiemoglobina foi de 1,0 % ± 0,75; o intervalo de confiança 95%, entre 0,9 e 1,1 % e o valor de referência superior, de 2,5%. Através do teste t de Student (p < 0,05 não foi detectada diferença nos valores de acordo com o sexo, idade ou uso de bebidas alcoólicas. Os valores de referência encontrados foram similares aos reportados em outros países.

  1. Valores de referência para carboxiemoglobina

    Directory of Open Access Journals (Sweden)

    Maria Elisa P. B. de Siqueira

    1997-12-01

    Full Text Available INTRODUÇÃO: Os valores de referência de indicadores biológicos são utilizados como parâmetros para interpretação de resultados de valores obtidos em indivíduos expostos ocupacionalmente aos agentes químicos. O Grupo Brasileiro para Estabelecimento dos Valores de Referência tem se dedicado a estas determinações objetivando estabelecer valores de referência para os diferentes bioindicadores em diversas regiões do País. Determinaram-se os valores de referência para a carboxiemoglobina (COHb no Sul de Minas Gerais. MATERIAL E MÉTODO: A COHb foi analisada pelo método espectrofométrico, otimizado no laboratório de análises toxicológicas. Em todas as amostras também foram realizadas análises de alguns parâmetros bioquímicos e hematológicos para atestar o estado de saúde da população, constituída de 200 voluntários não-fumantes e não-expostos, por motivo profissional, ao monóxido de carbono. Cada indivíduo respondeu um questionário para levantamento de dados relevantes à interpretação dos resultados. Os valores de referência foram expressos em termos da média ± desvio-padrão, intervalo de confiança 95% e valor de referência superior. A distribuição estatística dos resultados obtidos foi realizada para possibilitar sua comparação com grupos de trabalhadores, preferentemente à avaliação individual. RESULTADOS E CONCLUSÕES: O valor médio ± desvio-padrão para a carboxiemoglobina foi de 1,0 % ± 0,75; o intervalo de confiança 95%, entre 0,9 e 1,1 % e o valor de referência superior, de 2,5%. Através do teste t de Student (p < 0,05 não foi detectada diferença nos valores de acordo com o sexo, idade ou uso de bebidas alcoólicas. Os valores de referência encontrados foram similares aos reportados em outros países.

  2. Propuestas para combatir la contabilidad creativa

    OpenAIRE

    Oriol Amat Salas; Ester Oliveras

    2004-01-01

    Los escándalos contables han reavivado el interés en combatir la contabilidad creativa. Este artículo analiza la naturaleza de esta problemática y los aspectos de la normativa que la afectan. Incluye el ejemplo de una empresa real para visualizar los efectos que los maquillajes contables, amparados en la normativa contable española y en las Normas Internacionales de Contabilidad, pueden provocar en el resultado. Al final, se proponen medidas para mejorar la credibil...

  3. Un modelo SETAR para el PIB colombiano

    OpenAIRE

    Vivas Lorena; Ramos Johanna; Hoyos Milena

    2010-01-01

    En este artículo se estudia el comportamiento de la tasa de crecimiento del PIB colombiano durante el período 1982-2008 a partir de un modelo SETAR (Self-Exciting Threshold Autoregressive), con base en la metodología propuesta por Tsay (1989) y Tong (1990) para la detección de no linealidades relacionadas con la existencia de regímenes cambiantes. Adicionalmente, se evalúa el desempeño de los pronósticos generados en relación a los obtenidos con un modelo autorregresivos lineal para diferente...

  4. Controlador DNP3 para la CIAA

    OpenAIRE

    Tobar, Sebastián; Noguera, Joel; Taffernaberry, Juan Carlos; Mercado, Gustavo

    2016-01-01

    La CIAA [1] (Computadora Industrial Abierta Argentina) tiene las características necesarias para utilizarse como RTU (Remote Terminal Unit - Unidad Terminal Remota) en sistemas SCADA [2] (Supervisory Control And Data Acquisition – Supervisión Control y Adquisición de Datos). Sin embargo, una gran limitación para esta aplicación radica en que actualmente soporta un único protocolo de comunicación: Modbus. Si bien este protocolo es, probablemente, el más utilizado históricamente en la industria...

  5. Genome-Wide Analysis of Host Responses to Four Different Types of Microorganisms in Bombyx Mori (Lepidoptera: Bombycidae).

    Science.gov (United States)

    Cheng, Tingcai; Lin, Ping; Huang, Lulin; Wu, Yuqian; Jin, Shengkai; Liu, Chun; Xia, Qingyou

    2016-01-01

    Several pathogenic microorganisms have been used to investigate the genome-wide transcriptional responses of Bombyx mori to infection. However, studies have so far each focused on one microorganism, and systematic genome-wide comparison of transcriptional responses to different pathogenic microorganisms has not been undertaken. Here, we surveyed transcriptional responses of B. mori to its natural bacterial, viral, and fungal pathogens, Bacillus bombyseptieus, B. mori nucleopolyhedrovirus (BmNPV), and Beauveria bassiana, respectively, and to nonpathogenic Escherichia coli, by microarray analysis. In total, the expression of 2,436, 1,804, 1,743, and 912 B. mori genes was modulated by infection with B. bombyseptieus, BmNPV, B. bassiana, and E. coli, respectively. Notably, the expression of 620, 400, 177, or 165 of these genes was only modulated by infection with B. bombyseptieus, BmNPV, B. bassiana, or E. coli, respectively. In contrast to the expression of genes related to juvenile hormone synthesis and metabolism, that of genes encoding juvenile hormone binding proteins was microorganism-specific. Three basal metabolic pathways were modulated by infection with any of the four microorganisms, and 3, 14, 5, and 2 metabolic pathways were specifically modulated by infection with B. bombyseptieus, BmNPV, B. bassiana, and E. coli, respectively. Interestingly, BmNPV infection modulated the JAK/STAT signaling pathway, whereas both the Imd and Toll signaling pathways were modulated by infection with B. bombyseptieus, B. bassiana, or E. coli These results elucidate potential molecular mechanisms of the host response to different microorganisms, and provide a foundation for further work on host-pathogen interaction. PMID:27382132

  6. Entomopathogens Isolated from Invasive Ants and Tests of Their Pathogenicity

    Directory of Open Access Journals (Sweden)

    Maria Fernanda Miori de Zarzuela

    2012-01-01

    Full Text Available Some ant species cause severe ecological and health impact in urban areas. Many attempts have been tested to control such species, although they do not always succeed. Biological control is an alternative to chemical control and has gained great prominence in research, and fungi and nematodes are among the successful organisms controlling insects. This study aimed to clarify some questions regarding the biological control of ants. Invasive ant species in Brazil had their nests evaluated for the presence of entomopathogens. Isolated entomopathogens were later applied in colonies of Monomorium floricola under laboratory conditions to evaluate their effectiveness and the behavior of the ant colonies after treatment. The entomopathogenic nematodes Heterorhabditis sp. and Steinernema sp. and the fungi Beauveria bassiana, Metarhizium anisopliae, and Paecilomyces sp. were isolated from the invasive ant nests. M. floricola colonies treated with Steinernema sp. and Heterorhabditis sp. showed a higher mortality of workers than control. The fungus Beauveria bassiana caused higher mortality of M. floricola workers. However, no colony reduction or elimination was observed in any treatment. The defensive behaviors of ants, such as grooming behavior and colony budding, must be considered when using fungi and nematodes for biological control of ants.

  7. EVALUATIO OF MICROBIAL AGENTS AND BIO-PRODUCTS FOR THE MANAGEMENT OF MUSTARD APHID, LIPAPHIS ERYSIMI (KALT.

    Directory of Open Access Journals (Sweden)

    RAJENDRA NAGAR

    2013-01-01

    Full Text Available Microbial agents (Verticillium lecanii, Beauveria bassiana and Metarhizium anisopliae @ 5 g per litre of water,plant products (Tobacco, onion and neem seed kernel extract @ 5%, cow urine @ 50 litre/ha and dimethoate30EC @ 300 g a.i/ha were evaluated against mustard aphid, Lipaphis erysimi (Kalt. and their safety to naturalenemies and pollinators. Significantly higher aphid reduction was recorded under these treatments over thecontrol without any phytotoxic effect and found safe to natural enemies of mustard aphid and honeybee. Mostfavourable cost-benefit ratio was obtained under the treatment i.e. dimethoate 30 EC @ 300 g a.i/ha (1:38followed by neem seed kernel extract @ 5% (1:18, onion extract @ 5% (1:17, cow urine @ 50 litre/ha (1:11,Beauveria bassiana @ 5 g per litre of water (1:10, Verticillium lecanii @ 5 g per litre of water (1:10, Metarhiziumanisopliae @ 5 g per litre of water (1:8, tobacco extract @ 5% (1:6 and water spray (1:2.

  8. Viability and stability of biological control agents on cotton and snap bean seeds.

    Science.gov (United States)

    Elliott, M L; Des Jardin, E A; Batson, W E; Caceres, J; Brannen, P M; Howell, C R; Benson, D M; Conway, K E; Rothrock, C S; Schneider, R W; Ownley, B H; Canaday, C H; Keinath, A P; Huber, D M; Sumner, D R; Motsenbocker, C E; Thaxton, P M; Cubeta, M A; Adams, P D; Backman, P A; Fajardo, J; Newman, M A; Pereira, R M

    2001-08-01

    Cotton and snap bean were selected for a multi-year, multi-state regional (south-eastern USA) research project to evaluate the efficacy of both commercial and experimental bacterial and fungal biological control agents for the management of damping-off diseases. The goal for this portion of the project was to determine the viability and stability of biological agents after application to seed. The biological seed treatments used included: (1) Bacillaceae bacteria, (2) non-Bacillaceae bacteria, (3) the fungus Trichoderma and (4) the fungus Beauveria bassiana. Seed assays were conducted to evaluate the following application factors: short-term (seed treatment; quality (i.e. isolate purity); compatibility with chemical pesticides and other biocontrol agents; application uniformity between years and plant species. For the bacterial treatments, the Bacillaceae genera (Bacillus and Paenibacillus) maintained the greatest population of bacteria per seed, the best viability over time and the best application uniformity across years and seed type. The non-Bacillaceae genera Burkholderia and Pseudomonas had the least viability and uniformity. Although Beauveria bassiana was only evaluated one year, the seed fungal populations were high and uniform. The seed fungal populations and uniformity for the Trichoderma isolates were more variable, except for the commercial product T-22. However, this product was contaminated with a Streptomyces isolate in both the years that it was evaluated. The study demonstrated that Bacillaceae can be mixed with Trichoderma isolates or with numerous pesticides to provide an integrated pest control/growth enhancement package. PMID:11517723

  9. Especializaci??n para la empleabilidad eficiente, anotaciones para el postgrado en trabajo social

    OpenAIRE

    Alonso Alonso, Rosario; Julve Negre, Milagros

    2006-01-01

    La especializaci??n ofrecida en los Postgrados de Trabajo Social deber??a de introducir nuevos principios de organizaci??n para situar a los profesionales en una posici??n competitiva para facilitar la movilidad laboral, caracter??stica espec??fica en el sector. Al mismo tiempo, orientarse por la eficacia y el ??xito en la intervenci??n profesional. Para ello es necesario introducir el concepto de "pr??cticas de calidad" e incluir contenidos que no s??lo formen en competencias Te??rico- t??cn...

  10. Modelo para el análisis de una aptitud cognitiva para el aprendizaje

    OpenAIRE

    Clara Cecilia Uribe Hernández

    2009-01-01

    La investigación en el campo de las aptitudes cognitivas para el aprendizaje requiere una forma de abordarlas y definir sus características y componentes. A su vez, esta definición debe conducir al investigador a la creación de pruebas de medición que ayuden al análisis de este tipo de aptitudes y su relación con otras variables del aprendizaje. Para dar respuesta a esas necesidades, el objetivo de este artículo es proponer la creación de un modelo para el análisis de una aptitud cognitiva pa...

  11. Consumo de bebidas para una vida saludable: recomendaciones para la población mexicana

    OpenAIRE

    Juan A Rivera; Onofre Muñoz-Hernández; Martín Rosas-Peralta; Aguilar-Salinas, Carlos A; Willett, Walter C.; Popkin, Barry M.

    2008-01-01

    El secretario de Salud convocó al Comité de Expertos para la elaboración de las Recomendaciones sobre el consumo de bebidas para la población mexicana ; la finalidad fue desarrollar lineamientos basados en evidencia científica para los consumidores, los profesionales de la salud y el sector gubernamental. Las prevalencias de sobrepeso, obesidad y diabetes han aumentado con rapidez en México y las bebidas representan la quinta parte de la energía que consumen los mexicanos. La evidencia señal...

  12. Proyecto de domótica para vivienda nueva y para vivienda existente

    OpenAIRE

    Ruzo Parragués, Martín

    2007-01-01

    Este proyecto consiste en el detalle de una instalación domótica de acuerdo a unas necesidades de usuario determinadas. El trabajo se divide en dos partes principales: la primera detalla una solución para esta instalación domótica en el caso que la vivienda escogida sea de nueva construcción. La segunda, en cambio, propone una solución para el caso que la misma vivienda esté ya construida. Para ambas soluciones se proponen tecnologías diferentes y se presentan sus características princi...

  13. Vendaje funcional para la ''mano abierta''

    OpenAIRE

    Rochina, Iván

    2013-01-01

    Se muestra la aplicación de un vendaje funcional para el tratamiento de las molestias ocasionadas por la distensión de los ligamentos propios de los huesos del carpo; Producción: SFPIE(www.uv.es/sfpie)|VLC Campus (www.vlc-campus.com)

  14. Para uma abordagem virtuosa do Jornalismo

    Directory of Open Access Journals (Sweden)

    Rogério Christofoletti

    2012-06-01

    Full Text Available As últimas décadas têm favorecido o crescimento do interesse e dos estudos sobre a ética jornalística. No Brasil e em outras praças, as abordagens deste tema têm sido na maioria das vezes por um caráter deontológico ou utilitarista. Neste artigo, chamamos a atenção para uma perspectiva que privilegie as virtudes como pontos de partida para os debates acerca das condutas dos profissionais. Uma ética das virtudes remete a Aristóteles e aos estoicos, mas vem sendo retomada por autores mais contemporâneos, como Macintyre e Comte-Sponville, entre outros. No jornalismo, esta abordagem não é definitiva ou totalizante, mas contribui para uma compreensão mais ampla da discussão, chamando inclusive a atenção para recomendações éticas úteis, práticas e atuais.

  15. Educación para la paz

    Directory of Open Access Journals (Sweden)

    Federico Mayor Zaragoza

    2003-01-01

    Full Text Available La educación para la paz ha experimentado un desarrollo importante en los últimos 20 años, y el 2000 ha sido declarado Año Internacional para la Cultura de Paz. Exige un esfuerzo de pariicipación y una capacidad crítica para facilitar el paso de una cultura de guerra a un cultura de paz. Se trata de ayudar a todos los ciudadanos a observar y reflexionar sobre el conjunto de la tierra y de quienes la habitan. De escuchar a los jóvenes y ser escuchado. La educación para la paz ha de ser considerada como contenido transversal de la educación. La situación actual, los conflictos interétnicos e interculturales , la exclusión y la marginalidad, las sociedades pobres y las ricas son cuestiones que reclaman una educación par la paz. De la cultura de imposición hemos de pasar a la cultura del diálogo y parti-cipación, solidaridad, compromiso, tolerancia y respeto. Es necesario construir otro mundo en el que podamos asegurar a nuestros descendientes el futuro. La paz es un comportamiento, es traducir a la práctica los principios de con-vivencia, de solidaridad, de fraternidad. Sólo así «vendrá el amanecer (y brilla-rá mucha luz en nuestro camino»

  16. Infraestructura de comunicaciones para algoritmos colaborativos

    OpenAIRE

    Sopena Ballesteros, Manuel

    2013-01-01

    Este proyecto intenta crear un sistema cliente/servidor de comunicaciones para distintas máquinas paralelas en C++ utilizando WCF como tecnología en el servidor. Aquest projecte intenta crear un sistema client/servidor de comunicacions per a diferents màquines paral·leles en C++ utilitzant WCF com tecnologia al servidor.

  17. Tratamentos alternativos para o combate à Varroa

    OpenAIRE

    Vilas-Boas, Miguel

    2006-01-01

    Mais de 20 anos após a detecção em Portugal do ácaro da Varroa Jacobsoni, a sua coexistência com a abelha Apis Mellifera continua a ser um desafio constante para o apicultor provocando continuadamente baixas no efectivo apícola.

  18. PAISAJES PARA UN DESARROLLO SUSTENTABLE Y PARTICIPATIVO

    Directory of Open Access Journals (Sweden)

    RAFAEL MATA OLMO

    2014-01-01

    Full Text Available El texto se ocupa del renovado sentido del paisaje que, a partir de diversas tradiciones disciplinares contemporáneas, ha adoptado el Convenio del Paisaje, un tratado internacional promulgado por el Consejo de Europa en el año 2000. La primera parte trata del concepto adoptado por el citado Convenio, que entiende el paisaje como el carácter de cada territorio, percibido socialmente y resultado de la interacción de hechos y procesos naturales y/o humanos. La segunda aborda las bases metodológicas de la caracterización y valoración del paisaje, destacando los planteamientos del método británico de Landscape Character Assessment y algunos resultados empíricos de esta metodología. La tercera parte trata de las políticas de paisaje, incidiendo en las potencialidades de los instrumentos de planificación territorial y urbanística para incorporar objetivos, directrices y acciones dirigidos a la salvaguarda, gestión, recualificación y acceso público al paisaje. Para terminar, el texto recoge una experiencia de proyecto territorial de paisaje, la del Plan Insular de Menorca (Islas Baleares, España, aprobado en 2003. Se sintetizan sus determinaciones sobre la protección de determinados terrenos por sus altos valores paisajísticos, sus directrices para que las políticas sectoriales (turismo, agricultura, infraestructuras, etc. incorporen criterios paisajísticos, y sus iniciativas para la gestión y mejora del paisaje y para el fomento del acceso público a su contemplación y disfrute.

  19. Herramientas para el desarrollo de software embebido para aplicaciones aeronáuticas

    OpenAIRE

    Arias, Silvia; Montes, Alfredo Miguel; Banchio, Enrique; Gonzalez Kriegel, Bernardo; Muñoz, Gabriel J.

    2008-01-01

    El desarrollo y mantenimiento de software aeronáutico, y especialmente el software utilizado a bordo de aeronaves, constituye una tarea de enorme complejidad. Debido a los prolongados ciclos de vida que caracterizan a estas aplicaciones, muchas veces se encuentran desarrolladas en lenguajes de programación para los cuales no existen las sofisticadas herramientas disponibles para lenguajes más actuales. Ello provoca que los desarrolladores deban utilizar a menudo herramientas ad-hoc, de baja r...

  20. Programas universitarios para mayores: ¿educación para la reinserción?

    OpenAIRE

    Sánchez Martínez, Mariano

    2003-01-01

    Los Programas Universitarios para Mayores (PUM) pueden tener como una de sus finalidades la reinserción social de sus alumnos. Esta objetivo conecta abiertamente a los PUM con la estructura social, más amplia, en la que se lleva a cabo, y propone enfatizar, más que la adaptación, el cambio, la participacion y la recapacitación, para que los mayores puedan tener un mayor autocontrol sobre sus vidas personales y sociales.

  1. PineApp : Aplicación para Android para el aprendizaje del idioma chino

    OpenAIRE

    Pino Linares, Luis

    2013-01-01

    Desarrollo de una aplicación para Android que ofrece un método fácil para aprender chino mandarín desde el español. Desenvolupament d'una aplicació per a Android que ofereix un mètode fàcil per aprendre xinès mandarí des de l'espanyol.

  2. Centro para la Salud Mundial (CGH) del NCI

    Science.gov (United States)

    El Centro para la Salud Mundial (CGH) del NCI coordina actividades de investigación y trabaja con socios nacionales e internacionales para comprender y enfrentar la carga que representa el cáncer a nivel mundial.

  3. FINANCIAMIENTO ESTATAL PARA LOS PROCESOS ELECTORALES MUNICIPALES

    Directory of Open Access Journals (Sweden)

    Alejandro Robles Leal

    2012-01-01

    Full Text Available A partir de un breve repaso de las últimas reformas jurídicas al régimen electoral, tanto del Código Municipal como del Código Electoral, el artículo describe el nuevo sistema de financiamiento estatal que se ha dispuesto para apoyar económicamente a los partidos políticos que participan en los procesos electorales municipales y que, antes de la entrada en vigencia del nuevo Código Electoral, no existía. Haciendo énfasis en las características legales de ese nuevo sistema de financiamiento, a partir de las diferencias con el sistema de financiamiento estatal para los partidos políticos que participan en los procesos electorales nacionales, refiere la jurisprudencia del TSE en la materia, destacando que la primera resolución del Tribunal, que ordenó girar recursos del Estado, fue precisamente para un partido político inscrito en el nivel cantonal. Finalmente, partiendo de la tesis de que la ausencia de financiamiento estatal para los procesos electorales municipales constituyó una barrera para la profundización democrática costarricense, por lo que su inclusión representa un avance en el fortalecimiento de los derechos políticos de la ciudadanía, los autores concluyen con algunas recomendaciones de carácter legislativo, con el fin de fortalecer este régimen de financiamiento, principalmente por la vía de su sistematización y equiparación con el financiamiento para procesos electorales nacionales, con la expectativa de robustecer las plataformas partidarias y profundizar, así, nuestra cultura democrática en el nivel local. Se anexa cuadro con la lista de los partidos políticos a los que ya se ordenó girar el financiamiento indicado, que desglosa los montos totales y porcentuales, así como los montos que no pudieron ser liquidados y que regresan al erario.

  4. Construcción de una Matriz de Contabilidad Social para Ecuador para el Año 2007

    OpenAIRE

    Cicowiez, Martín; Zamorano, Ana

    2011-01-01

    En este documento se describe el procedimiento seguido para la construcción de una matriz de contabilidad social (SAM; del inglés Social Accounting Matrix) para Ecuador para el año 2007. El objetivo que se persigue es facilitar la posibilidad de replicar el trabajo realizado. Asimismo, la documentación de los pasos seguidos puede servir de base para futuras actualizaciones de la SAM elaborada.

  5. Diversity of entomopathogenic Hypocreales in soil and phylloplanes of five Mediterranean cropping systems.

    Science.gov (United States)

    Garrido-Jurado, Inmaculada; Fernández-Bravo, María; Campos, Carlos; Quesada-Moraga, Enrique

    2015-09-01

    The diversity of entomopathogenic Hypocreales from the soil and phylloplanes in five Mediterranean cropping systems with different degrees of management [organic olive orchard conventional olive orchard, holm oak reforestation, holm oak dehesa (a multifunctional agro-sylvo-pastoral system), and sunflower plantation] was studied during four seasons. A total of 697 entomopathogenic fungal isolates were obtained from 272 soil samples, 1608 crop phylloplane samples and 1368 weed phylloplane samples. The following nine species were identified: Beauveria amorpha, B. bassiana, B. pseudobassiana, B. varroae, Metarhizium brunneum, M. guizhoense, M. robertsii, Paecilomyces marquandii and lilacinum using EF-1α gene sequences. All the fungal entomopathogenic species were found in both the soil and phylloplane samples, with the exception of M. robertsii, which was only isolated from the soil. The species richness, diversity (Shannon-Wiener index) and evenness (Pielou index) were calculated for each cropping system, yielding the following species ranking, which was correlated with the crop management intensity: holm oak reforestation>organic olive orchard>conventional olive orchard>holm oak dehesa>sunflower plantation. The number of fungal species isolated was similar in both phylloplane habitats and dissimilar between the soil and the crop phylloplane habitats. The ISSR analysis revealed high genotypic diversity among the B. bassiana isolates on the neighbourhood scale, and the isolates were clustered according to the habitat. These results suggest that the entomopathogenic Hypocreales in the phylloplane could result from the dispersal of fungal propagules from the soil, which might be their habitat of origin; a few isolates, including EABb 09/28-Fil of Beauveria bassiana, inhabit only the phylloplane. PMID:26146223

  6. Technological properties of kaolin from Para

    International Nuclear Information System (INIS)

    The NE of the State of Para, is notable for its large reserves of kaolin for paper. Kaolin is a mineral composed of hydrated aluminum silicates such as kaolinite and halloysite. The exploitation of these reserves to generate products with higher commercial value, especially in the industries of adsorbents and catalysts, is what motivates the continuous study of technological properties of the Amazon kaolin's. Thus, this paper presents a technological characterization of a sample of kaolin from Para State by X-ray diffraction, SEM - scanning electron microscopy and infrared spectroscopy. The results of preliminary tests indicate that the sample consists for the most part by kaolinite present in low concentrations of quartz and anatase. (author)

  7. Alternativas fundamentales para cuantificar el riesgo operacional

    OpenAIRE

    Ermilson Velasquez Ceballos; Luis Ceferino Franco Arbeláez

    2010-01-01

    El presente artículo es uno de los resultados de un proyecto de investigación financiado por la Universidad EAFIT en el año 2009. En el contexto del riesgo operacional, se hace un desarrollo formal de los métodos de Simulación Montecarlo, el algoritmo de recursión de Panjer y la Aproximación Analítica de Böcker y Klüppelberg, que son tres de las técnicas más utilizados para cuantificar ese riesgo en entidades financieras en el ámbito mundial. Luego se desarrolla una aplicación para un caso pr...

  8. SOL: Un lenguaje para el programador

    OpenAIRE

    Fontao, Rafael O.; Delrieux, Claudio; Kalocai, Guillermo; Goñi, Gustavo; Ramoscelli, Gustavo

    2002-01-01

    En este trabajo se propone llevar a la práctica, a la luz de nuevas tecnologías informáticas, un ambiente de concepción de programas cuyos orígenes se toman de un trabajo publicado por el director del proyecto (1978) y desarrollado a través de diferentes implementaciones y aplicaciones de la metodología a lo largo de los últimos años. La idea central consiste en brindar un lenguaje para el programador, que refleje la metodología de concepción de ideas, más que un lenguaje estándar para pro...

  9. Educación para el consumo

    OpenAIRE

    Castillejo, J.L.; Colom, A.J.; P. Mª Alonso Pérez-Geta; Rodríguez Neira, T.; J. Sarramona; Touriñán, J. M.; G Vázquez

    2011-01-01

    El consumo es un fenómeno de gran peso en la vida actual de los países desarrollados y también de los que están en vías de desarrollo, sinónimo de felicidad y de estatus personal. Por todo ello el consumo merece ser objeto de la educación. En la educación para el consumo resulta clave la implicación familia- escuela, puesto que los padres marcan las primeras pautas en este terreno, junto al contexto social y los medios de comunicación. La educación para el consumo implica información, capacid...

  10. Criterios para proyecto de sifones en colectores

    Directory of Open Access Journals (Sweden)

    Galán Soraluce, Francisco

    1987-04-01

    Full Text Available Exposition of the criteria and ways to be developed, for the construction of siphons for large and little flow that can assure the cleanness of the horizontal lengths, carried out in Pamplona zone. These results can be reached fitting a reservoir at the entrance of the sewer to make periodical cleanliness and programming the working of the pipes.

    Se describen a continuación los criterios y el modo de desarrollarlos, utilizados en la Comarca de Pamplona para construir sifones para caudales grandes y pequeños, que tengan asegurada la limpieza de los tramos horizontales. Se consigue este resultado disponiendo un depósito junto a la cámara de entrada que asegura limpiezas periódicas, y programando el funcionamiento de las tuberías.

  11. Thermal conductivities of ortho and para hydrogen

    International Nuclear Information System (INIS)

    The thermal conductivity of molecular hydrogen has been calculated using a Lennard-Jones potential added to a quadrupole-quadrupole interaction term. Large differences between ortho and para hydrogen were obtained particularly in the range about 200 K. Results for 'normal' hydrogen, here taken as a simple sum of results for the two components, were found to agree very well with recommended values for experiments on normal hydrogen. (Auth.)

  12. ALGUNAS CARTAS DE CONTROL BIVARIADAS PARA ATRIBUTOS

    Directory of Open Access Journals (Sweden)

    CAROLINA OSPINA HINCAPIE

    2010-01-01

    Full Text Available Muchos procesos industriales son de naturaleza multivariada dado que la calidad de un producto depende de más de una variable. El control multivariado de procesos captura la relación en las variables asociadas al proceso, si se ignora esta correlación y se utilizan gráficos de control univariados para cada variable por separado se puede concluir erróneamente acerca del estado del proceso. En variables continuas correlacionadas se han realizado muchas investigaciones, sin embargo se encuentran pocos trabajos que traten sobre atributos correlacionados. En este trabajo se comparan tres cartas de control para variables aleatorias binomiales bivariadas, correlacionadas entre sí, las cuales miden atributos. Las cartas son: La carta de Hotelling basada en la aproximación de la distribución binomial multivariada a la distribución normal multivariada. La carta MNP la cual es una extensión de las cartas univariadas, y la carta que es una metodología no paramétrica basada en el índice de profundidad de Mahalanobis. La comparación se hace vía simulación utilizando como medida de comparación, la longitud promedio de racha (ARL. Dentro del trabajo se presenta un ejemplo aplicado de las metodologías para construir cartas de control para variables binomiales bivariadas en una empresa de telecomunicaciones. De los resultados se aprecia, en términos generales, que la carta MNP es la mejor tanto en control como fuera de control.

  13. Actitud Positiva: la base para la competitividad

    OpenAIRE

    Marco Anderson Espinoza

    2008-01-01

    Una estrategia empresarial enfocado en el mejoramiento continuo de la productividad para la competitividad, depende significativamente del manejo inteligente de tres variables visibles:Calidad, Entrega oportuna y Costo. No obstante, estas tres variables no suelen sersuficientes. La estrategia debe ser complementada con el manejo adecuado de variables intangibles como la Motivación y las Condiciones de Trabajo, con la aplicación de Tecnología Ambientalmente Amigable, en un marco de Actitud Pos...

  14. Diagnóstico molecular para Leishmaniasis

    Directory of Open Access Journals (Sweden)

    Ysabel Montoya

    1997-01-01

    Full Text Available El potencial diagnóstico de epitopes inmunodominantes seleccionados fue ensayado satisfactoriamente a fin de obtener una prueba serodiagnóstica alternativa para la Leishmaniasis Tegumentaria Americana. Dos proteínas recombinantes prometedoras de L. (v. peruviana referidas como T-26-U2/T26-U4 fueron reconocidas por sueros individuales de pacientes con Leishmaniasis Tegumentaria Americana usando Western Blot. La sensibilidad de la prueba fue de 86% con sueros permanentes con Leishmaniasis peruana.

  15. El modelo Biasca para transformar la empresa

    Directory of Open Access Journals (Sweden)

    Rodolfo Eduardo Biasca

    2004-01-01

    Full Text Available Basado en su experiencia en el campo de la consultoría en América Latina, el autor propone un modelo para evaluar la transformación de las empresas, cuyos componentes básicos son: 1 evaluación del cambio que necesita la empresa competitiva, 2 mejoramiento cuantitativo, 3 mejoramiento incremental, 4 revolución o cambio discontinuo y 5 evolución o cambio continuo.

  16. Arquitectura Organizacional para Soluciones Empresariales de Software

    Directory of Open Access Journals (Sweden)

    Solangel Rodríguez Vázquez

    2013-09-01

    Full Text Available La arquitectura organizacional para soluciones empresariales de software es un modelo organizativo que tiene como objetivo contribuir a elevar la productividad de los procesos y el empleo adecuado de los recursos humanos de una organización productiva de software. Para la elaboración de la arquitectura se tuvo en cuenta los problemas en el flujo de trabajo actual, las deficiencias referentes a la distribución de roles, la inadecuada gestión del tiempo y la escasa utilización de componentes de software. Dicha arquitectura cuenta con una estructura formada por cinco entidades o componentes organizacionales las cuales son: la entidad Inteligencia, Gerencia de proyecto, Personas, Repositorio y Proceso. En cada una de ellas se organiza el trabajo a desarrollar a partir de procesos y actividades establecidas lo que ajusta el modelo a su objetivo fundamental para obtener productos con la calidad requerida. Estos procesos están concebidos para que sigan una línea de desarrollo que permita el buen funcionamiento entre las entidades. Es muy importante en este ámbito la comunicación, interacción e integración entre los componentes organizacionales ya que el trabajo de cada uno depende de los demás. Dicha arquitectura de factoría permite ser adaptado a cualquier organización o empresa teniendo en cuenta sus particularidades además de responsabilizar e identificar a los recursos humanos con su trabajo.

  17. Ortho-para transition in molecular hydrogen

    OpenAIRE

    Pachucki, Krzysztof; Komasa, Jacek

    2008-01-01

    The radiative ortho-para transition in the molecular hydrogen is studied. This highly forbidden transition is very sensitive to relativistic and subtle nonadiabatic effects. Our result for the transition rate in the ground vibrational level $\\Gamma(J=1\\to J=0) = 6.20(62)\\cdot 10^{-14} \\iyr$ is significantly lower in comparison to all the previous approximate calculations. Experimental detection of such a weak line by observation of, for example, the cold interstellar molecular hydrogen is at ...

  18. “Tudo feito para se perder”

    OpenAIRE

    Figueiredo, Maria Leonor

    2015-01-01

    Apesar de a obra de António Aragão ser muito vincada por um humor satírico e bastante cáustico, o romance Um buraco na boca traz um tom mais disfórico e marcado pela perda, numa vida que vai surgindo em fragmentos de tempos e memórias nem sempre ordenadas e, definitivamente, nem sempre com espaço para um riso sobre a ausência.

  19. La escuela para el siglo XXI

    Directory of Open Access Journals (Sweden)

    Juan Delval

    2013-01-01

    Full Text Available Centro Europeo de Derecho La escuela para el siglo XXI Currículo: doctor en Filosofía. Catedrático de Psicología Evolutiva y Educación en la Univer- sidad Autónoma de Madrid. Sus líneas de investigación versan sobre el desarrollo del pen- samiento infantil, especialmente en lo relativo a la lógica, a la formación del pensamiento científico y a la construcción de nociones sociales, así como a su aplicación a la formación de conocimientos en la escuela. Trabaja también sobre la historia de la psicoLa escuela debería ser un lugar privilegiado para proporcionar una formación que permita participar plenamente en la vida ciudadana y democrática, pero pode- mos percibir hoy que existe una contradicción entre el tipo de educación que se proporciona en las escuelas, y el modelo de sociedad al que formalmente se aspira. Lo que tendríamos que conseguir es constituir escuelas que sean demo- cráticas y que preparen a los individuos para actuar como auténticos ciudadanos, y no como súbditos. ¿Cómo se hace?, ¿cómo podemos llegar hacia una escuela que cumpla esas funciones?, ¿qué tendríamos que hacer en las escuelas para poder encaminarnos hacia la formación de individuos que tengan este tipo de características? Si optamos por fomentar la existencia de individuos felices y au- tónomos hay que comenzar por emprender una serie de reformas.

  20. Los consorcios exportadores: Estrategia para vender extralocalmente

    Directory of Open Access Journals (Sweden)

    Margot Cajigas Romero

    2006-01-01

    Full Text Available Bajo el título Los consorcios exportadores: Estrategia para vender extralocalmente,se expone cómo a través de una investigación exploratoria, realizada mediante la interacción de empresarios en una mesa de trabajo, cumplida con reuniones periódicas por más de un año, se consigue diseñar un sistema de unión entre empresas locales, para que vendan sus productos en mercados seleccionados de Colombia y algunas otrasnaciones. El comercio internacional no es unjuego de suma cero, es dable encontrar mercados externos dónde venderlos productos de economías en desarrollo, el primer mercado donde se debe competir es el propio mercado nacional y los empresarios aceptan organizarse para buscar vender en mercados seleccionados de Colombia y el mundo mediante la estrategia Coexco(Comercializadoras Extralocales de Colombia es el mensaje último del artículo.

  1. Cirurgia para controle de danos: estado atual

    Directory of Open Access Journals (Sweden)

    Rodrigo Camargo Leão Edelmuth

    2013-04-01

    Full Text Available A cirurgia de controle de danos é um conceito amplamente aceito atualmente entre os especialistas em trauma abdominal quando se trata de doentes gravemente traumatizados. Nestes pacientes a morte decorre, na maioria das vezes, da instalação da tríade letal (hipotermia, coagulopatia e acidose e não da incapacidade de reparar as graves lesões presentes. Nesta revisão, os autores abordam a tríade letal, em suas três fases, e enfatizam as medidas adotadas para preveni-las. Além de discutirem a indicação e o emprego da cirurgia para o controle de danos em seus vários estágios. A restauração dos padrões fisiológicos do doente na UTI, para que o mesmo possa ser submetido à operação definitiva e ao fechamento da cavidade abdominal, outro desafio no paciente traumatizado grave, também é discutida.

  2. Rehacer los caminos para otros mundos posibles

    Directory of Open Access Journals (Sweden)

    Jaime Alberto Rendón Acevedo

    2016-05-01

    Full Text Available Se ha generado un ambiente de fracaso de las propuestas y acciones que desde la izquierda o desde sectores progresistas se hicieron en América Latina y más precisamente en Sur América. Un embate político sobre las alternativas al modelo neoliberal que se lograron instaurar en América Latina en los últimos 15 años. Este artículo contribuye a un debate que apenas comienza; una discusión en torno a los futuros posibles y al papel de los sectores progresistas y de izquierda en un continente que cada día cobra mayor importancia para los intereses de la geopolítica y la geoeconomía mundial. Para esto se empieza por analizar la coyuntura, obviamente con una perspectiva histórica, de tal manera que se posibilite entender el giro a la derecha o si se prefiere el retorno al modelo neoliberal. Luego el análisis tomará perspectivas de futuro, en donde los riesgos necesariamente aumentan para la Región por ser más visible y de mayor peso ante las presiones internacionales que ya ven en Sur América un actor importante. Por último, se presentan algunas reflexiones frente a los procesos económicos y políticos de cara al Buen Vivir en la América Latina.

  3. Novo amostrador para as terras roxas

    Directory of Open Access Journals (Sweden)

    Rino N. Tosello

    1960-01-01

    Full Text Available Neste trabalho descreve-se um novo amostrador tubular, de percussão, especialmente desenvolvido para a amostragem freqüente do solo, em terras roxas, para fins de determinação de umidade e controle de irrigação. Um desenho detalhado do novo amostrador é apresentado, com tôdas as indicações necessárias para que as pessoas ou organizações interessadas possam mandar construir novos modelos, em qualquer oficina mecânica bem aparelhada.In this paper is described a new soil sampler, specially designed for use in sampling Brazilian purple-soil series, which is known to present very peculiar physical properties. The sampler was developed as a result of the need to sample the soil frequently, for the purpose of maintaining the soil water balance in irrigation experiments, carried on field plots. This basic method of controlling water application in such experiments is being extensively used by the Seção de Irrigação, of the Instituto Agronômico. Detailed drawings ond some pictures are shown to allow interested persons or organizations, facing similar problems, to have models of the new sampler built in any good machine shop. The new sampler is very similar in its general characteristics to Veihmeyer's soil sampling tube, and was developed after the failure of this last sampler to operate properly in Brazilian purple-soils

  4. A leitura: um passaporte para a vida

    Directory of Open Access Journals (Sweden)

    Armindo Teixeira Mesquita

    2011-06-01

    Full Text Available Nas sociedades actuais, a capacidade para usar material escrito é indispensável ao acesso a todo tipo de informação, tornando o uso da leitura cada vez mais necessário à participação real do cidadão em actividades produtivas e colectivas, porque ajuda a formar seres pensantes. O contacto com os livros deve ser iniciado o mais cedo possível, não só pelo manuseio, como também pela história contada ou pelos jogos rítmicos. Com efeito, na idade da infância, toda a energia do indivíduo é dirigida para a construção da sua identidade. Logo, as primeiras leituras entram no período da formação e da fundação, isto é, consignamos à leitura uma grande força de desenvolvimento pessoal. Os livros, para além de auxiliares na aprendizagem do mundo, formam o leitor no gosto. Formar o gosto e possibilitar escolhas são realidades fundamentais na vida adulta.

  5. Cuestionarios Interactivos para Autoevaluación

    Directory of Open Access Journals (Sweden)

    Sánchez García, Juan Francisco

    2007-01-01

    Full Text Available La autoevaluación es un instrumento valioso para que el propio alumno pueda medir el grado de conocimientos adquiridos de la materia en cuestión, al tiempo sirve para adiestrarlo en el tipo de prueba que se utilizará posteriormente en el examen. Por otro lado, dado que en la adaptación al Espacio Europeo de Educación Superior (E3S tiene particular importancia la labor realizada por el propio alumno, los pruebas de autoevalución adquieren, si cabe, una mayor relevancia. Por todo ello, hemos elaborado unos test interactivos con hoja de calculo, para cubrir el doble propósito de evaluar los conocimientos alcanzados por nuestros alumnos, relativos tanto a la materia, como al manejo en sí de la propia herramienta informática de la hoja de cálculo. Se muestran ejemplos concretos relacionados con las matemáticas y la hoja de cálculo Excel.

  6. Ochratoxin A Management in Vineyards by Lobesia botrana Biocontrol

    Directory of Open Access Journals (Sweden)

    Giuseppe Cozzi

    2013-01-01

    Full Text Available Grape berries attacked by Lobesia botrana larvae are more easily infected by Aspergillus section Nigri (black aspergilli ochratoxigenic species. Two-year field trials were carried out in Apulia (Italy to evaluate a bioinsecticide control strategy against L. botrana and the indirect effect on reducing ochratoxin A (OTA contamination in vineyards. A commercial Bacillus thuringiensis formulate and an experimental Beauveria bassiana (ITEM-1559 formulate were tested in two vineyards cultivated with the same grape variety, Negroamaro, but with two different training systems (espalier and little-arbor techniques. In both years and training systems the treatments by B. bassiana ITEM-1559 significantly controlled L. botrana larvae attacks with effectiveness similar to B. thuringensis (more than 20%. A significant reduction of OTA concentrations (up to 80% compared to untreated controls was observed only in the first year in both training systems, when the metereological parameters prior to harvest were more favorable to the insect attack. Results of field trials showed that B. bassiana ITEM-1559 is a valid bioinsecticide against L. botrana and that grape moth biocontrol is a strategy to reduce OTA contamination in vineyard in seasons with heavy natural infestation.

  7. Control of the Alphitobius diaperinus (Panzer (Coleoptera: Tenebrionidae with entomopathogenic fungi

    Directory of Open Access Journals (Sweden)

    SRF Rezende

    2009-06-01

    Full Text Available The beetle Alphitobius diaperinus (Panzer, considered a worldwide pest in the poultry industry, is difficult to control and it is a vector for pathogens. The objective of this study was to evaluate the biological control of the lesser mealworm, by strains of fungi Beauveria bassiana, Cladosporium sp. and Trichoderma sp. Larvae and adults of the A. diaperinus were inoculated with suspensions of conidia in the concentration of 10(7 conídia.mL-1. The B. bassiana isolate caused higher insect mortality as compared to Cladosporium sp. and Trichoderma sp. isolates, with the larvae being more susceptible than adults. The entomopathogenicity of B. bassiana was further evaluated with 200 larvae and 200 adults of A. diaperinus inoculated with suspensions 10(6, 10(7, and 10(8 conidia.mL-1, and observed for ten days. Larvae mortality started at the fourth day at the lowest concentration, and the adult mortality was only observed on the sixth day at the concentration of 10(8 conidia.mL-1.

  8. Effects of endophyte colonization of Vicia faba (Fabaceae) plants on the life-history of leafminer parasitoids Phaedrotoma scabriventris (hymenoptera: braconidae) and Diglyphus isaea (hymenoptera: eulophidae).

    Science.gov (United States)

    Akutse, Komivi S; Fiaboe, Komi K M; Van den Berg, Johnnie; Ekesi, Sunday; Maniania, Nguya K

    2014-01-01

    Effects of the fungal endophytes Beauveria bassiana (isolates ICIPE 279, G1LU3, S4SU1) and Hypocrea lixii (isolate F3ST1) on the life-history of Phaedrotoma scabriventris and Diglyphus isaea, parasitoids of the pea leafminer Liriomyza huidobrensis, were studied in the laboratory. Parasitoids were allowed to parasitize 2(nd) and 3(rd) instar L. huidobrensis larvae reared on endophytically-inoculated faba bean, Vicia faba. In the control, parasitoids were reared on non-inoculated host plants. Parasitism, pupation, adult emergence and survival were recorded. No significant difference was observed between the control and the endophyte-inoculated plants in terms of parasitism rates of P. scabriventris (p = 0.68) and D. isaea (p = 0.45) and adult' survival times (p = 0.06). The survival period of the F1 progeny of P. scabriventris was reduced (p<0.0001) in B. bassiana S4SU1 to 28 days as compared to more than 40 days for B. bassiana G1LU3, ICIPE 279 and H. lixii F3ST1. However, no significant difference (p = 0.54) was observed in the survival times of the F1 progeny of D. isaea. This study has demonstrated that together, endophytes and parasitoids have beneficial effects in L. huidobrensis population suppression. PMID:25338084

  9. Effects of Endophyte Colonization of Vicia faba (Fabaceae) Plants on the Life–History of Leafminer Parasitoids Phaedrotoma scabriventris (Hymenoptera: Braconidae) and Diglyphus isaea (Hymenoptera: Eulophidae)

    Science.gov (United States)

    Akutse, Komivi S.; Fiaboe, Komi K. M.; Van den Berg, Johnnie; Ekesi, Sunday; Maniania, Nguya K.

    2014-01-01

    Effects of the fungal endophytes Beauveria bassiana (isolates ICIPE 279, G1LU3, S4SU1) and Hypocrea lixii (isolate F3ST1) on the life-history of Phaedrotoma scabriventris and Diglyphus isaea, parasitoids of the pea leafminer Liriomyza huidobrensis, were studied in the laboratory. Parasitoids were allowed to parasitize 2nd and 3rd instar L. huidobrensis larvae reared on endophytically-inoculated faba bean, Vicia faba. In the control, parasitoids were reared on non-inoculated host plants. Parasitism, pupation, adult emergence and survival were recorded. No significant difference was observed between the control and the endophyte-inoculated plants in terms of parasitism rates of P. scabriventris (p = 0.68) and D. isaea (p = 0.45) and adult' survival times (p = 0.06). The survival period of the F1 progeny of P. scabriventris was reduced (p<0.0001) in B. bassiana S4SU1 to 28 days as compared to more than 40 days for B. bassiana G1LU3, ICIPE 279 and H. lixii F3ST1. However, no significant difference (p = 0.54) was observed in the survival times of the F1 progeny of D. isaea. This study has demonstrated that together, endophytes and parasitoids have beneficial effects in L. huidobrensis population suppression. PMID:25338084

  10. Selection of Isolates of Entomopathogenic Fungi and the Bioefficacy of Their Liquid Production against Leptocorisa oratorius Nymphs

    Directory of Open Access Journals (Sweden)

    SITI HERLINDA

    2008-12-01

    Full Text Available Entomopathogenic fungi are fungi pathogenic to insects and are widely used as biocontrol agents for insect pests. The aim of this research was to study the virulence of Beauveria bassiana and Metarhizium sp. isolates and to evaluate the efficacy of liquid production of those fungi against Leptocorisa oratorius (rice bug. Twelve isolates of B. bassiana and five isolates of Metarhizium sp. were used in this research. Selection result of B. bassiana isolates on third-instar rice bug nymphs showed that the isolate KBC caused the highest mortality rate (93%, while the lowest (46% was caused by the isolate BBY 725. The shortest time needed to produce 50% mortality (Lethal time, LT50 was 3.52 days (isolate KBC. The longest time (10.36 days was produced by isolate SLSS. The mortality of rice bug nymphs caused by Metarhizium isolates was only 50-62%. The shortest LT50 of Metarhizium (5.75 days was produced by isolate Mtm, while the longest (7.46 days was produced by isolate Mpx. Bioefficacy tests on six kinds of liquid formations of entomopathogenic fungi indicated that all were effective, mostly with LT50 d” two days. The mortality rates of rice bug nymphs caused by bioefficacy of fungus liquid production was generally above 85% up to 100%. The liquid media for entomopathogenic fungi performed better compared with solid media (SDA, as indicated by the greater mortality rate and shorter LT50.

  11. Effects of endophyte colonization of Vicia faba (Fabaceae plants on the life-history of leafminer parasitoids Phaedrotoma scabriventris (hymenoptera: braconidae and Diglyphus isaea (hymenoptera: eulophidae.

    Directory of Open Access Journals (Sweden)

    Komivi S Akutse

    Full Text Available Effects of the fungal endophytes Beauveria bassiana (isolates ICIPE 279, G1LU3, S4SU1 and Hypocrea lixii (isolate F3ST1 on the life-history of Phaedrotoma scabriventris and Diglyphus isaea, parasitoids of the pea leafminer Liriomyza huidobrensis, were studied in the laboratory. Parasitoids were allowed to parasitize 2(nd and 3(rd instar L. huidobrensis larvae reared on endophytically-inoculated faba bean, Vicia faba. In the control, parasitoids were reared on non-inoculated host plants. Parasitism, pupation, adult emergence and survival were recorded. No significant difference was observed between the control and the endophyte-inoculated plants in terms of parasitism rates of P. scabriventris (p = 0.68 and D. isaea (p = 0.45 and adult' survival times (p = 0.06. The survival period of the F1 progeny of P. scabriventris was reduced (p<0.0001 in B. bassiana S4SU1 to 28 days as compared to more than 40 days for B. bassiana G1LU3, ICIPE 279 and H. lixii F3ST1. However, no significant difference (p = 0.54 was observed in the survival times of the F1 progeny of D. isaea. This study has demonstrated that together, endophytes and parasitoids have beneficial effects in L. huidobrensis population suppression.

  12. Objeto de aprendizaje para la formación docente orientado a desarrollar competencias para usar recursos educativos abiertos

    OpenAIRE

    Lugo López, Ahabael; Lozano Martínez, Fernando Gustavo; Ramírez Montoya, María Soledad

    2014-01-01

    1. Introducción; 2. Referente teórico; 2.1 Competencias docentes; 2.2 Definición y características de los Recursos Educativos Abiertos; 2.3 Competencias para usar recursos educativos abiertos para la práctica educativa; 2.4 Objetos de aprendizaje abiertos; 3. Marco metodológico; 3.1 Descripción del objeto de aprendizaje para desarrollar competencias para usar recursos educativos abiertos para la práctica educativa; 3.2 Competencias didácticas del objeto; 3.3 Componentes tecnológicos del objet...

  13. Procedimiento para el cierre de canteras de materiales para construcción en Cuba

    Directory of Open Access Journals (Sweden)

    Julio Montero-Matos

    2016-03-01

    Full Text Available Con el propósito de facilitar a los concesionarios de canteras de materiales para la construcción una herramienta metodológica para efectuar el cierre de estas y garantizar una minería sostenible se propuso un procedimiento en seis etapas a partir del diagnóstico realizado en 22 canteras, ubicadas en tres regiones mineras cubanas. El procedimiento busca disminuir los impactos ambientales provocados por la explotación de las canteras y ofrecer a la industria un estándar para lograr uniformidad en la planificación y ejecución del cierre con un costo mínimo.

  14. Metodología para el desarrollo de Hidrolizados Proteicos para Medios de Cultivo en Cuba.

    Directory of Open Access Journals (Sweden)

    Raisa Zhurbenko

    2005-01-01

    La metodología incluyó elementos científico-técnicos, de Buenas Prácticas de Laboratorio y de Manufactura y las normas ISO 9000 del 2000, entre otros. Se desarrollaron 12 bases nutritivas por nuevos métodos, que cumplen con los requisitos de calidad exigidos para estos productos. La composición físico-química, de minerales y aminoácidos, así como su reactividad biológica posibilitaron su empleo en más de 20 medios de cultivo diferentes para el control de calidad sanitaria de los alimentos. Más de 15 toneladas se han obtenido para el mantenimiento del Sistema de Vigilancia Epidemiológica del país.

  15. La estrategia educativa 2020 o las limitaciones del Banco Mundial para promover el "aprendizaje para todos"

    Directory of Open Access Journals (Sweden)

    Antoni Verger

    2011-12-01

    Full Text Available LA NUEVA Estrategia Educativa 2020 del Banco Mundial establece las prioridades de reforma educativa en países en vías de desarrollo para la década siguiente. El título explícito de la estrategia, Aprendizaje para Todos, es un claro reconocimiento de que, más allá de políticas centradas en el acceso, se debe hacer algo más para asegurar que la educación derive en experiencias positivas de aprendizaje. Sin embargo, como este artículo sostiene, las opciones de políticas explícitas y latentes en la Estrategia 2020 no son las más adecuadas para lograr el Aprendizaje para Todos. El artículo desarrolla tres tipos de argumentos al respecto. El primero se refiere al fuerte apego del Banco a un conocimiento disciplinario y un enfoque metodológico que es insuficiente para entender lo que aprenden los niños en la escuela y por qué. El segundo argumento se refiere al sesgo pro-mercado de la Estrategia por lo que respecta a la reforma del sector público y a nuevas formas de oferta educativa. En tercer lugar, el artículo señala las principales ausencias de la Estrategia, con especial atención a las omisiones relacionadas con la compleja relación entre educación y pobreza.

  16. Esquema para el soporte de clases audiovisuales para la herramienta PEDCO

    OpenAIRE

    Zanellato, Claudio; Grosclaude, Eduardo; Balladini, Javier; Sanchez, Laura

    2009-01-01

    En el marco del proyecto de investigación “Software para Aprendizaje y Trabajo Colaborativos” del Departamento de Ciencias de la Computación, se está trabajando desde el año 2002 en implantación de plataformas educativas que sirvan como soporte de contenido y comunicación tanto para la modalidad de enseñanza presencial como a distancia. Luego de definir los requerimientos, se implementó la Plataforma de Educación a Distancia del Comahue - PEDCO. Desde entonces, está funcionando y cada vez ...

  17. Armas para luchar, brazos para proteger: las mujeres hablan de la guerra [Reseña

    OpenAIRE

    Rodríguez, Marcela; Rapacci, María Lucía

    2001-01-01

    El presente texto forma parte del Programa de Recuperación Oral de Testimonios desarrollado por PANOS INSTlTUTE, organización independiente de información que trabaja internacionalmente para que el desarrollo sea social, ambiental y económicamente sostenible. Los testimonios recogidos corresponden a uno de los ejes centrales de este proyecto: "Mujeres y guerra", cuya intención básica ha sido la de generar condiciones para que las mujeres hablen de sus propias percepciones y comprensiones. En ...

  18. Un criterio para seleccionar operadores genéticos para resolver CSP

    OpenAIRE

    Riff Rojas, María Cristina

    1998-01-01

    Nuestro interés es definir algoritmos evolucionistas para la resolución de problemas de satisfacción de restricciones (CSP), los cuales tomen en cuenta tanto las ventajas de los métodos tradicionales de resolución de CSP, así como las características propias de este tipo de problemas. En este contexto, se propone en el presente artículo un criterio para poder evaluar la performance de los operadores gen'eticos dentro de algoritmos evolucionistas que resuelven CSP.

  19. Los riesgos de Internet. Consejos para su uso seguro. Habilidades necesarias para utilizar Internet

    OpenAIRE

    Marquès Graells, Pere

    2005-01-01

    Internet ofrece infinitas posibilidades, pero también conlleva riesgos para ciertos perfiles de personas. Estos riesgos están relacionados con la información, la comunicación interpersonal, las actividades económicas, el funcionamiento de Internet y las adiciones. Ante estos peligros potenciales, es conveniente adoptar medidas preventivas (decálogo de los derechos de la infancia en Internet, programas de sensibilización para promover el uso seguro y responsable de Internet, etc.) y además, pa...

  20. La Escucha Efectiva. Recomendaciones para lograrla.

    Directory of Open Access Journals (Sweden)

    Mariano Álvarez Farfán

    2009-10-01

    Full Text Available La comunicación es y seguirá siendo una condición de la existencia humana. Aún avanzando por las sendas del siglo XXI es imposible vivir sin dedicarle atención priorizada a este proceso. Dentro de él un lugar primordial lo ocupa la habilidad de escuchar. Saber escuchar es una de las habilidades más importantes que debe tener un profesional e incluso cualquier persona común de la sociedad. En los últimos años los especialistas han venido dedicando una atención especial a esta habilidad, dándole un tratamiento relativamente independiente dentro de los estudios sobre el proceso de comunicación. En investigaciones realizadas sobre las habilidades que debe tener todo buen comunicador se ha determinado que la más necesaria y difícil de lograr es la de saber escuchar. Realmente pasamos más tiempo escuchando que hablando, pero no son muchos los que se pueden calificar como buenos oyentes. Los estudiosos del tema a nivel mundial coinciden también que desarrollar esta habilidad requiere, de una gran voluntad y disposición hacia el cambio de enfoques, conductas y formas de ver las cosas, porque solo hay una manera de lograrlo y es luchando desde “dentro” del individuo. En el trabajo se ofrecen diferentes opiniones y enfoques que pueden contribuir a desarrollar esta habilidad tan importante, para el trabajo profesional y para las relaciones interpersonales. Se enfatiza en los beneficios que reporta una buena escucha, qué entender por una buena escucha o escucha efectiva y las recomendaciones para lograr esa escucha efectiva.

  1. Hacer para pensar: ideas, espacios y herramientas

    Directory of Open Access Journals (Sweden)

    Miranda Garnier, Ximena

    2012-02-01

    Full Text Available Resumen: Con el presente ensayo se busca compartir la experiencia de aprendizaje diseñada y desarrollada por un grupo interdisciplinario de profesores y profesoras de la Universidad de Costa Rica. La actividad contó con la participación de docentes de distintas disciplinas académicas. La propuesta se concretó en un taller que utilizó el lenguaje de programación Scratch y las tarjetas Pico,como oportunidad para modelar un ambiente de aprendizaje construccionista. Ideas poderosas, espacios y herramientas se pusieron a disposición de los y las participantes para la construcción de historias digitales, modelos y simulaciones. El objetivo final fue que los y las profesoras pudieran vivenciar, a través de una experiencia práctica, el ambiente de aprendizaje construccionista, las ideas y las herramientas, para que más adelante las pudieran extrapolar en sus propias disciplinas y cursos.Abstract: With this essay we intend to share a learning experience designed for and developed with an interdisciplinary group of faculty at the University of Costa Rica. Scratch programming language and Pico Boards supported this opportunity to experience a constructionist environment, where powerful ideas, spaces and tools were available for participants to design and construct their own digital stories, models and simulations. The final goal was that participants would experience, through a practical experience, the constructionist learning environment and the tools available, so that they could, in the future, extrapolate the knowledge they constructed in their own disciplines and classes.

  2. FINANCIAMIENTO ESTATAL PARA LOS PROCESOS ELECTORALES MUNICIPALES

    OpenAIRE

    Alejandro Robles Leal

    2012-01-01

    A partir de un breve repaso de las últimas reformas jurídicas al régimen electoral, tanto del Código Municipal como del Código Electoral, el artículo describe el nuevo sistema de financiamiento estatal que se ha dispuesto para apoyar económicamente a los partidos políticos que participan en los procesos electorales municipales y que, antes de la entrada en vigencia del nuevo Código Electoral, no existía. Haciendo énfasis en las características legales de ese nuevo sistema de finan...

  3. CXML: intérprete para XML

    OpenAIRE

    Concha Medina, Edgard José; Corro, Gonzalo Gabriel; Leiva, Mario

    2014-01-01

    El lenguaje XML, de creación relativamente reciente, está siendo muy utilizado en aplicaciones web y en las comunicaciones entre servidores web, y adquiriere importancia en el área de las bases de datos, no sólo como soporte para la transferencia de datos sino como formato de almacenamiento. Ya que el lenguaje XML es un estándar internacional y dado su importancia, en el año académico 2013 se solicitó a los alumnos de la asignatura Lenguajes de Programación y Compiladores de la Licenciatur...

  4. Los ritmos como terapia para la impulsividad

    Directory of Open Access Journals (Sweden)

    Mónica Triviño

    2012-10-01

    Full Text Available Investigaciones recientes muestran que el uso de patrones rítmicos facilita la respuesta óptima en el tiempo, por lo que el entrenamiento mediante ritmos podría proponerse como terapia novedosa ante problemas como la impulsividad. Esto podría beneficiar a pacientes con daño prefrontal o personas con trastorno por déficit de atención e hiperactividad (TDAH, que suelen mostrar conductas impulsivas, así como dificultad para estimar el paso del tiempo.

  5. Educar para a literacia : perspectivas e desafios

    OpenAIRE

    Azevedo, Fernando José Fraga de, coord.

    2011-01-01

    Comunicação proferida na abertura do "VII Encontro de Educação : Numeracia e Literacia em Educação" Esta conferência aborda as principais perspectivas e desafios com que nos confrontamos quando abordamos o conceito de literacia. Assume-se que a aprendizagem da literacia é um direito da pessoa e que o conceito incorpora, no seu espectro semântico, processos de transformação social e política, muito para além da mera aprendizagem e domínio das técnicas de leitura e de escrita.

  6. Macros y atajos para el traductor

    OpenAIRE

    José Luis Heredero

    2007-01-01

    Sin necesidad de recurrir a los productos comerciales de ayuda a la traducción que se han ido generalizando en muchas grandes empresas y organizaciones, el traductor independiente puede ver considerablemente facilitado su trabajo si sabe explotar las muchas posibilidades que brindan Visual Basic y otros lenguajes poco conocidos de dominio público. Se presentan aquí varias macros de Word y pequeñas aplicaciones desarrolladas en los últimos años para acelerar tanto las búsquedas de términos —ba...

  7. Fontes para o estudo da arte medieval

    OpenAIRE

    Fraga Sampedro, Mª Dolores

    2013-01-01

    A materia Fontes documentais e literarias para a Historia da Arte, posúe o carácter de obrigatoria e ten que ser cursada no segundo ano (2º curso), en concreto no segundo cuadrimestre. Está integrada no módulo Coñecementos sistemáticos e integrados do feito artístico. Esta materia está estreitamente relacionada con Literatura e Arte no mundo antigo e medieval de primeiro curso, Fundamentos teóricos da historia da Arte de primeiro curso, Métodos de Análise e Interpretación do Fenómen...

  8. API REST con MEAN para contenidos multimedia

    OpenAIRE

    López Jurado, Francisco Carlos

    2016-01-01

    Memoria de Proyecto Fin de Grado API REST con MEAN para Contenidos Multimedia. En ella se especifica todo el proceso de elaboración del proyecto, desde la confección de la idea, pasando por el análisis y la definición de requisitos de elaboración, hasta la entrega definitiva del producto final. El proyecto consta de dos bloques claramente diferenciados: Una documentación extensa de la línea de trabajo, con apoyo de diagramas, imágenes, descripciones y metodologías. Implementación de la líne...

  9. Para no olvidar el comentario de texto.

    Directory of Open Access Journals (Sweden)

    Rúben López.

    2004-03-01

    Full Text Available ¿Qué es comentar?El Diccionario de la Real Academia Española enuncia que la noción de “comentario” tiene tres sentidos: 1 Escrito que sirve de explicación de una obra, para que se entienda más fácilmente. 2 Juicio, parecer, mención o consideración que se hace, oralmente o por escrito, acerca de una persona o cosa. 3 Título que se da a algunas historias escritas en estilo conciso.

  10. Retroníquia: Reconhecer para Tratar

    OpenAIRE

    Cabete, J; de Lencastre, A.

    2013-01-01

    Introdução: Retroníquia é o termo proposto por alguns autores para definir o processo caracterizado por onicocriptose proximal e consequente inflamação crónica da prega ungueal proximal (PUP), provavelmente de etiologia traumática. Os autores descrevem dois casos desta entidade clínica recentemente descrita. Casos clínicos: Caso 1: Jovem de 18 anos é observada por sinais inflamatórios do hálux esquerdo com 5 meses de evolução, em relação com trauma pelo calçado. ...

  11. Razonamiento algebraico elemental: propuestas para el aula

    Directory of Open Access Journals (Sweden)

    Walter F. Castro G

    2014-09-01

    Full Text Available En este artículo se aborda el problema de la enseñanza de álgebra en la escuela primaria. Se discute lo que se entiende como “early álgebra” y se presentan varios enfoques sobre la introducción del álgebra en la escuela elemental. En correspondencia con los enfoques, se discuten tanto algunas tareas de razonamiento algebraico elemental que pueden ser implantadas en el aula, como algunas de las características algebraicas atribuidas. Finalmente, se presenta una propuesta para asignar niveles o grados de algebrización a algunas tareas.

  12. Hacer para pensar: ideas, espacios y herramientas

    OpenAIRE

    Miranda Garnier, Ximena; Badilla Saxe, Eleonora; Urrea Giraldo, Claudia; Barrantes Acuña, Danny

    2012-01-01

    Resumen: Con el presente ensayo se busca compartir la experiencia de aprendizaje diseñada y desarrollada por un grupo interdisciplinario de profesores y profesoras de la Universidad de Costa Rica. La actividad contó con la participación de docentes de distintas disciplinas académicas. La propuesta se concretó en un taller que utilizó el lenguaje de programación Scratch y las tarjetas Pico,como oportunidad para modelar un ambiente de aprendizaje construccionista. Ideas poderosas, espacios y he...

  13. Redes sociales para educomunicadores : recursos y experiencias

    OpenAIRE

    Universitat Autònoma de Barcelona. Máster en Comunicación y Educación (online)

    2013-01-01

    Las redes sociales han sido universalmente acogidas entre los usuarios de internet como una manera comprometerse en eventos, grupos sociales y temas de interés. Estos usuarios han encontrado en las redes un espacio para compartir información, socializar y, en muchos casos, construir verdaderas redes de cooperación y colaboración, un uso que puede ampliarse aún más en la medida en que madure la alfabetización mediática de sus participantes. Este informe muestra las principales redes sociales, ...

  14. Metodologia analitica para la determinacion de oxiesteroles

    OpenAIRE

    Guardiola Ibarz, Francesc; Codony Salcedo, Rafael; Rafecas Martínez, Magdalena; Boatella Riera, Josep

    1994-01-01

    El presente trabajo recoge los principales aspectos relacionados con el análisis de los derivados oxidados del colesterol. Este problema analítico es relativamente reciente y muchas cuestiones relacionadas con el mismo son controvertidas. Prueba de ello es la existencia de un número elevado de metodologías, que exigen aún, en muchos casos, una mejora y validación. Por ello, se ha creído interesante una discusión de los principales sistemas propuestos para su determinación (cromatografía de ga...

  15. PARA EVITAR LA CONTAMINACIÓN AMBIENTAL

    Directory of Open Access Journals (Sweden)

    F Pachón

    2005-01-01

    Full Text Available El presente artículo se enmarca dentro de la caracterización del sistema de producción bovina del municipio de Utica (Cundinamarca y dentro de los problemas más importantes que lo afectan. Como resultado, el estudio identificó la escasez de alimento de buena calidad en épocas secas como la principal limitante del productor bovino del municipio. Aprovechando una ventaja presente en la zona, como es la elaboración de panela (proceso a través del cual resultan algunos subproductos, como bagazo y melote, que pueden ser utilizados como alternativa alimenticia para los bovinos en cualquier época del año, se planteó un experimento en el que se elaboraron bloques multinutricionales con base en dichos subproductos. El experimento se adelantó en una finca de un productor y se utilizaron 57 novillos cebús con edades entre los 11 y los 24 meses y pesos entre los 124 y los 463 kilogramos. Los animales se dividieron dos grupos que se mantuvieron en pasturas no manejadas. Al grupo experimental se le ofrecieron adicionalmente bloques multinutricionales. Los animales fueron examinados para comprobar su estado fisiológico, con el fin de determinar posibles inconvenientes sanitarios que pudieran afectar el ensayo. Se realizaron pesajes para medir las ganancias de peso en los dos grupos. Los resultados mostraron promedios de ganancias diarias de peso similares a Pr < 5%, donde fueron ligeramente superiores las del grupo alimentado con los bloques multinutricionales (0,848 vs. 0,769 kg animal/día. Los aportes más importantes del experimento fueron, primero, brindar una opción para que el productor pueda alimentar a sus animales en épocas de escasez y evitar que tenga que venderlos a bajos precios. El segundo aporte fue abrir la posibilidad de usar los productos de la elaboración de la panela, que en muchas ocasiones se convierten en desechos que no son usados y que contaminan las fuentes de agua, de una forma económicamente viable.

  16. Convénceme para leer

    OpenAIRE

    Hernanz Vicente, Marina

    2014-01-01

    La animación a la lectura debe fomentarse desde los primeros años de vida del niño, en el ámbito familiar y promoverla en el ámbito escolar de forma sistematizada. En el ámbito educativo, que es el que compete a este trabajo, debemos tener en cuenta el progreso de los alumnos en la lectura y la importancia de una motivación adecuada. Es importante que los alumnos desarrollen un gusto por la lectura, un gusto que se verá reflejado en la cantidad de libros que lean y en su capacidad para com...

  17. Cuatro preguntas para iniciarse en cambio organizacional

    OpenAIRE

    Carlos Acosta

    2008-01-01

    El presente artículo llega a un concepto sobre el cambio organizacional a partir de las respuestas que ofrece a cuatro preguntas: ¿Qué es lo que cambia en las organizaciones?, ¿Por qué cambian las organizaciones?, ¿Cómo cambian las organizaciones? y -entonces- ¿Qué es el cambio organizacional? Para lograr el propósito se toma como objeto a las organizaciones empresariales y se centra en las dimensiones donde se localizan los cambios, explora lo que algunos autores dicen sobre el cambio, revis...

  18. Condiciones para el desarrollo del practicum

    OpenAIRE

    Miguel Zabalza Beraza

    2011-01-01

    El art??culo analiza las condiciones consideradas fundamentales para el desarrollo de buenos programas de practicum y pr??cticas en empresas. Son cuatro las condiciones que plantea: 1) doctrinales; 2) curriculares; 3) organizativas; y 4) personales. De la conjunci??n de una adecuada articulaci??n del practicum en los cuatro ejes, se derivar?? la mejor o peor definici??n de su sentido y de sus aportaciones a la formaci??n de los futuros profesionales. Advierte de posibles peligr...

  19. Educación para el emprendimiento

    OpenAIRE

    Nieto García, Yolanda

    2012-01-01

    RESUMEN: La crisis económica global que estamos padeciendo, unido a las elevadas tasas de desempleo, que doblan la media europea, ha dejado al descubierto problemas estructurales de nuestro país que, aun no siendo nuevos, hacen necesario más que nunca la adopción de medidas encaminadas a reconducir la situación. Para que se pueda crear riqueza y empleo es necesario que haya empresas, si bien uno de los problemas de la sociedad actual es que no se valora adecuadamente a los emprendedores, p...

  20. Yoga para crianças

    Directory of Open Access Journals (Sweden)

    Maria Ester Massola

    2012-06-01

    Full Text Available As crianças nascem em uma época de grandes mudanças, tudo parece instantâneo. No mundo externo tudo se transforma rapidamente, mas em nosso mundo interior, o ritmo é outro. Necessitamos desenvolver a observação e o olhar interno, para nos relacionarmos de forma mais equilibrada e saudável com nós mesmos e com os outros. Ensinar crianças e adolescentes a relaxar, a meditar, a gostar de permanecer um pouco em silêncio, a cuidar tanto de si como dos outros, a acalmar o corpo e a mente é sem dúvida uma tarefa fundamental e imprescindível em nossa sociedade.  A prática de Yoga tem se mostrado uma maneira nova e eficiente para auxiliar no desenvolvimento físico e mental desta faixa etária.Vários trabalhos científicos têm sido publicados e sugerem que ensinar Yoga às crianças e aos jovens é uma atividade que traz benefícios à saúde tanto física como mental. Aparece também como uma forma promissora de terapia complementar, porém é recomendado que mais pesquisas sejam feitas para comprovar de forma mais clara e objetiva seus benefícios e aplicações. Na prática, observa-se nas crianças grande interesse, alegria e facilidade em aprender esta milenar arte indiana para integração de corpo e mente. Ouvir uma criança dizer: “Que silêncio gostoso...” ou “Parece que estou nas nuvens!” indicam que práticas contemplativas como Yoga são muito bem vindas na formação desta nova geração.

  1. Interfaz web para BaDELE3000

    OpenAIRE

    González Izquierdo, Adrián

    2012-01-01

    El objetivo del presente Trabajo de Fin de Carrera es el estudio, diseño e implementación de una aplicación web que sirva de interfaz para una base de datos relacional llamada BaDELE3000 que trabaja actualmente con unos 3000 lexemas y sigue en fase de desarrollo. BaDELE modela conceptos y principios lingüísticos más o menos complejos, dentro del marco de la Teoría Sentido-Texto. El desarrollo de esta interfaz, permitirá a personas autorizadas, seguir nutriendo la base de datos. La memoria est...

  2. Proyecto educativo para una escuela rural

    OpenAIRE

    Galve-Pina, Ana María

    2014-01-01

    La propuesta que se desarrolla a continuación tiene la intención de dar una solución educativa a un colegio agrupado en el entorno rural. Ha sido diseñada para trabajar con niños de Educación Infantil de una clase en la que conviven alumnos de distintas edades y diversas procedencias, buscando una educación adaptada a sus diferentes características. Tanto las actividades como la metodología, así como las medidas de evaluación, objetivos propuestos y competencias a conseguir, en...

  3. 11 Verduras para Diversificar la Dieta Peruana

    OpenAIRE

    Ugas, Roberto; Loayza, Sara; Chang, Agusto

    2013-01-01

    Los peruanos debemos comer más verduras. Estos alimentos son fuentes esenciales de vitaminas, minerales, antioxidantes y fibra alimentaria y la ciencia muestra día a día su contribución a la prevención de enfermedades. Para tener un estilo de vida saludable es necesario comer diariamente cinco porciones de frutas y verduras y hacer ejercicio físico regularmente. Aquí presentamos una lista corta de once hortalizas de hoja, algunas son yuyos de uso tradicional en el campo peruano, otras son ver...

  4. Desarrollo de motores stirling para aplicaciones solares

    OpenAIRE

    García Menéndez, David

    2013-01-01

    Los sistemas de conversión termosolar basados en motores Stirling figuran entre las líneas de investigación actuales que pretenden contribuir al uso racional de la energía y al desarrollo sostenible. La presente Tesis Doctoral tiene como objetivo proporcionar criterios de análisis, diseño, fabricación y ensayo útiles para el desarrollo de motores Stirling alimentados con energía solar, a diferentes niveles de salto térmico. La metodología empleada está basada principalmente en técnicas...

  5. Factorización para invidentes

    OpenAIRE

    Ramirez, Natalia; García, Carolina; Gutiérrez, Claudia

    2008-01-01

    Planteamos la utilización de la Áreas Mágicas, un material didáctico para la factorización de polinomios que consta de figuras geométricas (cuadrados y rectángulos) de ciertas dimensiones que, dispuestas de la forma correcta, proporcionan al educando la opción de deducir las expresiones utilizadas en los llamados “casos de factorización” sin recurrir a la memorización. Esto facilitaría un aprendizaje significativo de dicha temática sin caer en la rutina de solucionar un gran...

  6. Plan para control de malaria en colombia

    OpenAIRE

    Rey, Hernando

    2011-01-01

    Con motivo de la colaboración de la Oficina de Relaciones Interamericanas en la solución de algunos problemas de Higiene pública en Colombia, el Secretario del Ministerio de Trabajo, Higiene y Previsión Social, doctor Alfonso Orozco, me pidió la elaboración de un breve plan para control de Paludismo en Colombia. El Plan fué presentado al Ministerio por una parte y por otra enviado al doctor Mark F. Boyd de la International Health Division de la Fundación Rockefeller.

  7. Herramienta para implementar LEL y escenarios (TILS)

    OpenAIRE

    Gil, Gustavo Daniel

    2002-01-01

    Esta tesis se divide en seis grandes partes: Introducción, Estado del Arte: Ingeniería de requerimientos, Léxico Extendido del Lenguaje, Escenarios, Funcionalidad y Arquitectura de la Herramienta, Utilización de la Herramienta y Conclusiones. ESTADO DEL ARTE: incluye el capítulo 2, llamado INGENIERÍA DE REQUERIMIENTOS , en donde se analizan algunos modelos para el análisis de requerimientos, áreas de problemas y técnicas de elicitación. Los capítulo 3 y 4, LA INGENIERÍA DE SOFTWARE en los ...

  8. Claves para la agenda del desarrollo

    OpenAIRE

    Octavio Rodríguez

    2011-01-01

    El presente artículo parte de las concepciones de Celso Furtado respecto de la renovación de la agenda del desarrollo para América Latina. El autor analiza con especial interés y cuidado diversos conceptos, como los de desarrollo, identidad cultural, crecimiento autocentrado, inserción externa, cooperación internacional y asimetrías entre países. Insertos en una visión global de los sistemas culturales, esos conceptos constituyen elementos esenciales en una agenda del desarrollo, habida cu...

  9. Frutos do paraíso

    OpenAIRE

    Daisy Wajnberg

    2008-01-01

    O livro do poeta, tradutor e ensaísta Haroldo de Campos, Éden: um tríptico bíblico, publicado postumamente, aborda e transcria as passagens bíblicas da expulsão do Paraíso, a da torre de Babel e o Cântico dos Cânticos em sua íntegra. Palavras-chave Bíblia, literatura, tradução, poética, transcriação Abstract Éden: um tríptico bíblico is the last book by Haroldo de Campos, Brazilian poet and translator, published after ...

  10. Modelo de aprendizaje para entornos distribuidos colaborativos

    OpenAIRE

    Paletta, Mauricio

    2009-01-01

    En la gran familia de aplicaciones distribuidas, los sistemas colaborativos se distinguen por el hecho de que los nodos que forman parte del entorno, pueden tener la intención de trabajar juntos para el cumplimiento de tareas que se originan de alguno de estos nodos. El intercambio de información, el intercambio de solicitudes, el control de unos sobre otros y el intercambio de recursos computacionales son algunos ejemplos de procesos que pueden ser parte de las tareas que los nodos en este t...

  11. PLAN DE NEGOCIO PARA BARTLEBY & GARCIA

    OpenAIRE

    González-Gascón, Matías

    2015-01-01

    Este trabajo aborda las posibilidades del Marketing digital aplicado a Bartleby & García, una pequeña tienda online especializada en libros de anticuario. Para ello, se analiza la empresa, se seleccionan las herramientas Social Media que mejor se adaptan a su naturaleza y recur-sos y se diseña una estrategia alrededor del Inbound marketing que posibilite alcanzar los objetivos propuestos. El resultado es un plan de negocio viable que permitirá a Bartleby & García mejorar sus resultados económ...

  12. NZEB: um desafio para a engenharia civil

    OpenAIRE

    Baiona, Rui Miguel Santos

    2014-01-01

    Na União Europeia (UE), os edifícios representam 40% no consumo de energia final, logo se forem efetuadas alterações para melhoria da eficiência energética neste sector, poderá reduzir-se os consumos associados e as emissões dos gases com efeito estufa (GEE). Com o objetivo de reduzir o consumo de energia no parque edificado, a UE publicou a 19 de Maio de 2010 a diretiva 2010/31/UE relativa ao desempenho energético dos edifícios e que revoga a diretiva 2002/91/CE. A nova dire...

  13. Accesibilidad digital para usuarios con limitaciones visuales

    OpenAIRE

    Toledo, Gabriela Alejandra

    2012-01-01

    Trabajo presentado para la obtención del titulo de Magister en Tecnología Informática aplicada a la Educación. Suscribe los siguientes principios: * La Educación permanente es un Derecho Humano Universal. * Las TIC son herramientas de apoyo, potenciales colaboradoras en el desarrollo y mejora de las habilidades cognitivas. * La cognición de los sujetos se potencia cuando los entornos de aprendizaje resultan “amigables”, accesibles y usables. * Los fundamentos del Diseño par...

  14. Receptores de radio monochip para FM

    OpenAIRE

    Miguel López, José María

    2005-01-01

    Este libro aborda de forma estructurada tanto los aspectos de diseño como los de realización de receptores de radio para la banda de FM. Tras unos primeros capítulos dedicados al estudio de las propiedades de la modulación de frecuencia y de los circuitos básicos que configuran un receptor de radio, se desarrolla un minucioso análisis de los circuitos integrados TDA7000/10/21. Paso a paso se muestra cómo diseñar con estos circuitos receptores de FM que, al requerir muy pocos ajustes, puede...

  15. Modelos de datos para datos espaciales

    OpenAIRE

    Vitturini, Mercedes; Fillottrani, Pablo Rubén; Castro, Silvia Mabel

    2003-01-01

    El desarrollo de tecnologías de recolección y digitalización de datos geográficos junto con la nueva demanda de visualización, manipulación interactiva y análisis de los resultados, ha generado la necesidad de un nuevo tipo de software dedicado, denominados GIS. Las Bases de Datos Espaciales en sus diferentes modalidades son una parte integral de los GIS: proveen capacidades para representar, almacenar y acceder a los datos, además de resolver los problemas de control de concurrencia, manejo ...

  16. Estrategias para un aprendizaje significativo-constructivista

    OpenAIRE

    Lara Guerrero, Juan

    1997-01-01

    Los docentes suelen preocuparse casi exclusivamente del qué y cómo enseñar; pero, generalmente, suelen desentenderse del aprendizaje de los alumnos al considerar que es competencia y responsabilidad de ellos. Hoy se pide un enfoque alternativo, en el cual se preste atención también al proceso de aprendizaje, porque es tan importante lo que se aprende como el modo en que se aprende. Se trata de orientarlos en el proceso de aprendizaje (cómo aprender) para que sean capaces de aprender...

  17. Fomento de responsabilidad procreativa para adolescentes

    OpenAIRE

    Vanegas de Ahogado Blanca Cecilia

    2010-01-01

    Se está desarrollando una línea de investigación-Docencia-Extensión que pretende, con medidas de promoción y prevención primaria, fomentar en los adolescentes un manejo responsable de su sexualidad, para contribuir en la disminución del embarazo indeseado y del aborto provocado. El trabajo se inició con un programa de atención individual y de pareja en una importante universidad colombiana; continuó con un programa de educación a grupos, utilizando técnica participativa con juegos de...

  18. Conjuntos minimos determinantes para spline bidimensional

    OpenAIRE

    Ramos, Rogelio; Aguilar, Armando; León, Frida María; García, Omar; Garibay, Juan

    2014-01-01

    La idea fundamental de esta experiencia en clase, es explorar el objeto matemático de los conjuntos mínimos, a fin de transponer (Castañeda, 2004) el modelo que corresponde a dicho objeto de estudio y así, ponerlo al alcance de los estudiantes de ingeniería y tecnología; es decir, el problema planteado es determinar el camino adecuado; tal que los estudiantes puedan apropiarse del conocimiento, manejo y aplicación del modelo de los conjuntos mínimos para el “spline” bivariado (Verlan, 2011). ...

  19. Investigar para que Siga la Fiesta

    OpenAIRE

    Andrés Darío

    2014-01-01

    Las universidades deberían incentivar más las investigaciones relacionadas con los servicios públicos, con el uso de referentes como la regulación actual, con el fin de cuestionarla y mejorarla. Lejos de un afán de negocio, el objetivo sería garantizar su sostenibilidad por varias generaciones y ojalá por siempre. Esta debería ser reconocida como la principal responsabilidad de las universidades, investigar para que siga la fiesta.

  20. Pensar la naturaleza: la naturaleza para “nosotros” y para los “otros”

    OpenAIRE

    Regina Ricco

    2013-01-01

    Mientras que la separación occidental naturaleza/cultura convierte a la primera en objeto de exploración al definirla negativamente como parte de la realidad que existe independientemente de lo humano, para otros pueblos supone un conjunto de interacciones donde el hombre es un elemento más

  1. Cinco paradigmas para abordar lo real

    Directory of Open Access Journals (Sweden)

    Eva Pasek de Pinto

    2006-01-01

    Full Text Available Considerando la crisis de la investigación social, el propósito del estudio fue configurar un fundamento paradigmático para la investigación en ciencias sociales. Partiendo de dos cuerpos teóricos: Mardones, (1991; y Padrón, (1994, 1998, por medio de la deducción y del análisis se obtuvieron cuatro paradigmas de investigación que, integrados, permitieron obtener un quinto paradigma. Así, como resultado del estudio se presentan cinco paradigmas posibles para abordar la realidad: el empírico- inductivo; el racionalista deductivo; el fenomenológico vivencial, el reflexivo crítico y el holístico o de la complejidad. A lo largo del estudio, cada uno de ellos se analiza en cuatro aspectos paradigmáticos: el Ontológico, el Epistemológico, el Axiológico y el Metodológico.

  2. Allergic contact dermatitis to para-phenylenediamine.

    Science.gov (United States)

    Jenkins, David; Chow, Elizabeth T

    2015-02-01

    Exposure to hair dye is the most frequent route of sensitisation to para-phenylenediamine (PPD), a common contact allergen. International studies have examined the profile of PPD, but Australian-sourced information is lacking. Patients are often dissatisfied with advice to stop dyeing their hair. This study examines patients' characteristics, patch test results and outcomes of PPD allergy from a single Australian centre, through a retrospective analysis of patch test data from 2006 to 2013 at the Liverpool Hospital Dermatology Department. It reviews the science of hair dye allergy, examines alternative hair dyes and investigates strategies for hair dyeing. Of 584 patients, 11 were allergic to PPD. Our PPD allergy prevalence rate of 2% is at the lower end of international reported rates. About half these patients also react to para-toluenediamine (PTD). Affected patients experience a significant lifestyle disturbance. In all, 78% tried alternative hair dyes after the patch test diagnosis and more than half continued to dye their hair. Alternative non-PPD hair dyes are available but the marketplace can be confusing. Although some patients are able to tolerate alternative hair dyes, caution is needed as the risk of developing an allergy to other hair dye ingredients, especially PTD, is high. PMID:25302475

  3. Tratamiento acortado estrictamente supervisado para tuberculosis pulmonar

    Directory of Open Access Journals (Sweden)

    Alvarez-Gordillo Guadalupe del Carmen

    1998-01-01

    Full Text Available Objetivo. Evaluar la posibilidad de aplicar el tratamiento acortado estrictamente supervisado (TAES en el Programa de Control de la Tuberculosis en Chiapas, México. Material y métodos. Se evaluó la eficacia y la eficiencia del tratamiento en una cohorte de pacientes con tuberculosis pulmonar confirmada por baciloscopía, que ingresaron a tratamiento con esquemas de autoadministración semisupervisión y estricta supervisión, de enero a junio de 1996. Resultados. La eficacia fue de 90.9. 97.7 y 100% para los esquemas de tratamiento autoadministrado, semisupervisado y TAES, respectivamente, mientras que la eficiencia fue de 68.1. 77.6 y 88.5% en el mismo orden. Conclusiones. Para la salud pública el TAES demostró ser la actividad más importante en el control de la tuberculosis, al elevar las tasas de curación y disminuir, por lo tanto, las fuentes de transmisión de la enfermedad.

  4. Custos sociais: Onde para o mercado?

    Directory of Open Access Journals (Sweden)

    Vítor Neves

    2012-12-01

    Full Text Available Os mercados constituem um poderoso mecanismo de coordenação económica. Ainda assim, as suas limitações não podem nem devem ser ignoradas. Os custos da mais diversa ordem com origem na atividade das empresas no quadro do capitalismo e externalizados, isto é, transferidos para outros agentes ou para a sociedade como um todo sem repercussão no mecanismo de preços, são um exemplo particularmente relevante dessas limitações. Neste artigo põem‑se em confronto as diferentes conceções sobre os custos sociais existentes na literatura económica, desde a identificação do problema como uma “falha do mercado” até à conceção mais heterodoxa (e também menos conhecida de K. William Kapp, segundo a qual os custos sociais são um problema intrínseco e inevitável no contexto institucional do capitalismo. Num primeiro momento discute‑se a natureza do problema. Em seguida, apresentam‑se, se bem que de forma muito sumária, duas linhas fundamentais de fratura entre a abordagem convencional dominante e a abordagem heterodoxa de Kapp: o conceito de eficiência adotado e o modo como é vista a questão da valoração dos custos sociais.

  5. Sistema integral para viviendas unifamiliares -SIVIM-

    Directory of Open Access Journals (Sweden)

    Drágula, Josef

    1984-07-01

    Full Text Available The Integral System for Multi-family Housing —SIVIM— is a proposition combining a structural solution and a functional one. In the first, techniques developed in civil construction for reinforced concrete technology are incorporated in the production of buildings. The second one proposes a spatial solution appropriate to the users’ requirements. Thus, with this proposition, the aims of constructing mass, low-cost housing are maintained in countries with tropical climatesEl Sistema Integral para Viviendas Multifamiliares —SIVIM— es una proposición que combina una solución estructural y una solución funcional. En la primera, se incorporan técnicas desarrolladas en la construcción civil, para la tecnología del hormigón armado, a la producción de edificaciones. La segunda, propone una solución espacial apropiada a los requerimientos de los usuarios. Se mantiene así con esta proposición, las metas de la construcción masiva y del bajo costo de la vivienda en países de clima tropical

  6. Adolfo Celi, um olhar para dois mundos

    Directory of Open Access Journals (Sweden)

    Alessandra Vanucci

    2002-11-01

    Full Text Available O ensaio resgata a vivência brasileira de Adolfo Celi, ator e diretor italiano ativo em cinema e teatro (1922-1986, inserido no laboratório paulista da renovação, na década de 1950. Sua atuação impôs, no palco, o legado texto-cêntrico de Sílvio d'Amico e a utopia do ator plástico de Copeau e, na tela, a estética neo-realista associada a uma atuação fortemente marcada pelo ideário teatral moderno. As intuições, a herança, as oportunidades e as invenções perdidas desta experiência transcultural sugerem um quadro de realização somente parcial do projeto modernizador. Ao entrar na década de 60, é a sensação de ter esgotado um ciclo existencial que fornece a Celi um válido álibi para o retorno. Álibi (1969, seu terceiro e último filme como diretor, realizado na Itália com Gassmann e Lucignani, é um testemunho de vida e memórias, de raiva e de saudade do Brasil; e um precioso guia para entender sua extraordinária ‘aventura americana’.

  7. Alternativas fundamentales para cuantificar el riesgo operacional

    Directory of Open Access Journals (Sweden)

    Ermilson Velasquez Ceballos

    2010-04-01

    Full Text Available El presente artículo es uno de los resultados de un proyecto de investigación financiado por la Universidad EAFIT en el año 2009. En el contexto del riesgo operacional, se hace un desarrollo formal de los métodos de Simulación Montecarlo, el algoritmo de recursión de Panjer y la Aproximación Analítica de Böcker y Klüppelberg, que son tres de las técnicas más utilizados para cuantificar ese riesgo en entidades financieras en el ámbito mundial. Luego se desarrolla una aplicación para un caso práctico, aplicando los tres métodos, y se obtienen conclusiones sobre su desempeño relativo. ABSTRACTThis article is one of the outcomes of a research project financed by Universidad EAFIT in the year 2009. In the operational risk context, a formal development of Montecarlo simulation methods, Panjer recursion algorithm, as well as Böcker and Klüppelberg analytical approximation is done, which are three of the most used techniques in order to quantify this risk in financial institutions worldwide. Subsequently an application for a practical case is developed by applying the three methods, and conclusions about its relative performance are obtained.

  8. FUNDAMENTOS COGNITIVOS PARA O ENSINO DA LEITURA

    Directory of Open Access Journals (Sweden)

    Lucilene Bender de Sousa

    2010-01-01

    Full Text Available Neste artigo, revisamos alguns fundamentos teóricos para o ensino da leitura baseados em recentes estudos das neurociências e ciências cognitivas. A leitura, enquanto processo cognitivo, deve ser compreendida em todos os seus níveis de processamento para que o ensino possa identificar e atender às necessidades do aluno. Primeiramente, abordamos o processamento da leitura do nível mais básico, a decodificação, ao nível mais avançado, a compreensão. Em seguida, exploramos funções cognitivas que não são exclusivas da leitura, a memória, a emoção e a aprendizagem. Por fim, propomos uma visão integrada desses processos, considerando a intrínseca relação entre língua, cognição e cultura, a qual permeia todas as nossas atividades, destacando o papel da cultura e da educação no desenvolvimento cognitivo.

  9. La casa del paraíso

    Directory of Open Access Journals (Sweden)

    de Prada Poole, José Miguel

    1992-02-01

    Full Text Available The article is the report that was submitted for the Contest. This is a house in which "the man" is a friend of the nature, he controls it and incorporates it in his most immediate surroundings. People, animals and plants live together forming an interdependent system. The house gives lodging to the man as a group (any kind of group with certain recognized rules of cohabitation. The individual intimacy is protected through "compact building elements" in which the user can retreat and get completely isolated. The glass of the partition le electro-optical and its properties vary as desired. All the necessary installations, controls and networks are situated under the pavement.

    La memoria que se utilizó para el Concurso, al que se presentó esta propuesta, es la que sirve para su exposición. Es ésta, una casa en la que el Hombre es amigo de la naturaleza, la controla, y la incorpora a su entorno más inmediato. Hombres, animales y plantas conviven formando un sistema interdependiente. La vivienda, da cobijo al hombre como grupo (cualquier clase de grupo con ciertas reglas de convivencia reconocidas. Se protege la intimidad individual mediante "elementos compactos de edificación", en los que el usuario puede aislarse por completo. El vidrio del cerramiento es electroóptico y sus propiedades varían a voluntad. Todas las instalaciones, controles y redes necesarios se encuentran bajo el pavimento.

  10. Un modelo SETAR para el PIB colombiano

    Directory of Open Access Journals (Sweden)

    Vivas Lorena

    2010-08-01

    Full Text Available En este artículo se estudia el comportamiento de la tasa de crecimiento del PIB colombiano entre 1982-2008 a partir de un modelo SETAR (Self-Exciting Threshold Autoregressive, empleando la metodología propuesta por Tsay (1989 y Tong (1990 para la detección de no linealidades relacionadas con la existencia de regímenes cambiantes. Adicionalmente, se comparan los pronósticos generados con los obtenidos en un modelo autorregresivo lineal para diferentes horizontes de predicción, empleando funciones de pérdida simétricas. Los resultados muestran evidencia empírica de que existe no linealidad de umbral en la serie asociada a las altas o bajas tasas de crecimiento registradas por su rezago anual (permaneciendo más tiempo en el régimen de tasas de crecimiento más elevadas y que el desempeño de los pronósticos del modelo SETAR parece no mejorar con respecto al modelo base.

  11. EMPRENDIMIENTO, UNA OPCIÓN PARA EL DESARROLLO

    OpenAIRE

    TITO DUARTE; MYRIAM RUIZ TIBANA

    2009-01-01

    En este artículo, se presentan algunas teorías y supuestos fundamentales para el desarrollo de una cultura emprendedora, como justificación para potenciar procesos creativos e innovadores, capaces de generar productividad y desarrollo a partir de la creación de nuevos entes económicos a nivel local, regional y nacional. El propósito es incluir algunas bases teóricas claves para implementar un programa de emprendimiento.

  12. Lectums: red social para amantes de la lectura

    OpenAIRE

    Hernández Trueba, Alexandre

    2011-01-01

    “Lectums, red social para amantes de la lectura” es un proyecto de fin de carrera con el que se pretende hacer un prototipo para Lectums, una red social dedicada a gente a la que le gusta la lectura y quiere compartir su afición y sus gustos literarios. Para ello se necesita crear una parte pública en la que los usuari...

  13. Ortesis para amortiguación de temblor

    OpenAIRE

    Pons Rovira, José Luis; Rocon, Eduardo; Loureiro, Rui; Belda-Lois, J. M.; Lawrence, Normie

    2007-01-01

    Ortesis para amortiguación de temblor. El objeto de esta invención es un dispositivo ortésico portátil que es compacto y no invasivo. El dispositivo ortésico es de utilidad para el amortiguamiento del temblor y comprende: Un sustrato o sistema de soporte para fijar el dispositivo al miembro superior que comprende una parte distal y una parte proximal. Al menos un sensor unido al sustrato para medir el movimiento del miembro y generar una señal sensorial. Al menos un actuador ancl...

  14. Sinopsis del género aechmea (bromeliaceae) para colombia

    OpenAIRE

    2013-01-01

    Se presenta la sinopsis de Aechmea (Bromeliaceae: Bromelioideae) para Colombia, la cual incluye la descripción del género, una clave para la identificación de las especies y la lista anotada de las mismas. Además, para cada especie se incluyen comentarios sobre el hábito de crecimiento, la categoría de amenaza y la distribución geográfica y altitudinal. Se registran 44 especies de Aechmea para Colombia, de las cuales nueve son endémicas: A. anomala, A. nivea, A. stenosepala, A. subpetiolata y...

  15. Novel synthesis of para-hydroxy-phenylglycine and related chemistry

    OpenAIRE

    Titulaer, Gerardus Theodorus Maria

    2003-01-01

    para-Hydroxy-Phenylglycine (HPG) is an important sidechain in several b-lactam antibiotics. In industry HPG is produced from phenol as the starting material via an electrophilic substitution reaction. A serious problem in this approach is the formation of ortho/para regioisomers, which is caused by activation of both the ortho and para positions of phenol. In this thesis a novel two-step synthesis of HPG from the relatively cheap benzoquinone is described, in which the ortho/para problem is c...

  16. Nueva especie de Loxostethus (Coleoptera: Tenebrionidae: Diaperini) para Cuba

    OpenAIRE

    Garrido, Orlando H.; Gutierrez, Esteban

    2010-01-01

    El género Loxostethus fue descrito por Triplehorn (1962), describiendo las especies fasciatus y opacifrons para Cuba, jamaicensis para Jamaica, y unicolor para Puerto Rico. Todas fueron halladas en hongos, y si bien no han sido reportadas de la Isla de Santo Domingo no es de extrañar que eventualmente aparezcan. Zayas (1989) describió L. quadrimaculata para Trinidad, Cuba-sin embargo, esta última especie cae dentro de la variación individual de L. fasciatus de acuerdo a la descripción de Trip...

  17. PROPUESTA METODOLÓGICA PARA EL MAPEO DE COMUNIDADES ARRECIFALES

    OpenAIRE

    Carlos F. Candelaria -Silva; Norma A. Corado-Nava; J. Manuel Oseguera-Cruz; Emmanuel Teyssier-Teutli; Brian Urbano-Alonso; Magali Honey-Escandón; Andrés Ocampo-Palacios; Silvia Hinojosa-Álvarez; Alejandra Martínez-Melo

    2006-01-01

    La cartografía de arrecifes coralinos se ha constituido en una valiosa herramienta para conocer diversos fenómenos y procesos biológicos que ocurren en estas comunidades, relacionados con su dimensión espacial. Los mapas se han empleado para representar la conformación topográfica de la formación arrecifal, los patrones de distribución de los corales y otras especies, como referentes para estudios de sucesión y para propósitos aplicados relacionados con programas de conservación y desarrollo ...

  18. Puente mixto para ferrocarril y carretera

    Directory of Open Access Journals (Sweden)

    Harris, P. C.

    1963-10-01

    Full Text Available This new bridge, known as the West Branch, spans the course of a river, and has a double function and two superimposed decks. One of these carries the road, and the other lower one, the railway line. It has been constructed by the Dept. of Public Works of California. The structure consists of four main spans resting on reinforced concrete piles, of great height. Four rectangular holes run down their centres. The decks consist of a continuous metal framework, made up of heavy elements, some of them weighing up to 56 tons each, was assembled in the workshop in separate sections. These were then transported to the site, to be integrated within the whole structure. In the final assembly high tensile steel bolts were employed. As the piles are very high, they are of varying cross section, according to the height. The concreting was done by means of sliding formwork, and this was sufficiently wide to ensure that the concrete was at least four hours old when the formwork passed beyond its level. To carry out these operations an auxiliary tower was built up. which supported the framework carrying the concreting tub and its pouring mechanism. From this main tub the concrete was poured into others, which placed it into the various parts of the formwork. The operation of the concrete elevator, whose motive power was provided by of the plant at ground level, was controlled by telephone between the operator of the power plant and the person responsible for distributing the concrete on the top platform. To provide the finish of the surfaces left by the sliding formwork, another platform was installed, working at a level below the lower edge of the formwork, and a similar arrangement was adopted with respect to the inner formwork for the four hollows running inside the piles.El nuevo puente, llamado West Branch, que salva el profundo cauce de un río, tiene una doble finalidad y dos tableros superpuestos: uno para carretera en la parte superior y otro para una

  19. Nave para Volkswagen en Ravenna, Italia

    Directory of Open Access Journals (Sweden)

    Epaminonda, Ceccarelli

    1965-09-01

    Full Text Available This factory hall is meant to house an exhibition, workshops, stores and offices of the Italian subsidiary of the Volkswagen firm. It is sited in an urbanized, but not yet built up, area. Its ground area is 54 by 38 m. Part of the frontage, about 36 m, is set back 8 m with respect to the remaining 18 m; the latter correspond to the part of the building occupied by the exhibition hall. As the ground is weak, it has been necessary to use piles to support the foundations. The structure is metallic, and the enclosing walls and roof consist of prefabricated panels and metals sheets. The roof contains a special chamber, where the air conditioning ducts and other services are housed. Great care has been taken over the colour patterns, both inside and outside. The type of structure and use of prefabricated panels has greatly lowered the overall cost of the building. All the foundation elements have been suitable waterproofed.Esta nave industrial está destinada a albergar los servicios de exposición, talleres, depósito y oficinas para la empresa concesionaria, en Italia, de la marca de automóviles Volkswagen. Se halla situada en una zona urbanizada, pero sin edificar, y tiene 54x38 m en planta. Parte de la fachada principal—unos 36 m—está retranqueada 8 m respecto de la alineación; los 18 m restantes corresponden al salón de exposiciones. Como el terreno es de escasa capacidad de sustentación, ha sido necesario el empleo de pilotes en los puntos de apoyo. La estructura resistente es metálica y se ha cerrado y cubierto con paneles prefabricados y placas metálicas. Los forjados de cubierta tienen una cámara que permite la colocación de conductos para el acondicionamiento. Se han cuidado mucho los colores para la estructura vista y paramentos interiores. La disposición de la estructura y el empleo de paneles prefabricados han permitido obtener costos muy favorables. Todas las partes de la infraestructura han sido debidamente

  20. EKSPLOITASI EKONOMI DAN SEKSUAL PARA PENARI LENGGER

    Directory of Open Access Journals (Sweden)

    Eka Septianingsih

    2013-04-01

    Full Text Available Awalnya kesenian lengger digunakan dalam upacara-upacara ritual di pedesaan serta upacara-upacara yang berkaitan dengan kesuburan. Saat ini kesenian lengger lebih mengarah pada fungsi hiburan dan komersial. Hal ini membuat penari lengger rentan terhadap eksploitasi baik secara ekonomi maupun seksual. Pertanyaan penelitian ini adalah bagaimana bentuk pertunjukan lengger; bagaimana tanggapan masyarakat terhadap keberadaan penari lengger;  bagaimana bentuk eksploitasi yang dialami oleh penari lengger; dan apa respon penari lengger tentang tindakan eksploitasi itu. Metode penelitian yang digunakan adalah kualitatif, dengan analisis data interpretatif. Lokasi penelitian di desa Selanegara, Sumpiuh, Banyumas. Hasil penelitian menunjukkan bahwa ada beberapa unsur yang terkait dengan bentuk pertunjukan lengger, yaitu: pemain, gerak, iringan musik, tata rias dan busana, serta tempat pementasan. Citra negatif penari lengger biasanya diasosiakan dengan gerakan tari yang erotis sehingga dapat memancing pelecehan, seperti diraba, dicolek, dipeluk dan dicium oleh para pengibing. Bentuk eksploitasi ekonomi terjadi karena tuntutan ekonomi sehingga mendorong para penari mengeksploitasi tubuhnya untuk mendapatkan uang.  Perlakuan tidak senonoh dari penonton merupakan bagian dari resiko profesi yang harus dijalani. Fenomena ini diharapkan dapat mendorong masyarakat dan pemerintah untuk melindungi para pelaku kesenian dari tindakan eksploitasi.Originally lengger is performed in ceremonies and rituals in rural ceremonies associated with fertility. Currently the performance of lengger has more entertainment and commercial functions. This makes the dancers vulnerable to exploitation lengger both economically and sexually. The objectiveof this study is to explore the form of lengger show, forms of exploitation experienced by dancers lengger, and the responses of the lengger dancer towards exploitation. Research methods used are qualitative approach, with