
Sample records for bd imagn microvolume

  1. Proportional microvolume capacitive liquid level sensor array. (United States)

    Seliskar, D; Waterbury, R; Kearney, R


    A sensor array has been developed for use with laboratory automation to permit closed-loop control of liquid levels in a multiwell microplate geometry. We extended a simple electrical model for non-contact capacitance-based fluid sensors to describe a fluid-level dependency. The new model shows that a charge-transfer based capacitance transducer, employing a liquid-specific calibration, can be used to obtain an output signal that varies linearly with the liquid level. The calibration also compensates for liquid-to-liquid conductivity and permittivity differences. A prototype 3×3 sensor array was built and tested using NaCl and ethanol solutions to simulate the range of conductivity and permittivity typical in biological and chemical research. Calibrated output signals were linear with liquid volume for all tested solutions (R2>0.92). Measurement error averaged 1.3 % (2.0 μl) with a standard deviation of 6.0% (9.0 μl). These results demonstrate the feasibility of developing a microvolume sensor array in essentially any M×N microplate geometry. PMID:17281955

  2. Three-Electrode Analytical and Preparative Electrochemistry in Micro-Volume Hanging Droplets


    Perez Jimenez, Ana Isabel; Challier, Lylian; Di Pisa, Margherita; Guille-Collignon, Manon; Lemaître, Frédéric; Lavielle, Solange; Mansuy, Christelle; Amatore, Christian; Labbé, Eric; Buriez, Olivier


    Three-electrode micro-cells equipped with a conventional reference electrode (SCE) were easily constructed based on micro-volume droplets suspended by capillary forces to the fritted glass of the SCE bridge. Working and counter electrodes were simply inserted through the droplet surface, allowing classical electrochemistry to be readily performed in minute samples.

  3. Microvolume TOC Analysis as Useful Tool in the Evaluation of Lab Scale Photocatalytic Processes

    Directory of Open Access Journals (Sweden)

    Pegie Cool


    Full Text Available Analysis methods that require small volumes of aqueous samples can be of large benefit for applications when expensive chemicals are involved or available volumes are substantially small and concentrations are low. A new method is presented to allow microvolume liquid injections on TOC equipment using a special designed Shimadzu gas injection kit® in combination with a high precision syringe and Chaney adapter. Next to details on the methodology of microvolume TOC injections, the technique is shown to be beneficial to evaluate the efficiency of photocatalytic dye degradation on titania materials in terms of CO2 conversion simultaneously with classic UV-Vis analysis measurements within a lab scale photocatalytic test setup (volume <100 mL. The possibility to allow multiple microvolume samplings in short time intervals during several hours without a substantial decrease in volume/catalyst ratio is of particular value for the evaluation of photocatalysts. By combining both techniques at short time intervals, additional knowledge of the degradation process/mechanism, kinetics and the efficiency can be obtained in a direct way. Moreover, the developed μV-TOC analysis is specifically useful in those applications in which low sample volumes in combination with low concentrations are involved. For example, μV-TOC can similarly be put into service in a wide range of small volume setups, e.g., analytes from high-throughput screening, pharmaceutical applications and other advanced oxidation processes that formally could not be analyzed due to limited sample volumes and often low concentrations.

  4. Researches towards establishing procedures and protocols for testing instrumental accuracy and reproducibility of UV-visible microvolume drop spectroscopy instrumentation

    International Nuclear Information System (INIS)

    The Reference Materials (DTRM-2SG and DTRM-4SG) for validation of the absorbance scale for a Transmitted Light Drop Analyser (TLDA) have been developed specifically for microvolume spectroscopy. The approach to the calibration of photometric accuracy and reproducibility is briefly illustrated. These materials can be used also for wavelength checks. The study addresses however a wider range of issues for microvolume spectroscopy quality assurance. This study concludes with a general discussion of this quality programme on the important practical and philosophical issues needed for drop science quality systems.

  5. Research of mechanics of the compact bone microvolume and porous ceramics under uniaxial compression

    International Nuclear Information System (INIS)

    The research results of the mechanics are presented and the effective mechanical characteristics under uniaxial compression of the simulative microvolume of the compact bone are defined subject to the direction of the collagen-mineral fibers, porosity and mineral content. The experimental studies of the mechanics are performed and the effective mechanical characteristics of the produced porous zirconium oxide ceramics are defined. The recommendations are developed on the selection of the ceramic samples designed to replace the fragment of the compact bone of a definite structure and mineral content

  6. Research of mechanics of the compact bone microvolume and porous ceramics under uniaxial compression

    Energy Technology Data Exchange (ETDEWEB)

    Kolmakova, T. V., E-mail:; Buyakova, S. P., E-mail:; Kul’kov, S. N., E-mail: [Institute of Strength Physics and Materials Science of Siberian Branch of Russian Academy of Sciences (Russian Federation); National Research Tomsk State University (Russian Federation)


    The research results of the mechanics are presented and the effective mechanical characteristics under uniaxial compression of the simulative microvolume of the compact bone are defined subject to the direction of the collagen-mineral fibers, porosity and mineral content. The experimental studies of the mechanics are performed and the effective mechanical characteristics of the produced porous zirconium oxide ceramics are defined. The recommendations are developed on the selection of the ceramic samples designed to replace the fragment of the compact bone of a definite structure and mineral content.

  7. Enhancing Liquid Micro-volume Mixing with Wettability-Patterned Surfaces (United States)

    Morrissette, Jared; Sinha Mahapatraa, Pallab; Ganguly, Ranjan; Megaridis, Constantine; Uic-Mnftl Team


    Self-driven surface micromixers (SDSM) based on patterned wettability technology provide an elegant solution for low-cost point-of-care (POC) devices and lab-on-a-chip (LOC) applications. Our SDSMs are fabricated by strategically patterning three wettable wedge-shaped tracks onto a non-wettable surface. Current state-of-the-art micromixers require energy, however, our SDSMs utilize the inherent surface energy of liquids, coupled with wettability contrast to efficiently mix small amounts of liquids (e.g. droplets). Transport and mixing of the SDSMs is accomplished by means of Laplace pressure-driven flow and several mixing approaches, such as splitting-recombining, stretching-folding, and transversal vortices. Mixing is initiated when separate liquid micro-volumes are transported along respective, juxtaposed wettable tracks. As the liquid micro-volumes coalesce, subsequent mixing occurs during transport of the combined volume over a third separate wettable track that also features a non-wettable ``island.'' The two-dimensional island disrupts the flow of liquids, in a similar manner a three-dimensional obstacle would, thus generating the aforementioned mixing enhancement. Several SDSMs, each having different island geometries, were investigated, giving rise to a greater understanding of efficient mixing on surfaces. The study offers a design basis for developing a low-cost surface microfluidic mixing device on various substrates.

  8. Headspace single-drop microextraction coupled to microvolume UV-vis spectrophotometry for iodine determination

    International Nuclear Information System (INIS)

    Headspace single-drop microextraction has been combined with microvolume UV-vis spectrophotometry for iodine determination. Matrix separation and preconcentration of iodide following in situ volatile iodine generation and extraction into a microdrop of N,N'-dimethylformamide is performed. An exhaustive characterization of the microextraction system and the experimental variables affecting iodine generation from iodide was carried out. The procedure employed consisted of exposing 2.5 μL of N,N'-dimethylformamide to the headspace of a 10 mL acidic (H2SO4 2 mol L-1) aqueous solution containing 1.7 mol L-1 Na2SO4 for 7 min. Addition of 1 mL of H2O2 1 mol L-1 for in situ iodine generation was performed. The limit of detection was determined as 0.69 μg L-1. The repeatability, expressed as relative standard deviation, was 4.7% (n = 6). The calibration working range was from 5 to 200 μg L-1 (r2 = 0.9991). The large preconcentration factor obtained, ca. 623 in only 7 min, compensate for the 10-fold loss in sensitivity caused by the decreased optical path, which results in improved detection limits as compared to spectrophotometric measurements carried out with conventional sample cells. The method was successfully applied to the determination of iodine in water, pharmaceutical and food samples

  9. Nuclear burst detection information transfers system based on BD Navigation

    International Nuclear Information System (INIS)

    The article introduces the character of BD Navigation System.The feasibility of using BD Navigation System is analyzed. Nuclear explosion information transmission system based on BD Navigation System is designed and implemented. (authors)

  10. BD monomer and elastomer production processes. (United States)

    Lynch, J


    The monomer 1,3 butadiene (BD) is a product of the petrochemical industry. It is used to make several elastomers including the very high volume styrene butadiene rubber (SBR) that comprises the bulk of automobile tires. It is also used to make polybutadiene rubber that is used in parts of tires, coatings, composites and other products. The monomer can be converted to chlorobutadiene (chloroprene) and used to make polychloroprene (neoprene). BD is one of the several olefins created by cracking hydrocarbons in the presence of steam. A mixed C4 stream from the steam cracker is then sent to a BD monomer extraction unit. Modern units typically use dimethyl formamide as the extraction solvent. SBR is commonly made by the copolymerization of BD and styrene, along with various additives to control the reaction, in a water emulsion. The reaction proceeds in a continuous chain of reactors until it is 'shortstopped' by a strong reducing agent. After removing unreacted monomers from the stabilized latex, it is blended, coagulated and dewatered. The resulting dry rubber crumb is bailed, film wrapped and stored in crates. The polymerization of BD to make polybutadiene rubber can be conducted as a water suspension type polymerization similar to SBR or in a solvent system followed by solvent recovery and transfer into water suspension. PMID:11397387

  11. Bd/s -> mu+ mu- in ATLAS

    CERN Document Server

    AUTHOR|(INSPIRE)INSPIRE-00215268; The ATLAS collaboration


    The ATLAS Experiment has conducted a search for the rare decays of Bs and Bd into mu+mu-. 25 fb−1 of integrated luminosity of proton-proton collisions collected during LHC Run 1 were studied and new results were obtained, as presented in this talk. An upper limit is set on the Bd to mu+mu- branching ratio of BR(Bd to mu+mu-) < 4.2×10−10 at 95% confidence level. For Bs, ATLAS measurement yields the branching ratio BR(Bs to mu+mu-)=(0.9+1.1−0.8)×10−9. The result is consistent with the Standard Model expectation and other available measurements.

  12. Bd/s -> mu+ mu- in ATLAS

    CERN Document Server

    Guenther, Jaroslav; The ATLAS collaboration


    The ATLAS Experiment has conducted a search for the rare decays of Bs and Bd into mu+mu-. 25 fb−1 of integrated luminosity of proton-proton collisions collected during LHC Run 1 were studied to provide new results presented in this talk. An upper limit is set on the branching ratio BR(Bd to mu+mu-) < 4.2×10−10 at 95% confidence level. For Bs, ATLAS measurement yields the branching ratio BR(Bs to mu+mu-)=(0.9+1.1−0.8)×10−9. The result is consistent with the Standard Model expectation and other available measurements.

  13. 黏合剂Argaprint BD-L%Adhesive Argaprint BD-L for pigment printing

    Institute of Scientific and Technical Information of China (English)



    Application of Argaprint BD-L in pigment printing of cotton fabric is carried out. The results show that cotton fabric printed with Argaprint BD-L from 15% to 30% and pigment from 3% to 8% feature good color fastness and soft handle, as well as lower formaldehyde residual content less than 20 mg/kg. The application performances of Argaprint BD-L are slightly affected by fabric structure and pigment type. It can meet the requirements of high fastness printing in deep color to use Argaprint BD-L combined with cross-linking agent Argaprint CL-SLF and promoter for rubbing fastness Argaprint PF-SO.%黏合剂Argaprint BD-L系自交联型黏合剂.当涂料用量为3%~8%,即从浅色到特深色印花,黏合剂Argaprint BD-L对应的用量为15%~30%(对色浆质量),均可获得良好的牢度和柔软的手感,且布面甲醛含量小于20 mg/kg.黏合剂Argaprint BD-L与配套的交联剂Argaprint CL-SLF和摩擦牢度提升剂Argaprint PF-SO联用,可满足高牢度要求的特深色印花.

  14. The pulsating extreme helium star BD + 1303224

    International Nuclear Information System (INIS)

    Ultraviolet flux variations are reported for the pulsating extreme helium star BD + 1303224 (V652 Her). Effective temperature and angular radius variations over a cycle are determined from static plane-parallel LTE model atmospheres. When compared with radius changes derived from ground-based spectroscopy, the angular radius variations indicate radial pulsations and correspond to a distance of 1.5 +- 0.1 kpc. BD + 1303224 is thought to be a helium-burning star of 0.7 Msolar masses, which has an envelope contracting as the helium-burning core grows; it is similar to HD 144941 and these two stars may constitute a new sub-class of the hydrogen-deficient stars. (author)

  15. BdCESA7, BdCESA8, and BdPMT Utility Promoter Constructs for Targeted Expression to Secondary Cell-Wall-Forming Cells of Grasses


    Petrik, Deborah L.; Cass, Cynthia L.; Padmakshan, Dharshana; Foster, Cliff E.; Vogel, John P; Steven D. Karlen; Ralph, John; Sedbrook, John C


    Utility vectors with promoters that confer desired spatial and temporal expression patterns are useful tools for studying gene and cellular function and for industrial applications. To target the expression of DNA sequences of interest to cells forming plant secondary cell walls, which generate most of the vegetative biomass, upstream regulatory sequences of the Brachypodium distachyon lignin biosynthetic gene BdPMT and the cellulose synthase genes BdCESA7 and BdCESA8 were isolated and cloned...

  16. Elevated Corticosterone Levels and Changes in Amphibian Behavior Are Associated with Batrachochytrium dendrobatidis (Bd Infection and Bd Lineage.

    Directory of Open Access Journals (Sweden)

    Caitlin R Gabor

    Full Text Available Few studies have examined the role hormones play in mediating clinical changes associated with infection by the parasite Batrachochytrium dendrobatidis (Bd. Glucocorticoid (GC hormones such as corticosteroids (CORT regulate homeostasis and likely play a key role in response to infection in amphibians. We explore the relationship between CORT release rates and Bd infection in tadpoles of the common midwife toad, Alytes obstetricians, using a non-invasive water-borne hormone collection method across seven populations. We further examined whether tadpoles of A. muletensis infected with a hypervirulent lineage of Bd, BdGPL, had greater CORT release rates than those infected with a hypovirulent lineage, BdCAPE. Finally, we examined the relationship between righting reflex and CORT release rates in infected metamorphic toads of A. obstetricans. We found an interaction between elevation and Bd infection status confirming that altitude is associated with the overall severity of infection. In tandem, increasing elevation was associated with increasing CORT release rates. Tadpoles infected with the hypervirulent BdGPL had significantly higher CORT release rates than tadpoles infected with BdCAPE showing that more aggressive infections lead to increased CORT release rates. Infected metamorphs with higher CORT levels had an impaired righting reflex, our defined experimental endpoint. These results provide evidence that CORT is associated with an amphibian's vulnerability to Bd infection, and that CORT is also affected by the aggressiveness of infection by Bd. Together these results indicate that CORT is a viable biomarker of amphibian stress.

  17. Screen-printed electrode based electrochemical detector coupled with ionic liquid dispersive liquid–liquid microextraction and microvolume back-extraction for determination of mercury in water samples


    Fernández Martínez, Elena; Vidal Martínez, Lorena; Martín-Yerga, Daniel; Blanco, María del Carmen; Canals Hernández, Antonio; Costa-García, Agustín


    A novel approach is presented, whereby gold nanostructured screen-printed carbon electrodes (SPCnAuEs) are combined with in-situ ionic liquid formation dispersive liquid–liquid microextraction (in-situ IL-DLLME) and microvolume back-extraction for the determination of mercury in water samples. In-situ IL-DLLME is based on a simple metathesis reaction between a water-miscible IL and a salt to form a water-immiscible IL into sample solution. Mercury complex with ammonium pyrrolidinedithiocarbam...

  18. Quantitative drop spectroscopy using the drop analyser: theoretical and experimental approach for microvolume applications of non-turbid solutions

    International Nuclear Information System (INIS)

    The drop analyser, also termed the tensiograph, is an optical fibre-based instrument system for monitoring liquids. A comprehensive assessment of the drop analyser used as a UV–visible spectrophotometer has been undertaken employing both experimental and theoretical studies. A model of the tensiograph signal (tensiotrace) has been developed using a ray-tracing approach to accurately predict the form of the tensiotrace as an aid to drop spectroscopy. An analytical equation is derived for quantitative drop spectroscopy and the form of the equation has been experimentally tested. The equation applies to both the case of a growing drop and the situation in which the drop volume is held stationary. Measurements on both stationary and moving drops are of practical value. Modelling has been used to compute the average path length of the coupled light in the drop to give a result that compares favourably with values obtained from experimental measurements. An optimized method has been identified for quantitative drop spectroscopy measurements. Results from UV–visible studies on both pollutants in water and pharmaceuticals demonstrate the utility of this approach. Two key matters relating to the practicalities of drop spectroscopy are then discussed. Some experimental studies have been made to ascertain the practical limit in analyte concentration above which variations in transmitted light from the drop shape variations result. Here, tabulated information on a representative range of liquid types has been provided as a guide to optimized spectroscopic drop analysis. Secondly, the handling of micro-volume samples is discussed. The paper concludes with a brief evaluation of the usefulness of this drop spectroscopy approach, but specifically points to the importance of drop spectroscopy for nanoscience applications

  19. Reliable TLDA-microvolume UV spectroscopy with applications in chemistry and biosciences for microlitre analysis and rapid pipette calibration (United States)

    McMillan, Norman; O'Neill, Martina; Smith, Stephen; Hammond, John; Riedel, Sven; Arthure, Kevin; Smith, S.


    A TLDA-microvolume (transmitted light drop analyser) accessory for use with a standard UV-visible fibre spectrophotometer is described. The physics of the elegantly simple optical design is described along with the experimental testing of this accessory. The modelling of the arrangement is fully explored to investigate the performance of the drop spectrophotometer. The design optimizes the focusing to deliver the highest quality spectra, rapid and simple sample handling and, importantly, no detectable carryover on the single quartz drophead. Results of spectral measurements in a laboratory providing NIST standards show the closest correlation between modelled pathlength and experimental measurement for different drop volumes in the range 0.7-3 µl. This instrument accessory delivers remarkably accurate and reproducible results that are good enough to allow the accessory to be used for rapid pipette calibration to avoid the laborious weighing methods currently employed. Measurements on DNA standards and proteins are given to illustrate the main application area of biochemistry for this accessory. The accessory has a measurement range of at least 0-60 A units without sample dilution and, since there exists an accurate volume-pathlength relationship, the drop volume used in any specific measurement or assay should be optimized to minimize the photometric error. Studies demonstrate that the cleaning of the drophead with lab wipes results in no measurable carryover. This important practical result is confirmed from direct reading of the accessory and an analytical balance which was used to perform carryover studies. For further information on the TLDA please contact: Drop Technology, Unit 2, Tallaght Business Park, Whitestown, Dublin 24, Republic of Ireland. email:

  20. Widespread occurrence of bd in French Guiana, South America.

    Directory of Open Access Journals (Sweden)

    Elodie A Courtois

    Full Text Available The amphibian chytrid fungus Batrachochytrium dendrobatidis (Bd is a purported agent of decline and extinction of many amphibian populations worldwide. Its occurrence remains poorly documented in many tropical regions, including the Guiana Shield, despite the area's high amphibian diversity. We conducted a comprehensive assessment of Bd in French Guiana in order to (1 determine its geographical distribution, (2 test variation of Bd prevalence among species in French Guiana and compare it to earlier reported values in other South American anuran species (; 123 species from 15 genera to define sentinel species for future work, (3 track changes in prevalence through time and (4 determine if Bd presence had a negative effect on one selected species. We tested the presence of Bd in 14 species at 11 sites for a total of 1053 samples (306 in 2009 and 747 in 2012. At least one Bd-positive individual was found at eight out of 11 sites, suggesting a wide distribution of Bd in French Guiana. The pathogen was not uniformly distributed among the studied amphibian hosts, with Dendrobatidae species displaying the highest prevalence (12.4% as compared to Bufonidae (2.6 % and Hylidae (1.5%. In contrast to earlier reported values, we found highest prevalence for three Dendrobatidae species and two of them displayed an increase in Bd prevalence from 2009 to 2012. Those three species might be the sentinel species of choice for French Guiana. For Dendrobates tinctorius, of key conservation value in the Guiana Shield, smaller female individuals were more likely to be infected, suggesting either that frogs can outgrow their chytrid infections or that the disease induces developmental stress limiting growth. Generally, our study supports the idea that Bd is more widespread than previously thought and occurs at remote places in the lowland forest of the Guiana shield.

  1. Measuring γ Cleanly with CP -Tagged Bs and Bd Decays

    International Nuclear Information System (INIS)

    We propose a new method for measuring the Cabibbo-Kobayashi-Maskawa phase γ using the partial rates for CP -tagged Bs decays. Such an experiment could be performed at a very high luminosity symmetric e+e- collider operating at the Υ(5S) resonance, where the BsBs pair is produced in a state of definite CP . We also discuss CP tagging in the Bd system at the Υ(4S) , where a time-dependent analysis is required to compensate for the anticipated large CP violation in Bd-Bd mixing. (c) 2000 The American Physical Society

  2. Wormhole solution of BD theory in an anisotropic radiation background

    Directory of Open Access Journals (Sweden)

    B. Nasre Esfahani


    Full Text Available   Time-dependent wormhole solution of the BD theory in an anisotropic radiation background is presented. It is also found that the BD scalar field depends only on time. This time dependency is in power-law form. It is shown that the wormhole geometry is valid for ω ≥ -3/2, and for any arbitrary positive values of . The GR limit of our solution is obtained for ω=0 , not for ω→∞ . Though the BD field can be non-exotic, the background material is entirely exotic.

  3. TRAC-BD1/MOD1 user's guideline

    International Nuclear Information System (INIS)

    Code assessment studies and specific code applications have provided insight into the effective use of the TRAC-BWR series of codes. This document reports the experience gained from the studies and serves to assist the user in the effective application of the TRAC-BD1/MOD1 computer code. This document stresses the user's perspective relative to approprite use of the TRAC-BD1/MOD1 code and is considered an adjunct to other documentation provided with the code

  4. Elevated Corticosterone Levels and Changes in Amphibian Behavior Are Associated with Batrachochytrium dendrobatidis (Bd) Infection and Bd Lineage


    Gabor, Caitlin R.; Fisher, Matthew C; Bosch, Jaime


    Few studies have examined the role hormones play in mediating clinical changes associated with infection by the parasite Batrachochytrium dendrobatidis (Bd). Glucocorticoid (GC) hormones such as corticosteroids (CORT) regulate homeostasis and likely play a key role in response to infection in amphibians. We explore the relationship between CORT release rates and Bd infection in tadpoles of the common midwife toad, Alytes obstetricians, using a non-invasive water-borne hormone collection metho...

  5. Measurement of the B$_{d}^{0}$ meson oscillation frequency

    CERN Document Server

    Acciarri, M; Aguilar-Benítez, M; Ahlen, S P; Alpat, B; Alcaraz, J; Alemanni, G; Allaby, James V; Aloisio, A; Alverson, G; Alviggi, M G; Ambrosi, G; Anderhub, H; Andreev, V P; Angelescu, T; Antreasyan, D; Arefev, A; Azemoon, T; Aziz, T; Bagnaia, P; Baksay, L; Ball, R C; Banerjee, S; Banicz, K; Barillère, R; Barone, L; Bartalini, P; Baschirotto, A; Basile, M; Battiston, R; Bay, A; Becattini, F; Becker, U; Behner, F; Berdugo, J; Berges, P; Bertucci, B; Betev, B L; Biasini, M; Biland, A; Bilei, G M; Blaising, J J; Blyth, S C; Bobbink, Gerjan J; Böck, R K; Böhm, A; Borgia, B; Boucham, A; Bourilkov, D; Bourquin, Maurice; Boutigny, D; Brambilla, Elena; Branson, J G; Brigljevic, V; Brock, I C; Buijs, A; Burger, J D; Burger, W J; Busenitz, J K; Buytenhuijs, A O; Cai, X D; Campanelli, M; Capell, M; Cara Romeo, G; Caria, M; Carlino, G; Cartacci, A M; Casaus, J; Castellini, G; Castello, R; Cavallari, F; Cavallo, N; Cecchi, C; Cerrada-Canales, M; Cesaroni, F; Chamizo-Llatas, M; Chan, A; Chang, Y H; Chaturvedi, U K; Chemarin, M; Chen, A; Chen, G; Chen, G M; Chen, H F; Chen, H S; Chen, M; Chiefari, G; Chien, C Y; Choi, M T; Cifarelli, Luisa; Cindolo, F; Civinini, C; Clare, I; Clare, R; Cohn, H O; Coignet, G; Colijn, A P; Colino, N; Costantini, S; Cotorobai, F; de la Cruz, B; Csilling, Akos; Dai, T S; D'Alessandro, R; De Asmundis, R; De Boeck, H; Degré, A; Deiters, K; Denes, P; De Notaristefani, F; DiBitonto, Daryl; Diemoz, M; Van Dierendonck, D N; Di Lodovico, F; Dionisi, C; Dittmar, Michael; Dominguez, A; Doria, A; Dorne, I; Dova, M T; Drago, E; Duchesneau, D; Duinker, P; Durán, I; Dutta, S; Easo, S; Efremenko, Yu V; El-Mamouni, H; Engler, A; Eppling, F J; Erné, F C; Ernenwein, J P; Extermann, Pierre; Fabre, M; Faccini, R; Falciano, S; Favara, A; Fay, J; Fedin, O; Felcini, Marta; Ferguson, T; Fernández, D; Ferroni, F; Fesefeldt, H S; Fiandrini, E; Field, J H; Filthaut, Frank; Fisher, P H; Forconi, G; Fredj, L; Freudenreich, Klaus; Furetta, C; Galaktionov, Yu; Ganguli, S N; Gau, S S; Gentile, S; Gerald, J; Gheordanescu, N; Giagu, S; Goldfarb, S; Goldstein, J; Gong, Z F; Gougas, Andreas; Gratta, Giorgio; Grünewald, M W; Gupta, V K; Gurtu, A; Gutay, L J; Hangarter, K; Hartmann, B; Hasan, A; Hebbeker, T; Hervé, A; Van Hoek, W C; Hofer, H; Hoorani, H; Hou, S R; Hu, G; Ilyas, M M; Innocente, Vincenzo; Janssen, H; Jin, B N; Jones, L W; de Jong, P; Josa-Mutuberria, I; Kasser, A; Khan, R A; Kamyshkov, Yu A; Kapinos, P; Kapustinsky, J S; Karyotakis, Yu; Kaur, M; Kienzle-Focacci, M N; Kim, D; Kim, J K; Kim, S C; Kim, Y G; Kinnison, W W; Kirkby, A; Kirkby, D; Kirkby, Jasper; Kiss, D; Kittel, E W; Klimentov, A; König, A C; Korolko, I; Koutsenko, V F; Krämer, R W; Kramer, T; Krenz, W; Kuijten, H; Kunin, A; Ladrón de Guevara, P; Landi, G; Lapoint, C; Lassila-Perini, K M; Laurikainen, P; Lebeau, M; Lebedev, A; Lebrun, P; Lecomte, P; Lecoq, P; Le Coultre, P; Lee Jae Sik; Lee, K Y; Leggett, C; Le Goff, J M; Leiste, R; Lenti, M; Leonardi, E; Levchenko, P M; Li Chuan; Lieb, E H; Lin, W T; Linde, Frank L; Lista, L; Liu, Z A; Lohmann, W; Longo, E; Lu, W; Lü, Y S; Lübelsmeyer, K; Luci, C; Luckey, D; Ludovici, L; Luminari, L; Lustermann, W; Ma Wen Gan; Macchiolo, A; Maity, M; Majumder, G; Malgeri, L; Malinin, A; Maña, C; Mangla, S; Marchesini, P A; Marin, A; Martin, J P; Marzano, F; Massaro, G G G; Mazumdar, K; McNally, D; Mele, S; Merola, L; Meschini, M; Metzger, W J; Von der Mey, M; Mi, Y; Mihul, A; Van Mil, A J W; Mirabelli, G; Mnich, J; Monteleoni, B; Moore, R; Morganti, S; Mount, R; Müller, S; Muheim, F; Nagy, E; Nahn, S; Napolitano, M; Nessi-Tedaldi, F; Newman, H; Nippe, A; Nowak, H; Organtini, G; Ostonen, R; Pandoulas, D; Paoletti, S; Paolucci, P; Park, H K; Pascale, G; Passaleva, G; Patricelli, S; Paul, T; Pauluzzi, M; Paus, C; Pauss, Felicitas; Peach, D; Pei, Y J; Pensotti, S; Perret-Gallix, D; Petrak, S; Pevsner, A; Piccolo, D; Pieri, M; Pinto, J C; Piroué, P A; Pistolesi, E; Plyaskin, V; Pohl, M; Pozhidaev, V; Postema, H; Produit, N; Prokofev, D; Prokofiev, D O; Raghavan, R; Rahal-Callot, G; Rancoita, P G; Rattaggi, M; Raven, G; Razis, P A; Read, K; Ren, D; Rescigno, M; Reucroft, S; Van Rhee, T; Riemann, S; Riemers, B C; Riles, K; Rind, O; Ro, S; Robohm, A; Rodin, J; Rodríguez-Calonge, F J; Roe, B P; Röhner, S; Romero, L; Rosier-Lees, S; Rosselet, P; Van Rossum, W; Roth, S; Rubio, Juan Antonio; Rykaczewski, H; Salicio, J; Sánchez, E; Santocchia, A; Sarakinos, M E; Sarkar, S; Sassowsky, M; Sauvage, G; Schäfer, C; Shchegelskii, V; Schmidt-Kärst, S; Schmitz, D; Schmitz, P; Schneegans, M; Schöneich, B; Scholz, N; Schopper, Herwig Franz; Schotanus, D J; Schwenke, J; Schwering, G; Sciacca, C; Sciarrino, D; Sens, Johannes C; Servoli, L; Shevchenko, S; Shivarov, N; Shoutko, V; Shukla, J; Shumilov, E; Shvorob, A V; Siedenburg, T; Son, D; Sopczak, André; Soulimov, V; Smith, B; Spillantini, P; Steuer, M; Stickland, D P; Sticozzi, F; Stone, H; Stoyanov, B; Strässner, A; Strauch, K; Sudhakar, K; Sultanov, G G; Sun, L Z; Susinno, G F; Suter, H; Swain, J D; Tang, X W; Tauscher, Ludwig; Taylor, L; Ting, Samuel C C; Ting, S M; Tonisch, F; Tonutti, M; Tonwar, S C; Tóth, J; Tully, C; Tuchscherer, H; Tung, K L; Ulbricht, J; Uwer, U; Valente, E; Van de Walle, R T; Vesztergombi, G; Vetlitskii, I; Viertel, Gert M; Vivargent, M; Völkert, R; Vogel, H; Vogt, H; Vorobev, I; Vorobyov, A A; Vorvolakos, A; Wadhwa, M; Wallraff, W; Wang, J C; Wang, X L; Wang, Y F; Wang, Z M; Weber, A; Wittgenstein, F; Wu, S X; Wynhoff, S; Xu, J; Xu, Z Z; Yang, B Z; Yang, C G; Yao, X Y; Ye, J B; Yeh, S C; You, J M; Zalite, A; Zalite, Yu; Zemp, P; Zeng, Y; Zhang, Z; Zhang, Z P; Zhou, B; Zhou, Y; Zhu, G Y; Zhu, R Y; Zichichi, Antonino


    Time-dependent \\Bd-\\Bbd\\ mixing is studied using 1.5 million hadronic Z decays collected by L3. Semileptonic B decays are selected by requiring at least one reconstructed lepton in both thrust hemispheres. Charge correlations between the tagged leptons are studied as a function of proper time. The proper time of the b-hadron decay is measured by reconstructing the production and decay vertices using a silicon microvertex detector. The measured \\Bd\\ meson oscillation frequency corresponds to a mass difference \\Dmd\\ between the two \\Bd\\ mass eigenstates of \\begin{displaymath} \\Dmd = \\left( 0.496 ^{+ 0.055}_{- 0.051}\\ \\mathrm{(stat)} \\pm{ 0.043}\\ \\mathrm{(syst)} \\right)\\ \\mathrm{ps}^{-1}. \\end{displaymath}

  6. Saudi production capacity climbing to 10 million b/d

    International Nuclear Information System (INIS)

    Saudi Arabia this year is completing its expansion of production capacity and developing recent discoveries to enhance export flexibility. The 3 million b/d capacity expansion to 10 million b/d, announced in 1989, is on target for completion by year end 1994. Most of the effort involves restoration of mothballed production equipment and installation of several gas-oil separation plants (GOSPs) in existing fields. But Saudi Arabian Oil Co. (Saudi Aramco) also this year will start up production of extra-light oil from a new field in the central part of the kingdom. Start-up of Hawtah area production demonstrates success of an oil search Aramco began after receiving exclusive exploration rights to nearly all of Saudi Arabia's prospective area in 1986. From new fields and traditional producing areas, therefore, Saudi Arabia has the potential to expand production capacity beyond 10 million b/d. The paper describes the development of the extra capacity

  7. La base de datos BD.EURS (NACE Rev.1)


    Escriba, Javier; Murgui , M.ª José


    El objetivo de este documento es el de presentar la base de datos de regiones europeas desagregadas sectorialmente BD.EURS. Esta base es el resultado de analizar la calidad y la congruencia de las diferentes fuentes estadísticas disponibles sobre las variables macroeconómicas básicas —VAB en nominales y reales, empleo, formación bruta de capital fijo y stock de capital— para los países y a nivel NUTS-2. En esta primera versión de la BD.EURS nos hemos limitado a 121 regiones de nueve países eu...

  8. Relevance of baryon-antibaryon decays of Bd0, anti Bd0 in tests of CP violation

    International Nuclear Information System (INIS)

    The decays of the type Bd0, anti Bd0→panti p, Λanti Λ, ΛC+anti ΛC+, into a spin 1/2 baryon and its antiparticle proceed in both the S-wave (parity conversing) and the P-wave (parity violating), and the final state is not an eigenstate of CP. Generalizing the type of tests of CP violation first proposed by Sanda et al., the CP violating asymmetries are proportional to ΓS-ΓP. We compute the parity conserving and the parity violating amplitudes within a pole model. The ratio ΓS/ΓP is of O(1) for panti p, but we find the selection rule ΓS=0 for Λanti Λ, and ΓP≤ΓS for ΛC+anti ΛC+. For the modes panti p and Λanti Λ, where the detection efficiency is large, we estimate the number of Bd0, anti Bd0 pairs needed to observe the CP asymmetries at the 3σ level to be of the order 1010. (orig.)

  9. Dicty_cDB: FC-BD18 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-BD18 (Link to dictyBase) - - - Contig-U15092-1 FC-BD18Z (Link to Origina ... ssgelsevcyhtkphvvklpsit*kfskvsqphtiksrellshllsvlsn*tpp ... vntpsylvypkksvgntelllpn*kskenkdlqlitvkll*skptelkp* ...

  10. Trajectory and physical properties of near-Earth asteroid 2009 BD

    NARCIS (Netherlands)

    Farnocchia, D.; Mommert, M.; Hora, J. L.; Chesley, S. R.; Vokrouhlický, D.; Trilling, D. E.; Mueller, M.; Harris, A. W.; Smith, H. A.; Fazio, G. G.; Knežević, Zoran; Lemaitre, Anne


    We analyze the trajectory of near-Earth asteroid 2009~BD, which is a candidate target of the NASA Asteroid Redirect Mission. The small size of 2009 BD and its Earth-like orbit pose challenges to understanding the dynamical properties of 2009 BD. In particular, nongravitational perturbations, such as

  11. Bd +60 73 = Igr J00370+6122 (United States)

    Negueruela, Ignacio; Reig, Pablo


    A classification spectrum of BD +60 73, reported to be the optical counterpart to IGR J00370+6122 (ATel #281), was taken on the night of 2003 July 7th with the 2.5-m Issac Newton telescope at La Palma. The derived spectral type is BN0.5II-III, where the composite luminosity class indicates an intermediate luminosity. The Nitrogen enhancement is moderately high, with numerous NII lines being rather stronger than corresponds to the spectral type.

  12. The Far-Ultraviolet Spectrum of BD+60 2522 (United States)

    Moore, B. D.; Dufour, R. J.; Aufdenberg, J. P.; Sankrit, R.


    We present observations of the OIIIef star BD+60o 2522 obtained with the Far Ultraviolet Spectroscopic Telescope (FUSE). The star is responsible for powering the H ii region S162, and its wind has swept up some of the material within it into a spheroidal shell. We construct a detailed model for the star and its wind based on this spectrum and others in the literature. In particular, we focus on the P Cygni profile of the C iii 1175 Å. Previous studies of BD+60o 2522 assign it a stellar type of O6.5 giant. Models of photoionized structures in the H ii region, however, suggest the shape for the UV continuum more appropriate to an O9 giant. Based on these, there is also a discrepancy in the shape of the interstellar curve towards the star. We discuss our model of BD+60o 2522 in the context of these discrepancies. This research was supported in part by NASA grant NAG5-13720 to Rice University.

  13. Soft lepton tagging for Bd mixing at CDF

    International Nuclear Information System (INIS)

    The authors present a study of heavy flavor tagging using soft lepton identification. They optimize their soft lepton identification method for use in a time-dependent Bd mixing measurement. In events triggered by a high Pt lepton from one B hadron, they search for a soft lepton from the semileptonic decay of the other B hadron. The charge of each lepton tags the flavor of its parent B hadron at the time of that parent's decay. The authors present the resulting efficiency and dilution for their optimized method

  14. Screen-printed electrode based electrochemical detector coupled with ionic liquid dispersive liquid-liquid microextraction and microvolume back-extraction for determination of mercury in water samples. (United States)

    Fernández, Elena; Vidal, Lorena; Martín-Yerga, Daniel; Blanco, María del Carmen; Canals, Antonio; Costa-García, Agustín


    A novel approach is presented, whereby gold nanostructured screen-printed carbon electrodes (SPCnAuEs) are combined with in-situ ionic liquid formation dispersive liquid-liquid microextraction (in-situ IL-DLLME) and microvolume back-extraction for the determination of mercury in water samples. In-situ IL-DLLME is based on a simple metathesis reaction between a water-miscible IL and a salt to form a water-immiscible IL into sample solution. Mercury complex with ammonium pyrrolidinedithiocarbamate is extracted from sample solution into the water-immiscible IL formed in-situ. Then, an ultrasound-assisted procedure is employed to back-extract the mercury into 10 µL of a 4 M HCl aqueous solution, which is finally analyzed using SPCnAuEs. Sample preparation methodology was optimized using a multivariate optimization strategy. Under optimized conditions, a linear range between 0.5 and 10 µg L(-1) was obtained with a correlation coefficient of 0.997 for six calibration points. The limit of detection obtained was 0.2 µg L(-1), which is lower than the threshold value established by the Environmental Protection Agency and European Union (i.e., 2 µg L(-1) and 1 µg L(-1), respectively). The repeatability of the proposed method was evaluated at two different spiking levels (3 and 10 µg L(-1)) and a coefficient of variation of 13% was obtained in both cases. The performance of the proposed methodology was evaluated in real-world water samples including tap water, bottled water, river water and industrial wastewater. Relative recoveries between 95% and 108% were obtained. PMID:25640123

  15. An investigation of Bd0 and Bs0 oscillation (United States)

    Buskulic, D.; de Bonis, I.; Decamp, D.; Ghez, P.; Goy, C.; Lees, J.-P.; Minard, M.-N.; Odier, P.; Pietrzyk, B.; Ariztizabal, F.; Comas, P.; Crespo, J. M.; Efthymiopoulos, I.; Fernandez, E.; Fernandez-Bosman, M.; Gaitan, V.; Garrido, Ll.; Martinez, M.; Mattison, T.; Orteu, S.; Pacheco, A.; Padilla, C.; Pascual, A.; Creanza, D.; de Palma, M.; Farilla, A.; Iaselli, G.; Maggi, G.; Marinelli, N.; Natali, S.; Nuzzo, S.; Ranieri, A.; Raso, G.; Romano, F.; Ruggieri, F.; Selvaggi, G.; Silvestris, L.; Tempesta, P.; Zito, G.; Chai, Y.; Hu, H.; Huang, D.; Huang, X.; Lin, J.; Wang, T.; Xie, Y.; Xu, D.; Xu, R.; Zhang, J.; Zhang, L.; Zhao, W.; Bonvicini, G.; Boudreau, J.; Casper, D.; Drevermann, H.; Forty, R. W.; Ganis, G.; Gay, C.; Girone, M.; Hagelberg, R.; Harvey, J.; Hilgart, J.; Jacobsen, R.; Jost, B.; Knobloch, J.; Lehraus, I.; Maggi, M.; Markou, C.; Mato, P.; Meinhard, H.; Minten, A.; Miquel, R.; Moser, H.-G.; Palazzi, P.; Pater, J. R.; Perlas, J. A.; Perrodo, P.; Pusztaszeri, J.-F.; Ranjard, F.; Rolandi, L.; Rothberg, J.; Ruan, T.; Saich, M.; Schlatter, D.; Schmelling, M.; Sefkow, F.; Tejessy, W.; Tomalin, I. R.; Veenhof, R.; Wachsmuth, H.; Wasserbaech, S.; Wiedenmann, W.; Wildish, T.; Witzeling, W.; Wotschack, J.; Ajaltouni, Z.; Bardadin-Otwinowska, M.; Barres, A.; Boyer, C.; Falvard, A.; Gay, P.; Guicheney, C.; Henrard, P.; Jousset, J.; Michael, B.; Montret, J.-C.; Pallin, D.; Perret, P.; Podlyski, F.; Proriol, J.; Saadi, F.; Fearnley, T.; Hansen, J. B.; Hansen, J. D.; Hansen, J. R.; Hansen, P. H.; Johnson, S. D.; Møllerud, R.; Nilsson, B. S.; Kyriakis, A.; Simopoulou, E.; Siotis, I.; Vayaki, A.; Zachariadou, K.; Badier, J.; Blondel, A.; Bonneaud, G.; Brient, J. C.; Bourdon, P.; Fouque, G.; Passalacqua, L.; Rougé, A.; Rumpf, M.; Tanaka, R.; Verderi, M.; Videau, H.; Candlin, D. J.; Parsons, M. I.; Veitch, E.; Focardi, E.; Moneta, L.; Parrini, G.; Corden, M.; Delfino, M.; Georgipoulos, C.; Jaffe, D. E.; Levinthal, D.; Antonelli, A.; Bencivenni, G.; Bologna, G.; Bossi, F.; Campana, P.; Capon, G.; Cerutti, F.; Chiarella, V.; Felici, G.; Laurelli, P.; Mannocchi, G.; Murtas, F.; Murtas, G. P.; Pepe-Altarelli, M.; Salomone, S.; Colrain, P.; Ten Have, I.; Knowles, I. G.; Lynch, J. G.; Maitland, W.; Morton, W. T.; Raine, C.; Reeves, P.; Scarr, J. M.; Smith, K.; Smith, M. G.; Thompson, A. S.; Thorn, S.; Turnbull, R. M.; Brandl, B.; Braun, O.; Geweniger, C.; Hanke, P.; Hepp, V.; Kluge, E. E.; Maumary, Y.; Putzer, A.; Rensch, B.; Stahl, A.; Tittel, K.; Wunsch, M.; Beuselinck, R.; Binnie, D. M.; Cameron, W.; Cattaneo, M.; Colling, D. J.; Dornan, P. J.; Hassard, J. F.; Lieske, N. M.; Moutoussi, A.; Nash, J.; Patton, S.; Payne, D. G.; Phillips, M. J.; San Martin, G.; Sedgbeer, J. K.; Wright, A. G.; Girtler, P.; Kuhn, D.; Rudolph, G.; Vogl, R.; Bowdery, C. K.; Brodbeck, T. J.; Finch, A. J.; Foster, F.; Hughes, G.; Jackson, D.; Keemer, N. R.; Nuttall, M.; Patel, A.; Sloan, T.; Snow, S. W.; Whelan, E. P.; Galla, A.; Greene, A. M.; Kleinknecht, K.; Raab, J.; Renk, B.; Sander, H.-G.; Schmidt, H.; Walther, S. M.; Wanke, R.; Wolf, B.; Bencheikh, A. M.; Benchouk, C.; Bonissent, A.; Calvet, D.; Carr, J.; Coyle, P.; Diaconu, C.; Drinkard, J.; Etienne, F.; Nicod, D.; Payre, P.; Roos, L.; Rousseau, D.; Schwemling, P.; Talby, M.; Adlung, S.; Assmann, R.; Bauer, C.; Blum, W.; Brown, D.; Cattaneo, P.; Dehning, B.; Dietl, H.; Dydak, F.; Frank, M.; Halley, A. W.; Jakobs, K.; Lauber, J.; Lütjens, G.; Lutz, G.; Männer, W.; Richter, R.; Schröder, J.; Schwarz, A. S.; Settles, R.; Seywerd, H.; Stierlin, U.; Stiegle, U.; St. Denis, R.; Wolf, G.; Alemany, R.; Boucrot, J.; Callot, O.; Cordier, A.; Davier, M.; Duflot, L.; Grivaz, J.-F.; Heusse, Ph.; Janot, P.; Kim, D. W.; Le Diberder, F.; Lefrançois, J.; Lutz, A.-M.; Musolino, G.; Schune, M.-H.; Veillet, J.-J.; Videau, I.; Abbaneo, D.; Bagliesi, G.; Batignani, G.; Bottigli, U.; Bozzi, C.; Calderini, G.; Carpinelli, M.; Ciocci, M. A.; Ciulli, V.; Dell'Orso, R.; Ferrante, I.; Fidecaro, F.; Foà, L.; Forti, F.; Giassi, A.; Giorgi, M. A.; Gregorio, A.; Ligabue, F.; Lusiani, A.; Mannelli, E. B.; Marrocchesi, P. S.; Messineo, A.; Palla, F.; Rizzo, G.; Sanguinetti, G.; Spagnolo, P.; Steinberger, J.; Tenchini, R.; Tonelli, G.; Triggiani, G.; Valassi, A.; Vannini, C.; Venturi, A.; Verdini, P. G.; Walsh, J.; Betteridge, A. P.; Gao, Y.; Green, M. G.; Johnson, D. L.; March, P. V.; Medcalf, T.; Mir, Ll. M.; Quazi, I. S.; Strong, J. A.; Bertin, V.; Botterill, D. R.; Clifft, R. W.; Edgecock, T. R.; Haywood, S.; Edward, M.; Norton, P. R.; Thompson, J. C.; Bloch-Devaux, B.; Colas, P.; Duarte, H.; Emery, S.; Kozanecki, W.; Lançon, E.; Lemaire, M. C.; Locci, E.; Marx, B.; Perez, P.; Rander, J.; Renardy, J.-F.; Rosowsky, A.; Roussarie, A.; Schuller, J.-P.; Schwindling, J.; Si Mohand, D.; Vallage, B.; Johnson, R. P.; Litke, A. M.; Taylor, G.; Wear, J.; Babbage, W.; Booth, C. N.; Buttar, C.; Cartwright, S.; Combley, F.; Dawson, I.; Thompson, L. F.; Barberio, E.; Böhrer, A.; Brandt, S.; Cowan, G.; Grupen, C.; Lutters, G.; Rivera, F.; Schäfer, U.; Smolik, L.; Bosisio, L.; Della Marina, R.; Giannini, G.; Gobbo, B.; Pitis, L.; Ragusa, F.; Bellantoni, L.; Chen, W.; Chen, W.; Conway, J. S.; Feng, Z.; Ferguson, D. P. S.; Gao, Y. S.; Grahl, J.; Harton, J. L.; Hayes, O. J.; Nachtman, J. M.; Pan, Y. B.; Saadi, Y.; Schmitt, M.; Scott, I.; Sharma, V.; Shi, Z. H.; Turk, J. D.; Walsh, A. M.; Weber, F. V.; Sau Lan Wu; Wu, X.; Zheng, M.; Zobernig, G.; Aleph Collaboration


    B 0overlineB0 oscillation is studied using almost a million hadronic Z decays collected by the ALEPH experiment at LEP. Events are selected with two leptons present, on opposite sides of the event and with high transverse momentum. The leptons are expected to be dominantly from b decays; a topological vertexing technique is applied to measure the decay length of the b hadrons, and their momentum is determined using an energy-flow method. The fraction of events in which the leptons have the same charge is studied as a function of the measured decay time, and clear evidence is seen for the time-dependent nature of B d0overlineBd0 mixing. The frequency measured for the oscillation corresponds to a mass difference for the Bd0 mass eigenstates Δmd = (3.3 -0.4+0.5 ± 0.7) × 10 -4 eV/ c2. Allowing a second frequency component for the Bs0 a high value for Δms is favoured, leading to the limit Δms > 12 × 10 -4 eV/ c2 (95% CL), from which ( Δm/ Γ) s > 2.0 is derived.

  16. Role of Cytochrome bd Oxidase from Corynebacterium glutamicum in Growth and Lysine Production▿


    Kabus, Armin; Niebisch, Axel; Bott, Michael


    Corynebacterium glutamicum possesses two terminal oxidases, cytochrome aa3 and cytochrome bd. Cytochrome aa3 forms a supercomplex with the cytochrome bc1 complex, which contains an unusual diheme cytochrome c1. Both the bc1-aa3 supercomplex and cytochrome bd transfer reducing equivalents from menaquinol to oxygen; however, they differ in their proton translocation efficiency by a factor of three. Here, we analyzed the role of cytochrome bd for growth and lysine production. When cultivated in ...

  17. Complete Genome Sequence of the Probiotic Strain Lactobacillus casei BD-II ▿


    Ai, Lianzhong; Chen, Chen; Zhou, Fangfang; Wang, Lei; Zhang, Hao; Chen, Wei(Department of Physics, State Key Laboratory of Nuclear Physics and Technology, Peking University, Beijing, 100871, China); Guo, Benheng


    Lactobacillus casei BD-II, a patented probiotic strain (U.S. patent 7,270,994 B2), was isolated from homemade koumiss in China and has been implemented in the industrial production as starter cultures. Here we report the complete genome sequence of BD-II, which shows high similarity with the well-studied probiotic BL23.

  18. Nuclear hBD-1 accumulation in malignant salivary gland tumours.

    NARCIS (Netherlands)

    Wenghoefer, M.H.; Pantelis, A.; Dommisch, H.; Gotz, W.; Reich, R.; Berge, S.; Martini, M.; Allam, J.P.; Jepsen, S.; Merkelbach-Bruse, S.; Fischer, H.P.; Novak, N.; Winter, J.


    BACKGROUND: Whereas the antimicrobial peptides hBD-2 and -3 are related to inflammation, the constitutively expressed hBD-1 might function as 8p tumour suppressor gene and thus play a key role in control of transcription and induction of apoptosis in malignant epithelial tumours. Therefore this stud

  19. Dicty_cDB: FC-BD02 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available P27685 ) RecName: Full=40S ribosomal protein S2; AltName: Full=R... 379 e-104 AY961548_1( AY961548 |pid:none) Lysiphlebus testacei...FC-BD02Z (Link to Original site) Representative DNA sequence >FC-BD02 (FC-BD02Q) /CSM/FC/FC-BD/ c576. 109 3e-28 6 AU013664 |AU013664.1 Schizosaccharomyces pombe cDNA, clone spc08473. 105 4e-27 3 BW0490... 2003. 7.12 Homology vs Protein Score E Sequences producing significant alignments: (bits) Value (...nk to dictyBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U15674-1 Original site URL http:/

  20. Increased expression and levels of human β defensins (hBD2 and hBD4 in adults with dental caries

    Directory of Open Access Journals (Sweden)

    Girolamo Jose Barrera


    Full Text Available Introduction: Defensins are small anti-microbial peptides produced by epithelial cells. These peptides have a broad range of actions against microorganisms, including Gram-positive and Gram-negative bacteria.Human defensins are classifi ed into two subfamilies, the α-, and β- defensins, which differ in their distribution of disulphide bonds between the six conserved cysteine residues. Defensins are found in salivaand others compartments of the body. Human β defensins 2 (hBD2, beta defensins 4 (hBD4 and alpha defensins 4 (hNP4 in saliva may contributes to vulnerability or resistance to caries. This study aimed to determine a possible correlation between caries and levels of defensins measuring the expression in gingival tissue and concentrations in saliva samples.Methods: Oral examinations were performed on 100 adults of both genders (18-30 years old, and unstimulated whole saliva was collected for immunoassays of the three peptides and for the salivary pH, buffercapacity, protein, and peroxidase activity. mRNA levels of defensins in gingival sample were assessed by semi-quantitative RT-PCR technique.Results: The median salivary levels of hBD2 and hBD4 were 1.88 μg/ml and 0.86 μg/ml respectively for the caries-free group (n=44 and 7.26 μ/ml (hBD2 and 4.25 μg/ml (hBD4 for all subjects with evidenceof caries (n=56. There was no difference in the levels of hNP4, salivary pH, and proteins between groups, however the peroxidase activity and buffer capacity (interval 6.0-5.0 were reduced in caries group. Transcriptional levels of hBD2 and hBD4 did correlate with caries experience, the mRNA expression of hBD2 and hBD4 were signifi cantly higher in patients with caries than in patients with no-caries (p Conclusion: We conclude that high salivary levels and expression of beta defensins, low peroxidase activity and buffer capacity may represent a biological response of oral tissue to caries. Our observation couldlead to new ways to prevent caries

  1. Characterization of Phosphate Transporters BdPT4 and BdPT8 in Mycorrhizal and Non-Mychorrhizal Brachypodium distachyon

    DEFF Research Database (Denmark)

    Clausen, Signe Sandbech

    BdPT proteins were expressed in cells where direct PTs are believed to perform their function, as well as in the vascular tissue. In NM plants, BdPT4 was localized to the plasma membrane whereas BdPT8 accumulated in the endoplasmic reticulum (ER) in the secretory pathway. A similar expression pattern......Phosphorus (P) is an essential plant nutrient in agricultural production but the P rock reserves used for production of fertilizers are currently being depleted. One approach to reduce the demand on P fertilizers is to optimize the phosphate (Pi) uptake and utilization efficiency of crop plants to...... support maximal growth at a low nutrient supply. Roots of most plant species are colonized by arbuscular mycorrhiza (AM) fungi, which increase the uptake of nutrients, in particular P. In grasses, however, AM colonization may result in growth depressions, which have conventionally been ascribed to fungal...

  2. Search for variability in the hot hydrogen-deficient star BD + 10/sup 0/2179

    Energy Technology Data Exchange (ETDEWEB)

    Hill, P.W.; Lynas-Gray, A.E.; Kilkenny, D.


    The discovery of pulsation in the hot, extremely hydrogen-deficient star BD + 13/sup 0/ 3224 has prompted a search for this phenomenon in similar stars. In this paper, spectroscopic and photometric observations of BD + 10/sup 0/ 2179 made during 1979-82 are presented. No significant variations are found and a previously reported period in the range 0.162-0.164 day is not seen in any of the data sequences.

  3. A search for variability in the hot hydrogen-deficient star BD + 1002179

    International Nuclear Information System (INIS)

    The discovery of pulsation in the hot, extremely hydrogen-deficient star BD + 130 3224 has prompted a search for this phenomenon in similar stars. In this paper, spectroscopic and photometric observations of BD + 100 2179 made during 1979-82 are presented. No significant variations are found and a previously reported period in the range 0.162-0.164 day is not seen in any of the data sequences. (author)

  4. Effect of flavor-changing neutral currents in the leptonic asymmetry in Bd decays (United States)

    Branco, G. C.; Parada, P. A.; Morozumi, T.; Rebelo, M. N.


    We evaluate the charge asymmetry in equal sign dileptons arising from the decay of a Bd0-Bd0 pair, in the presence of Z-mediated flavor-changing neutral currents. We compare our predictions with those of the standard model and the superweak model. Work supported by the Deprtment of Energy, contract DEAC03-76SF00515 and by a fellowship from OTAN (NATO).

  5. A Mycobacterium tuberculosis Cytochrome bd Oxidase Mutant Is Hypersensitive to Bedaquiline


    Berney, Michael; Hartman, Travis E.; William R Jacobs


    ABSTRACT The new medicinal compound bedaquiline (BDQ) kills Mycobacterium tuberculosis by inhibiting F1Fo-ATP synthase. BDQ is bacteriostatic for 4 to 7 days and kills relatively slowly compared to other frontline tuberculosis (TB) drugs. Here we show that killing with BDQ can be improved significantly by inhibiting cytochrome bd oxidase, a non-proton-pumping terminal oxidase. BDQ was instantly bactericidal against a cytochrome bd oxidase null mutant of M. tuberculosis, and the rate of killin...

  6. Evaluation of the BD Max Enteric Parasite Panel for Clinical Diagnostics. (United States)

    Mölling, Paula; Nilsson, Peter; Ennefors, Theresa; Ögren, Jessica; Florén, Kerstin; Thulin Hedberg, Sara; Sundqvist, Martin


    We compared the performance of the BD Max enteric parasite panel to routine microscopy and an in-house PCR for the detection of Giardia intestinalis, Entamoeba histolytica, and Cryptosporidium spp. The enteric parasite panel showed good specificity for all targets and good sensitivity for E. histolytica and Cryptosporidium spp. Sensitivity for G. intestinalis with the BD Max enteric parasite panel was equivalent to that with microscopy. PMID:26582832

  7. Reconstitution of emulsifying activity of Acinetobacter calcoaceticus BD4 emulsan by using pure polysaccharide and protein.


    N. Kaplan; Zosim, Z; Rosenberg, E


    Acinetobacter calcoaceticus BD4 and BD413 produce extracellular emulsifying agents when grown on 2% ethanol medium. For emulsifying activity, both polysaccharide and protein fractions were required, as demonstrated by selective digestion of the polysaccharide with a specific bacteriophage-borne polysaccharide depolymerase, deproteinization of the extracellular emulsifying complex with hot phenol, and reconstitution of emulsifier activity with pure polysaccharide and a polysaccharide-free prot...

  8. Nuclear hBD-1 accumulation in malignant salivary gland tumours

    International Nuclear Information System (INIS)

    Whereas the antimicrobial peptides hBD-2 and -3 are related to inflammation, the constitutively expressed hBD-1 might function as 8p tumour suppressor gene and thus play a key role in control of transcription and induction of apoptosis in malignant epithelial tumours. Therefore this study was conducted to characterise proteins involved in cell cycle control and host defence in different benign and malignant salivary gland tumours in comparison with healthy salivary gland tissue. 21 paraffin-embedded tissue samples of benign (n = 7), and malignant (n = 7) salivary gland tumours as well as healthy (n = 7) salivary glands were examined immunohistochemically for the expression of p53, bcl-2, and hBD-1, -2, -3. HBD-1 was distributed in the cytoplasm of healthy salivary glands and benign salivary gland tumours but seems to migrate into the nucleus of malignant salivary gland tumours. Pleomorphic adenomas showed cytoplasmic as well as weak nuclear hBD-1 staining. HBD-1, 2 and 3 are traceable in healthy salivary gland tissue as well as in benign and malignant salivary gland tumours. As hBD-1 is shifted from the cytoplasm to the nucleus in malignant salivary gland tumours, we hypothesize that it might play a role in the oncogenesis of these tumours. In pleomorphic adenomas hBD-1 might be connected to their biologic behaviour of recurrence and malignant transformation

  9. 78 FR 65231 - Special Conditions: Bombardier Inc., Models BD-500-1A10 and BD-500-1A11 series airplanes... (United States)


    ... be found in the Federal Register published on April 11, 2000 (65 FR 19477-19478), as well as at http... fire ignition/ flame propagation of thermal/acoustic insulation materials based on real-world fire... BD- 500-1A11 series airplanes; Fuselage In-Flight Fire Safety and Flammability Resistance...

  10. Clinical management and burden of bipolar disorder: a multinational longitudinal study (WAVE-bd Study

    Directory of Open Access Journals (Sweden)

    Moreno-Manzanaro Miriam


    Full Text Available Abstract Background Studies in bipolar disorder (BD to date are limited in their ability to provide a whole-disease perspective - their scope has generally been confined to a single disease phase and/or a specific treatment. Moreover, most clinical trials have focused on the manic phase of disease, and not on depression, which is associated with the greatest disease burden. There are few longitudinal studies covering both types of patients with BD (I and II and the whole course of the disease, regardless of patients' symptomatology. Therefore, the Wide AmbispectiVE study of the clinical management and burden of Bipolar Disorder (WAVE-bd (NCT01062607 aims to provide reliable information on the management of patients with BD in daily clinical practice. It also seeks to determine factors influencing clinical outcomes and resource use in relation to the management of BD. Methods WAVE-bd is a multinational, multicentre, non-interventional, longitudinal study. Approximately 3000 patients diagnosed with BD type I or II with at least one mood event in the preceding 12 months were recruited at centres in Austria, Belgium, Brazil, France, Germany, Portugal, Romania, Turkey, Ukraine and Venezuela. Site selection methodology aimed to provide a balanced cross-section of patients cared for by different types of providers of medical aid (e.g. academic hospitals, private practices in each country. Target recruitment percentages were derived either from scientific publications or from expert panels in each participating country. The minimum follow-up period will be 12 months, with a maximum of 27 months, taking into account the retrospective and the prospective parts of the study. Data on demographics, diagnosis, medical history, clinical management, clinical and functional outcomes (CGI-BP and FAST scales, adherence to treatment (DAI-10 scale and Medication Possession Ratio, quality of life (EQ-5D scale, healthcare resources, and caregiver burden (BAS scale

  11. High Milk-Clotting Activity Expressed by the Newly Isolated Paenibacillus spp. Strain BD3526

    Directory of Open Access Journals (Sweden)

    Feng Hang


    Full Text Available Paenibacillus spp. BD3526, a bacterium exhibiting a protein hydrolysis circle surrounded with an obvious precipitation zone on skim milk agar, was isolated from raw yak (Bos grunniens milk collected in Tibet, China. Phylogenetic analysis based on 16S rRNA and whole genome sequence comparison indicated the isolate belong to the genus Paenibacillus. The strain BD3526 demonstrated strong ability to produce protease with milk clotting activity (MCA in wheat bran broth. The protease with MCA was predominantly accumulated during the late-exponential phase of growth. The proteolytic activity (PA of the BD3526 protease was 1.33-fold higher than that of the commercial R. miehei coagulant. A maximum MCA (6470 ± 281 SU mL−1 of the strain BD3526 was reached under optimal cultivation conditions. The protease with MCA was precipitated from the cultivated supernatant of wheat bran broth with ammonium sulfate and purified by anion-exchange chromatography. The molecular weight of the protease with MCA was determined as 35 kDa by sodium dodecyl sulfate-polyacrylamide gels electrophoresis (SDS-PAGE and gelatin zymography. The cleavage site of the BD3526 protease with MCA in κ-casein was located at the Met106–Ala107 bond, as determined by mass spectrometry analysis.

  12. Redox control of fast ligand dissociation from Escherichia coli cytochrome bd

    International Nuclear Information System (INIS)

    Bacterial bd-type quinol oxidases, such as cytochrome bd from Escherichia coli, contain three hemes, but no copper. In contrast to heme-copper oxidases and similarly to globins, single electron-reduced cytochrome bd forms stable complexes with O2, NO and CO at ferrous heme d. Kinetics of ligand dissociation from heme d 2+ in the single electron- and fully-reduced cytochrome bd from E. coli has been investigated by rapid mixing spectrophotometry at 20 oC. Data show that (i) O2 dissociates at 78 s-1 (ii) NO and CO dissociation is fast as compared to heme-copper oxidases and (iii) dissociation in the single electron-reduced state is hindered as compared to the fully-reduced enzyme. Presumably, rapid ligand dissociation requires reduced heme b 595. As NO, an inhibitor of respiratory oxidases, is involved in the immune response against microbial infection, the rapid dissociation of NO from cytochrome bd may have important bearings on the patho-physiology of enterobacteria

  13. Assembly of a chimeric respiratory chain from bovine heart submitochondrial particles and cytochrome bd terminal oxidase of Escherichia coli


    Gavrikova, Eleonora V.; Grivennikova, Vera G.; Borisov, Vitaliy B.; Cecchini, Gary; Vinogradov, Andrei D.


    Cytochrome bd is a terminal quinol oxidase in Escherichia coli. Mitochondrial respiration is inhibited at cytochrome bc1 (complex III) by myxothiazol. Mixing purified cytochrome bd oxidase with myxothiazol-inhibited bovine heart submitochondrial particles (SMP) restores up to 50% of the original rotenone-sensitive NADH oxidase and succinate oxidase activities in the absence of exogenous ubiquinone analogues. Complex III bypassed respiration and is saturated at amounts of added cytochrome bd s...

  14. Isolation and identification of berberine and berberrubine metabolites by berberine-utilizing bacterium Rhodococcus sp. strain BD7100. (United States)

    Ishikawa, Kazuki; Takeda, Hisashi; Wakana, Daigo; Sato, Fumihiko; Hosoe, Tomoo


    Based on the finding of a novel berberine (BBR)-utilizing bacterium, Rhodococcus sp. strain BD7100, we investigated the degradation of BBR and its analog berberrubine (BRU). Resting cells of BD7100 demethylenated BBR and BRU, yielding benzeneacetic acid analogs. Isolation of benzeneacetic acid analogs suggested that BD7100 degraded the isoquinoline ring of the protoberberine skeleton. This work represents the first report of cleavage of protoberberine skeleton by a microorganism. PMID:26882131

  15. Managing the computational chemistry big data problem: the ioChem-BD platform. (United States)

    Álvarez-Moreno, M; de Graaf, C; López, N; Maseras, F; Poblet, J M; Bo, C


    We present the ioChem-BD platform ( ) as a multiheaded tool aimed to manage large volumes of quantum chemistry results from a diverse group of already common simulation packages. The platform has an extensible structure. The key modules managing the main tasks are to (i) upload of output files from common computational chemistry packages, (ii) extract meaningful data from the results, and (iii) generate output summaries in user-friendly formats. A heavy use of the Chemical Mark-up Language (CML) is made in the intermediate files used by ioChem-BD. From them and using XSL techniques, we manipulate and transform such chemical data sets to fulfill researchers' needs in the form of HTML5 reports, supporting information, and other research media. PMID:25469626

  16. Precision Measurement of B(D+ -> mu+ nu) and the Pseudoscalar Decay Constant fD+

    CERN Document Server

    Eisenstein, B I; Mehrabyan, S; Lowrey, N; Selen, M; White, E J; Wiss, J; Mitchell, R E; Shepherd, M R; Besson, D; Pedlar, T K; Cronin-Hennessy, D; Gao, K Y; Hietala, J; Kubota, Y; Klein, T; Lang, B W; Poling, R; Scott, A W; Zweber, P; Dobbs, S; Metreveli, Z; Seth, K K; Tomaradze, A G; Libby, J; Martin, L; Powell, A; Wilkinson, G; Ecklund, K M; Love, W; Savinov, V; Méndez, H; Ge, J Y; Miller, D H; Shipsey, I P J; Xin, B; Adams, G S; Anderson, M; Cummings, J P; Danko, I; Hu, D; Moziak, B; Napolitano, J; He, Q; Insler, J; Muramatsu, H; Park, C S; Thorndike, E H; Yang, F; Artuso, M; Blusk, S; Khalil, S; Li, J; Menaa, N; Mountain, R; Nisar, S; Randrianarivony, K; Sultana, N; Skwarnicki, T; Stone, S; Wang, J C; Zhang, L M; Bonvicini, G; Cinabro, D; Dubrovin, M; Lincoln, A; Naik, P; Rademacker, J; Asner, D M; Edwards, K W; Reed, J; Briere, R A; Ferguson, T; Tatishvili, G; Vogel, H; Watkins, M E; Rosner, J L; Alexander, J P; Cassel, D G; Duboscq, J E; Ehrlich, R; Fields, L; Galik, R S; Gibbons, L; Gray, R; Gray, S W; Hartill, D L; Heltsley, B K; Hertz, D; Hunt, J M; Kandaswamy, J; Kreinick, D L; Kuznetsov, V E; Ledoux, J; Mahlke-Krüger, H; Mohapatra, D; Onyisi, P U E; Patterson, J R; Peterson, D; Riley, D; Ryd, A; Sadoff, A J; Shi, X; Stroiney, S; Sun, W M; Wilksen, T; Athar, S B; Patel, R; Yelton, J; Rubin, P


    We measure the branching ratio of the purely leptonic decay of the D+ meson with unprecedented precision as B(D+ -> mu+ nu) = (3.82 +/- 0.32 +/- 0.09)x10^(-4), using 818/pb of data taken on the psi(3770) resonance with the CLEO-c detector at the CESR collider. We use this determination to derive a value for the pseudoscalar decay constant fD+, combining with measurements of the D+ lifetime and assuming |Vcd| = |Vus|. We find fD+ = (205.8 +/- 8.5 +/- 2.5) MeV. The decay rate asymmetry [B(D+ -> mu+ nu)-B(D- -> mu- nu)]/[B(D+ -> mu+ nu)+B(D- -> mu- nu)] = 0.08 +/- 0.08, consistent with no CP violation. We also set 90% confidence level upper limits on B(D+ -> tau+ nu) e+ nu) < 8.8x10^(-6).

  17. Preliminary measurement of time-dependent Bd0-Bd0 mixing using topology and charge selected semi-leptonic B decays

    International Nuclear Information System (INIS)

    The time dependence of Bd0-Bd0 mixing has been measured using a sample of 150,000 hadronic Z0 decays collected by the SLD experiment at the SLC between 1993 and 1995. The analysis identifies the semileptonic decays of B mesons with high (p, pt) leptons and reconstructs the B meson decay length and charge by vertexing the lepton with a partially reconstructed D meson. Vertex charge is used to enrich the selection of neutral over charged B mesons. This method results in a sample of 581 neutral decays with high charge purity. The B candidate is tagged at production with a combined tag that exploits the large polarized b forward-backward asymmetry in conjunction with the opposite hemisphere b jet charge. The final state is tagged by the sign of the high (p, pt) lepton. From their preliminary analysis the authors find a mass difference between the two Bd0 mass eigenstates of, Δmd = 0.452 ± 0.074(stat) ± 0.049(syst) ps-1

  18. Dicty_cDB: FC-BD22 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available . - 3' end seq. ID - 3' end seq. - Length of 3' end seq. - Connected seq. ID - Connected seq. - Length of connect...lilalvlglev*liwvlipvqnsqsl vlprhymkrlnnsllmyqllf*ailkqismkqfqwlki*livilpkllvnsvkki*rkll vvi...09387_68( AP009387 |pid:none) Burkholderia multivorans ATCC 176... 132 1e-30 CP000480_1581( CP000480 |pid:none) Mycobacterium sm...FC (Link to library) FC-BD22 (Link to dictyBase) - G01751 DDB0238029 Contig-U15177-... ID FC-BD22 (Link to dictyBase) Atlas ID - NBRP ID G01751 dictyBase ID DDB0238029 Link to Contig Contig-U151

  19. Dicty_cDB: FC-BD20 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available seq. - Length of 3' end seq. - Connected seq. ID - Connected seq. - Length of connected seq. - Full length S...alvlglev*liwvlipvqnsqsl vlprhymkrlnnsllmyqllf*ailkqismkqfqwlki*livilpkllvnsvkki*rkll vvihkkllmf*liihtnqiyllifslvqliis...orans ATCC 176... 132 1e-30 CP000480_1581( CP000480 |pid:none) Mycobacterium smegmatis ...FC (Link to library) FC-BD20 (Link to dictyBase) - - - Contig-U15177-1 FC-BD20E (Li...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U15177-1 Original site URL http://dict

  20. Folding Behaviour for Proteins BBL and E3BD with Gō-like Models

    Institute of Scientific and Technical Information of China (English)

    ZUO Guang-Hong; ZHANG Jian; WANG Jun; WANG Wei


    @@ Folding behaviour of protein BBL and its homologue domain E3BD are studied by using an off-lattice Gō-like model. It is found that the folding behaviours of these two proteins are different. Protein BBL folds in a downhill manner, which is consistent with experiments. In contrast, protein E3BD folds cooperatively and has a bimodal distribution of the Q values (the similarity to the native state). By analysing the native structures of the two proteins, it is found that the difference in folding behaviours can be attributed to the different structural features described by the number of nonlocal contacts per residue.

  1. Clinical management and burden of bipolar disorder: a multinational longitudinal study (WAVE-bd Study)


    Moreno-Manzanaro Miriam; Langosch Jens M; Figueira Maria; Blasco-Colmenares Elena; Vieta Eduard; Medina Esteban


    Abstract Background Studies in bipolar disorder (BD) to date are limited in their ability to provide a whole-disease perspective - their scope has generally been confined to a single disease phase and/or a specific treatment. Moreover, most clinical trials have focused on the manic phase of disease, and not on depression, which is associated with the greatest disease burden. There are few longitudinal studies covering both types of patients with BD (I and II) and the whole course of the disea...

  2. Clinical Evaluation of the BD FACSPresto™ Near-Patient CD4 Counter in Kenya (United States)

    Angira, Francis; Akoth, Benta; Omolo, Paul; Opollo, Valarie; Bornheimer, Scott; Judge, Kevin; Tilahun, Henok; Lu, Beverly; Omana-Zapata, Imelda; Zeh, Clement


    Background The BD FACSPresto™ Near-Patient CD4 Counter was developed to expand HIV/AIDS management in resource-limited settings. It measures absolute CD4 counts (AbsCD4), percent CD4 (%CD4), and hemoglobin (Hb) from a single drop of capillary or venous blood in approximately 23 minutes, with throughput of 10 samples per hour. We assessed the performance of the BD FACSPresto system, evaluating accuracy, stability, linearity, precision, and reference intervals using capillary and venous blood at KEMRI/CDC HIV-research laboratory, Kisumu, Kenya, and precision and linearity at BD Biosciences, California, USA. Methods For accuracy, venous samples were tested using the BD FACSCalibur™ instrument with BD Tritest™ CD3/CD4/CD45 reagent, BD Trucount™ tubes, and BD Multiset™ software for AbsCD4 and %CD4, and the Sysmex™ KX-21N for Hb. Stability studies evaluated duration of staining (18–120-minute incubation), and effects of venous blood storage <6–24 hours post-draw. A normal cohort was tested for reference intervals. Precision covered multiple days, operators, and instruments. Linearity required mixing two pools of samples, to obtain evenly spaced concentrations for AbsCD4, total lymphocytes, and Hb. Results AbsCD4 and %CD4 venous/capillary (N = 189/ N = 162) accuracy results gave Deming regression slopes within 0.97–1.03 and R2 ≥0.96. For Hb, Deming regression results were R2 ≥0.94 and slope ≥0.94 for both venous and capillary samples. Stability varied within 10% 2 hours after staining and for venous blood stored less than 24 hours. Reference intervals results showed that gender—but not age—differences were statistically significant (p<0.05). Precision results had <3.5% coefficient of variation for AbsCD4, %CD4, and Hb, except for low AbsCD4 samples (<6.8%). Linearity was 42–4,897 cells/μL for AbsCD4, 182–11,704 cells/μL for total lymphocytes, and 2–24 g/dL for Hb. Conclusions The BD FACSPresto system provides accurate, precise clinical

  3. The Unusual Resistance of Avian Defensin AvBD7 to Proteolytic Enzymes Preserves Its Antibacterial Activity. (United States)

    Bailleul, Geoffrey; Kravtzoff, Amanda; Joulin-Giet, Alix; Lecaille, Fabien; Labas, Valérie; Meudal, Hervé; Loth, Karine; Teixeira-Gomes, Ana-Paula; Gilbert, Florence B; Coquet, Laurent; Jouenne, Thierry; Brömme, Dieter; Schouler, Catherine; Landon, Céline; Lalmanach, Gilles; Lalmanach, Anne-Christine


    Defensins are frontline peptides of mucosal immunity in the animal kingdom, including birds. Their resistance to proteolysis and their ensuing ability to maintain antimicrobial potential remains questionable and was therefore investigated. We have shown by bottom-up mass spectrometry analysis of protein extracts that both avian beta-defensins AvBD2 and AvBD7 were ubiquitously distributed along the chicken gut. Cathepsin B was found by immunoblotting in jejunum, ileum, caecum, and caecal tonsils, while cathepsins K, L, and S were merely identified in caecal tonsils. Hydrolysis product of AvBD2 and AvBD7 incubated with a panel of proteases was analysed by RP-HPLC, mass spectrometry and antimicrobial assays. AvBD2 and AvBD7 were resistant to serine proteases and to cathepsins D and H. Conversely cysteine cathepsins B, K, L, and S degraded AvBD2 and abolished its antibacterial activity. Only cathepsin K cleaved AvBD7 and released Ile4-AvBD7, a N-terminal truncated natural peptidoform of AvBD7 that displayed antibacterial activity. Besides the 3-stranded antiparallel beta-sheet typical of beta-defensins, structural analysis of AvBD7 by two-dimensional NMR spectroscopy highlighted the restricted accessibility of the C-terminus embedded by the N-terminal region and gave a formal evidence of a salt bridge (Asp9-Arg12) that could account for proteolysis resistance. The differential susceptibility of avian defensins to proteolysis opens intriguing questions about a distinctive role in the mucosal immunity against pathogen invasion. PMID:27561012

  4. Molecular characterization and functional analysis of BdFoxO gene in the oriental fruit fly, Bactrocera dorsalis (Diptera: Tephritidae). (United States)

    Wu, Yi-Bei; Yang, Wen-Jia; Xie, Yi-Fei; Xu, Kang-Kang; Tian, Yi; Yuan, Guo-Rui; Wang, Jin-Jun


    The forkhead box O transcription factor (FoxO) is an important downstream transcription factor in the well-conserved insulin signaling pathway, which regulates the body size and development of insects. In this study, the FoxO gene (BdFoxO) was identified from the oriental fruit fly, Bactrocera dorsalis (Hendel). The open reading frame of BdFoxO (2732bp) encoded a 910 amino acid protein, and the sequence was well conserved with other insect species. The BdFoxO was highly expressed in larvae and pupae among different development stages, and the highest tissue-specific expression level was found in the fat bodies compared to the testis, ovary, head, thorax, midgut, and Malpighian tubules of adults. Interestingly, we found BdFoxO expression was also up-regulated by starvation, but down-regulated when re-fed. Moreover, the injection of BdFoxO double-stranded RNAs into third-instar larvae significantly reduced BdFoxO transcript levels, which in turn down-regulated the expression of other four genes in the insulin signaling pathway. The silencing of BdFoxO resulted in delayed pupation, and the insect body weight increased significantly compared with that of the control. These results suggested that BdFoxO plays an important role in body size and development in B. dorsalis. PMID:26701614

  5. Angular distributions of four neutron groups from the 10B(d, n)11C reaction

    NARCIS (Netherlands)

    Paris, C.H.; Endt, P.M.


    Measurements are described of the angular distributions of the four most energetic neutron groups from the 10B(d, n)11C reaction at a deuteron energy of 0.6 MeV. Neutrons were detected by their recoil protons in nuclear emulsions. The angular distributions have been analyzed in terms of a stripping

  6. GREAT [CII] and CO observations of the BD+40{\\deg}4124 region

    CERN Document Server

    Sandell, Göran; Requena-Torres, Miguel Angel; Heyminck, Stefan; Güsten, Rolf; Stutzki, Jürgen; Simon, Robert; Graf, Urs U; 10.1051/0004-6361/201218920


    The BD+40\\degree4124 region was observed with high angular and spectral resolution with the German heterodyne instrument GREAT in CO J = 13 \\rightarrow 12 and [CII] on SOFIA. These observations show that the [CII] emission is very strong in the reflection nebula surrounding the young Herbig Ae/Be star BD+40\\degree4124. A strip map over the nebula shows that the [CII] emission approximately coincides with the optical nebulosity. The strongest [CII] emission is centered on the B2 star and a deep spectrum shows that it has faint wings, which suggests that the ionized gas is expanding. We also see faint CO J = 13 \\rightarrow 12 at the position of BD+40\\degree4124, which suggests that the star may still be surrounded by an accretion disk.We also detected [CII] emission and strong CO J = 13 \\rightarrow 12 toward V1318 Cyg. Here the [CII] emission is fainter than in BD+40\\degree4124 and appears to come from the outflow, since it shows red and blue wings with very little emission at the systemic velocity, where the C...

  7. RVX-297- a novel BD2 selective inhibitor of BET bromodomains. (United States)

    Kharenko, Olesya A; Gesner, Emily M; Patel, Reena G; Norek, Karen; White, Andre; Fontano, Eric; Suto, Robert K; Young, Peter R; McLure, Kevin G; Hansen, Henrik C


    Bromodomains are epigenetic readers that specifically bind to the acetyl lysine residues of histones and transcription factors. Small molecule BET bromodomain inhibitors can disrupt this interaction which leads to potential modulation of several disease states. Here we describe the binding properties of a novel BET inhibitor RVX-297 that is structurally related to the clinical compound RVX-208, currently undergoing phase III clinical trials for the treatment of cardiovascular diseases, but is distinctly different in its biological and pharmacokinetic profiles. We report that RVX-297 preferentially binds to the BD2 domains of the BET bromodomain and Extra Terminal (BET) family of protein. We demonstrate the differential binding modes of RVX-297 in BD1 and BD2 domains of BRD4 and BRD2 using X-ray crystallography, and describe the structural differences driving the BD2 selective binding of RVX-297. The isothermal titration calorimetry (ITC) data illustrate the related differential thermodynamics of binding of RVX-297 to single as well as dual BET bromodomains. PMID:27282480

  8. The dual oxidase gene BdDuox regulates the intestinal bacterial community homeostasis of Bactrocera dorsalis. (United States)

    Yao, Zhichao; Wang, Ailin; Li, Yushan; Cai, Zhaohui; Lemaitre, Bruno; Zhang, Hongyu


    The guts of metazoans are in permanent contact with the microbial realm that includes beneficial symbionts, nonsymbionts, food-borne microbes and life-threatening pathogens. However, little is known concerning how host immunity affects gut bacterial community. Here, we analyze the role of a dual oxidase gene (BdDuox) in regulating the intestinal bacterial community homeostasis of the oriental fruit fly Bactrocera dorsalis. The results showed that knockdown of BdDuox led to an increased bacterial load, and to a decrease in the relative abundance of Enterobacteriaceae and Leuconostocaceae bacterial symbionts in the gut. The resulting dysbiosis, in turn, stimulates an immune response by activating BdDuox and promoting reactive oxygen species (ROS) production that regulates the composition and structure of the gut bacterial community to normal status by repressing the overgrowth of minor pathobionts. Our results suggest that BdDuox plays a pivotal role in regulating the homeostasis of the gut bacterial community in B. dorsalis. PMID:26565723

  9. 13 CFR 124.3 - What definitions are important in the 8(a) BD program? (United States)


    ... anniversary of program certification and runs for one 12-month period. Same or similar line of business means... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false What definitions are important in the 8(a) BD program? 124.3 Section 124.3 Business Credit and Assistance SMALL BUSINESS...

  10. Constraining the physical properties of near-Earth object 2009 BD

    International Nuclear Information System (INIS)

    We report on Spitzer Space Telescope Infrared Array Camera observations of near-Earth object 2009 BD that were carried out in support of the NASA Asteroid Robotic Retrieval Mission concept. We did not detect 2009 BD in 25 hr of integration at 4.5 μm. Based on an upper-limit flux density determination from our data, we present a probabilistic derivation of the physical properties of this object. The analysis is based on the combination of a thermophysical model with an orbital model accounting for the non-gravitational forces acting upon the body. We find two physically possible solutions. The first solution shows 2009 BD as a 2.9 ± 0.3 m diameter rocky body (ρ = 2.9 ± 0.5 g cm–3) with an extremely high albedo of 0.85−0.10+0.20 that is covered with regolith-like material, causing it to exhibit a low thermal inertia (Γ=30−10+20 SI units). The second solution suggests 2009 BD to be a 4 ± 1 m diameter asteroid with pV=0.45−0.15+0.35 that consists of a collection of individual bare rock slabs (Γ = 2000 ± 1000 SI units, ρ=1.7−0.4+0.7 g cm–3). We are unable to rule out either solution based on physical reasoning. 2009 BD is the smallest asteroid for which physical properties have been constrained, in this case using an indirect method and based on a detection limit, providing unique information on the physical properties of objects in the size range smaller than 10 m.

  11. Constraining the Physical Properties of Near-Earth Object 2009 BD (United States)

    Mommert, M.; Hora, J. L.; Farnocchia, D.; Chesley, S. R.; Vokrouhlický, D.; Trilling, D. E.; Mueller, M.; Harris, A. W.; Smith, H. A.; Fazio, G. G.


    We report on Spitzer Space Telescope Infrared Array Camera observations of near-Earth object 2009 BD that were carried out in support of the NASA Asteroid Robotic Retrieval Mission concept. We did not detect 2009 BD in 25 hr of integration at 4.5 μm. Based on an upper-limit flux density determination from our data, we present a probabilistic derivation of the physical properties of this object. The analysis is based on the combination of a thermophysical model with an orbital model accounting for the non-gravitational forces acting upon the body. We find two physically possible solutions. The first solution shows 2009 BD as a 2.9 ± 0.3 m diameter rocky body (ρ = 2.9 ± 0.5 g cm-3) with an extremely high albedo of 0.85_{-0.10}^{+0.20} that is covered with regolith-like material, causing it to exhibit a low thermal inertia (\\Gamma =30_{-10}^{+20} SI units). The second solution suggests 2009 BD to be a 4 ± 1 m diameter asteroid with p_V=0.45_{-0.15}^{+0.35} that consists of a collection of individual bare rock slabs (Γ = 2000 ± 1000 SI units, \\rho = 1.7_{-0.4}^{+0.7} g cm-3). We are unable to rule out either solution based on physical reasoning. 2009 BD is the smallest asteroid for which physical properties have been constrained, in this case using an indirect method and based on a detection limit, providing unique information on the physical properties of objects in the size range smaller than 10 m.

  12. Measurement of the Bd0 bar Bd0 oscillation frequency using dimuon data in p bar p collisions at √ (s) =1.8 TeV

    International Nuclear Information System (INIS)

    We present a measurement of the mass difference Δmd of the two Bd0 mass eigenstates. We use a flavor tagging method based on the lepton charge, in a sample of events with two muons at low transverse momentum. The sample corresponds to an integrated luminosity of 90 pb-1 collected by the Collider Detector at Fermilab. The result obtained is Δmd=0.503±0.064(stat)±0.071(syst) ps-1. copyright 1999 The American Physical Society

  13. Characterization of Young measures generated by sequences in BV an BD

    CERN Document Server

    Rindler, Filip


    First, this work presents a new and improved proof strategy for the recent characterization theorem for generalized Young measures generated by sequences in BV by Kristensen and the author [Arch. Ration. Mech. Anal. 197 (2010), 539-598]. The present proof is based on a localization technique together with a rigidity argument and avoids employing a relaxation theorem. Then, based on this new technique, we prove an analogous characterization result for Young measures generated by sequences in the space BD of functions of bounded deformation. This theorem places these Young measures in duality to symmetric-quasiconvex functions. For this purpose we need to strengthen a recent rigidity result for BD-functions and their associated tangent Young measures, which is also interesting in its own right. Finally, as an application of the characterization theorem, we show how for Young measures with an "atomic" part one can find a generating sequence respecting this structure.

  14. Criss-cross mapping BD+30 3639: a new kinematic analysis technique

    CERN Document Server

    Steffen, Wolfgang; Koning, Nico


    We present a new analysis of kinematic data of the young planetary nebula BD+30 3639. The data include spectroscopic long-slit and internal proper motion measurements. In this paper we also introduce a new type of mapping of kinematic proper motion data that we name "criss-cross" mapping. It basically consists of finding all points where extended proper motion vectors cross converge. From the crossing points a map is generated which helps to interpret the kinematic data. From the criss-cross mapping of BD+30 3639, we conclude that the kinematic center is approximately 0.5 arcsec offset to the South-East from the central star. The mapping does also show evidence for a non-homologous expansion of the nebula that is consistent with a disturbance aligned with the bipolar molecular bullets.


    International Nuclear Information System (INIS)

    We introduce a new method to analyze kinematic proper motion data. The method is called 'criss-cross' mapping. It emphasizes regions where proper motion vector extensions cross or converge. From a superposition of lines through the vectors a map is generated which helps to interpret the kinematic data. The new mapping technique is applied to the young planetary nebula BD+30 3639. The data are more than 200 internal proper motion measurements from Li et al. From the criss-cross mapping of BD+30 3639, we conclude that the kinematic center is approximately 0.5 arcsec off-set to the southeast from the central star. The mapping also shows evidence for a non-homologous expansion of the nebula that is consistent with a disturbance due to the bipolar molecular bullets.

  16. TRAC-BD1: transient reactor analysis code for boiling-water systems

    Energy Technology Data Exchange (ETDEWEB)

    Spore, J.W.; Weaver, W.L.; Shumway, R.W.; Giles, M.M.; Phillips, R.E.; Mohr, C.M.; Singer, G.L.; Aguilar, F.; Fischer, S.R.


    The Boiling Water Reactor (BWR) version of the Transient Reactor Analysis Code (TRAC) is being developed at the Idaho National Engineering Laboratory (INEL) to provide an advanced best-estimate predictive capability for the analysis of postulated accidents in BWRs. The TRAC-BD1 program provides the Loss of Coolant Accident (LOCA) analysis capability for BWRs and for many BWR related thermal hydraulic experimental facilities. This code features a three-dimensional treatment of the BWR pressure vessel; a detailed model of a BWR fuel bundle including multirod, multibundle, radiation heat transfer, leakage path modeling capability, flow-regime-dependent constitutive equation treatment, reflood tracking capability for both falling films and bottom flood quench fronts, and consistent treatment of the entire accident sequence. The BWR component models in TRAC-BD1 are described and comparisons with data presented. Application of the code to a BWR6 LOCA is also presented.

  17. A revised ephemeris for the pulsating hydrogen-deficient star BD + 130 3224 (V652 Her)

    International Nuclear Information System (INIS)

    Additional observations of maxima of the pulsating hydrogen-deficient star, BD + 130 3224 (V652 Her), give an improved ephemeris for the decreasing period of pulsation. A simple quadratic no longer appears sufficient and a cubic solution may be preferable, indicating that the pulsation decrease rate is slowing down as the star contracts. An alternative hypotheses, that the star is a binary is also discussed. (author)

  18. BD : un média méconnu des chercheurs en communication


    Dacheux, Eric


    La BD est « le lieu d'une mise en abyme du procès de la communication » (Fresnault-Desruelle, 1975, p.101). Pourtant, au cours du XX e siècle, les chercheurs en communication ne se sont guère intéressés au neuvième art. Pourquoi? Le but de ce texte et d'apporter une réponse à cette question.

  19. Application of recombinant Pediococcus acidilactici BD16 (fcs⁺/ech⁺) in malolactic fermentation. (United States)

    Kaur, Baljinder; Kumar, Balvir; Kaur, Gaganjot; Chakraborty, Debkumar; Kaur, Kiranjeet


    This study was conducted to enhance flavor characteristics of wine by malolactic fermentation using recombinant Pediococcus acidilactici BD16 (fcs (+)/ech (+)) encoding synthetic genes of feruloyl-CoA synthetase and enoyl-CoA hydratase. After malolactic fermentation, wine phenolics were characterized using LCMS-ESI technique and a significant improvement in the antioxidant activity and flavor characteristics of wine was observed due to increased concentration of cinnamic acid derivatives. This proof of concept study highlights the role of recombinant P. acidilactici BD16 (fcs (+)/ech (+)) in improving flavor as well as aroma of wine due to production of several phenolic derivatives during secondary fermentation. A novel metabolic pathway was predicted from mass spectral analysis data that indicates biotransformation of cinnamic acid and derivatives into apigenin, catechin, coniferyl aldehyde, cyanidin, hydroxybenzoic acids, laricitrin, luteolin, malvidin 3-glucoside, myricetin, naringenin, pelargonin, piceatannol, querecitin, and vanillin that not only increased the overall consumer appreciation but also improved nutritional and probably the therapeutic properties of wines. This is a first evidence-based study where role of recombinant P. acidilactici BD16 (fcs (+)/ech (+)) in the wine secondary fermentation has been elucidated. PMID:25650327

  20. The mysterious sdO X-ray binary BD+37 442

    CERN Document Server

    Heber, U; Irrgang, A; Schneider, D; Barbu-Barna, I; Mereghetti, S; La Palombara, N


    Pulsed X-ray emission in the luminous, helium-rich sdO BD+37 442 has recently been discovered (La Palombara et al., 2012). It was suggested that the sdO star has a neutron star or white dwarf companion with a spin period of 19.2 s. After HD 49798, which has a massive white dwarf companion spinning at 13.2 s in an 1.55 day orbit, this is only the second O-type subdwarf from which X-ray emission has been detected. We report preliminary results of our ongoing campaign to obtain time-resolved high-resolution spectroscopy using the CAFE instrument at Calar Alto observatory and SARG at the Telescopio Nationale Galileo. Atmospheric parameters were derived via a quantitative NLTE spectral analysis. The line fits hint at an unusually large projected rotation velocity. Therefore it seemed likely that BD+37 442 is a binary similar to HD 49798 and that the orbital period is also similar. The level of X-ray emission from BD+37 442 could be explained by accretion from the sdO wind by a neutron star orbiting at a period of ...

  1. Mixing and CP violation in the Bd and Bs systems at ATLAS

    CERN Document Server

    Barton, Adam Edward; The ATLAS collaboration


    This note includes a measurement of the $B^0_s$ decay parameters in the $ B_s \\rightarrow J/\\psi$ channel and a measurement of the $B_d$ meson using the statistics collected by the ATLAS experiment in Run I of the LHC. The first result presents the measurement of the $CP$-violating phase $\\phi_s$, the decay width $\\Gamma_s$ and the width difference between the mass eigenstates $\\Delta \\Gamma_s$. The second result presents the measurement of the width difference $\\Delta \\Gamma_d$, which is extracted from the measurement of the lifetime dependence of $B_d \\to J/\\psi K_S$ and $B_d \\to J/\\psi K^{*0}$ decays. The obtained results are $\\phi_s = −0.098 \\pm 0.084 (\\textrm{stat.}) \\pm 0.040 (\\textrm{syst.})$ rad. and $\\Delta \\Gamma_d / \\Gamma_d = (-0.06 \\pm 1.42)\\times 10^{-2}$.

  2. Spectroscopic studies of O-type binaries. I. BD+4004220: an enigma ripe for resolution

    International Nuclear Information System (INIS)

    A new orbit for BD+40degree4220(V729 Cygni, Cyg OB2 No 5) is calculated from coude spectra. While the mass ratio is unchanged from that of Wilson and Abt, the masses (M1 sin3 i=47 +- 7M/sub sun/, M2 sin3 i=11 +- 5 M/sub sun/) and the scale of the system (a1 sini=7.6 +- 0.7 x 106 km, a2 sin i=3.3 +- 0.2 x 107 km) are larger because the absorption lines of each star can be resolved. The system is composed of two OF supergiants with equally high luminosity, M/sub V/approx. =-7.1. The less massive stars, which is called the secondary, is very overluminous for its mass. It has by far the stronger emission lines of the two stars. Some emission also comes from material surrounding the system. The BD+40degree4220 system is compared with classical Wolf-Rayet (W-R) binaries, and it is found that the secondary has all of the physical properties of a W-R star in a binary system except for the spectrum. It is suggested that BD+40degree4220 is on the way to becoming a Wolf-Rayet binary system

  3. Identification and characterization of the RouenBd1987 Babesia divergens Rhopty-Associated Protein 1.

    Directory of Open Access Journals (Sweden)

    Marilis Rodriguez

    Full Text Available Human babesiosis is caused by one of several babesial species transmitted by ixodid ticks that have distinct geographical distributions based on the presence of competent animal hosts. The pathology of babesiosis, like malaria, is a consequence of the parasitaemia which develops through the cyclical replication of Babesia parasites in a patient's red blood cells, though symptoms typically are nonspecific. We have identified the gene encoding Rhoptry-Associated Protein -1 (RAP-1 from a human isolate of B. divergens, Rouen1987 and characterized its protein product at the molecular and cellular level. Consistent with other Babesia RAP-1 homologues, BdRAP-1 is expressed as a 46 kDa protein in the parasite rhoptries, suggesting a possible role in red cell invasion. Native BdRAP-1 binds to an unidentified red cell receptor(s that appears to be non-sialylated and non-proteinacious in nature, but we do not find significant reduction in growth with anti-rRAP1 antibodies in vitro, highlighting the possibility the B. divergens is able to use alternative pathways for invasion, or there is an alternative, complementary, role for BdRAP-1 during the invasion process. As it is the parasite's ability to recognize and then invade host cells which is central to clinical disease, characterising and understanding the role of Babesia-derived proteins involved in these steps are of great interest for the development of an effective prophylaxis.

  4. Measurement of the ratio B(D0->pi+pi-pi0)/B(D0->K-pi+pi0) and the time-integrated CP asymmetry in D0->pi+pi-pi0

    CERN Document Server

    Arinstein, K; Aihara, H; Aulchenko, V; Aushev, T; Aziz, T; Bahinipati, S; Bakich, A M; Balagura, V; Barberio, E; Bay, A; Bedny, I; Belous, K S; Bhardwaj, V; Bitenc, U; Blyth, S; Bondar, A; Bozek, A; Brako, M; Browder, T E; Chao, Y; Chen, A; Chen, W T; Cheon, B G; Chistov, cR; Cho, I S; Choi, Y; Cole, S; Dalseno, J; Danilov, M; Dash, M; Drutskoy, A; Eidelman, S; Epifanov, D; Gabyshev, N; Goldenzweig, P; Golob, B; Ha, H; Haba, J; Hara, K; Hayasaka, K; Hayashii, H; Hazumi, M; Hoshi, Y; Hou, W S; Iijima, T; Inami, K; Ishikawa, A; Ishino, H; Itoh, R; Iwasaki, M; Iwasaki, Y; Joshi, N J; Kah, D H; Kaji, H; Kang, J H; Katayama, N; Kawai, H; Kawasaki, T; Kichimi, H; Kim, S K; Kim, Y J; Kinoshita, K; Korpar, S; Kozakai, Y; Krian, P; Krokovny, P; Kumar, R; Kuo, C C; Kuroki, Y; Kuzmin, A; Kwon, Y J; Lange, J S; Lee, J S; Lee, M J; Lee, S E; Lesiak, T; Limosani, A; Lin, S W; Liu, C; Liu, Y; Liventsev, D; Mandl, F; McOnie, S; Mitaroff, W A; Miyabayashi, K; Miyake, H; Miyata, H; Miyazaki, Y; Mizuk, R; Moloney, G R; Mori, T; Nakano, E; Nakao, M; Nishida, S; Nitoh, O; Ogawa, S; Ohshima, T; Okuno, S; Ozaki, H; Pakhlov, P; Pakhlova, G; Park, C W; Park, H; Park, K S; Pestotnik, R; Piilonen, L E; Poluektov, A; Sahoo, H; Sakai, Y; Schneider, O; Schümann, J; Schwanda, C; Schwartz, A J; Senyo, K; Sevior, M E; Shapkin, M; Shebalin, V; Shibuya, H; Shiu, J G; Shwartz, B; Singh, J B; Sokolov, A; Somov, A; Stani, S; Stari, M; Sumiyoshi, T; Suzuki, S Y; Takasaki, F; Tanaka, M; Taylor, G N; Teramoto, Y; Tikhomirov, I; Uehara, S; Ueno, K; Uglov, T; Unno, Y; Uno, S; Usov, Yu; Varner, G; Vervink, K; Villa, S; Vinokurova, A; Wang, C H; Wang, M Z; Wang, P; Wang, X L; Watanabe, Y; Won, E; Yabsley, B D; Yamamoto, H; Yamashita, Y; Zhang, C C; Zhang, Z P; Zhilich, V; Zhulanov, V; Zupanc, A; Zyukova, O


    We report a high-statistics measurement of the relative branching fraction B(D0->pi+pi-pi0)/B(D0->K-pi+pi0) using a 532 fb^{-1} data sample collected with the Belle detector at the KEKB asymmetric-energy e+e- collider. The measured value of the relative branching fraction is B(D0->pi+pi-pi0)/B(D0->K-pi+pi0) = (10.12 +/- 0.04(stat) +/- 0.18(syst))x10^{-2} which has an accuracy comparable to the world average. We also present a measurement of the time-integrated CP asymmetry in D0->pi+pi-pi0 decay. The result, A_{CP} = (0.43 +/- 1.30)%, shows no significant CP violation.

  5. Automation of the BD GeneOhm Methicillin-Resistant Staphylococcus aureus Assay for High-Throughput Screening of Nasal Swab Specimens▿


    Wang, Xue-Ping; Ginocchio, Christine C.


    This study demonstrated that an automated version of the BD-GeneOhm methicillin-resistant Staphylococcus aureus (MRSA) assay (BD-MRSA), using achromopeptidase sample lysis and PCR setup performed on the Hamilton MICROLAB STARlet (Auto-MRSA), gave results comparable to those obtained with BD-MRSA. The positive- and negative-result concordance rates and overall concordance of BD-MRSA and Auto-MRSA were 98.2, 97.7, and 97.6%, respectively. Auto-MRSA required 60% less technical time than BD-MRSA,...

  6. Levan-Producing Leuconostoc citreum Strain BD1707 and Its Growth in Tomato Juice Supplemented with Sucrose. (United States)

    Han, Jin; Xu, Xiaofen; Gao, Caixia; Liu, Zhenmin; Wu, Zhengjun


    A levan-producing strain, BD1707, was isolated from Tibetan kefir and identified as Leuconostoc citreum. The effects of carbon sources on the growth of L. citreum BD1707 and levan production in tomato juice were measured. The changes in pH, viable cell count, sugar content, and levan yield in the cultured tomato juice supplemented with 15% (wt/vol) sucrose were also assayed. L. citreum BD1707 could synthesize more than 28 g/liter of levan in the tomato juice-sucrose medium when cultured at 30°C for 96 h. Based on the monosaccharide composition, molecular mass distribution, Fourier transform infrared (FTIR) spectra, and nuclear magnetic resonance (NMR) spectra, the levan synthesized by L. citreum BD1707 was composed of a linear backbone consisting of consecutive β-(2→6) linked d-fructofuranosyl units, with an estimated average molecular mass of 4.3 × 10(6) Da. PMID:26682858

  7. Structural and functional characterization of hBD-1(Ser35), a peptide deduced from a DEFB1 polymorphism. (United States)

    Circo, Raffaella; Skerlavaj, Barbara; Gennaro, Renato; Amoroso, Antonio; Zanetti, Margherita


    beta-Defensins are mammalian antimicrobial peptides that share a unique disulfide-bonding motif of six conserved cysteines. An intragenic polymorphism of the DEFB1 gene that changes a highly conserved Cys to Ser in the peptide coding region has recently been described. The deduced peptide cannot form three disulfide bonds, as one of the cysteines is unpaired. We have determined the cysteine connectivities of a corresponding synthetic hBD-1(Ser35) peptide, investigated the structure by circular dichroism spectroscopy, and assayed the in vitro antimicrobial activity. Despite a different arrangement of the disulfides, hBD-1(Ser35) proved as active as hBD-1 against the microorganisms tested. This activity likely depends on the ability of hBD-1(Ser35) to adopt an amphipathic conformation in hydrophobic environment, similar to the wild type peptide, as suggested by CD spectroscopy. PMID:12054642

  8. Chiral corrections and lattice QCD results for fBs/fBd and (Delta ms/Delta md)

    CERN Document Server

    Becirevic, D; Prelovsek, S; Zupan, J; Becirevic, Damir; Fajfer, Svjetlana; Prelovsek, Sasa; Zupan, Jure


    It has been argued recently that the inclusion of the chiral logarithms in extrapolation of the lattice data can shift the value of the hadronic parameter xi = (fBs sqrt(B_{Bs}))/(fBd sqrt(B_{Bd})), from 1.16(6) to 1.32(10) and even higher. If true, that would considerably change the theoretical estimate for the ratio of oscillation frequencies in the neutral Bs- and Bd-systems, and would affect the standard CKM unitarity triangle analysis. In this letter we show that (fBs/fBd) \\approx (fK/fpi), and thus the uncertainty due to the missing chiral logs is smaller than previously thought. By combining the NLO chiral expansion with the static heavy quark limit we obtain xi = 1.22(7).

  9. Impact of Introduction of the BD Kiestra InoqulA on Urine Culture Results in a Hospital Clinical Microbiology Laboratory


    Strauss, Sharon; Bourbeau, Paul P.


    This study compared results from plating urine specimens with the BD InoqulA instrument using a 10-μl inoculum with results from cultures plated manually with a 1-μl loop for comparable 2-month periods. The positivity rates, turnaround times for positive cultures, and BD Phoenix identification and antimicrobial susceptibility test results were comparable for both time periods. We experienced no problems with culture interpretation as the result of moving to the 10-μl inoculum.

  10. Detection of Trichomonas vaginalis DNA by use of self-obtained vaginal swabs with the BD ProbeTec Qx assay on the BD Viper system. (United States)

    Van Der Pol, Barbara; Williams, James A; Taylor, Stephanie N; Cammarata, Catherine L; Rivers, Charles A; Body, Barbara A; Nye, Melinda; Fuller, Deanna; Schwebke, Jane R; Barnes, Mathilda; Gaydos, Charlotte A


    Trichomonas vaginalis is the most prevalent nonviral sexually transmitted infection worldwide, and improved diagnostic methods are critical for controlling this pathogen. Diagnostic assays that can be used in conjunction with routine chlamydia/gonorrhea nucleic acid-based screening are likely to have the most impact on disease control. Here we describe the performance of the new BD T. vaginalis Qx (TVQ) amplified DNA assay, which can be performed on the automated BD Viper system. We focus on data from vaginal swab samples, since this is the specimen type routinely used for traditional trichomonas testing and the recommended specimen type for chlamydia/gonorrhea screening. Vaginal swabs were obtained from women attending sexually transmitted disease or family planning clinics at 7 sites. Patient-collected vaginal swabs were tested by the TVQ assay, and the Aptima T. vaginalis (ATV) assay was performed using clinician-collected vaginal swabs. Additional clinician-collected vaginal swabs were used for the wet mount and culture methods. Analyses included comparisons versus the patient infection status (PIS) defined by positive results with the wet mount method or culture, direct comparisons assessed with κ scores, and latent class analysis (LCA) as an unbiased estimator of test accuracy. Data from 838 women, 116 of whom were infected with T. vaginalis, were analyzed. The TVQ assay sensitivity and specificity estimates based on the PIS were 98.3% and 99.0%, respectively. The TVQ assay was similar to the ATV assay (κ=0.938) in direct analysis. LCA estimated the TVQ sensitivity and specificity as 98.3 and 99.6%, respectively. The TVQ assay performed well using self-collected vaginal swabs, the optimal sample type, as recommended by the CDC for chlamydia/gonorrhea screening among women. PMID:24391200

  11. Planetary Systems Around Spectroscopic Binary Stars: The Very Dusty, Old, Sun-like BD+20 307 (United States)

    Zuckerman, Ben M.; Fekel, F. C.; Williamson, M. H.; Henry, G. W.; Muno, M. P.; Melis, C.; Marois, C.


    Field star BD+20 307 is the dustiest known main sequence star, based on the fraction of its bolometric luminosity, 4%, emitted at infrared wavelengths (Song et al. 2005; Rhee et al. 2008). The temperature of the particles that carry this large IR luminosity is comparable to that of the Sun's zodiacal dust, and their existence is likely a consequence of a fairly recent collision of large objects such as planets or planetary embryos. BD+20 307 is now known to be a 3.4 day spectroscopic binary composed of two nearly equal solar-mass stars (Weinberger 2008; Zuckerman et al. 2008). Consideration of various age indicators implies that that star is likely to be at least one Gyr old, perhaps many Gyr old. Probably the dust around this close binary star has nothing to do with planet formation and everything to do with some major catastrophic event that recently took place near 1 AU in a mature planetary system. Destabilizing planetary orbits in an old system with a single star at its center appears to be possible, e.g., Mercury (Batygin & Laughlin 2008 and references therein). Destabilization may be easier to achieve in a close binary star system and easier yet in a triple star system. Tokovinin et al. (2006) conclude that, for a spectroscopic binary star with an orbital period of 3.4 days, the probability is 70% that a third star is present. Thus, we have searched for such a tertiary star in the BD+20 307 system using accurate radial velocities measured at Fairborn and Lick observatories and with adaptive optics imaging at Keck observatory. As of the writing of this abstract, no third star is detected. Limits on mass and semimajor axis of any tertiary star will be discussed. This research was supported by a grant from the Chandra X-ray Observatory.

  12. The Bifidobacterium dentium Bd1 genome sequence reflects its genetic adaptation to the human oral cavity.

    Directory of Open Access Journals (Sweden)

    Marco Ventura


    Full Text Available Bifidobacteria, one of the relatively dominant components of the human intestinal microbiota, are considered one of the key groups of beneficial intestinal bacteria (probiotic bacteria. However, in addition to health-promoting taxa, the genus Bifidobacterium also includes Bifidobacterium dentium, an opportunistic cariogenic pathogen. The genetic basis for the ability of B. dentium to survive in the oral cavity and contribute to caries development is not understood. The genome of B. dentium Bd1, a strain isolated from dental caries, was sequenced to completion to uncover a single circular 2,636,368 base pair chromosome with 2,143 predicted open reading frames. Annotation of the genome sequence revealed multiple ways in which B. dentium has adapted to the oral environment through specialized nutrient acquisition, defences against antimicrobials, and gene products that increase fitness and competitiveness within the oral niche. B. dentium Bd1 was shown to metabolize a wide variety of carbohydrates, consistent with genome-based predictions, while colonization and persistence factors implicated in tissue adhesion, acid tolerance, and the metabolism of human saliva-derived compounds were also identified. Global transcriptome analysis demonstrated that many of the genes encoding these predicted traits are highly expressed under relevant physiological conditions. This is the first report to identify, through various genomic approaches, specific genetic adaptations of a Bifidobacterium taxon, Bifidobacterium dentium Bd1, to a lifestyle as a cariogenic microorganism in the oral cavity. In silico analysis and comparative genomic hybridization experiments clearly reveal a high level of genome conservation among various B. dentium strains. The data indicate that the genome of this opportunistic cariogen has evolved through a very limited number of horizontal gene acquisition events, highlighting the narrow boundaries that separate commensals from

  13. Isolation of an aerobic sulfur oxidizer from the SUP05/Arctic96BD-19 clade


    Marshall, Katharine T.; Morris, Robert M.


    Bacteria from the uncultured SUP05/Arctic96BD-19 clade of gamma proteobacterial sulfur oxidizers (GSOs) have the genetic potential to oxidize reduced sulfur and fix carbon in the tissues of clams and mussels, in oxygen minimum zones and throughout the deep ocean (>200 m). Here, we report isolation of the first cultured representative from this GSO clade. Closely related cultures were obtained from surface waters in Puget Sound and from the deep chlorophyll maximum in the North Pacific gyre. P...

  14. Charmless Hadronic Two-body Decays of B_u and B_d Mesons


    Chen, Yaw-Hwang; Cheng, Hai-Yang; Tseng, B.; Yang, Kwei-Chou


    Two-body charmless nonleptonic decays of B_u and B_d mesons are studied within the framework of generalized factorization in which the effective Wilson coefficients $c^{eff}_i$ are renormalization-scale and -scheme independent while factorization is applied to the tree-level hadronic matrix elements. Contrary to previous studies, our $c_i^{eff}$ do not suffer from gauge and infrared problems. Nonfactorizable effects are parametrized in terms of N_c(LL) and N_c(LR), the effective numbers of co...

  15. On the period of the pulsating hydrogen-deficient star BD + 1303224

    International Nuclear Information System (INIS)

    Recent observations of maxima of the pulsating early-type hydrogen-deficient star BD + 1303224 indicate a decrease in period since the discovery observations. The data are best fitted by a decrease rate of 46 x 10-10 day cycle, a value which is comparable with the rate derived from a theoretical study of the fast evolutionary phase of a post-giant helium star. Four-colour data are averaged to give mean colours at 0.1 phase intervals around the pulsation cycle. (author)

  16. Period of the pulsating hydrogen-deficient star BD + 13/sup 0/3224

    Energy Technology Data Exchange (ETDEWEB)

    Kilkenny, D. (Council for Scientific and Industrial Research, Cape Town (South Africa). South African Astronomical Observatory); Lynas-Gray, A.E. (University Coll., London (UK); Saint Andrews Univ. (UK). Observatory)


    Recent observations of maxima of the pulsating early-type hydrogen-deficient star BD + 13/sup 0/3224 indicate a decrease in period since the discovery observations. The data are best fitted by a decrease rate of 46 x 10/sup -10/ day cycle, a value which is comparable with the rate derived from a theoretical study of the fast evolutionary phase of a post-giant helium star. Four-colour data are averaged to give mean colours at 0.1 phase intervals around the pulsation cycle.

  17. BD-22deg3467, a DAO-type Star Exciting the Nebula Abell 35 (United States)

    Ziegler, M.; Rauch, T.; Werner, K.; Koppen, J.; Kruk, J. W.


    Spectral analyses of hot, compact stars with non-local thermodynamical equilibrium (NLTE) model-atmosphere techniques allow the precise determination of photospheric parameters such as the effective temperature (T(sub eff)), the surface gravity (log g), and the chemical composition. The derived photospheric metal abundances are crucial constraints for stellar evolutionary theory. Aims. Previous spectral analyses of the exciting star of the nebula A35, BD-22deg3467, were based on He+C+N+O+Si+Fe models only. For our analysis, we use state-of-the-art fully metal-line blanketed NLTE model atmospheres that consider opacities of 23 elements from hydrogen to nickel. We aim to identify all observed lines in the ultraviolet (UV) spectrum of BD-22deg3467 and to determine the abundances of the respective species precisely. Methods. For the analysis of high-resolution and high signal-to-noise ratio (S/N) far-ultraviolet (FUSE) and UV (HST/STIS) observations, we combined stellar-atmosphere models and interstellar line-absorption models to fully reproduce the entire observed UV spectrum. Results. The best agreement with the UV observation of BD-22deg3467 is achieved at T(sub eff) = 80 +/- 10 kK and log g = 7.2 +/- 0.3. While T(sub eff) of previous analyses is verified, log g is significantly lower. We re-analyzed lines of silicon and iron (1/100 and about solar abundances, respectively) and for the first time in this star identified argon, chromium, manganese, cobalt, and nickel and determined abundances of 12, 70, 35, 150, and 5 times solar, respectively. Our results partially agree with predictions of diffusion models for DA-type white dwarfs. A combination of photospheric and interstellar line-absorption models reproduces more than 90% of the observed absorption features. The stellar mass is M approx. 0.48 Solar Mass. Conclusions. BD.22.3467 may not have been massive enough to ascend the asymptotic giant branch and may have evolved directly from the extended horizontal branch

  18. BD-22°3467, a DAO-type star exciting the nebula Abell 35 (United States)

    Ziegler, M.; Rauch, T.; Werner, K.; Köppen, J.; Kruk, J. W.


    Context. Spectral analyses of hot, compact stars with non-local thermodynamical equilibrium (NLTE) model-atmosphere techniques allow the precise determination of photospheric parameters such as the effective temperature (Teff), the surface gravity (log g), and the chemical composition. The derived photospheric metal abundances are crucial constraints for stellar evolutionary theory. Aims: Previous spectral analyses of the exciting star of the nebula A 35, BD-22°3467, were based on He+C+N+O+Si+Fe models only. For our analysis, we use state-of-the-art fully metal-line blanketed NLTE model atmospheres that consider opacities of 23 elements from hydrogen to nickel. We aim to identify all observed lines in the ultraviolet (UV) spectrum of BD-22°3467 and to determine the abundances of the respective species precisely. Methods: For the analysis of high-resolution and high signal-to-noise ratio (S/N) far-ultraviolet (FUSE) and UV (HST/STIS) observations, we combined stellar-atmosphere models and interstellar line-absorption models to fully reproduce the entire observed UV spectrum. Results: The best agreement with the UV observation of BD-22°3467 is achieved at Teff = 80 ± 10 kK and log g = 7.2 ± 0.3. While Teff of previous analyses is verified, log g is significantly lower. We re-analyzed lines of silicon and iron (1/100 and about solar abundances, respectively) and for the first time in this star identified argon, chromium, manganese, cobalt, and nickel and determined abundances of 12, 70, 35, 150, and 5 times solar, respectively. Our results partially agree with predictions of diffusion models for DA-type white dwarfs. A combination of photospheric and interstellar line-absorption models reproduces more than 90% of the observed absorption features. The stellar mass is M ≈ 0.48 M⊙. Conclusions.BD-22°3467 may not have been massive enough to ascend the asymptotic giant branch and may have evolved directly from the extended horizontal branch to the white dwarf

  19. Jofre de Foixa, “Subrafusa ab cabirol” (BdT 304.4

    Directory of Open Access Journals (Sweden)

    Wendy Pfeffer


    Full Text Available Jofre de Foixa’s verses “Subrafusa ab cabirol” (BdT 304.4 merit attention for the light the two ‘coblas’ shed on Jofre’s familiarity with his Occitan predecessors, for the information the text provides regarding food practices in his time, and for the use of a food term rare in the Iberian peninsula, “unyo”. The resources of culinary history, specifically fourteenth- and fifteenth-century Languedocian and Catalan cookbooks, allow us better to understand the meaning of Jofre’s lyric.

  20. Effect of hBD2 genetically modified dermal multipotent stem cells on repair of infected irradiated wounds

    International Nuclear Information System (INIS)

    Deficiencies in repair cells and infection are two of the main factors that can hinder the process of wound healing. In the present study, we investigated the ability of human beta-defensin-2 (hBD2) genetically modified dermal multipotent stem cells (dMSCs) to accelerate the healing irradiated wounds complicated by infections. An hBD2 adenovirus expression vector (Adv-hBD2) was firstly constructed and used to infect dMSCs. The antibacterial activity of the supernatant was determined by Kirby-Bauer method and macrodilution broth assay. Time to complete wound healing, residual percentage of wound area, and the number of bacteria under the scar were measured to assess the effects of Adv-hBD2-infected dMSC transplantation on the healing of irradiated wounds complicated by Pseudomonas aeruginosa infection. Results showed that the supernatant from Adv-hBD2-infected dMSCs had obvious antibacterial effects. Transplantation of Adv-hBD2-infected dMSCs killed bacteria in the wound. The complete wound healing time was 19.8±0.45 days, which was significantly shorter than in the control groups (P<0.05). From 14 days after transplantation, the residual wound area was smaller in the experimental group than in the control groups (P<0.05). In conculsion, we found that transplantation of hBD2 genetically modified dMSCs accelerated the healing of wounds complicated by P. aeruginosa infection in whole body irradiated rats. (author)

  1. Albertet, “Donna pros e richa” (BdT 16.11

    Directory of Open Access Journals (Sweden)

    Francesca Sanguineti


    Full Text Available This paper will provide a commentary and a new critical edition of “Donna pros e richa” by Albertet, a poem with an exceptional metrical structure, halfway between a ‘canso’ and an isostrophic ‘descort’. Its structure is identical to Raimbaut de Vaqueiras’ “Carros” (BdT 392.32: most likely Albertet’s poem is the original while “Truan, mala guerra” is a contrafactum, considering the fact that it is comparable to a sirventes. The lyric self urgently requests the love of a Genoese lady, complaining of her indifference and cursing her quite violently at the end of each stanza. The passionate tone that characterizes the poem becomes less so towards the end where God is finally called upon to protect the lady. What is clear here is, on the one hand, the poem’s conformity with the characteristics of the ‘mala canso’, and, on the other, its similarity with another poem by Raimbaut de Vaqueiras, the ‘contrasto’ with the Genoese lady (BdT 392.7. Thus Albertet’s poem is curious from different points of view: for its metrical form, uncommon in a ‘canso’; for its linguistic register which ressembles that of narrative genres such as the ‘fabliaux’; for its rhymes which offer a series of analogies and exchanges of rhyme-words with the two Raimbauts, the previously mentioned Raimbaut de Vaqueiras and Raimbaut d’Aurenga.

  2. EduBD: A Machine Understandable Approach to Integrate Information of Educational Institutions of Bangladesh

    Directory of Open Access Journals (Sweden)

    Shima Chakraborty


    Full Text Available Web contents related to educational institutions as well as their geographic data of a country is an emerging field of data sharing and consolidating with suitable data repositories to extract useful information to improve and maintain the area-based quality of education. The information of these institutions is available in the unstructured or semi-structured format from heterogeneous sources on the web that originate challenges to develop a smarter method in finding specific information using traditional search engines. The integration of these heterogeneous data along with geographic information is a formidable task to explore implicit knowledge of educational institutions that assist people to improve these systems and it is still getting researchers’ attention. In this regard, our research demonstrates the feasibility of semantic web technologies for converting and integrating these unstructured or semistructured information by introducing machine understandable description of resources and instances by consisting of their concepts and relations, called a repository name EduBD. This yields a magnificent knowledge graph with .75 million nodes, i.e. RDF triples to facilitate reasoning meaningful information by a graph based query language SPARQL. Furthermore, we utilized our knowledge-base EduBD with one more accessible spatial data source Geo-Bangladesh using Physical-Cyber-Social computing approach to examine spatial contents and social information of each institution and therefore achieved the semantic interoperability of our Linked Open Data (LOD application by eliminating natural language polisemy problems.

  3. BD-22 3467, a DAO-type star exciting the nebula Abell 35

    CERN Document Server

    Ziegler, M; Werner, K; Koeppen, J; Kruk, J W


    Spectral analyses of hot, compact stars with NLTE (non-local thermodynamical equilibrium) model-atmosphere techniques allow the precise determination of photospheric parameters. The derived photospheric metal abundances are crucial constraints for stellar evolutionary theory. Previous spectral analyses of the exciting star of the nebula A 35, BD-22 3467, were based on He+C+N+O+Si+Fe models only. For our analysis, we use state-of-the-art fully metal-line blanketed NLTE model atmospheres that consider opacities of 23 elements from hydrogen to nickel. For the analysis of high-resolution and high-S/N (signal-to-noise) FUV (far ultraviolet, FUSE) and UV (HST/STIS) observations, we combined stellar-atmosphere models and interstellar line-absorption models to fully reproduce the entire observed UV spectrum. The best agreement with the UV observation of BD-22 3467 is achieved at Teff = 80 +/- 10 kK and log g =7.2 +/- 0.3. While Teff of previous analyses is verified, log g is significantly lower. We re-analyzed lines ...

  4. Re (epsilon'/epsilon_K) vs. B_d -> phi K_S CP asymmetry

    CERN Document Server

    Ko, P; Park, J; Park, Jae-hyeon


    In a SUSY GUT seesaw scenario, the largeness of the atmospheric neutrino mixing can reflect itself into an enhanced flavor changing mixing of beauty and strange right-handed scalar quarks. If the CP violating phase in such down type squark RR insertion is the main source of CP asymmetry in B_d -> phi K_S and the gluino contributions to K0-K0 bar and B0-B0 bar mixing are negligible, there is a correlation between Re (epsilon'/epsilon_K) and B_d -> phi K_S CP asymmetry, in addition to that with the strange quark CEDM. The current data on Re (epsilon'/epsilon_K) = (16.7 +- 2.6) 10^-4 imply that S_{phi K} should be greater than \\sim 0.5 (0.25) for mu tan beta = 1 (5) TeV, assuming the RR dominance in b -> s transition and the minimal supergravity type boundary conditions for soft parameters.

  5. Detection of Phosphorus, Sulphur, and Zinc in the Carbon-Enhanced Metal-Poor Star BD+44 493

    CERN Document Server

    Roederer, Ian U; Beers, Timothy C


    The carbon-enhanced metal-poor star BD+44 493 ([Fe/H]=-3.9) has been proposed as a candidate second-generation star enriched by metals from a single Pop III star. We report the first detections of P and S and the second detection of Zn in any extremely metal-poor carbon-enhanced star, using new spectra of BD+44 493 collected by the Cosmic Origins Spectrograph on the Hubble Space Telescope. We derive [P/Fe]=-0.34 +/- 0.21, [S/Fe]=+0.07 +/- 0.41, and [Zn/Fe]=-0.10 +/- 0.24. We increase by ten-fold the number of Si I lines detected in BD+44 493, yielding [Si/Fe]=+0.15 +/- 0.22. The solar [S/Fe] and [Zn/Fe] ratios exclude the hypothesis that the abundance pattern in BD+44 493 results from depletion of refractory elements onto dust grains. Comparison with zero-metallicity supernova models suggests that the stellar progenitor that enriched BD+44 493 was massive and ejected much less than 0.07 Msun of Ni-56, characteristic of a faint supernova.

  6. Cytochrome bd-I in Escherichia coli is less sensitive than cytochromes bd-II or bo′' to inhibition by the carbon monoxide-releasing molecule, CORM-3☆☆☆ (United States)

    Jesse, Helen E.; Nye, Tacita L.; McLean, Samantha; Green, Jeffrey; Mann, Brian E.; Poole, Robert K.


    Background: CO-releasing molecules (CO-RMs) are potential therapeutic agents, able to deliver CO – a critical gasotransmitter – in biological environments. CO-RMs are also effective antimicrobial agents; although the mechanisms of action are poorly defined, haem-containing terminal oxidases are primary targets. Nevertheless, it is clear from several studies that the effects of CO-RMs on biological systems are frequently not adequately explained by the release of CO: CO-RMs are generally more potent inhibitors than is CO gas and other effects of the molecules are evident. Methods: Because sensitivity to CO-RMs cannot be predicted by sensitivity to CO gas, we assess the differential susceptibilities of strains, each expressing only one of the three terminal oxidases of E. coli — cytochrome bd-I, cytochrome bd-II and cytochrome bo′, to inhibition by CORM-3. We present the first sensitive measurement of the oxygen affinity of cytochrome bd-II (Km 0.24 μM) employing globin deoxygenation. Finally, we investigate the way(s) in which thiol compounds abolish the inhibitory effects of CORM-2 and CORM-3 on respiration, growth and viability, a phenomenon that is well documented, but poorly understood. Results: We show that a strain expressing cytochrome bd-I as the sole oxidase is least susceptible to inhibition by CORM-3 in its growth and respiration of both intact cells and membranes. Growth studies show that cytochrome bd-II has similar CORM-3 sensitivity to cytochrome bo′. Cytochromes bo′ and bd-II also have considerably lower affinities for oxygen than bd-I. We show that the ability of N-acetylcysteine to abrogate the toxic effects of CO-RMs is not attributable to its antioxidant effects, or prevention of CO targeting to the oxidases, but may be largely due to the inhibition of CO-RM uptake by bacterial cells. Conclusions: A strain expressing cytochrome bd-I as the sole terminal oxidase is least susceptible to inhibition by CORM-3. N-acetylcysteine is a

  7. Study of Charmless Bd,s0 → h+h'-π0 decays in LHCb

    International Nuclear Information System (INIS)

    This thesis work is about the identification of charmless three-body decays of neutral B mesons with a π0 in the final state (Bd,s0 → h+h'-π0) through the analysis of a 1.0 fb-1 data sample collected in 2011 by the LHCb experiment at the LHC. Those modes are sensitive to CKM parameters and allow to test Standard Model predictions related to CP violation. Some of them, such as Bs0 → K-π+π0 and Bs0 → K+K-π0, have not been observed previously. This is the first analysis with energetic π0 in LHCb. To evaluate the detector performance for π0, D*+ → D0 (→ K-π+π0)π+ decays have been selected. This provides a clean and high statistics sample of neutral pions used to study their energy calibration as well as the effectiveness of the π0/γ separation tool of the experiment. Radiative decays are indeed the most dangerous backgrounds for the study of Bd,s0 → h+h'-π0 modes. To select Bd,s0 → h+h'-π0 events, a dedicated trigger algorithm has been implemented. It complements the standard online selections and significantly improves the efficiency. Offline, obvious backgrounds, mainly from charm decays, are rejected applying simple criteria. The sample is then further purified using a multivariate classifier. At last, information from the ring imaging Cherenkov detectors allows to separate π+π-π0, K±π±π0 and K+K-π0 final states. A simultaneous fit of the reconstructed B mass spectra in the three sub-samples is used to extract the signal yields. It accounts for the different backgrounds remaining as well as for the signal cross-feeds from one sub-sample to the other. The B0 → π+π-π0, B0 → K+π-π0 and Bs0 → K+K-π0 contributions are clearly established. This is the first observation of the Bs0 → K+K-π0 decay mode. (author)

  8. Spectroscopic evidence for a heme-heme binuclear center in the cytochrome bd ubiquinol oxidase from Escherichia coli.


    Hill, J J; Alben, J O; Gennis, R B


    The cytochrome bd complex is a ubiquinol oxidase, which is part of the aerobic respiratory chain of Escherichia coli. This enzyme is structurally unrelated to the heme-Cu oxidases such as cytochrome c oxidase. While the cytochrome bd complex contains no copper, it does have three heme prosthetic groups: heme b558, heme b595, and heme d (a chlorin). Heme b558 appears to be involved in the oxidation of quinol, and heme d is known to be the site where oxygen binds and is reduced to water. The ro...

  9. Molecular line formation in the extremely metal-poor star BD+44 493

    CERN Document Server

    Aoki, Wako


    Molecular absorption lines of OH (99 lines) and CH (105 lines) are measured for the carbon-enhanced metal-poor star BD+44 493 with [Fe/H]=-3.8. The abundances of oxygen and carbon determined from individual lines based on an 1D-LTE analysis exhibit significant dependence on excitation potentials of the lines; d log e/d chi ~ -0.15 - -0.2 dex/eV, where e and chi are elemental abundances from individual spectral lines and their excitation potentials, respectively. The dependence is not explained by the uncertainties of stellar parameters, but suggests that the atmosphere of this object possesses a cool layer that is not reproduced by the 1D model atmosphere. This result agrees with the predictions by 3D model calculations. Although absorption lines of neutral iron exhibit similar trend, it is much weaker than found in molecular lines and that predicted by 3D LTE models.

  10. Charmless Hadronic Two-body Decays of $B_{u}$ and $B_{d}$ Mesons

    CERN Document Server

    Chen, Y H; Tseng, B; Yang, K C; Chen, Yaw-Hwang; Cheng, Hai-Yang; Yang, Kwei-Chou


    Two-body charmless nonleptonic decays of B_u and B_d mesons are studied within the framework of generalized factorization in which the effective Wilson coefficients $c^{eff}_i$ are renormalization-scale and -scheme independent while factorization is applied to the tree-level hadronic matrix elements. Contrary to previous studies, our $c_i^{eff}$ do not suffer from gauge and infrared problems. Nonfactorizable effects are parametrized in terms of N_c(LL) and N_c(LR), the effective numbers of colors arising from (V-A)(V-A) and (V-A)(V+A) four-quark operators, respectively. Tree and penguin transitions are classified into six different classes. The data of $B^-\\to\\rho^0\\pi^-$ and $B^-\\to\\phi K^-$ clearly indicate that $N_c(LR)\

  11. Brachypodium distachyon line Bd3-1 resistance is elicited by the barley stripe mosaic virus triple gene block 1 movement protein

    NARCIS (Netherlands)

    Lee, M.Y.; Yan, L.J.; Gorter, F.A.; Kim, B.Y.T.; Cui, Y.; Hu, Y.; Yuan, C.; Grindheim, J.; Ganesan, U.; Liu, Z.Y.; Han, C.G.; Yu, J.L.; Li, D.W.; Jackson, A.O.


    Barley stripe mosaic virus North Dakota 18 (ND18), Beijing (BJ), Xinjiang (Xi), Type (TY) and CV21 strains are unable to infect the Brachypodium distachyon Bd3-1 inbred line, which harbours a resistance gene designated Bsr1, but the Norwich (NW) strain is virulent on Bd3-1. Analysis of ND18 and NW g

  12. Working Effectively with Students with BD in a General Education Classroom: The Case for Universal Design for Learning (United States)

    Johnson-Harris, Kimberly M.; Mundschenk, Nancy A.


    To one degree or another, inclusion is the word of the day in public schools across the country, and as a result many general education teachers find themselves face-to-face in their classrooms with students who have been diagnosed with behavior disorders (BD). While the behavior of these students is frequently (and euphemistically) referred to as…

  13. Role of the superoxide anion in the oxidative activation of the new antitumor drug BD40: a radiolysis study

    International Nuclear Information System (INIS)

    BD40, a new antitumor drug derived from 9-azaellipticine, is thought to have an oxygen-dependent metabolism in vivo. The one-electron oxidation of this drug was effected by γ radiolysis using OH radical free radicals as oxidants and the reaction of O2anionradical with the BD40 oxidized transient(s). The absorption spectrum of the one-electron oxidized free radical was determined by pulse radiolysis using OH radical or N3radical as reactant. In the absence of O2 and O2anionradical, the initial yield of disappearance of the drug is equal to 2.5 x 10-7 molJ-1 independently of the initial concentration of the drug and of the dose rate. When BD40 is oxidized by OH anion radicals in the presence of O2 and O2anionradical, the yield is the same. This yield is halved if superoxide dismutase is present during irradiation. Superoxide anions do not react directly with the drug. Thus it is suggested that these radicals oxidize the BD40 free radical produced by oxidation with OH radical. Biological implications are discussed. (author)

  14. New Possibility of Solving the Problem of Lifetime Ratio $\\tau (\\Lambda_b) / \\tau (B_d)$

    CERN Document Server

    Ito, T; Matsui, Y; Ito, Toshiaki; Matsuda, Masahisa; Matsui, Yoshimitsu


    We discuss the problem of the large discrepancy between the observed lifetime ratio of $B_d$ to $\\Lambda_b$ and the theoretical prediction obtained by the heavy quark effective theory. A new possibility of solving this problem is proposed from the viewpoint of operator product expansion and the lifetime ratio of $\\Lambda_b$ to $\\Omega_b$ is predicted.

  15. Factors affecting the response of the bubble detector BD-100 and a comparison of its response to CR-39

    International Nuclear Information System (INIS)

    The BD-100 is a bubble detector available commercially from Chalk River Nuclear Laboratories, Canada for neutron dosimetry. According to the manufacturer, the BD-100 detects neutrons over an energy range of 100 keV to 14 MeV and the dose equivalent response is independent of energy. The sensitivity of the detector is dependent upon its temperature at the time of irradiation. The sensitized detector self-nucleates upon sharp impact and when heated to temperatures of 480C or greater. The BD-100 is insensitive to low energy gamma rays but responds to 6 MeV photons. The sensitivity (bubbles/μSv) of the BD-100 was found to be energy dependent when exposed to standard neutron sources with average energies ranging from 0.5 to 4.5 MeV. The bubbles formed upon irradiation continued to grow in size with time. The response of electrochemically etched CR-39 to the same neutron sources is also reported for comparison

  16. Tolerance and antiviral effects of high-dose interferon-alpha B/D in patients with chronic hepatitis B

    NARCIS (Netherlands)

    Rasch, MC; Schellekens, H; van Dijck, CMM; Haagsma, EB; Michielsen, PP; van Buuren, AHJAM; Stotter, H; van Hattum, J


    A novel recombinant interferon-alpha B/D hybrid was applied to assess tolerability, antiviral effect, and biological activity in chronic hepatitis B. The study was designed as an open nonrandomized trial. Treatment comprised a two-week run-in phase with 16 MU three times a week followed by 14 weeks

  17. Detection of Phosphorus, Sulphur, and Zinc in the Carbon-enhanced Metal-poor Star BD+44 493 (United States)

    Roederer, Ian U.; Placco, Vinicius M.; Beers, Timothy C.


    The carbon-enhanced metal-poor star BD+44°493 ([Fe/H] = ‑3.9) has been proposed as a candidate second-generation star enriched by metals from a single Pop III star. We report the first detections of P and S and the second detection of Zn in any extremely metal-poor carbon-enhanced star, using new spectra of BD+44°493 collected by the Cosmic Origins Spectrograph on the Hubble Space Telescope. We derive [P/Fe] = ‑0.34 ± 0.21, [S/Fe] = +0.07 ± 0.41, and [Zn/Fe] = ‑0.10 ± 0.24. We increase by 10-fold the number of Si i lines detected in BD+44°493, yielding [Si/Fe] = +0.15 ± 0.22. The [S/Fe] and [Zn/Fe] ratios exclude the hypothesis that the abundance pattern in BD+44°493 results from depletion of refractory elements onto dust grains. Comparison with zero-metallicity supernova (SN) models suggests that the stellar progenitor that enriched BD+44°493 was massive and ejected much less than 0.07 M ⊙ of 56Ni, characteristic of a faint SN. Based on observations made with the NASA/ESA Hubble Space Telescope, obtained at the Space Telescope Science Institute (STScI), which is operated by the Association of Universities for Research in Astronomy, Inc. (AURA) under NASA contract NAS 5-26555. These observations are associated with program GO-14231.

  18. 肠膜明串珠菌BD1710在TSM中的产糖条件优化%Optimization of the Condition for Leuconostoc mesenteroides BD1710 to Biosynthesis Glycan in Tomato Juice-sucrose Medium

    Institute of Scientific and Technical Information of China (English)

    韩瑨; 吴正钧; 游春苹; 徐晓芬


    The condition for Leuconostoc mesenteroides BD1710 to biosynthesis glycan in tomato juice-sucrose medium was optimizized, which was a combination of a medium composed of pure tomato juice supplemented with 15%sucrose, with the initial pH value of the medium adjusted to 7.0, and the fermentation undertaken at 28 ℃ with an inoculation ratio of 2.0 %. Under the optimized conditions , the glycan synthesized by L. mesenteroides BD1710 in the tomato juice-sucrose medium could reached 32.15 g/L , at the same level or a little higher than the yield of glycan by the same bacterial strain in a reported chemically defined medium suitable for Leuconostoc mesenteroides to express polysaccharides. The polymers obtained from the fermented tomato juice-sucrose medium by L.mesenteroides BD1710 via alchol participation was composed of 97.54 %carbohydrate and 0.72%protein, respectively. Therefore, tomato juice-sucrose medium could be an alternative of chemically defined medium for L. mesenteroides strains to biosynthesis glycan.%研究了肠膜明串珠菌BD1710(L. mesenteroides BD1710,CGMCC NO.6432)以TSM为基料时,接种量、初始pH、番茄汁浓度、蔗糖浓度、发酵温度对多糖产量的影响,同时,比较了肠膜明串珠菌BD1710在最优条件下发酵TSM和CDM的多糖产量,并对所获得的多糖组成进行了分析。结果表明:肠膜明串珠菌BD1710发酵TSM产多糖的最适条件分别为接种量2.0%(体积分数)、初始pH 7.0、番茄汁浓度100%(体积分数)、蔗糖浓度15%、发酵温度28℃。在优化条件下,肠膜明串珠菌BD1710的多糖产量最高可达32.15 g/L,与在CDM中多糖的产量相当。采用乙醇沉淀的方法从BD1710发酵TSM得到的多糖碳水化合物含量为97.54%,蛋白质含量为0.72%。因此,TSM可替代CDM来应用于明串珠菌合成多糖。

  19. 肠膜明串珠菌BD1710在TSM中的产糖条件优化%Optimization of the Condition for Leuconostoc mesenteroides BD1710 to Biosynthesis Glycan in Tomato Juice-sucrose Medium

    Institute of Scientific and Technical Information of China (English)

    韩瑨; 吴正钧; 游春苹; 徐晓芬


    研究了肠膜明串珠菌BD1710(L. mesenteroides BD1710,CGMCC NO.6432)以TSM为基料时,接种量、初始pH、番茄汁浓度、蔗糖浓度、发酵温度对多糖产量的影响,同时,比较了肠膜明串珠菌BD1710在最优条件下发酵TSM和CDM的多糖产量,并对所获得的多糖组成进行了分析。结果表明:肠膜明串珠菌BD1710发酵TSM产多糖的最适条件分别为接种量2.0%(体积分数)、初始pH 7.0、番茄汁浓度100%(体积分数)、蔗糖浓度15%、发酵温度28℃。在优化条件下,肠膜明串珠菌BD1710的多糖产量最高可达32.15 g/L,与在CDM中多糖的产量相当。采用乙醇沉淀的方法从BD1710发酵TSM得到的多糖碳水化合物含量为97.54%,蛋白质含量为0.72%。因此,TSM可替代CDM来应用于明串珠菌合成多糖。%The condition for Leuconostoc mesenteroides BD1710 to biosynthesis glycan in tomato juice-sucrose medium was optimizized, which was a combination of a medium composed of pure tomato juice supplemented with 15%sucrose, with the initial pH value of the medium adjusted to 7.0, and the fermentation undertaken at 28 ℃ with an inoculation ratio of 2.0 %. Under the optimized conditions , the glycan synthesized by L. mesenteroides BD1710 in the tomato juice-sucrose medium could reached 32.15 g/L , at the same level or a little higher than the yield of glycan by the same bacterial strain in a reported chemically defined medium suitable for Leuconostoc mesenteroides to express polysaccharides. The polymers obtained from the fermented tomato juice-sucrose medium by L.mesenteroides BD1710 via alchol participation was composed of 97.54 %carbohydrate and 0.72%protein, respectively. Therefore, tomato juice-sucrose medium could be an alternative of chemically defined medium for L. mesenteroides strains to biosynthesis glycan.

  20. Characterization of the levan produced by Paenibacillus bovis sp. nov BD3526 and its immunological activity. (United States)

    Xu, Xiaofen; Gao, Caixia; Liu, Zhenmin; Wu, Jiang; Han, Jin; Yan, Minghui; Wu, Zhengjun


    Paenibacillus bovis sp. nov BD3526 synthesizes a large amount of exopolysaccharides (EPSs) (36.25g/L) in a semi-defined chemical medium containing 20% (w/v) sucrose. The EPSs were extracted from the cultured broth by ethanol precipitation and purified via anion-exchange and gel permeation chromatography. The Fourier transform infrared (FT-IR) and nuclear magnetic resonance (NMR) spectra showed that the primary EPS fraction (F1) was a linear β (2→6)-linked levan. The peak molecular weight (Mp) of the levan exceeded 2.6×10(6)Da based on high-performance size-exclusion chromatography (HPSEC). The levan adopted a spherical conformation in aqueous solution as confirmed by transmission electron microscopy (TEM). The corresponding levansucrase was identified by SDS-PAGE analysis and in situ polymer synthesis. The in vitro assay demonstrated that the levan significantly stimulated the proliferation of spleen cells and induced the expression of TNF-α, indicating its potential as a natural immunomodulator. PMID:27083807

  1. The Chemical Composition and Age of the Metal-Poor Halo Star BD +17^\\circ 3248

    CERN Document Server

    Cowan, J J; Burles, S M; Ivans, I I; Beers, T C; Truran, J W; Lawler, J E; Primas, F; Fuller, G M; Pfeiffer, B; Kratz, K L; Cowan, John J.; Sneden, Christopher; Burles, Scott; Ivans, Inese I.; Beers, Timothy C.; Truran, James W.; Lawler, James E.; Primas, Francesca; Fuller, George M.; Pfeiffer, Bernd; Kratz, Karl-Ludwig


    We have combined new high-resolution spectra obtained with the Hubble Space Telescope (HST) and ground-based facilities to make a comprehensive new abundance analysis of the metal-poor, halo star BD +17^\\circ 3248. We have detected the third r-process peak elements osmium, platinum, and (for the first time in a metal-poor star) gold, elements whose abundances can only be reliably determined using HST. Our observations illustrate a pattern seen in other similar halo stars with the abundances of the heavier neutron-capture elements, including the third r-process peak elements, consistent with a scaled solar system r-process distribution. The abundances of the lighter neutron-capture elements, including germanium and silver, fall below that same scaled solar r-process curve, a result similar to that seen in the ultra-metal-poor star CS 22892--052. A single site with two regimes or sets of conditions, or perhaps two different sites for the lighter and heavier neutron-capture elements, might explain the abundance ...

  2. Research of smoothing pseudo-range algorithm by Doppler based on GPS/BD (United States)

    Kang, Chuanli; Zhou, Yanliu


    GNSS (Global Navigation Satellite System) technology not only in the general field of surveying and mapping, geology, mining, water and electricity, and in particular in the field of public security, fire protection, tourism, search and rescue, adventure have been more widely used. These special areas require real-time and high positioning accuracy. Currently, GNSS precision positioning technology has become a hot research direction. This paper introduced an algorithm of smoothing pseudo range by Doppler based GPS/BD to improve GNSS positioning precision. This algorithm decoded the pseudo range data and ephemeris data, and then designed algorithm of smoothing pseudo range by Doppler according principle of Doppler smoothing pseudo range. This algorithm was realized by C++ and proved its efficiency. At last, this algorithm has proved its correctness through calculating and analyzing practical Doppler and pseudo range data, and then a conclusion has been obtained: the Doppler value precision is sub-meter, far better than the pseudo-range accuracy, so that if the two data are combined to calculate position that can help to improve the positioning accuracy.

  3. Development of a metadata schema describing Institutional Repository content objects enhanced by ''LODE-BD'' strategies

    Directory of Open Access Journals (Sweden)

    Iryna Solodovnik


    Full Text Available Based on ''Guidelines for metadata creation and management in the Institutional Repositories'' (CRUI, Italy, 2012 and ''LODE-BD Recommendations'' (AIMS, 2012, and exploring other principles and strategies for qualitative development of metadata representing contents and properties of digital contents, this article presents the specific metadata profile for description of Institutional Repository information resources. This profile is allocated within a metadata schema provided by well-defined metadata terms, compilation specifications, and alignment (mapping strategies to more specific metadata terms and value properties enabling basic metadata to become more efficient in authority control context, richer in their semantic profiles and more accessible and usable on the web by means of Linked Data sets. Developing and implementing metadata schemas aligned completely or partially with Linked Data paradigm will provide metadata exchange among different Linked Data-enabling repositories, potentiate semantic relationship browsing and querying of their contents, enable their participation in the Linked Open Data cloud and contribution to an open research commons space.

  4. Photoionization Models of the Inner Gaseous Disk of the Herbig Be Star BD+65 1637

    CERN Document Server

    Patel, P; Landstreet, J D


    We attempt to constrain the physical properties of the inner, gaseous disk of the Herbig Be star BD+65 1637 using non-LTE, circumstellar disk codes and observed spectra (3700 to 10,500 \\r{A}) from the ESPaDOnS instrument on CFHT. The photoionizing radiation of the central star is assumed to be the sole source of input energy for the disk. We model optical and near-infrared emission lines that are thought to form in this region using standard techniques that have been successful in modeling the spectra of Classical Be stars. By comparing synthetic line profiles of hydrogen, helium, iron and calcium with the observed line profiles, we try to constrain the geometry, density structure, and kinematics of the gaseous disk. Reasonable matches have been found for all line profiles individually; however, no disk density model based on a single power-law for the equatorial density was able to simultaneously fit all of the observed emission lines. Amongst the emission lines, the metal lines, especially the Ca II IR trip...

  5. Pulsating extreme helium star BD + 13/sup 0/3224. 2. Ultraviolet fluxes and effective temperature variations

    Energy Technology Data Exchange (ETDEWEB)

    Lynas-Gray, A.E. (University Coll., London (UK). Dept. of Physics and Astronomy; Saint Andrews Univ. (UK). Observatory); Schoenberner, D.; Heber, U. (Kiel Univ. (Germany, F.R.). Inst. fuer Theoretische Physik; Kiel Univ. (Germany, F.R.). Sternwarte); Hill, P.W. (Saint Andrews Univ. (UK). Observatory; Anglo-Australian Observatory, Epping (Australia))


    Ultraviolet flux variations are reported for the pulsating extreme helium star BD + 13/sup 0/3224 (V652 Her). Effective temperature and angular radius variations over a cycle are determined from static plane-parallel LTE model atmospheres. When compared with radius changes derived from ground-based spectroscopy, the angular radius variations indicate radial pulsations and correspond to a distance of 1.5 +- 0.1 kpc. BD + 13/sup 0/3224 is thought to be a helium-burning star of 0.7 Msolar masses, which has an envelope contracting as the helium-burning core grows; it is similar to HD 144941 and these two stars may constitute a new sub-class of the hydrogen-deficient stars.

  6. Inclusive decays of the B meson and possible life-time difference between Bd0 and B± mesons

    International Nuclear Information System (INIS)

    We study branching ratios of the inclusive semileptonic decay and the inclusive anti ccanti s decay of the B meson in the spectator model, focusing on the life-time difference between Bd0 and B+ mesons. In the case of τsub(B±)/τsub(Bd0)=1, it is impossible to get the branching ratio below 12% for B→eνX without going over 20% for B→anti ccanti s, which is unfavored by the inclusive K- decay of the B meson. It is found that the sizable life-time difference leads to the reasonable inclusive semileptonic decay rate and the inclusive anti ccanti s decay rate. (orig.)

  7. X-ray Observations of Bow Shocks around Runaway O Stars. The case of $\\zeta$ Oph and BD+433654

    CERN Document Server

    Toalá, J A; González-Gaán, A; Guerrero, M A; Ignace, R; Pohl, M


    Non-thermal radiation has been predicted within bow shocks around runaway stars by recent theoretical works. We present X-ray observations towards the runaway stars $\\zeta$ Oph (Chandra and Suzaku) and BD+433654 (XMM-Newton) to search for the presence of non-thermal X-ray emission. We found no evidence of non-thermal emission spatially coincident with the bow shocks, nonetheless, diffuse emission is detected in the vicinity of $\\zeta$ Oph. After a careful analysis of its spectral characteristics we conclude that this emission has a thermal nature with a plasma temperature of $T \\approx 2 \\times10^{6}$ K. The cometary shape of this emission seems to be in line with recent predictions of radiation-hydrodynamic models of runaway stars. The case of BD+433654 is puzzling as non-thermal emission has been reported in a previous work for this source.

  8. Comparative Evaluation of Inoculation of Urine Samples with the Copan WASP® and BD Kiestra™ InoqulA™ Instruments

    DEFF Research Database (Denmark)

    Iversen, Jesper; Stendal, Gitta; Gerdes, Cecilie Marie; Hjortberg Meyer, Christian; Andersen, Christian Østergaard; Frimodt-Møller, Niels


    This study evaluated quantitative results as well as the quality of the inoculation patterns on urine specimens produced by two automated instruments, the Copan WASP® and the BD InoqulA™. 526 urine samples submitted in 10 ml canisters containing boric acid were processed within 30 minutes on an...... InoqulA, plating 10 ul of specimen, and two WASP instruments, one plating 1 ul of specimen (WASP-1) and the second WASP 10 ul (WASP-10). All samples were incubated, analysed, and digitally imaged using the BD Kiestra™ Total Lab Automation system. Results were evaluated using a quantitative protocol as...... automated instruments divided by the counts for the calibrated pipet (golden standard). Ratios for the InoqulA were closest to 1,0 with the smallest standard deviations indicating that, compared to a calibrated pipet, the InoqulA results were more accurate than the WASP.. For clinical samples, the WASPs...

  9. Angular distribution and yield of protons from the 10B(d, p)11B reaction (II)

    NARCIS (Netherlands)

    Paris, C.H.; Valckx, F.P.G.; Endt, P.M.


    In a previous paper (to be quoted as (I)) angular distribution measurements have been described of four proton groups from the B(d, p)B reaction at a deuteron energy of Ed = 0.31 MeV. In the present investigation measurements were added at Ed = 0.20, 0.45 and 0.60 MeV. The differential cross sectio

  10. Revised ephemeris for the pulsating hydrogen-deficient star BD + 13/sup 0/ 3224 (V652 Her)

    Energy Technology Data Exchange (ETDEWEB)

    Kilkenny, D.; Lynas-Gray, A.E.


    Additional observations of maxima of the pulsating hydrogen-deficient star, BD + 13/sup 0/ 3224 (V652 Her), give an improved ephemeris for the decreasing period of pulsation. A simple quadratic no longer appears sufficient and a cubic solution may be preferable, indicating that the pulsation decrease rate is slowing down as the star contracts. An alternative hypotheses, that the star is a binary is also discussed.

  11. Comparison of the BD MAX® Enteric Bacterial Panel assay with conventional diagnostic procedures in diarrheal stool samples. (United States)

    Knabl, L; Grutsch, I; Orth-Höller, D


    Although infectious diarrhea is one of the most predominant diseases around the world, the identification of the causative microorganism is still challenging. The aim of this study was the evaluation of the BD MAX® Enteric Bacterial Panel assay in comparison to conventional diagnostic procedures concerning the detection of the enteric pathogens Salmonella spp., Campylobacter spp., Shigella spp., and Shiga toxin-producing Escherichia coli. For this purpose, 971 prospectively collected stool samples were evaluated. Utilization of the BD MAX Enteric Bacterial Panel elevated the overall detection rate from 5.26 % to 8.06 %. The positive percent agreement of the BD MAX Enteric Bacterial Panel assay and stool culture or enzyme immunoassay was 0.97 for Campylobacter spp., 0.75 for Salmonella spp., 1.00 for Shigella spp., and 0.88 for Shiga toxins. Furthermore, a negative percent agreement of 0.98 for Campylobacter spp., 0.99 for Salmonella spp., 0.99 for Shigella spp., and 0.99 for Shiga toxins has been demonstrated. This study highlighted the superior detection rate of molecular assays compared to conventional diagnostic procedures. PMID:26563899

  12. Multichannel astrometric photometer and photographic astrometric studies in the regions of Lalande 21185, BD 56 deg 2966, and HR 4784 (United States)

    Gatewood, George; Stein, John; De Jonge, Joost K.; Persinger, Timothy; Reiland, Thomas; Stephenson, Bruce


    The parallaxes of stars determined from the multichannel astrometric photometer (MAP) in the regions of Lalande 21185, BD 56 deg 2966, and from photographic plates in the region of BD 56 deg 2966 and the region of HR 4783 and HR 4784 are reported. The parallax determined for Lalande 21185, 395.1 +/-1.0 mas yields what is believed to be the most precise distance modulus (-2.984 +/-0.0055) known for a star other than the sun. The absolute magnitude of Lalande 21185 is found to be 10.474 +/-0.008. No significant evidence of unseen companions is detected. The photographic study of BD 56 deg 2966 indicates that the long-term (65 yr) motion of the star is linear to better than +/-16 mas, while the MAP study indicates that the motion is linear to better than +/-2.5 mas over a period of some 5 yr. The photographically determined parallaxes are compared with those observed with the MAP. The photographically calculated standard errors are found to be in agreement with the standard error of the differences.

  13. High level expression of human epithelial β-defensins (hBD-1, 2 and 3 in papillomavirus induced lesions

    Directory of Open Access Journals (Sweden)

    Chong Kong T


    Full Text Available Abstract Background Epithelial defensins including human β-defensins (hBDs and α-defensins (HDs are antimicrobial peptides that play important roles in the mucosal defense system. However, the role of defensins in papillomavirus induced epithelial lesions is unknown. Results Papilloma tissues were prospectively collected from 15 patients with recurrent respiratory papillomatosis (RRP and analyzed for defensins and chemokine IL-8 expression by quantitative, reverse-transcriptase polymerase chain reaction (RT-PCR assays. HBD-1, -2 and -3 mRNAs were detectable in papilloma samples from all RRP patients and the levels were higher than in normal oral mucosal tissues from healthy individuals. Immunohistochemical analysis showed that both hBD-1 and 2 were localized in the upper epithelial layers of papilloma tissues. Expression of hBD-2 and hBD-3 appeared to be correlated as indicated by scatter plot analysis (r = 0.837, p Conclusion Human β-defensins are upregulated in respiratory papillomas. This novel finding suggests that hBDs might contribute to innate and adaptive immune responses targeted against papillomavirus-induced epithelial lesions.

  14. New Abundance Determinations of Cadmium, Lutetium, and Osmium in the r-process Enriched Star BD+173248

    CERN Document Server

    Roederer, Ian U; Lawler, James E; Cowan, John J


    We report the detection of Cd I (Z = 48), Lu II (Z = 71), and Os II (Z = 76) in the metal-poor star BD+173248. These abundances are derived from an ultraviolet spectrum obtained with the Space Telescope Imaging Spectrograph on the Hubble Space Telescope. This is the first detection of these neutron-capture species in a metal-poor star enriched by the r-process. We supplement these measurements with new abundances of Mo I, Ru I, and Rh I derived from an optical spectrum obtained with the High Resolution Echelle Spectrograph on Keck. Combined with previous abundance derivations, 32 neutron-capture elements have been detected in BD+173248, the most complete neutron-capture abundance pattern in any metal-poor star to date. The light neutron-capture elements (38 <= Z <= 48) show a more pronounced even-odd effect than expected from current Solar system r-process abundance predictions. The age for BD+173248 derived from the Th II/Os II chronometer is in better agreement with the age derived from other chronome...

  15. ALA-mediated photodynamic therapy of experimental malignant glioma in the BD-IX rat model (United States)

    Hirschberg, Henry; Angell-Petersen, Even; Peng, Qian; Sun, Chung-Ho; Sorensen, Dag R.; Carper, Steven W.; Madsen, Steen J.


    Introduction: Failure of treatment for high grade gliomas is usually due to local recurrence at the site of surgical resec-tion indicating that a more aggressive form of local therapy could be of benefit. Photodynamic therapy (PDT) is a local form of treatment involving the administration of a tumor-localizing photosensitizing drug that is activated by light of a specific wavelength The results of in vitro experiments indicated that PDT, given at low fluence rates was substantially more effective at inhibiting glioma spheroid growth than short term high fluence rate regimes. This prompted the initia-tion of in vivo studies of low fluence rate 5-aminolevulinic acid (ALA) PDT in a rat glioma model. Methods:BT4C cell line tumors were established in the brains of inbred BD- IX rats. Eighteen days following tumor induction the animals were injected with 125 mg/kg ALA ip. and four hours later light treatment at various fluences and fluence rates were given after the introduction of an optical fiber. Tumor histology and animal survival were examined. Results: In vitro experiments verified that the cell line was sensitive to ALA PDT. Microfluorometry of frozen tissue sections showed that PpIX is produced with a greater than 20:1 tumor to normal tissue selectivity ratio four hours after ALA injection. Histological examination demonstrated neutrophil infiltration and tumor central necrosis in low fluence rate treated tumors. Conclusions: Low fluence rate long term ALA mediated PDT had a more pronounced effect on tumor histology than single shot short duration treatments at similar total fluence levels.

  16. A business case for on-site generation: The BD biosciences pharmingen project

    Energy Technology Data Exchange (ETDEWEB)

    Firestone, Ryan; Creighton, Charles; Bailey, Owen; Marnay, Chris; Stadler, Michael


    Deregulation is haltingly changing the United States electricity markets. The resulting uncertainty and/or rising energy costs can be hedged by generating electricity on-site and other benefits, such as use of otherwise wasted heat, can be captured. The Public Utility Regulatory Policy Act (PURPA) of 1978 first invited relatively small-scale generators ({ge} 1 MW) into the electricity market. The advent of efficient and reliable small scale and renewable equipment has spurred an industry that has, in recent years, made even smaller (business scale) electricity generation an economically viable option for some consumers. On-site energy capture and/or conversion, known as distributed energy resources (DER), offers consumers many benefits, such as economic savings and price predictability, improved reliability, control over power quality, and emissions reductions. Despite these benefits, DER adoption can be a daunting move to a customer accustomed to simply paying a monthly utility bill. San Diego is in many ways an attractive location for DER development: It has high electricity prices typical of California and a moderate climate i.e. energy loads are consistent throughout the year. Additionally, the price shock to San Diego Gas and Electric (SDG&E) customers during the summer of 2000 has interested many in alternatives to electricity price vulnerability. This report examines the business case for DER at the San Diego biotechnology supply company, BD Biosciences Pharmingen, which considered DER for a building with 200-300 kW base-load, much of which accommodates the refrigerators required to maintain chemicals. Because of the Mediterranean climate of the San Diego area and the high rate of air changes required due to on-site use of chemicals, modest space heating is required throughout the year. Employees work in the building during normal weekday business hours, and daily peak loads are typically about 500 kW.

  17. Development and Evaluation of a Real-Time PCR Assay for Detection of Pneumocystis jirovecii on the Fully Automated BD MAX Platform


    Dalpke, Alexander H.; Hofko, Marjeta; Zimmermann, Stefan


    Pneumocystis jirovecii is an opportunistic pathogen in immunocompromised and AIDS patients. Detection by quantitative PCR is faster and more sensitive than microscopic diagnosis yet requires specific infrastructure. We adapted a real-time PCR amplifying the major surface glycoprotein (MSG) target from Pneumocystis jirovecii for use on the new BD MAX platform. The assay allowed fully automated DNA extraction and multiplex real-time PCR. The BD MAX assay was evaluated against manual DNA extract...

  18. The cytochrome bd-type quinol oxidase is important for survival of Mycobacterium smegmatis under peroxide and antibiotic-induced stress


    Ping Lu; Marieke H. Heineke; Anil Koul; Koen Andries; Cook, Gregory M.; Holger Lill; Rob van Spanning; Dirk Bald


    Targeting respiration and ATP synthesis has received strong interest as a new strategy for combatting drug-resistant Mycobacterium tuberculosis. Mycobacteria employ a respiratory chain terminating with two branches. One of the branches includes a cytochrome bc 1 complex and an aa 3-type cytochrome c oxidase while the other branch terminates with a cytochrome bd-type quinol oxidase. In this communication we show that genetic inactivation of cytochrome bd, but not of cytochrome bc 1, enhances t...

  19. The cytochrome bd-type quinol oxidase is important for survival of Mycobacterium smegmatis under peroxide and antibiotic-induced stress. (United States)

    Lu, Ping; Heineke, Marieke H; Koul, Anil; Andries, Koen; Cook, Gregory M; Lill, Holger; van Spanning, Rob; Bald, Dirk


    Targeting respiration and ATP synthesis has received strong interest as a new strategy for combatting drug-resistant Mycobacterium tuberculosis. Mycobacteria employ a respiratory chain terminating with two branches. One of the branches includes a cytochrome bc1 complex and an aa3-type cytochrome c oxidase while the other branch terminates with a cytochrome bd-type quinol oxidase. In this communication we show that genetic inactivation of cytochrome bd, but not of cytochrome bc1, enhances the susceptibility of Mycobacterium smegmatis to hydrogen peroxide and antibiotic-induced stress. The type-II NADH dehydrogenase effector clofazimine and the ATP synthase inhibitor bedaquiline were bacteriostatic against wild-type M. smegmatis, but strongly bactericidal against a cytochrome bd mutant. We also demonstrated that the quinone-analog aurachin D inhibited mycobacterial cytochrome bd at sub-micromolar concentrations. Our results identify cytochrome bd as a key survival factor in M. smegmatis during antibiotic stress. Targeting the cytochrome bd respiratory branch therefore appears to be a promising strategy that may enhance the bactericidal activity of existing tuberculosis drugs. PMID:26015371

  20. Epitope mapping and identification of amino acids critical for mouse IgG-binding to linear epitopes on Gly m Bd 28K. (United States)

    Xi, Jun; Yan, Huili


    Gly m Bd 28K is one of the major allergens in soybeans, but there is limited information on its IgG-binding epitopes. Thirty-four overlapping peptides that covered the entire sequence of Gly m Bd 28K were synthesized, and 3 monoclonal antibodies against Gly m Bd 28K were utilized to identify the IgG-binding regions of Gly m Bd 28K. Three dominant peptides corresponding to (28)GDKKSPKSLFLMSNS(42)(G28-S42), (56)LKSHGGRIFYRHMHI(70)(L56-I70), and (154)ETFQSFYIGGGANSH(168)(E154-H168) were recognized. L56-I70 is the most important epitope, and a competitive ELISA indicated that it could inhibit the binding of monoclonal antibody to Gly m Bd 28K protein. Alanine scanning of L56-I70 documented that F64, Y65, and R66 were the critical amino acids of this epitope. Two bioinformatics tools, ABCpred and BepiPred, were used to predict the epitopes of Gly m Bd 28K, and the predictions were compared with the epitopes that we had located by monoclonal antibodies. PMID:27033966

  1. Antiadhesive activity of the biosurfactant pseudofactin II secreted by the Arctic bacterium Pseudomonas fluorescens BD5

    Directory of Open Access Journals (Sweden)

    Janek Tomasz


    Full Text Available Abstract Background Pseudofactin II is a recently identified biosurfactant secreted by Pseudomonas fluorescens BD5, the strain obtained from freshwater from the Arctic Archipelago of Svalbard. Pseudofactin II is a novel compound identified as cyclic lipopeptide with a palmitic acid connected to the terminal amino group of eighth amino acid in peptide moiety. The C-terminal carboxylic group of the last amino acid forms a lactone with the hydroxyl of Thr3. Adhesion is the first stage of biofilm formation and the best moment for the action of antiadhesive and anti-biofilm compounds. Adsorption of biosurfactants to a surface e.g. glass, polystyrene, silicone modifies its hydrophobicity, interfering with the microbial adhesion and desorption processes. In this study the role and applications of pseudofactin II as a antiadhesive compound has been investigated from medicinal and therapeutic perspectives. Results Pseudofactin II lowered the adhesion to three types of surfaces (glass, polystyrene and silicone of bacterial strains of five species: Escherichia coli, Enterococcus faecalis, Enterococcus hirae, Staphylococcus epidermidis, Proteus mirabilis and two Candida albicans strains. Pretreatment of a polystyrene surface with 0.5 mg/ml pseudofactin II inhibited bacterial adhesion by 36-90% and that of C. albicans by 92-99%. The same concentration of pseudofactin II dislodged 26-70% of preexisting biofilms grown on previously untreated surfaces. Pseudofactin II also caused a marked inhibition of the initial adhesion of E. faecalis, E. coli, E. hirae and C. albicans strains to silicone urethral catheters. The highest concentration tested (0.5 mg/ml caused a total growth inhibition of S. epidermidis, partial (18-37% inhibition of other bacteria and 8-9% inhibition of C. albicans growth. Conclusion Pseudofactin II showed antiadhesive activity against several pathogenic microorganisms which are potential biofilm formers on catheters, implants and internal

  2. Hubble space telescope near-ultraviolet spectroscopy of the bright cemp-no star BD+44°493

    Energy Technology Data Exchange (ETDEWEB)

    Placco, Vinicius M. [Gemini Observatory, Hilo, HI 96720 (United States); Beers, Timothy C.; Smith, Verne V. [National Optical Astronomy Observatory, Tucson, AZ 85719 (United States); Roederer, Ian U. [Department of Astronomy, University of Michigan, Ann Arbor, MI 48109 (United States); Cowan, John J. [Homer L. Dodge Department of Physics and Astronomy, University of Oklahoma, Norman, OK 73019 (United States); Frebel, Anna [Kavli Institute for Astrophysics and Space Research and Department of Physics, Massachusetts Institute of Technology, Cambridge, MA 02139 (United States); Filler, Dan; Ivans, Inese I. [Department of Physics and Astronomy, The University of Utah, Salt Lake City, UT 84112 (United States); Lawler, James E. [Department of Physics, University of Wisconsin, Madison, WI 53706 (United States); Schatz, Hendrik [JINA—Joint Institute for Nuclear Astrophysics, Department of Physics, University of Notre Dame, Notre Dame, IN 46556-5670 (United States); Sneden, Christopher [Department of Astronomy and McDonald Observatory, University of Texas, Austin, TX 78712 (United States); Sobeck, Jennifer S. [Department of Astronomy, University of Virginia, Charlottesville, VA 22904 (United States); Aoki, Wako, E-mail: [National Astronomical Observatory of Japan, 2-21-1 Osawa, Mitaka, Tokyo 181-8588 (Japan)


    We present an elemental-abundance analysis, in the near-ultraviolet (NUV) spectral range, for the extremely metal-poor star BD+44°493 a ninth magnitude subgiant with [Fe/H] =–3.8 and enhanced carbon, based on data acquired with the Space Telescope Imaging Spectrograph on the Hubble Space Telescope. This star is the brightest example of a class of objects that, unlike the great majority of carbon-enhanced metal-poor (CEMP) stars, does not exhibit over-abundances of heavy neutron-capture elements (CEMP-no). In this paper, we validate the abundance determinations for a number of species that were previously studied in the optical region, and obtain strong upper limits for beryllium and boron, as well as for neutron-capture elements from zirconium to platinum, many of which are not accessible from ground-based spectra. The boron upper limit we obtain for BD+44°493, log ε (B) <–0.70, the first such measurement for a CEMP star, is the lowest yet found for very and extremely metal-poor stars. In addition, we obtain even lower upper limits on the abundances of beryllium, log ε (Be) <–2.3, and lead, log ε (Pb) <–0.23 ([Pb/Fe] <+1.90), than those reported by previous analyses in the optical range. Taken together with the previously measured low abundance of lithium, the very low upper limits on Be and B suggest that BD+44°493 was formed at a very early time, and that it could well be a bona-fide second-generation star. Finally, the Pb upper limit strengthens the argument for non-s-process production of the heavy-element abundance patterns in CEMP-no stars.

  3. Hubble space telescope near-ultraviolet spectroscopy of the bright cemp-no star BD+44°493

    International Nuclear Information System (INIS)

    We present an elemental-abundance analysis, in the near-ultraviolet (NUV) spectral range, for the extremely metal-poor star BD+44°493 a ninth magnitude subgiant with [Fe/H] =–3.8 and enhanced carbon, based on data acquired with the Space Telescope Imaging Spectrograph on the Hubble Space Telescope. This star is the brightest example of a class of objects that, unlike the great majority of carbon-enhanced metal-poor (CEMP) stars, does not exhibit over-abundances of heavy neutron-capture elements (CEMP-no). In this paper, we validate the abundance determinations for a number of species that were previously studied in the optical region, and obtain strong upper limits for beryllium and boron, as well as for neutron-capture elements from zirconium to platinum, many of which are not accessible from ground-based spectra. The boron upper limit we obtain for BD+44°493, log ε (B) <–0.70, the first such measurement for a CEMP star, is the lowest yet found for very and extremely metal-poor stars. In addition, we obtain even lower upper limits on the abundances of beryllium, log ε (Be) <–2.3, and lead, log ε (Pb) <–0.23 ([Pb/Fe] <+1.90), than those reported by previous analyses in the optical range. Taken together with the previously measured low abundance of lithium, the very low upper limits on Be and B suggest that BD+44°493 was formed at a very early time, and that it could well be a bona-fide second-generation star. Finally, the Pb upper limit strengthens the argument for non-s-process production of the heavy-element abundance patterns in CEMP-no stars.

  4. Characterization of the NTPR and BD1 interacting domains of the human PICH-BEND3 complex

    DEFF Research Database (Denmark)

    Pitchai, Ganesha P; Hickson, Ian D; Streicher, Werner;


    Chromosome integrity depends on DNA structure-specific processing complexes that resolve DNA entanglement between sister chromatids. If left unresolved, these entanglements can generate either chromatin bridging or ultrafine DNA bridging in the anaphase of mitosis. These bridge structures are...... defined by the presence of the PICH protein, which interacts with the BEND3 protein in mitosis. To obtain structural insights into PICH-BEND3 complex formation at the atomic level, their respective NTPR and BD1 domains were cloned, overexpressed and crystallized using 1.56 M ammonium sulfate as a...

  5. Creation of a gold nanoparticle based electrochemical assay for the detection of inhibitors of bacterial cytochrome bd oxidases. (United States)

    Fournier, Eugénie; Nikolaev, Anton; Nasiri, Hamid R; Hoeser, Jo; Friedrich, Thorsten; Hellwig, Petra; Melin, Frederic


    Cytochrome bd oxidases are membrane proteins expressed by bacteria including a number of pathogens, which make them an attractive target for the discovery of new antibiotics. An electrochemical assay is developed to study the activity of these proteins and inhibition by quinone binding site tool compounds. The setup relies on their immobilization at electrodes specifically modified with gold nanoparticles, which allows achieving a direct electron transfer to/from the heme cofactors of this large enzyme. After optimization of the protein coverages, the assay shows at pH7 a good reproducibility and readout stability over time, and it is thus suitable for further screening of small molecule collections. PMID:27314676

  6. Improved management of SG BD demineralizer for reduced generation of low-level radioactive spent resin in Korean nuclear power plants

    International Nuclear Information System (INIS)

    Most nuclear power plants in Korea have adopted Ethanolamine(ETA) as a secondary pH control agent to increase the pH at the liquid phase, which may reduce the corrosion in steam generator tubes and moisture separator/reheat system. Along with its beneficial effect of SG protection from corrosion and degradation, the replacement of ammonia with ETA causes the increased generation of spent resin and the reduced run time of demineralizer in steam generator blowdown(SG BD) system. The composition ratio of cation- to anion- exchange resin in SG BD mixed bed should be increased in the ETA chemistry environment to meet the ratio of cation to anion in the aqueous solution, which results in the simultaneous exhaustion of cation and anion exchange resins. The utilization rate of mixed bed is greatest at the cation-to-anion ratio of 95:1 on the theoretical equivalent basis in the solution, but practically highest at that of 22:1 due to the possible inhomogeneous distribution of cation and anion exchange resins in SG BD bed. The run time of the bed could be extended by 30% such that, at that much, the purchase cost of new resin is saved and the production rate of spent resin is reduced. The guideline on the replacement of resin in SG BD bed is not necessary to secure the removal of radioactive particles without the leakage of the primary coolant into the secondary side since all the radioactive ions can be eliminated by SG BD bed with the sufficient time. They are retained during more than one month after their ingress into the SG BD bed without leakage. With the reduced replacement, thus, the SG BD spent resin that comprises 65% of low-level radioactive solid waste can be much cut down

  7. Skin Bacteria Diversity and Spatial Distribution in Litoria genimaculata (GREEN- EYED TREE FROG Body Parts and its Bd-Inhibitory Activity -abstract-

    Directory of Open Access Journals (Sweden)

    Martha L Silva-Velasco


    Full Text Available Several amphibian skin bacteria have shown inhibitory activity against the pathogenic fungus Batrachochytrium dendrobatidis (Bd. However‚ little is known about the spatial distribution of these inhibitory bacteria on amphibian skin‚ or their diversity. We looked at the diversity and distribution of skin bacteria of the green-eyed tree frog Litoria genimaculata. This stream-dwelling species from North Queensland rainforest declined in the early 1990s but has since recovered to pre-decline range population sizes. Swabs were taken from 5 body parts (hands‚ feet‚ legs and dorsal and ventral surfaces and inoculated onto agar plates for isolation of bacterial colonies. Bd- inhibitory activity was tested in challenge essays. Results show that feet had the highest number of bacterial isolates with Bd inhibitory activity followed by hands and legs with similar numbers of bacterial isolates and ventral body parts in that order. The dorsal surface had the lowest number of Bd inhibitory isolates. No sampled frogs were infected with Bd according to PCR assays‚ although Bd is endemic at the site. Information from morphological observations and Gram stains will be used to classify the bacterial isolates. Results will be analyzed for any patterns of distribution across the body of the frogs. Possible associations between body parts and bacterial isolates with and without Bd-inhibitory activity will be examined. This study will contribute to knowledge of the community structure of skin bacteria in frogs. Characterization of skin bacteria diversity is one of the first steps in understanding the role of amphibian skin bacteria in the resistance of the hosts to chytridiomycosis.

  8. Measurement of the Ratios of Branching Fractions B(Bs -> Ds pi pi pi) / B(Bd -> Dd pi pi pi) and B(Bs -> Ds pi) / B(Bd -> Dd pi)

    CERN Document Server

    Abulencia, A; Affolder, T; Akimoto, T; Albrow, M G; Ambrose, D; Amerio, S; Amidei, D; Anastassov, A; Anikeev, K; Annovi, A; Antos, J; Aoki, M; Apollinari, G; Arguin, J F; Arisawa, T; Artikov, A; Ashmanskas, W; Attal, A; Azfar, F; Azzi-Bacchetta, P; Azzurri, P; Bacchetta, N; Badgett, W; Barbaro-Galtieri, A; Barnes, V E; Barnett, B A; Baroiant, S; Bartsch, V; Bauer, G; Bedeschi, F; Behari, S; Belforte, S; Bellettini, G; Bellinger, J; Belloni, A; Benjamin, D; Beretvas, A; Beringer, J; Berry, T; Bhatti, A; Binkley, M; Bisello, D; Blair, R E; Blocker, C; Blumenfeld, B; Bocci, A; Bodek, A; Boisvert, V; Bölla, G; Bolshov, A; Bortoletto, D; Boudreau, J; Boveia, A; Brau, B; Brigliadori, L; Bromberg, C; Brubaker, E; Budagov, Yu A; Budd, H S; Budd, S; Budroni, S; Burkett, K; Busetto, G; Bussey, P; Byrum, K L; Cabrera, S; Campanelli, M; Campbell, M; Canelli, F; Canepa, A; Carillo, S; Carlsmith, D; Carosi, R; Casarsa, M; Castro, A; Catastini, P; Cauz, D; Cavalli-Sforza, M; Cerri, A; Cerrito, L; Chang, S H; Chen, Y C; Chertok, M; Chiarelli, G; Chlachidze, G; Chlebana, F; Cho, I; Cho, K; Chokheli, D; Chou, J P; Choudalakis, G; Chuang, S H; Chung, K; Chung, W H; Chung, Y S; Ciljak, M; Ciobanu, C I; Ciocci, M A; Clark, A; Clark, D; Coca, M; Compostella, G; Convery, M E; Conway, J; Cooper, B; Copic, K; Cordelli, M; Cortiana, G; Crescioli, F; Cuenca-Almenar, C; Cuevas-Maestro, J; Culbertson, R; Cully, J C; Cyr, D; D'Auria, S; D'Onofrio, M; Da Ronco, S; Dagenhart, D; Davies, T; De Barbaro, P; De Cecco, S; De Lentdecker, G; De Pedis, D; Deisher, A; Dell'Orso, Mauro; Delli Paoli, F; Demortier, L; Deng, J; Deninno, M; Derwent, P F; Di Giovanni, G P; Di Ruzza, B; Di Turo, P; Dionisi, C; Dittmann, J R; Donati, S; Donega, M; Dong, P; Donini, J; Dorigo, T; Dorr, C; Dube, S; Efron, J; Erbacher, R; Errede, D; Errede, S; Eusebi, R; Fang, H C; Farrington, S; Fedorko, I; Fedorko, W T; Feild, R G; Feindt, M; Fernández, J P; Field, R; Flanagan, G; Foland, A; Forrester, S; Foster, G W; Franklin, M; Freeman, J C; Furic, I; Gallinaro, M; Galyardt, J; Garberson, F; García, J E; Garfinkel, A F; Gay, C; Gerberich, H; Gerdes, D; Giagu, S; Giannetti, P; Gibson, A; Gibson, K; Gimmell, J L; Ginsburg, C; Giokaris, N; Giordani, M; Giromini, P; Giunta, M; Giurgiu, G; Glagolev, V; Glenzinski, D; Gold, M; Goldschmidt, N; Goldstein, J; Goncharov, M; González, O; Gorelov, I; Goshaw, A T; Goulianos, K; Gresele, A; Griffiths, M; Grinstein, S; Grosso-Pilcher, C; Group, R C; Grundler, U; Guimarães da Costa, J; Gunay-Unalan, Z; Gómez, G; Gómez-Ceballos, G; Haber, C; Hahn, K; Hahn, S R; Halkiadakis, E; Hamilton, A; Han, B Y; Han, J Y; Handler, R; Happacher, F; Hara, K; Hare, M; Harper, S; Harr, R F; Harris, R M; Hartz, M; Hatakeyama, K; Hauser, J; Heijboer, A; Heinemann, B; Heinrich, J; Henderson, C; Herndon, M; Heuser, J; Hidas, D; Hill, C S; Hirschbuehl, D; Holloway, A; Hou, S; Houlden, M; Hsu, S C; Huffman, B T; Hughes, R E; Husemann, U; Huston, J; Höcker, A; Incandela, J R; Introzzi, G; Iori, M; Ishizawa, Y; Ivanov, A; Iyutin, B; James, E; Jang, D; Jayatilaka, B; Jeans, D; Jensen, H; Jeon, E J; Jindariani, S; Jones, M; Joo, K K; Jun, S Y; Jung, J E; Junk, T R; Kamon, T; Karchin, P E; Kato, Y; Kemp, Y; Kephart, R; Kerzel, U; Khotilovich, V; Kilminster, B; Kim, D H; Kim, H S; Kim, J E; Kim, M J; Kim, S B; Kim, S H; Kim, Y K; Kimura, N; Kirsch, L; Klimenko, S; Klute, M; Knuteson, B; Ko, B R; Kondo, K; Kong, D J; Konigsberg, J; Korytov, A; Kotwal, A V; Kovalev, A; Kraan, A C; Kraus, J; Kravchenko, I; Kreps, M; Kroll, J; Krumnack, N; Kruse, M; Krutelyov, V; Kubo, T; Kuhlmann, S E; Kuhr, T; Kusakabe, Y; Kwang, S; Laasanen, A T; Lai, S; Lami, S; Lammel, S; Lancaster, M; Lander, R L; Lannon, K; Lath, A; Latino, G; Lazzizzera, I; LeCompte, T; Lee, J; Lee, S W; Lee, Y J; Lefèvre, R; Leonardo, N; Leone, S; Levy, S; Lewis, J D; Lin, C; Lin, C S; Lindgren, M; Lipeles, E; Lister, A; Litvintsev, D O; Liu, T; Lockyer, N S; Loginov, A; Loreti, M; Loverre, P F; Lu, R S; Lucchesi, D; Lujan, P; Lukens, P; Lungu, G; Lyons, L; Lys, J; Lysak, R; Lytken, E; MacQueen, D; Mack, P; Madrak, R; Maeshima, K; Makhoul, K; Maksimovic, P; Malde, S; Manca, G; Margaroli, F; Marginean, R; Marino, C; Marino, C P; Martin, A; Martin, M; Martin, V; Martínez, M; Maruyama, T; Mastrandrea, P; Masubuchi, T; Matsunaga, H; Mattson, M E; Mazini, R; Mazzanti, P; McFarland, K S; McIntyre, P; McNulty, R; Mehta, A; Mehtälä, P; Menzemer, S; Menzione, A; Merkel, P; Mesropian, C; Messina, A; Miao, T; Miladinovic, N; Miles, J; Miller, R; Mills, C; Milnik, M; Mitra, A; Mitselmakher, G; Miyamoto, A; Moed, S; Moggi, N; Mohr, B; Moore, R; Morello, M; Movilla-Fernández, P A; Mukherjee, A; Mumford, R; Murat, P; Mäki, T; Müller, T; Mülmenstädt, J; Nachtman, J; Nagano, A; Naganoma, J; Nakano, I; Napier, A; Necula, V; Neu, C; Neubauer, M S; Nielsen, J; Nigmanov, T; Nodulman, L; Norniella, O; Nurse, E; Oh, S H; Oh, Y D; Oksuzian, I; Okusawa, T; Oldeman, R; Orava, R; Pagliarone, C; Palencia, E; Papadimitriou, V; Paramonov, A A; Parks, B; Pashapour, S; Patrick, J; Pauletta, G; Paulini, M; Paus, C; Pellett, D E; Penzo, Aldo L; Phillips, T J; Piacentino, G; Piedra, J; Pinera, L; Pitts, K; Plager, C; Pondrom, L; Portell, X; Poukhov, O; Pounder, N; Prakoshyn, F; Pronko, A; Proudfoot, J; Ptohos, F; Punzi, G; Pursley, J; Rademacker, J; Rahaman, A; Ranjan, N; Rappoccio, S; Reisert, B; Rekovic, V; Renton, P B; Rescigno, M; Richter, S; Rimondi, F; Ristori, L; Robson, A; Rodrigo, T; Rogers, E; Rolli, S; Roser, R; Rossi, M; Rossin, R; Ruiz, A; Russ, J; Rusu, V; Saarikko, H; Sabik, S; Safonov, A; Saint-Denis, R; Sakumoto, W K; Salamanna, G; Salto, O; Saltzberg, D; Santi, L; Sarkar, S; Sartori, L; Sato, K; Savard, P; Savoy-Navarro, A; Scheidle, T; Schlabach, P; Schmidt, E E; Schmidt, M P; Schmitt, M; Schwarz, T; Scodellaro, L; Scott, A L; Scribano, A; Scuri, F; Sedov, A; Seidel, S; Seiya, Y; Semenov, A; Sexton-Kennedy, L; Sfyrla, A; Shapiro, M D; Shears, T G; Shepard, P F; Sherman, D; Shimojima, M; Shochet, M; Shon, Y; Shreyber, I; Sidoti, A; Sinervo, P; Sisakian, A; Sjölin, J; Slaughter, A J; Slaunwhite, J; Sliwa, K; Smith, J R; Snider, F D; Snihur, R; Soha, A; Somalwar, S; Sorin, V; Spalding, J; Spinella, F; Spreitzer, T; Squillacioti, P; Stanitzki, M; Staveris-Polykalas, A; Stelzer, B; Stelzer-Chilton, O; Stentz, D; Strologas, J; Stuart, D; Suh, J S; Sukhanov, A; Sun, H; Suzuki, T; Sánchez, C; Söderberg, M; Taffard, A; Takashima, R; Takeuchi, Y; Takikawa, K; Tanaka, M; Tanaka, R; Tecchio, M; Teng, P K; Terashi, K; Thom, J; Thompson, A S; Thomson, E; Tipton, P; Tiwari, V; Tkaczyk, S; Toback, D; Tokar, S; Tollefson, K; Tomura, T; Tonelli, D; Torre, S; Torretta, D; Tourneur, S; Trischuk, W; Tsuchiya, R; Tsuno, S; Turini, N; Ukegawa, F; Unverhau, T; Uozumi, S; Usynin, D; Vallecorsa, S; Van Remortel, N; Varganov, A; Vataga, E; Velev, G; Veramendi, G; Veszpremi, V; Vidal, R; Vila, I; Vilar, R; Vine, T; Vollrath, I; Volobuev, I P; Volpi, G; Vázquez, F; Wagner, J; Wagner, P; Wagner, R G; Wagner, R L; Wagner, W; Wallny, R; Wang, S M; Warburton, A; Waschke, S; Waters, D; Wester, W C; Whitehouse, B; Whiteson, D; Wicklund, A B; Wicklund, E; Williams, G; Williams, H H; Wilson, P; Winer, B L; Wittich, P; Wolbers, S; Wolfe, C; Wright, T; Wu, X; Wynne, S M; Würthwein, F; Yagil, A; Yamamoto, K; Yamaoka, J; Yamashita, T; Yang, C; Yang, U K; Yang, Y C; Yao, W M; Yeh, G P; Yoh, J; Yorita, K; Yoshida, T; Yu, G B; Yu, I; Yu, S S; Yun, J C; Zanello, L; Zanetti, A; Zaw, I; Zhang, X; Zhou, J; Zucchelli, S; Österberg, K


    Using 355 pb^-1 of data collected by the CDF II detector in \\ppbar collisions at sqrt{s} = 1.96 TeV at the Fermilab Tevatron, we study the fully reconstructed hadronic decays B -> D pi and B -> D pi pi pi. We present the first measurement of the ratio of branching fractions B(Bs -> Ds pi pi pi) / B(Bd -> Dd pi pi pi) = 1.05 pm 0.10 (stat) pm 0.22 (syst). We also update our measurement of B(Bs -> Ds pi) / B(Bd -> Dd pi) to 1.13 pm 0.08 (stat) pm 0.23 (syst) improving the statistical uncertainty by more than a factor of two. We find B(Bs -> Ds pi) = [3.8 pm 0.3 (stat) pm 1.3 (syst)] \\times 10^{-3} and B(Bs -> Ds pi pi pi) = [8.4 pm 0.8 (stat) pm 3.2 (syst)] \\times 10^{-3}.

  9. Hubble Space Telescope Near-Ultraviolet Spectroscopy of the Bright CEMP-no Star BD+44 493

    CERN Document Server

    Placco, Vinicius; Roederer, Ian; Cowan, John; Frebel, Anna; Filler, Dan; Ivans, Inese I; Lawler, James E; Schatz, Hendrik; Sneden, Christopher; Sobeck, Jennifer; Aoki, Wako; Smith, Verne


    We present an elemental-abundance analysis, in the near-ultraviolet (NUV) spectral range, for the extremely metal-poor star BD+44 493, a 9th magnitude sub-giant with [Fe/H] = -3.8 and enhanced carbon, based on data acquired with the Space Telescope Imaging Spectrograph on the Hubble Space Telescope. This star is the brightest example of a class of objects that, unlike the great majority of carbon-enhanced metal-poor (CEMP) stars, does not exhibit over-abundances of heavy neutron-capture elements (CEMP-no). In this paper, we validate the abundance determinations for a number of species that were previously studied in the optical region, and obtain strong upper limits for beryllium and boron, as well as for neutron-capture elements from zirconium to platinum, many of which are not accessible from ground-based spectra. The boron upper limit we obtain for BD+44 493, logeps(B) < -0.70, the first such measurement for a CEMP star, is the lowest yet found for very and extremely metal-poor stars. In addition, we ob...

  10. The orbital elements and physical properties of the eclipsing binary BD+36 3317, a probable member of $\\delta$ Lyr cluster

    CERN Document Server

    Kıran, E; Değirmenci, Ö L; Wolf, M; Nemravová, J; Šlechta, M; Koubský, P


    Context. The fact that eclipsing binaries belong to a stellar group is useful, because the former can be used to estimate distance and additional properties of the latter, and vice versa. Aims. Our goal is to analyse new spectroscopic observations of BD$+36^\\circ3317$ along with the photometric observations from the literature and, for the first time, to derive all basic physical properties of this binary. We aim to find out whether the binary is indeed a member of the $\\delta$ Lyr open cluster. Methods. The spectra were reduced using the IRAF program and the radial velocities were measured with the program SPEFO. The line spectra of both components were disentangled with the program KOREL and compared to a grid of synthetic spectra. The final combined radial-velocity and photometric solution was obtained with the program PHOEBE. Results. We obtained the following physical elements of BD$+36^\\circ3317$: $M_1 = 2.24\\pm0.07 M_{\\odot}$, $M_2 = 1.52\\pm0.03 M_{\\odot}$, $R_1 = 1.76\\pm0.01 R_{\\odot}$, $R_2 = 1.46\\pm...

  11. Bd on the beach: high prevalence of Batrachochytrium dendrobatidis in the lowland forests of Gorgona Island (Colombia, South America). (United States)

    Flechas, Sandra Victoria; Sarmiento, Carolina; Amézquita, Adolfo


    The amphibian chytrid fungus, Batrachochytrium dendrobatidis, Bd, has been implicated in the decimation and extinction of many amphibian populations worldwide, especially at mid and high elevations. Recent studies have demonstrated the presence of the pathogen in the lowlands from Australia and Central America. We extend here its elevational range by demonstrating its presence at the sea level, in the lowland forests of Gorgona Island, off the Pacific coast of Colombia. We conducted two field surveys, separated by four years, and diagnosed Bd by performing polymerase chain reactions on swab samples from the skin of five amphibian species. All species, including the Critically Endangered Atelopus elegans, tested positive for the pathogen, with prevalences between 3.9 % in A. elegans (in 2010) and 52 % in Pristimantis achatinus. Clinical signs of chytridiomycosis were not detected in any species. To our knowledge, this is the first report of B. dendrobatidis in tropical lowlands at sea level, where temperatures may exceed optimal growth temperatures of this pathogen. This finding highlights the need to understand the mechanisms allowing the interaction between frogs and pathogen in lowland ecosystems. PMID:22669408

  12. Search for the Bs0 → e+e- and Bd0 → e+e- decays in Flavor-Changing Z' Model

    International Nuclear Information System (INIS)

    The precise prediction of the branching ratios of the very rare decays Bs0 → e+e- and Bd0 → e+e- is an important ingredient for high energy research beyond standard model (SM). Recently, the CDF collaboration has reported upper limits for the branching ratios B(Bs0→e+e-)<2.8 x 10-7 and B(Bd0 →e+e-) < 8.3 x 10-8 at 90 % confidence level. These branching ratios are approximately seven orders of magnitude larger than the SMpredictions, providing in thi sway a direction in which the SM could be extended. In this paper, the Bs0→e+e- and Bd0 →e+e- rare decays in flavor-changing Z' model are studied. Our estimated branching ratios are enhanced from their SM values and provide signals for new physics. (author)

  13. Effects of the Imidazoline Binding Site Ligands, Idazoxan and Efaroxan, on the Viability of Insulin-Secreting BRIN-BD11 Cells

    Directory of Open Access Journals (Sweden)

    Gao H


    Full Text Available CONTEXT: Certain imidazoline drugs stimulate insulin secretion acutely but their longer term effects on the viability of pancreatic beta-cells are less well characterised. Indeed, some reports have suggested that imidazolines can be toxic to beta-cells while others have reported protective effects against other cytotoxic agents. OBJECTIVE: In order to address these discrepancies, the effects of two structurally related imidazolines, efaroxan and idazoxan, on the viability of clonal BRIN-BD11 beta-cells, were compared. DESIGN AND MAIN OUTCOME MEASURES: BRIN-BD11 cells were exposed to test reagents and their viability monitored by measuring cellular reducing ability and DNA fragmentation. Nitric oxide was measured indirectly via medium nitrite formation. RESULTS: Efaroxan (up to 100 micro M did not directly affect BRIN-BD11 cell viability in the absence of other agents and it did not protect these cells against the cytotoxic effects of interleukin-1beta. Indeed, analysis of DNA fragmentation in BRIN-BD11 cells revealed that efaroxan enhanced the level of damage caused by interleukin-1beta. Idazoxan caused a time- and dose-dependent loss of BRIN-BD11 cell viability in the absence of other ligands. This was associated with marked DNA degradation but was not associated with formation of nitric oxide. The effects of idazoxan were insensitive to blockade of alpha(2-adrenoceptors or 5-HT(1A (5-hydroxytryptamine; serotonin receptors. CONCLUSIONS: The results confirm that idazoxan is cytotoxic to beta-cells but show that efaroxan is better tolerated. However, since efaroxan enhanced the cytotoxic effects of interleukin-1beta, it appears that this imidazoline may sensitise BRIN-BD11 cells to the damaging effects of certain cytokines.

  14. Comparative genomic analysis and benzene, toluene, ethylbenzene, and o-, m-, and p-xylene (BTEX) degradation pathways of Pseudoxanthomonas spadix BD-a59. (United States)

    Choi, Eun Jin; Jin, Hyun Mi; Lee, Seung Hyeon; Math, Renukaradhya K; Madsen, Eugene L; Jeon, Che Ok


    Pseudoxanthomonas spadix BD-a59, isolated from gasoline-contaminated soil, has the ability to degrade all six BTEX (benzene, toluene, ethylbenzene, and o-, m-, and p-xylene) compounds. The genomic features of strain BD-a59 were analyzed bioinformatically and compared with those of another fully sequenced Pseudoxanthomonas strain, P. suwonensis 11-1, which was isolated from cotton waste compost. The genome of strain BD-a59 differed from that of strain 11-1 in many characteristics, including the number of rRNA operons, dioxygenases, monooxygenases, genomic islands (GIs), and heavy metal resistance genes. A high abundance of phage integrases and GIs and the patterns in several other genetic measures (e.g., GC content, GC skew, Karlin signature, and clustered regularly interspaced short palindromic repeat [CRISPR] gene homology) indicated that strain BD-a59's genomic architecture may have been altered through horizontal gene transfers (HGT), phage attack, and genetic reshuffling during its evolutionary history. The genes for benzene/toluene, ethylbenzene, and xylene degradations were encoded on GI-9, -13, and -21, respectively, which suggests that they may have been acquired by HGT. We used bioinformatics to predict the biodegradation pathways of the six BTEX compounds, and these pathways were proved experimentally through the analysis of the intermediates of each BTEX compound using a gas chromatograph and mass spectrometry (GC-MS). The elevated abundances of dioxygenases, monooxygenases, and rRNA operons in strain BD-a59 (relative to strain 11-1), as well as other genomic characteristics, likely confer traits that enhance ecological fitness by enabling strain BD-a59 to degrade hydrocarbons in the soil environment. PMID:23160122

  15. Isolation and characterization of two new lipopeptide biosurfactants produced by Pseudomonas fluorescens BD5 isolated from water from the Arctic Archipelago of Svalbard

    Czech Academy of Sciences Publication Activity Database

    Janek, T.; Lukaszewicz, M.; Řezanka, Tomáš; Krasowska, A.


    Roč. 101, č. 15 (2010), s. 6118-6123. ISSN 0960-8524 Institutional research plan: CEZ:AV0Z50200510 Keywords : Pseudomonas fluorescens BD5 * Lipopeptide * Pseudofactins Subject RIV: EE - Microbiology, Virology Impact factor: 4.365, year: 2010

  16. 13 CFR 124.502 - How does an agency offer a procurement to SBA for award through the 8(a) BD program? (United States)


    ... a small disadvantaged business set-aside if applicable, and that no other public communication (such... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false How does an agency offer a procurement to SBA for award through the 8(a) BD program? 124.502 Section 124.502 Business Credit...

  17. Comparison of the BD Phoenix System with the Cefoxitin Disk Diffusion Test for Detection of Methicillin Resistance in Staphylococcus aureus and Coagulase-Negative Staphylococci▿


    Mencacci, Antonella; Montecarlo, Ines; Gonfia, Francesca; Moretti, Amedeo; Cardaccia, Angela; Farinelli, Senia; Pagliochini, Maria Rita; Giuliani, Angela; Basileo, Michela; Pasticci, Maria Bruna; Bistoni, Francesco


    The BD Phoenix system was compared to the cefoxitin disk diffusion test for detection of methicillin (meticillin) resistance in 1,066 Staphylococcus aureus and 1,121 coagulase-negative staphylococcus (CoNS) clinical isolates. The sensitivity for Phoenix was 100%. The specificities were 99.86% for S. aureus and 88.4% for CoNS.

  18. Glycoprotein from street rabies virus BD06 induces early and robust immune responses when expressed from a non-replicative adenovirus recombinant. (United States)

    Wang, Shuchao; Sun, Chenglong; Zhang, Shoufeng; Zhang, Xiaozhuo; Liu, Ye; Wang, Ying; Zhang, Fei; Wu, Xianfu; Hu, Rongliang


    The rabies virus (RABV) glycoprotein (G) is responsible for inducing neutralizing antibodies against rabies virus. Development of recombinant vaccines using the G genes from attenuated strains rather than street viruses is a regular practice. In contrast to this scenario, we generated three human adenovirus type 5 recombinants using the G genes from the vaccine strains SRV9 and Flury-LEP, and the street RABV strain BD06 (nrAd5-SRV9-G, nrAd5-Flury-LEP-G, and nrAd5-BD06-G). These recombinants were non-replicative, but could grow up to ~10(8) TCID50/ml in helper HEK293AD cells. Expression of the G protein was verified by immunostaining, quantitative PCR and cytometry. Animal experiments revealed that immunization with nrAd5-BD06-G can induce a higher seroconversion rate, a higher neutralizing antibody level, and a longer survival time after rabies virus challenge in mice when compared with the other two recombinants. Moreover, the expression of granulocyte-macrophage colony-stimulating factor (GM-CSF) was significantly higher in mice immunized with nrAd5-BD06-G, which might also contribute to the increased protection. These results show that the use of street RABV G for non-replicative systems may be an alternative for developing effective recombinant rabies vaccines. PMID:26143474

  19. Comparison of Chromogenic Media to BD GeneOhm Methicillin-Resistant Staphylococcus aureus (MRSA) PCR for Detection of MRSA in Nasal Swabs▿


    Bischof, Larry J.; Lapsley, Linda; Fontecchio, Karen; Jacosalem, Dollie; Young, Carol; Hankerd, Rosemary; Newton, Duane W.


    To select a method for detecting methicillin-resistant Staphylococcus aureus (MRSA) in nasal swabs, we compared BD GeneOhm MRSA PCR and various culture media (mannitol salt agar with cefoxitin, MRSASelect, CHROMagar MRSA, and Spectra MRSA). While PCR detection of MRSA was more rapid, MRSASelect and Spectra MRSA demonstrated performance equivalent to that of PCR with maximal detection at 24 h.

  20. The Major Soybean Allergen Gly m Bd 28K Induces Hypersensitivity Reactions in Mice Sensitized to Cow's Milk Proteins. (United States)

    Candreva, Ángela María; Smaldini, Paola Lorena; Curciarello, Renata; Fossati, Carlos Alberto; Docena, Guillermo Horacio; Petruccelli, Silvana


    Reactions to soy have been reported in a proportion of patients with IgE-mediated cow's milk allergy (CMA). In this work, we analyzed if Gly m Bd 28K/P28, one of the major soybean allergens, is a cross-reactive allergen with cow milk proteins (CMP). We showed that P28 was recognized by IgE sera from CMA patients and activated human peripheral basophils degranulation. Moreover, IgE sera of mice exclusively sensitized to CMP recognized P28. Splenocytes from sensitized animals secreted IL-5 and IL-13 when incubated with CMP or soy proteins, but only IL-13 when treated with P28. In addition, a skin test was strongly positive for CMP and weakly positive for P28. Remarkably, milk-sensitized mice showed hypersensitivity symptoms following sublingual challenge with P28 or CMP. With the use of bioinformatics' tools seven putative cross-reactive epitopes were identified. In conclusion, using in vitro and in vivo tests we demonstrated that P28 is a novel cross-reactive allergen with CMP. PMID:26859063

  1. TRUMP-BD: A computer code for the analysis of nuclear fuel assemblies under severe accident conditions

    International Nuclear Information System (INIS)

    TRUMP-BD (Boil Down) is an extension of the TRUMP (Edwards 1972) computer program for the analysis of nuclear fuel assemblies under severe accident conditions. This extension allows prediction of the heat transfer rates, metal-water oxidation rates, fission product release rates, steam generation and consumption rates, and temperature distributions for nuclear fuel assemblies under core uncovery conditions. The heat transfer processes include conduction in solid structures, convection across fluid-solid boundaries, and radiation between interacting surfaces. Metal-water reaction kinetics are modeled with empirical relationships to predict the oxidation rates of steam-exposed Zircaloy and uranium metal. The metal-water oxidation models are parabolic in form with an Arrhenius temperature dependence. Uranium oxidation begins when fuel cladding failure occurs; Zircaloy oxidation occurs continuously at temperatures above 13000 degree F when metal and steam are available. From the metal-water reactions, the hydrogen generation rate, total hydrogen release, and temporal and spatial distribution of oxide formations are computed. Consumption of steam from the oxidation reactions and the effect of hydrogen on the coolant properties is modeled for independent coolant flow channels. Fission product release from exposed uranium metal Zircaloy-clad fuel is modeled using empirical time and temperature relationships that consider the release to be subject to oxidation and volitization/diffusion (''bake-out'') release mechanisms. Release of the volatile species of iodine (I), tellurium (Te), cesium (Ce), ruthenium (Ru), strontium (Sr), zirconium (Zr), cerium (Cr), and barium (Ba) from uranium metal fuel may be modeled

  2. Characterization of the NTPR and BD1 interacting domains of the human PICH-BEND3 complex. (United States)

    Pitchai, Ganesha P; Hickson, Ian D; Streicher, Werner; Montoya, Guillermo; Mesa, Pablo


    Chromosome integrity depends on DNA structure-specific processing complexes that resolve DNA entanglement between sister chromatids. If left unresolved, these entanglements can generate either chromatin bridging or ultrafine DNA bridging in the anaphase of mitosis. These bridge structures are defined by the presence of the PICH protein, which interacts with the BEND3 protein in mitosis. To obtain structural insights into PICH-BEND3 complex formation at the atomic level, their respective NTPR and BD1 domains were cloned, overexpressed and crystallized using 1.56 M ammonium sulfate as a precipitant at pH 7.0. The protein complex readily formed large hexagonal crystals belonging to space group P6122, with unit-cell parameters a = b = 47.28, c = 431.58 Å and with one heterodimer in the asymmetric unit. A complete multiwavelength anomalous dispersion (MAD) data set extending to 2.2 Å resolution was collected from a selenomethionine-labelled crystal at the Swiss Light Source. PMID:27487930

  3. Violation of CP invariance for neutral K0-, D0-, Bd0-, Bs0-mesons and quarks in weak interactions

    International Nuclear Information System (INIS)

    CP violation in the Kobayashi-Maskawa matrix was introduced by using phase which is the same for the three families of quarks. However, analysis of CP violation of mesons has shown that new small-angle mixings appear besides of CP phases. This work is devoted to the consideration of possible schemes for introducing CP violation. It is noted that in general case it is not correct to use CP phase only for the first and third quark families as it is usually introduced. CP phase has to be presented for all quark families, and moreover these phases cannot be the same for all families. Besides, a common case of CP violation was considered for K0, D0, Bd0, Bs0 mesons, where mixing angles and phases are present at CP violation. Expressions for transition probabilities for these processes are given. In conclusion, mixing of d, s, b quarks at CP violation was considered with taking into account their angle mixings and phases.

  4. Natural genetic transformation in Acinetobacter sp. BD413 Biofilms: introducing natural genetic transformation as a tool for bioenhancement of biofilm reactors

    Energy Technology Data Exchange (ETDEWEB)

    Hendrickx, L.


    This study focussed on the localization and quantification of natural genetic transformation using neutral and disadvantageous genes in monoculture biofilms to investigate gene transfer and expression of the transferred genes in the absence of a selective advantage. Data obtained by this investigation were regarded as initial steps for evaluating the applicability of adding catabolic traits into the indigenous bacterial community of biofilm reactors by in situ natural genetic transformation. Because Acinetobacter spp. strains are readily found in waste water treatment plants and because Acinetobacter sp. BD413 possesses a high effective level of competence, natural genetic transformation was investigated in monoculture Acinetobacter sp. BD413 biofilms. The genes used for transformation encoded for the green fluorescent protein (GFP) and its variants. Monitoring of transformation events were performed with the use of automated confocal laser scanning microscopy (CLSM) and semi automated digital image processing and analysis. (orig.)

  5. Follow-up observations of X-ray emitting hot subdwarf star: the He-rich sdO BD +37{\\deg} 1977

    CERN Document Server

    La Palombara, N; Mereghetti, S; Novara, G; Tiengo, A


    We report on the results of the first XMM-Newton satellite observation of the luminous and helium-rich O-type subdwarf BD +37{\\deg} 1977 carried out in April 2014. X-ray emission is detected with a flux of about 4*10^(-14) erg/cm2/s (0.2-1.5 keV), corresponding to a f_X/f_bol ratio about 10^(-7); the source spectrum is very soft, and is well fit by the sum of two plasma components at different temperatures. Both characteristics are in agreement with what is observed in the main-sequence early-type stars, where the observed X-ray emission is due to turbulence and shocks in the stellar wind. A smaller but still significant stellar wind has been observed also in BD +37{\\deg} 1977; therefore, we suggest that also in this case the detected X-ray flux has the same origin.

  6. Evaluation of the limit of detection of the BD Veritor™ system flu A+B test and two rapid influenza detection tests for influenza virus. (United States)

    Peters, Timothy R; Blakeney, Elizabeth; Vannoy, Lauren; Poehling, Katherine A


    We evaluated the limits of detection of 3 rapid influenza diagnostic tests-BD Veritor™ System for Flu A+B, Binax NOW® Influenza A+B, and QuickVue® Influenza-for influenza strains circulating in 2010-2012. Limits of detection varied by influenza strain, with Veritor™ Flu A+B test showing the lowest limit of detection for all strains. PMID:23219228

  7. The role of B/D ratio and A/D ratio to defferentiate malignancy from benignancy in distal extrahepatic bile duct obstruction

    International Nuclear Information System (INIS)

    To determine wheter bilirubin/extrahepatic bile duct diameter ratio(B/D ratio) or alkalinephosphatase/extrahepatic bile duct diameter ratio (A/D ratio) can be used to differentiate malignant from benigndisease in distal extrahepatic bile duct obstruction during ultrasonographic examination. We retrospectively reviewed the sonograms and laboratory data of 100 patients with obstructive jaundice (benign : n=50, malignant: : n=50). The diagnosis was confirmed either surgically (n=66) or clinically (n=34). The B/D ratio and A/D radio were calculated by means of dividing total bilirubin (mg/dl) and alkaline phosphatase (I.U.)respectively by maximum extrahepatic bile duct diameter(mm) on ultrasonogram. Significant difference in B/D ratio was found between the benignancy (0.28+0.25) and malignancy (0.98+0.84) groups (P<0.001). Significant difference in A/D ratio was also found between the benignancy (15.00+10.22) and malignancy (32.44+30.28) groups(P<0.001) Accuracies to predict malignancy according to criteria of B/D and A/D ratios were less than 75% and 65%respectively. On the other hand, the positive predictive value and specificity were relatively high. The B/D ratio and A/D ratio calculated from ultrasonograms can be used as a valuable screening index todifferentiate malignancy from benignacy in patients with distal extrahepatic bile duct obstruction, especially when the sonography is difficult because of the interposition of bowel gas or obesity

  8. The role of B/D ratio and A/D ratio to defferentiate malignancy from benignancy in distal extrahepatic bile duct obstruction

    Energy Technology Data Exchange (ETDEWEB)

    Rhim, Hyun Chul; Baek, JUng Hwan; Jeon, Eui Yong; Koh, Byung Hee; Cho, On Koo [Hanyang University College of Medicine, Seoul (Korea, Republic of); Kim, Young Hwan [Ulsan University College of Medicine, Ulsan (Korea, Republic of)


    To determine wheter bilirubin/extrahepatic bile duct diameter ratio(B/D ratio) or alkalinephosphatase/extrahepatic bile duct diameter ratio (A/D ratio) can be used to differentiate malignant from benigndisease in distal extrahepatic bile duct obstruction during ultrasonographic examination. We retrospectively reviewed the sonograms and laboratory data of 100 patients with obstructive jaundice (benign : n=50, malignant: : n=50). The diagnosis was confirmed either surgically (n=66) or clinically (n=34). The B/D ratio and A/D radio were calculated by means of dividing total bilirubin (mg/dl) and alkaline phosphatase (I.U.)respectively by maximum extrahepatic bile duct diameter(mm) on ultrasonogram. Significant difference in B/D ratio was found between the benignancy (0.28+0.25) and malignancy (0.98+0.84) groups (P<0.001). Significant difference in A/D ratio was also found between the benignancy (15.00+10.22) and malignancy (32.44+30.28) groups(P<0.001) Accuracies to predict malignancy according to criteria of B/D and A/D ratios were less than 75% and 65%respectively. On the other hand, the positive predictive value and specificity were relatively high. The B/D ratio and A/D ratio calculated from ultrasonograms can be used as a valuable screening index todifferentiate malignancy from benignacy in patients with distal extrahepatic bile duct obstruction, especially when the sonography is difficult because of the interposition of bowel gas or obesity

  9. Evaluation von Screeningverfahren zum Schnellnachweis von Methicillin-resistenten Staphylococcus aureus (MRSA)-Isolaten:Vergleich der Testsysteme BacLite Rapid MRSA+ und BD GeneOhm MRSA


    Maas, D. (Dominik)


    Zwei Schnellverfahren mit unterschiedlichem methodischem Ansatz wurden in dieser Studie evaluiert. Das auf Kurzkultur basierende Testsystem BacLite Rapid MRSA+, und das auf molekulargenetischem Nachweis basierende BD GeneOhm MRSA-Testsystem. Als Referenzmethode diente das klassische Kulturverfahren. Von 497 getesteten Patienten wurden klassisch kulturell bei insgesamt fuenf Patienten eine MRSA Besiedlung entdeckt. Das BacLite Rapid MRSA+ konnte davon zwei MRSA-Traeger erkennen und zeigte eine...

  10. Comparison of BD GeneOhm Methicillin-Resistant Staphylococcus aureus (MRSA) PCR versus the CHROMagar MRSA Assay for Screening Patients for the Presence of MRSA Strains▿


    Boyce, John M.; Havill, Nancy L.


    We compared the BD GeneOhm methicillin-resistant Staphylococcus aureus (MRSA) real-time PCR assay with the CHROMagar MRSA assay for the detection of MRSA in 286 nasal surveillance specimens. Compared with the CHROMagar MRSA assay, PCR had sensitivity, specificity, positive predictive value, and negative predictive values of 100%, 98.6%, 95.8%, and 100%, respectively. The mean PCR turnaround time was 14.5 h.

  11. A multiwavelength approach to BD+53$^\\circ$2790: the O9.5V counterpart to the X-ray binary system 4U~2206+54

    CERN Document Server

    Blay, Pere


    The X-ray binary system 4U 2206+54 hides many mysteries. Among them, the surprising behavior of both of its components: the O9.5 dwarf star BD+53$^\\circ$2790 and a slowly rotating neutron star. BD+53$^\\circ$2790 misled the astronomers showing itself very likely as a Be star. However, a deeper spectral analysis and more intense monitoring, revealed that the real picture was a bit more complicated: a) Although it shows evidence of a circumstellar envelope, its observable properties differ from those typical envelopes in Be stars. b) Comparison with spectral standards and models indicates a possible over-abundance in He. This would open the possibility to link the behavior of BD+53$^\\circ$2790 to the He-rich class of stars. c) UV spectra shows an abnormally slow and dense wind for an O9.5V star. d) Spectral classification in the IR wavelength region suggest a more likely supergiant nature of the source, in contradiction with the optical classification. e) The presence of an intense magnetic field is under invest...

  12. Potentialities of the LHCb experiment for the discovery of the physics beyond the standard model in the Bd0 → φKS0 decay

    International Nuclear Information System (INIS)

    The Standard Model predicts the same time-dependant CP asymmetry in both Bd0 -> J/ψKS0 and Bd0 → φKS0 decays. This asymmetry is proportional to sin(2*β). Any difference between the CP asymmetries measured in these 2 channels would indicate the presence of new phenomena beyond the Standard Model. We study the sensitivity of the LHCb experiment to this effect. To that end, we estimate the statistical error on the measurement of sin(2*β) in the Bd0 → φKS0 channel by LHCb. We do that with the LHCb classic detector, and then with the re-optimized detector. The number of simulated background events is too small with respect to the annual statistics to obtain precise evaluations. We developed several methods to improve these evaluations. In the most optimistic case, we predict that sin(2*β) would be measured in the LHCb classic configuration with a statistical error equal to 0.56. With the re-optimized detector, this error is further improved: 0.29. (author)

  13. Guillem Peire de Cazals, “Be·m plagr’ueymais qu’ab vos dona·m valgues” (BdT 227.6

    Directory of Open Access Journals (Sweden)

    Alessio Collura


    Full Text Available This paper proposes a new edition with commentary of the poem “Be·m plagr’ueymais qu’ab vos, dona, ·m valgues” by Guillem Peire de Cazals and represents a first critical and hermeneutical reassessment of the poetry of the troubadour from Cahors, that has long been neglected. The text presents the classical structure of a love-story (springtime exordium, singing brought on by love, the theme of improvement, courting with no hope of a reward, a request for mercé and invites the fin aman to be patient. The song is examined from the viewpoint of its metrical and stylistic relations to other troubadour poems (Bernart de Ventadorn, “Can par la flors josta·l vert folh” [BdT 70.41] and “La dousa votz ai auzida” [BdT 70.23] and Lanfranc Cigala, “Ioios d’amor farai de ioi senblan” [BdT 282.12], and represents an early example of the mannerisms and experimental tendencies that characterize Guillem Peire’s poems. The article also attempts to date the composition to the twenties or thirties of the 13th century.

  14. Power MOSFET quality and robustness enhancement with a new Q{sub BD} characterization performed at probe-die-wafer level

    Energy Technology Data Exchange (ETDEWEB)

    Pomes, Emilie, E-mail: [CNRS, LAAS, 7 Av. du Colonel Roche, F-31077 Toulouse (France); Universite de Toulouse, UPS, INSA, INP, ISAE, LAAS, F-31077 Toulouse (France); Reynes, Jean-Michel [Freescale Semiconductor SAS, Av. du General Eisenhower, 31023 Toulouse (France); Tounsi, Patrick; Dorkel, Jean-Marie [CNRS, LAAS, 7 Av. du Colonel Roche, F-31077 Toulouse (France); Universite de Toulouse, UPS, INSA, INP, ISAE, LAAS, F-31077 Toulouse (France)


    Highlights: Black-Right-Pointing-Pointer We used a new way of electrical characterization with the charge-to-breakdown test. Black-Right-Pointing-Pointer Measurements are performed directly at probe-die-wafer level. Black-Right-Pointing-Pointer An accurate monitor has been developed to evaluate dice quality and reliability. Black-Right-Pointing-Pointer The extrinsic failures responsible for potential rejects can be identified. Black-Right-Pointing-Pointer Process and gate stress impact can be evaluated with the diversion of Q{sub BD} test. - Abstract: The quality of the gate oxide is a central parameter for power MOSFET devices dedicated to automotive applications. Reliability is systematically evaluated through electrical tests. The purpose of this study is to apply the Q{sub BD} test directly at probe-die-wafer level and to correlate its results with reliability test conclusions. In other words, this new kind of Q{sub BD} test is a monitor of power MOSFET robustness which helps identify extrinsic failures and the process steps responsible. In summary, it is an accurate and fast measurement method of identifying weakened parts and enhancing device quality.


    International Nuclear Information System (INIS)

    We have obtained near-infrared adaptive optics imaging and collected additional radial velocity observations to search for a third component in the extremely dusty short-period binary system BD +20°307. Our image shows no evidence for a third component at separations greater than 19 AU. Our four seasons of radial velocities have a constant center-of-mass velocity and are consistent with the systemic velocities determined at two earlier epochs. Thus, the radial velocities also provide no support for a third component. Unfortunately, the separation domains covered by our imaging and radial velocity results do not overlap. Thus, we examined the parameters for possible orbits of a third component that could have been missed by our current observations. With our velocities we determined improved circular orbital elements for the 3.4 day double-lined binary. We also performed a spectroscopic abundance analysis of the short-period binary components and conclude that the stars are a mid- and a late-F dwarf. We find that the iron abundances of both components, [Fe/H] = 0.15, are somewhat greater than the solar value and comparable to that of stars in the Hyades. Despite the similarity of the binary components, the lithium abundances of the two stars are very unequal. The primary has log ε (Li) = 2.72, while in the secondary log ε (Li) ≤1.46, which corresponds to a difference of at least a factor of 18. The very disparate lithium abundances in very similar stars make it impossible to ascribe a single age to them. While the system is likely at least 1 Gyr old, it may well be as old as the Sun.

  16. The orbital elements and physical properties of the eclipsing binary BD+36°3317, a probable member of δ Lyrae cluster (United States)

    Kıran, E.; Harmanec, P.; Değirmenci, Ö. L.; Wolf, M.; Nemravová, J.; Šlechta, M.; Koubský, P.


    Context. The fact that eclipsing binaries belong to a stellar group is useful, because the former can be used to estimate distance and additional properties of the latter, and vice versa. Aims: Our goal is to analyse new spectroscopic observations of BD+ 36°3317 along with the photometric observations from the literature and, for the first time, to derive all basic physical properties of this binary. We aim to find out whether the binary is indeed a member of the δ Lyr open cluster. Methods: The spectra were reduced using the IRAF program and the radial velocities were measured with the program SPEFO. The line spectra of both components were disentangled with the program KOREL and compared to a grid of synthetic spectra. The final combined radial-velocity and photometric solution was obtained with the program PHOEBE. Results: We obtained the following physical elements of BD+36°3317: M1 = 2.24 ± 0.07 M⊙, M2 = 1.52 ± 0.03 M⊙, R1 = 1.76 ± 0.01 R⊙, R2 = 1.46 ± 0.01 R⊙, log L1 = 1.52 ± 0.08 L⊙, log L2 = 0.81 ± 0.07 L⊙. We derived the effective temperatures Teff,1 = 10 450 ± 420 K, Teff,2 = 7623 ± 328 K. Both components are located close to zero age main sequence in the Hertzsprung-Russell (HR) diagram and their masses and radii are consistent with the predictions of stellar evolutionary models. Our results imply the average distance to the system d̅ = 330 ± 29 pc. We re-investigated the membership of BD+ 36°3317 in the δ Lyr cluster and confirmed it. The distance to BD+ 36°3317, given above, therefore represents an accurate estimate of the true distance for δ Lyr cluster. Conclusions: The reality of the δ Lyr cluster and the cluster membership of BD+ 36°3317 have been reinforced.

  17. Franz E. Weinert (Hrsg.): Psychologie des Unterrichts und der Schule. (Enzyklopädie der Psychologie, Themenbereich D: Praxisgebiete, Serie 1: Pädagogische Psychologie, Bd. 3.) Göttingen: Hogrefe 1997. [Rezension


    Arnold, Karl-Heinz


    Rezension von: Franz E. Weinert (Hrsg.): Psychologie des Unterrichts und der Schule. (Enzyklopädie der Psychologie, Themenbereich D: Praxisgebiete, Serie 1: Pädagogische Psychologie, Bd. 3.) Göttingen: Hogrefe 1997. 842 S.

  18. [Rezension zu:] Schopenhauer, Arthur. Handschriftlicher Nachlass: "Philosophische Vorlesungen." Arthur Schopenhauers sämtliche Werke, herausgegeben von Paul Deussen, Verlag von R. Piper & Comp. München, 1913. Bd. IX und X


    Hasse, Heinrich


    Rezension zu: Schopenhauer, Arthur. Handschriftlicher Nachlass: "Philosophische Vorlesungen." Arthur Schopenhauers sämtliche Werke, herausgegeben von Paul Deussen, Verlag von R. Piper & Comp. München, 1913. Bd. IX und X.

  19. Klaus A. Schneewind (Hrsg.): Psychologie der Erziehung und Sozialisation. (Enzyklopädie der Psychologie, Themenbereich D: Praxisgebiete: Serie I: Pädagogische Psychologie, Bd. 1.) Göttingen: Hogrefe 1994. […] [Sammelrezension


    Krapp, Andreas


    Sammelrezension von: 1. Klaus A. Schneewind (Hrsg.): Psychologie der Erziehung und Sozialisation. (Enzyklopädie der Psychologie, Themenbereich D: Praxisgebiete: Serie I: Pädagogische Psychologie, Bd. 1.) Göttingen: Hogrefe 1994. 693 S. 2. Franz, E. Weinert (Hrsg.): Psychologie des Lernens und der Instruktion. (Enzyklopädie der Psychologie, Themenbereich D: Praxisgebiete, Serie I: Pädagogische Psychologie, Bd. 2.) Göttingen: Hogrefe 1996. 536 S.

  20. [Jörg Zägel (in Zusammenarbeit mit Reiner Steinweg). Vergangenheitsdiskurse in der Ostseeregion. Bd. 1. Auseinandersetzungen in den nordischen Staaten über Krieg. Völkermord, Diktatur, Besatzung und Vertreibung; B. 2 : Die Sicht auf Krieg, Diktat

    Index Scriptorium Estoniae

    Hecker-Stampehl, Jan


    Arvustus : Jörg Zägel (in Zusammenarbeit mit Reiner Steinweg). Vergangenheitsdiskurse in der Ostseeregion. Bd. 1. Auseinandersetzungen in den nordischen Staaten über Krieg. Völkermord, Diktatur, Besatzung und Vertreibung. Berlin : LIT Verlag, 2007. (Kieler Schriften zur Friedenswissenschaft. 14); Bd. 2 : Die Sicht auf Krieg, Diktatur, Völkermord, Besatsung und Vertreibung in Russland, Polen und den baltischen Staaten. Berlin: Lit Verlag, 2007. (Kieler Schriften zur Friedenswissenschaft. 15)

  1. Detecting imipenem resistance in Acinetobacter baumannii by automated systems (BD Phoenix, Microscan WalkAway, Vitek 2; high error rates with Microscan WalkAway

    Directory of Open Access Journals (Sweden)

    Ozlu Nagihan


    Full Text Available Abstract Background Increasing reports of carbapenem resistant Acinetobacter baumannii infections are of serious concern. Reliable susceptibility testing results remains a critical issue for the clinical outcome. Automated systems are increasingly used for species identification and susceptibility testing. This study was organized to evaluate the accuracies of three widely used automated susceptibility testing methods for testing the imipenem susceptibilities of A. baumannii isolates, by comparing to the validated test methods. Methods Selected 112 clinical isolates of A. baumanii collected between January 2003 and May 2006 were tested to confirm imipenem susceptibility results. Strains were tested against imipenem by the reference broth microdilution (BMD, disk diffusion (DD, Etest, BD Phoenix, MicroScan WalkAway and Vitek 2 automated systems. Data were analysed by comparing the results from each test method to those produced by the reference BMD test. Results MicroScan performed true identification of all A. baumannii strains while Vitek 2 unidentified one strain, Phoenix unidentified two strains and misidentified two strains. Eighty seven of the strains (78% were resistant to imipenem by BMD. Etest, Vitek 2 and BD Phoenix produced acceptable error rates when tested against imipenem. Etest showed the best performance with only two minor errors (1.8%. Vitek 2 produced eight minor errors(7.2%. BD Phoenix produced three major errors (2.8%. DD produced two very major errors (1.8% (slightly higher (0.3% than the acceptable limit and three major errors (2.7%. MicroScan showed the worst performance in susceptibility testing with unacceptable error rates; 28 very major (25% and 50 minor errors (44.6%. Conclusion Reporting errors for A. baumannii against imipenem do exist in susceptibility testing systems. We suggest clinical laboratories using MicroScan system for routine use should consider using a second, independent antimicrobial susceptibility

  2. Implementation and Evaluation of a Fully Automated Multiplex Real-Time PCR Assay on the BD Max Platform to Detect and Differentiate Herpesviridae from Cerebrospinal Fluids (United States)

    Köller, Thomas; Kurze, Daniel; Lange, Mirjam; Scherdin, Martin; Podbielski, Andreas; Warnke, Philipp


    A fully automated multiplex real-time PCR assay—including a sample process control and a plasmid based positive control—for the detection and differentiation of herpes simplex virus 1 (HSV1), herpes simplex virus 2 (HSV2) and varicella-zoster virus (VZV) from cerebrospinal fluids (CSF) was developed on the BD Max platform. Performance was compared to an established accredited multiplex real time PCR protocol utilizing the easyMAG and the LightCycler 480/II, both very common devices in viral molecular diagnostics. For clinical validation, 123 CSF specimens and 40 reference samples from national interlaboratory comparisons were examined with both methods, resulting in 97.6% and 100% concordance for CSF and reference samples, respectively. Utilizing the BD Max platform revealed sensitivities of 173 (CI 95%, 88–258) copies/ml for HSV1, 171 (CI 95%, 148–194) copies/ml for HSV2 and 84 (CI 95%, 5–163) copies/ml for VZV. Cross reactivity could be excluded by checking 25 common viral, bacterial and fungal human pathogens. Workflow analyses displayed shorter test duration as well as remarkable fewer and easier preparation steps with the potential to reduce error rates occurring when manually assessing patient samples. This protocol allows for a fully automated PCR assay on the BD Max platform for the simultaneously detection of herpesviridae from CSF specimens. Singular or multiple infections due to HSV1, HSV2 and VZV can reliably be differentiated with good sensitivities. Control parameters are included within the assay, thereby rendering its suitability for current quality management requirements. PMID:27092772

  3. Reduced Silent Occlusions with a Novel Catheter Infusion Set (BD FlowSmart): Results from Two Open-Label Comparative Studies


    Gibney, Michael; Xue, Zhenyi; Swinney, Monica; Bialonczyk, Damian; Hirsch, Laurence


    Abstract Background: Insulin pump users experience periods of unexplained hyperglycemia. In some cases these may be due to insulin flow interruptions termed “silent occlusions,” which occur without activating the pump alarm and may require set replacement. Materials and Methods: In-line pressure profiles of a novel infusion set with a 6-mm, 28-gauge polymer, dual-ported catheter (BD FlowSmart™; Becton Dickinson and Co., Franklin Lakes, NJ) were compared with those of an existing infusion set ...

  4. Long-Term Stability of Human Genomic and Human Papillomavirus DNA Stored in BD SurePath and Hologic PreservCyt Liquid-Based Cytology Media


    Agreda, Patricia M.; Beitman, Gerard H.; Gutierrez, Erin C.; Harris, James M.; Koch, Kristopher R.; LaViers, William D.; Leitch, Sharon V.; Maus, Courtney E.; McMillian, Ray A.; Nussbaumer, William A.; Palmer, Marcus L. R.; Porter, Michael J; Richart, Gregory A.; Schwab, Ryan J.; Vaughan, Laurence M.


    We evaluated the effect of storage at 2 to 8°C on the stability of human genomic and human papillomavirus (HPV) DNA stored in BD SurePath and Hologic PreservCyt liquid-based cytology media. DNA retained the ability to be extracted and PCR amplified for more than 2.5 years in both medium types. Prior inability to detect DNA in archived specimens may have been due to failure of the extraction method to isolate DNA from fixed cells.

  5. Measurement of B(D0 → K-π+) Using Partial Reconstruction of B → D*+Xscr(l)-bar ν

    International Nuclear Information System (INIS)

    We present a measurement of the absolute branching fraction for D0→K-π+ using the reconstruction of the decay chain B→D*+X ell -ν , D*+→D0π+ where only the lepton and the low-momentum pion from the D*+ are detected. With data collected by the CLEO II detector at the Cornell Electron Storage Ring, we have determined B(D0→K-π+)=[3.81±0.15(stat) ±0.16(syst)]% . copyright 1998 The American Physical Society

  6. MAP determinations of the parallaxes of stars in the regions of HD 2665, BD +68.946 deg, and Lambda Ophiuchi. [Multichannel Astrometric Photometer (United States)

    Gatewood, George


    The Multichannel Astrometic Photometer and new optical system of the Allegheny Observatory have been used to obtain parallaxes of stars in the regions of HD 2665, BD +68.946 deg, and Lambda Ophiuchi. HD 2665 is found to have an absolute visual magnitude of 1.6 + or - 0.4 and a distance of 149 + or - 28 pc. It is shown that the Lambda Ophiuchi system has a parallax of 23.5 + or - 2.1 mas and that its A0 V and A4 V components have masses of 2.7 + or - 0.7 and 1.5 + or - 0.4 solar masses, respectively.

  7. Metabolic engineering of Pediococcus acidilactici BD16 for production of vanillin through ferulic acid catabolic pathway and process optimization using response surface methodology. (United States)

    Kaur, Baljinder; Chakraborty, Debkumar; Kumar, Balvir


    Occurrence of feruloyl-CoA synthetase (fcs) and enoyl-CoA hydratase (ech) genes responsible for the bioconversion of ferulic acid to vanillin have been reported and characterized from Amycolatopsis sp., Streptomyces sp., and Pseudomonas sp. Attempts have been made to express these genes in Escherichia coli DH5α, E. coli JM109, and Pseudomonas fluorescens. However, none of the lactic acid bacteria strain having GRAS status was previously proposed for heterologous expression of fcs and ech genes for production of vanillin through biotechnological process. Present study reports heterologous expression of vanillin synthetic gene cassette bearing fcs and ech genes in a dairy isolate Pediococcus acidilactici BD16. After metabolic engineering, statistical optimization of process parameters that influence ferulic acid to vanillin biotransformation in the recombinant strain was carried out using central composite design of response surface methodology. After scale-up of the process, 3.14 mM vanillin was recovered from 1.08 mM ferulic acid per milligram of recombinant cell biomass within 20 min of biotransformation. From LCMS-ESI spectral analysis, a metabolic pathway of phenolic biotransformations was predicted in the recombinant P. acidilactici BD16 (fcs (+)/ech (+)). PMID:25077778

  8. The BD Onclarity HPV Assay on Samples Collected in SurePath Medium Meets the International Guidelines for Human Papillomavirus Test Requirements for Cervical Screening (United States)

    Bottari, Fabio; Pedersen, Helle; Sandri, Maria Teresa; Bonde, Jesper


    This study describes a validation of the BD Onclarity HPV (Onclarity) assay using the international guidelines for HPV test requirements for cervical cancer screening of women 30 years old and older using Danish SurePath screening samples. The clinical specificity (0.90, 95% confidence interval [CI] = 0.88 to 0.91) and sensitivity (0.97, 95% CI = 0.87 to 1.0) of the Onclarity assay were shown to be not inferior to the reference assay (specificity, 0.90 [95% CI = 0.88 to 0.92]; sensitivity, 0.98 [95% CI = 0.91 to 1.0]). The intralaboratory reproducibility of Onclarity was 97%, with a lower confidence bound of 96% (kappa value, 0.93). The interlaboratory agreement was 97%, with a lower confidence bound of 95% (kappa value, 0.92). The BD Onclarity HPV assay fulfills all the international guidelines for a new HPV test to be used in primarily screening. This is the first clinical validation of a new HPV assay using SurePath screening samples, and thus the Onclarity HPV assay is the first HPV assay to hold an international validation for both SurePath and ThinPrep. PMID:27307461

  9. Impact of family-non-universal Z' boson on pure annihilation Bs → π+π- and Bd → K+K- decays

    International Nuclear Information System (INIS)

    We study the Bs → π+π- and Bd → K+K- decays in the standard model and the family-non-universal Z' model. Since none of the quarks in the final states is the same as the initial quark, these decay modes can occur only via power-suppressed annihilation diagrams. Despite the consistency of the standard model prediction with the available data, room remains for a light Z' boson. Taking into account the Z' contribution, we find that theoretical results for the branching fractions can better accommodate the data. With the relevant data, we also derive a constraint on the parameter space for the Z'. Moreover, for Bd → K+K-, both the direct and the mixing-induced CP asymmetry are sensitive to the couplings between Z' and fermions in the parameter spaces constrained by the data. The measurements at future experimental facilities, including the LHCb, Belle-II, and the proposed high energy e+e- collider, will provide us useful hints for direct searching for the light Z' boson. (orig.)

  10. Development of a benthic diatom index of biotic integrity (BD-IBI) for ecosystem health assessment of human dominant subtropical rivers, China. (United States)

    Tan, Xiang; Ma, Peiming; Bunn, Stuart E; Zhang, Quanfa


    As efforts intensify to address the issues of declining water quality and biodiversity losses in freshwater ecosystems, there have been great demands for effective methods of evaluating aquatic ecosystem health. In this study, benthic algae assemblages and water quality variables were analyzed to develop a benthic diatom-based index of biotic integrity (BD-IBI) for assessment of the aquatic environment in the upper Han River (China). Through the use of multivariate and multimetric approaches, four metrics - % prostrate individuals, % Amphora individuals, % polysaprob species, and diatom-based eutrophication/pollution index (EPI-D) - were identified from 98 candidate metrics to develop a BD-IBI. Application of the index revealed that water quality in 11% of the 31 sampled sites could be described as excellent condition, in 43% of the sites it could be described as good condition, in 25% as moderate condition, and in 21% as poor condition. The assessment further revealed that the main reason for degradation of the Han river ecosystem was nutrient enrichment through agricultural land use. PMID:25585141

  11. Comparison of the BD Veritor System for Flu A+B with the Alere BinaxNOW influenza A&B card for detection of influenza A and B viruses in respiratory specimens from pediatric patients. (United States)

    Hassan, Ferdaus; Nguyen, Ashley; Formanek, Ashley; Bell, James J; Selvarangan, Rangaraj


    The performance characteristics of two commercially available rapid tests for influenza, the BD Veritor System for Flu A+B (BD) and the Alere BinaxNOW influenza A&B card (BN), were evaluated using 200 frozen clinical specimens collected from January 2011 to June 2012 from pediatric patients. Real-time reverse transcriptase PCR (RT-PCR) was used as the gold standard to evaluate the results obtained by the two different assays. Of the 200 specimens tested, real-time RT-PCR assay detected influenza A or B virus in 116 samples, while BD detected 104 samples and BN detected 84 samples as positive. The overall sensitivity and specificity for detection of both influenza A and B virus in comparison to those of real-time RT-PCR were 89.6% (95% confidence interval [CI], 82.2 to 94.3) and 98.8% (95% CI, 92.6 to 99.9) for BD Veritor and 72.4% (95% CI, 63.2 to 80.0) and 100% (95% CI, 94.5 to 100.0) for BinaxNOW. Workflow analysis indicated that overall processing times for a batch size of 10 specimens were virtually identical between both systems. Overall, these results indicate that the BD Veritor assay was more sensitive than the BinaxNOW assay in detection of influenza A and B viruses in respiratory specimens from pediatric patients. PMID:24391198

  12. Comparison of the BD Veritor System for Flu A+B with the Alere BinaxNOW Influenza A&B Card for Detection of Influenza A and B Viruses in Respiratory Specimens from Pediatric Patients (United States)

    Hassan, Ferdaus; Nguyen, Ashley; Formanek, Ashley; Bell, James J.


    The performance characteristics of two commercially available rapid tests for influenza, the BD Veritor System for Flu A+B (BD) and the Alere BinaxNOW influenza A&B card (BN), were evaluated using 200 frozen clinical specimens collected from January 2011 to June 2012 from pediatric patients. Real-time reverse transcriptase PCR (RT-PCR) was used as the gold standard to evaluate the results obtained by the two different assays. Of the 200 specimens tested, real-time RT-PCR assay detected influenza A or B virus in 116 samples, while BD detected 104 samples and BN detected 84 samples as positive. The overall sensitivity and specificity for detection of both influenza A and B virus in comparison to those of real-time RT-PCR were 89.6% (95% confidence interval [CI], 82.2 to 94.3) and 98.8% (95% CI, 92.6 to 99.9) for BD Veritor and 72.4% (95% CI, 63.2 to 80.0) and 100% (95% CI, 94.5 to 100.0) for BinaxNOW. Workflow analysis indicated that overall processing times for a batch size of 10 specimens were virtually identical between both systems. Overall, these results indicate that the BD Veritor assay was more sensitive than the BinaxNOW assay in detection of influenza A and B viruses in respiratory specimens from pediatric patients. PMID:24391198

  13. Evaluation of 3 automated real-time PCR (Xpert C. difficile assay, BD MAX Cdiff, and IMDx C. difficile for Abbott m2000 assay) for detecting Clostridium difficile toxin gene compared to toxigenic culture in stool specimens. (United States)

    Yoo, Jaeeun; Lee, Hyeyoung; Park, Kang Gyun; Lee, Gun Dong; Park, Yong Gyu; Park, Yeon-Joon


    We evaluated the performance of the 3 automated systems (Cepheid Xpert, BD MAX, and IMDx C. difficile for Abbott m2000) detecting Clostridium difficile toxin gene compared to toxigenic culture. Of the 254 stool specimens tested, 87 (48 slight, 35 moderate, and 4 heavy growth) were toxigenic culture positive. The overall sensitivities and specificities were 82.8% and 98.8% for Xpert, 81.6% and 95.8% for BD MAX, and 62.1% and 99.4% for IMDx, respectively. The specificity was significantly higher in IMDx than BD MAX (P= 0.03). All stool samples underwent toxin A/B enzyme immunoassay testing, and of the 254 samples, only 29 samples were positive and 2 of them were toxigenic culture negative. Considering the rapidity and high specificity of the real-time PCR assays compared to the toxigenic culture, they can be used as the first test method for C. difficile infection/colonization. PMID:26081240

  14. Substituting environmentally relevant flame retardants: assessment fundamentals. Vol. 1: results and summary overview; Erarbeitung von Bewertungsgrundlagen zur Substitution umweltrelevanter Flammschutzmittel. Bd. 1: Ergebnisse und zusammenfassende Uebersicht

    Energy Technology Data Exchange (ETDEWEB)

    Leisewitz, A.; Kruse, H.; Schramm, E.


    /Elektronik, Schienenfahrzeugbereich, Textil-/Polstermoebelindustrie. Parallel dazu werden dreizehn Flammschutzmittel hinsichtlich Mengenstrom, Anwendungen und Toxikologie/Oekotoxikologie charakterisiert. Bd. I: Ergebniszusammenfassung zu Flammschutzmitteleinsatz in Deutschland 1999/2000; Charakterisierung von 13 FSM nach Stoff- und Anwendungseigenschaften, Einsatzspektrum, Mengen; Ableitung von Bewertungsgrundlagen fuer FSM mit Schwergewicht auf Toxikologie/Oekotoxikologie, Kreislauffaehigkeit, Substitutions- und Minderungspotentialen; zusammenfassende Stoffbewertung zu 13 FSM; zusammenfassende Uebersicht zu FSM-Anwendungen. Bd. II: Anwendungsuntersuchungen (Stand der Technik, Trend, Alternativen) zu FSM bei UP-Harzen (Schienenfahrzeuge), bei PU-Daemm- und Montageschaeumen (Baubereich); bei Kunststoffen fuer E+E-Geraete insgesamt, Aussengehaeusen fuer E+E-Geraete und Leiterplatten (Elektro/Elektronikindustrie); bei Polstermoebeln/Matratzen (Textilanwendungen). Bd. III: Toxikologisch/oekotoxikologische Stoffprofile Decabromdiphenylether, Tetrabrombisphenol A; Bis[pentabromphenyl]ethan; Hexabromcyclododecan, Tris[chlorpropyl]phosphat, Resorcinol-bis-diphenyl-phosphat; N-Hydroxymethyl-3-dimethylphosphonpropionamid, roter Phosphor, Ammoniumpolyphosphat, Melamincyanurat, Aluminiumtrihydroxid, Borax, Antimontrioxid. (orig.)

  15. [Delayed testing for the diagnosis of fungi in the urines. Evaluation of the BD Vacutainer C&S tubes for the storage of urine samples at room temperature]. (United States)

    Baixench, M T; Al-Sheikh, M; Paugam, A


    The study included 37 urine samples which have been artificially infected with low levels (10(3) CFU/mL) of various fungi strains. We compared the effects of sample storage, up to 48 hours, at room temperature, in a urine evacuated tube containing specific additives with storage at + 4 degrees C, for the same length of time, in a urine evacuated tube without any additives. There have been no differences of results (speed of growth and colony size) between the 2 modes of storage. However, the experience has shown that samples needed a careful mixing before seeding to avoid underdetection of the strains. Based on the study results, the BD Vacutainer C&S tubes are suitable for delayed testing for the diagnosis of urine fungal infection. PMID:16330387

  16. A common variant of staphylococcal cassette chromosome mec type IVa in isolates from Copenhagen, Denmark, is not detected by the BD GeneOhm methicillin-resistant Staphylococcus aureus assay

    DEFF Research Database (Denmark)

    Bartels, Mette Damkjaer; Boye, Kit; Rohde, Susanne Mie; Larsen, Anders Rhod; Torfs, Herbert; Bouchy, Peggy; Skov, Robert; Westh, Henrik


    Rapid tests for detection of methicillin-resistant Staphylococcus aureus (MRSA) carriage are important to limit the transmission of MRSA in the health care setting. We evaluated the performance of the BD GeneOhm MRSA real-time PCR assay using a diverse collection of MRSA isolates, mainly from...

  17. Comparison of BD Bactec Plus Blood Culture Media to VersaTREK Redox Blood Culture Media for Detection of Bacterial Pathogens in Simulated Adult Blood Cultures Containing Therapeutic Concentrations of Antibiotics▿


    Miller, Nancy S.; Rogan, Dagmar; Orr, Beverley L.; Whitney, Dana


    Antibiotic neutralization in blood culture media from two automated systems was evaluated by measuring the recovery of organisms and times to detection in simulated cultures. Overall, BD Bactec Plus media (Bactec FX system) outperformed TREK 80 ml Redox media (VersaTREK system), although results suggest a relative rather than an absolute increased rate of recovery for the Bactec media.

  18. Tracking Advanced Planetary Systems (TAPAS) with HARPS-N. III. HD 5583 and BD+15 2375 - two cool giants with warm companions (United States)

    Niedzielski, A.; Villaver, E.; Nowak, G.; Adamów, M.; Kowalik, K.; Wolszczan, A.; Deka-Szymankiewicz, B.; Adamczyk, M.; Maciejewski, G.


    Context. Evolved stars are crucial pieces for our understanding of the dependency of the planet formation mechanism on the stellar mass and for exploring the mechanism involved in star-planet interactions more deeply. Over the last ten years, we have monitored about 1000 evolved stars for radial velocity variations in the search for low-mass companions under the Penn State - Torun Centre for Astronomy Planet Search program with the Hobby-Eberly Telescope (HET). Selected prospective candidates that required higher RV precision measurements were followed with HARPS-N at the 3.6 m Telescopio Nazionale Galileo under the TAPAS project. Aims: We aim to detect planetary systems around evolved stars to be able to build sound statistics on the frequency and intrinsic nature of these systems, and to deliver in-depth studies of selected planetary systems with evidence of star-planet interaction processes. Methods: For HD 5583 we obtained 14 epochs of precise RV measurements that were collected over 2313 days with the HET, and 22 epochs of ultra-precise HARPS-N data collected over 976 days. For BD+15 2375 we collected 24 epochs of HET data over 3286 days and 25 epochs of HARPS-S data over 902 days. Results: We report the discovery of two planetary mass objects that are orbiting two evolved red giant stars: HD 5583 has a msini = 5.78MJ companion at 0.529 AU in a nearly circular orbit (e = 0.076), the closest companion to a giant star detected with the RV technique, and BD+15 2735 that, with a msini = 1.06MJ, holds the record for the lightest planet orbiting an evolved star found so far (in a circular e = 0.001, 0.576 AU orbit). These are the third and fourth planets found within the TAPAS project, a HARPS-N monitoring of evolved planetary systems identified with the HET. Based on observations obtained with the Hobby-Eberly Telescope, which is a joint project of the University of Texas at Austin, the Pennsylvania State University, Stanford University, Ludwig

  19. Hairy root induction and phytoremediation of textile dye, Reactive green 19A-HE4BD, in a halophyte, Sesuvium portulacastrum (L. L.

    Directory of Open Access Journals (Sweden)

    Vinayak H. Lokhande


    Full Text Available In this study, we report phytoremediation of textile dyes using hairy roots derived through Agrobacterium rhizogenes (NCIM 5140 infection of in vitro leaf and stem explants of a halophyte Sesuvium portulacastrum (L. L. Leaf explants showed higher frequency of hairy root induction (70% than stem explants (30%, and maximum number of roots (leaf 42.3 ± 2.4 and stem 50.3 ± 1.7. Transformed nature of hairy roots was ascertained by amplifying 970 bp region of T-DNA of Ri plasmid. Hairy roots were screened for phytoremediation of various textile dyes and results showed that HRs were able to degrade Reactive green 19A HE4BD upto 98% within 5 days of incubation. Spectrophotometric analysis showed decrease in dye concentration while HPLC and FTIR analysis confirmed its degradation. Seed germination assay demonstrated non-toxic nature of the extracted metabolites. This is the first report on induction of hairy root culture in Sesuvium portulacastrum and phytoremediation of textile dyes.

  20. Search for $B_s \\rightarrow \\mu^{+}\\mu^{-}$ and $B_d \\rightarrow \\mu^{+}\\mu^{-}$ decays with the full CDF Run II data set

    CERN Document Server

    Aaltonen, T; Amidei, D; Anastassov, A; Annovi, A; Antos, J; Apollinari, G; Appel, J A; Arisawa, T; Artikov, A; Asaadi, J; Ashmanskas, W; Auerbach, B; Aurisano, A; Azfar, F; Badgett, W; Bae, T; Barbaro-Galtieri, A; Barnes, V E; Barnett, B A; Barria, P; Bartos, P; Bauce, M; Bedeschi, F; Behari, S; Bellettini, G; Bellinger, J; Benjamin, D; Beretvas, A; Bhatti, A; Bland, K R; Blumenfeld, B; Bocci, A; Bodek, A; Bortoletto, D; Boudreau, J; Boveia, A; Brigliadori, L; Bromberg, C; Brucken, E; Budagov, J; Budd, H S; Burkett, K; Busetto, G; Bussey, P; Butti, P; Buzatu, A; Calamba, A; Camarda, S; Campanelli, M; Canelli, F; Carls, B; Carlsmith, D; Carosi, R; Carrillo, S; Casal, B; Casarsa, M; Castro, A; Catastini, P; Cauz, D; Cavaliere, V; Cavalli-Sforza, M; Cerri, A; Cerrito, L; Chen, Y C; Chertok, M; Chiarelli, G; Chlachidze, G; Chokheli, D; Cho, K; Ciocci, M A; Clark, A; Clarke, C; Convery, M E; Conway, J; Corbo, M; Cordelli, M; Cox, C A; Cox, D J; Cremonesi, M; Cruz, D; Cuevas, J; Culbertson, R; d'Ascenzo, N; Datta, M; de Barbaro, P; Demortier, L; Deninno, M; d'Errico, M; Devoto, F; Di Canto, A; Di Ruzza, B; Dittmann, J R; Donati, S; D'Onofrio, M; Dorigo, M; Driutti, A; Ebina, K; Edgar, R; Elagin, A; Erbacher, R; Errede, S; Esham, B; Eusebi, R; Farrington, S; Fernandez Ramos, J P; Field, R; Flanagan, G; Forrest, R; Franklin, M; Freeman, J C; Frisch, H; Funakoshi, Y; Garfinkel, A F; Garosi, P; Gerberich, H; Gerchtein, E; Giagu, S; Giakoumopoulou, V; Gibson, K; Ginsburg, C M; Giokaris, N; Giromini, P; Giurgiu, G; Glagolev, V; Glenzinski, D; Goldin, D; Gold, M; Golossanov, A; Gomez-Ceballos, G; Gomez, G; Goncharov, M; Gonzalez Lopez, O; Gorelov, I; Goshaw, A T; Goulianos, K; Gramellini, E; Grinstein, S; Grosso-Pilcher, C; Group, R C; Guimaraes da Costa, J; Hahn, S R; Han, J Y; Happacher, F; Hara, K; Hare, M; Harrington-Taber, T; Harr, R F; Hatakeyama, K; Hays, C; Heinrich, J; Herndon, M; Hocker, A; Hong, Z; Hopkins, W; Hou, S; Hughes, R E; Husemann, U; Huston, J; Introzzi, G; Iori, M; Ivanov, A; James, E; Jang, D; Jayatilaka, B; Jeon, E J; Jindariani, S; Jones, M; Joo, K K; Junk, T R; Jun, S Y; Kambeitz, M; Kamon, T; Karchin, P E; Kasmi, A; Kato, Y; Ketchum, W; Keung, J; Kilminster, B; Kim, D H; Kim, H S; Kim, J E; Kim, M J; Kim, S B; Kim, S H; Kimura, N; Kim, Y J; Kim, Y K; Kirby, M; Knoepfel, K; Kondo, K; Kong, D J; Konigsberg, J; Kotwal, A V; Kreps, M; Kroll, J; Kruse, M; Kuhr, T; Kurata, M; Laasanen, A T; Lammel, S; Lancaster, M; Lannon, K; Latino, G; Lee, H S; Lee, J S; Leone, S; Leo, S; Lewis, J D; Limosani, A; Lipeles, E; Liu, H; Liu, Q; Liu, T; Lockwitz, S; Loginov, A; Lucchesi, D; Lueck, J; Lujan, P; Lukens, P; Lungu, G; Lysak, R; Lys, J; Madrak, R; Maestro, P; Malik, S; Manca, G; Manousakis-Katsikakis, A; Margaroli, F; Marino, P; Martinez, M; Matera, K; Mattson, M E; Mazzacane, A; Mazzanti, P; McNulty, R; Mehta, A; Mehtala, P; Mesropian, C; Miao, T; Mietlicki, D; Mitra, A; Miyake, H; Moed, S; Moggi, N; Moon, C S; Moore, R; Morello, M J; Mukherjee, A; Muller, Th; Murat, P; Mussini, M; Nachtman, J; Nagai, Y; Naganoma, J; Nakano, I; Napier, A; Nett, J; Neu, C; Nigmanov, T; Nodulman, L; Noh, S Y; Norniella, O; Oakes, L; Oh, S H; Oh, Y D; Oksuzian, I; Okusawa, T; Orava, R; Ortolan, L; Pagliarone, C; Palencia, E; Palni, P; Papadimitriou, V; Parker, W; Pauletta, G; Paulini, M; Paus, C; Phillips, T J; Piacentino, G; Pianori, E; Pilot, J; Pitts, K; Plager, C; Pondrom, L; Poprocki, S; Potamianos, K; Pranko, A; Prokoshin, F; Ptohos, F; Punzi, G; Ranjan, N; Redondo Fernandez, I; Renton, P; Rescigno, M; Riddick, T; Rimondi, F; Ristori, L; Robson, A; Rodriguez, T; Rolli, S; Ronzani, M; Roser, R; Rosner, J L; Ruffini, F; Ruiz, A; Russ, J; Rusu, V; Safonov, A; Sakumoto, W K; Sakurai, Y; Santi, L; Sato, K; Saveliev, V; Savoy-Navarro, A; Schlabach, P; Schmidt, E E; Schwarz, T; Scodellaro, L; Scuri, F; Seidel, S; Seiya, Y; Semenov, A; Sforza, F; Shalhout, S Z; Shears, T; Shepard, P F; Shimojima, M; Shochet, M; Shreyber-Tecker, I; Simonenko, A; Sinervo, P; Sliwa, K; Smith, J R; Snider, F D; Song, H; Sorin, V; Sperka, D; Stancari, M; St. Denis, R; Stelzer, B; Stelzer-Chilton, O; Stentz, D; Strologas, J; Sudo, Y; Sukhanov, A; Suslov, I; Takemasa, K; Takeuchi, Y; Tang, J; Tecchio, M; Teng, P K; Thom, J; Thomson, E; Thukral, V; Toback, D; Tokar, S; Tollefson, K; Tomura, T; Tonelli, D; Torre, S; Torretta, D; Totaro, P; Trovato, M; Ukegawa, F; Uozumi, S; Vazquez, F; Velev, G; Vellidis, C; Vernieri, C; Vidal, M; Vilar, R; Vizan, J; Vogel, M; Volpi, G; Wagner, P; Wallny, R; Wang, S M; Warburton, A; Waters, D; Wester, W C, III; Whiteson, D; Wicklund, A B; Wilbur, S; Williams, H H; Wilson, J S; Wilson, P; Winer, B L; Wittich, P; Wolbers, S; Wolfe, H; Wright, T; Wu, X; Wu, Z; Yamamoto, K; Yamato, D; Yang, T; Yang, U K; Yang, Y C; Yao, W M; Yeh, G P; Yi, K; Yoh, J; Yorita, K; Yoshida, T; Yu, G B; Yu, I; Zanetti, A M; Zeng, Y; Zhou, C; Zucchelli, S


    We report on a search for \\bsmm\\ and \\bdmm\\ decays using proton-antiproton collision data at $\\sqrt{s}=1.96$~TeV corresponding to $10~\\fb$ of integrated luminosity collected by the CDF detector at the Fermilab Tevatron collider. The observed number of \\bd\\ candidates is consistent with background-only expectations and yields an upper limit on the branching fraction of $\\brbdmm < 4.6\\times 10^{-9}$ at 95\\% confidence level. We observe an excess of \\bs\\ candidates. The probability that the background processes alone could produce such an excess or larger is $0.94\\%$. The probability that the combination of background and the expected standard model rate of \\bsmm\\ could produce such an excess or larger is $6.8\\%$. These data are used to determine a branching fraction $\\brbsmm = (1.3^{+0.9}_{-0.7}) \\times 10^{-8} $ and provide an upper limit of $\\brbsmm < 3.1\\times 10^{-8}$ at 95\\% confidence level.

  1. The Design and Production of the LHCb VELO High Voltage System and Analysis of the Bd ⇒ K*μ+μ- Rare Decay

    CERN Document Server

    Rakotomiaramanana, Barinjaka Mamitiana; Soler, P


    LHCb is the dedicated flavour physics experiment of the LHC. The experiment is designed for probing new physics through measurements of CP violation and rare decays. This thesis includes simulation studies of the Bd ⇒ K*μ+μ- decay. The LHCb vertex locator (VELO) is the highest precision tracking detector at the LHC and is used to identify primary and secondary vertices for the identification of the $b$ and $c$ hadrons. The VELO modules contain silicon strip detectors which must be operated under reverse bias voltage. This thesis presents the work performed on the design, production and characterisation of the VELO high voltage system. The VELO operates only 8\\mm~from the LHC beam in a high radiation environment. A future upgrade will require operation at up to 10$^{16}$ n_{eq}cm^{-2}.This thesis presents a characterisation of p-type silicon sensors before and after heavy irradiations. The design of the HV system and the substantial programme of quality assurance tests performed on both the hardware and so...

  2. Sleep Functioning in Relation to Mood, Function, and Quality of Life at Entry to the Systematic Treatment Enhancement Program for Bipolar Disorder (STEP-BD) (United States)

    Gruber, June; Harvey, Allison G.; Wang, Po W.; Brooks, John O.; Thase, Michael E.; Sachs, Gary S.; Ketter, Terence A.


    Background Sleep disturbance in bipolar disorder can be both a risk factor and symptom of mood episodes. However, the associations among sleep and clinical characteristics, function, and quality of life in bipolar disorder have not been fully investigated. Methods The prevalence of sleep disturbance, duration, and variability, as well as their associations with mood, function, and quality of life, was determined from 2,024 bipolar patients enrolled in the National Institute of Mental Health Systematic Treatment Enhancement Program for Bipolar Disorder (STEP-BD). Results Analyses indicated that 32% of patients were classified as short sleepers, 38% normal sleepers, and 23% long sleepers. Overall, short sleepers demonstrated greater mood elevation, earlier age at onset, and longer illness duration compared to both normal and long sleepers. Both short and long sleepers had greater depressive symptoms, poorer life functioning, and quality of life compared to normal sleepers. Discussion Short sleep duration in bipolar disorder was associated with a more severe symptom presentation, whereas both short and long sleep duration are associated with poorer function and quality of life compared to normal sleep duration. Sleep disturbance could be a trait marker of bipolar disorder, though longitudinal assessments are warranted to assess potential causal relations and the longer-term implications of sleep disturbance in bipolar disorder PMID:18707765

  3. Protein Binding between PcrG-PcrV and PcrH-PopB/PopD Encoded by the pcrGVH-popBD Operon of the Pseudomonas aeruginosa Type III Secretion System


    Allmond, Leonard R.; Karaca, Timur J.; Nguyen, Vinh N.; Nguyen, Thong; Wiener-Kronish, Jeanine P.; Sawa, Teiji


    Of the proteins encoded by the pcrGVH-popBD operon of the Pseudomonas aeruginosa type III secretion system, PcrG bound to PcrV and PcrH bound to PopB/PopD. In addition, Yersinia LcrG bound to PcrV, and Yersinia LcrH bound to PopD. The results imply a highly functional conservation of type III secretion between P. aeruginosa and Yersinia species.

  4. Comparison of BD Max Cdiff and GenomEra C. difficile molecular assays for detection of toxigenic Clostridium difficile from stools in conventional sample containers and in FecalSwabs. (United States)

    Hirvonen, J J; Kaukoranta, S-S


    In this study, the usability and performance of GenomEra™ C. difficile and BD Max™ Cdiff nucleic acid amplification tests (NAATs) for the detection of toxigenic Clostridium difficile were investigated in comparison with toxigenic culture and C. difficile toxin A- and toxin B-detecting immunochromatographic antigen (IA) test, the Tox A/B QuikChek®. In total, 302 faecal specimens were collected, 113 of which were in parallel to conventional sample containers and FecalSwab liquid-based microbiology (LBM) tubes. Seventy-nine specimens were considered true-positives for toxigenic C. difficile. The sensitivity and specificity were 97.5 % and 99.6 % and 93.7 % and 98.7 % for the GenomEra and BD Max assays respectively. Toxigenic culture and Tox A/B QuikChek had sensitivity and specificity of 91.1 % and 100 % and 34.2 % and 100 % respectively. Hands-on time for analysing 1 to 24 specimens using NAATs was 1 to 15 min. The rate of PCR inhibition was 0 % for both NAATs with faeces in LBM tubes, while with faeces in conventional sample containers the respective inhibition rates were 5.3 % and 4.4 % for the GenomEra and the BD Max assays. The NAATs demonstrated an excellent analytical performance, reducing significantly the overall workload of laboratory personnel compared with culture and IA test. PMID:25616552

  5. Recoding of the stop codon UGA to glycine by a BD1-5/SN-2 bacterium and niche partitioning between Alpha- and Gammaproteobacteria in a tidal sediment microbial community naturally selected in a laboratory chemostat

    Directory of Open Access Journals (Sweden)



    Full Text Available Sandy coastal sediments are global hotspots for microbial mineralization of organic matter and denitrification. These sediments are characterized by advective porewater flow, tidal cycling and an active and complex microbial community. Metagenomic sequencing of microbial communities sampled from such sediments showed that potential sulfur oxidizing Gammaproteobacteria and members of the enigmatic BD1-5/SN-2 candidate phylum were abundant in situ (>10% and ~2% respectively. By mimicking the dynamic oxic/anoxic environmental conditions of the sediment in a laboratory chemostat, a simplified microbial community was selected from the more complex inoculum. Metagenomics, proteomics and fluorescence in situ hybridization showed that this simplified community contained both a potential sulfur oxidizing Gammaproteobacterium (at 24±2% abundance and a member of the BD1-5/SN-2 candidate phylum (at 7±6% abundance. Despite the abundant supply of organic substrates to the chemostat, proteomic analysis suggested that the selected gammaproteobacterium grew partially autotrophically and performed hydrogen/formate oxidation. The enrichment of a member of the BD1-5/SN-2 candidate phylum enabled, for the first time, direct microscopic observation by fluorescent in situ hybridization and the experimental validation of the previously predicted translation of the stop codon UGA into glycine.

  6. Recoding of the stop codon UGA to glycine by a BD1-5/SN-2 bacterium and niche partitioning between Alpha- and Gammaproteobacteria in a tidal sediment microbial community naturally selected in a laboratory chemostat

    Energy Technology Data Exchange (ETDEWEB)

    Hanke, Anna [Max Planck Institute for Marine Microbiology; Hamann, Emmo [Max Planck Institute for Marine Microbiology; Sharma, Ritin [ORNL; Geelhoed, Jeanine [Max Planck Institute for Marine Microbiology; Hargesheimer, Theresa [Max Planck Institute for Marine Microbiology; Kraft, Beate [Max Planck Institute for Marine Microbiology; Meyer, Volker [Max Planck Institute for Marine Microbiology; Lenk, Sabine [Max Planck Institute for Marine Microbiology; Osmers, Harald [Max Planck Institute for Marine Microbiology; Wu, Rong [Delft University of Technology, Delft, Netherlands; Makinwa, Kofi [Delft University of Technology, Delft, Netherlands; Hettich, Robert {Bob} L [ORNL; Banfield, Jillian F. [University of California, Berkeley; Tegetmeyer, Halina [Max Planck Institute for Marine Microbiology; Strouss, Marc [University of Calgary, ALberta, Canada


    Sandy coastal sediments are global hot spots for microbial mineralization of organic matter and denitrification. These sediments are characterized by advective pore water flow, tidal cycling and an active and complex microbial community. Metagenomic sequencing of microbial communities sampled from such sediments showed that potential sulfuroxidizing Gammaproteobacteria and members of the enigmaticBD1-5/ SN-2 candidatephylumwereabundantinsitu (>10% and 2% respectively). By mimicking the dynamic oxic/anoxic environmental conditions of the sedimentin a laboratory chemostat, a simplified microbial community was selected from the more complex inoculum. Metagenomics, proteomics and fluorescenceinsituhybridization showed that this simplified community contained both a potential sulfuroxidizing Gamma proteobacteria (at 24 2% abundance) and a member of the BD1-5 / SN-2candidatephylum (at 7 6%abundance). Despite the abundant supply of organic substrates to the chemostat, proteomic analysis suggested that the selected gamma proteobacterium grew partially auto trophically and performed hydrogen/formate oxidation. The enrichment of a member of the BD1-5/SN-2candidatephylum enabled, for the first time, direct microscopic observation by fluorescent insitu hybridization and the experimental validation of the previously predicted translation of the stop codon UGA into glycine.

  7. Affinity composite cryogel discs functionalized with Reactive Red 120 and Green HE 4BD dye ligands: Application on the separation of human immunoglobulin G subclasses

    Energy Technology Data Exchange (ETDEWEB)

    Huseynli, Sabina; Baydemir, Gözde; Sarı, Esma [Department of Chemistry, Biochemistry Division, Hacettepe University, Ankara (Turkey); Elkak, Assem [Laboraory of “Valorisation des Ressources Naturelles et Produits de Santé (VRNPS)”, Doctoral School of Sciences and Technology, Lebanese University, Rafic Hariri University Campus, Hadath (Lebanon); Denizli, Adil, E-mail: [Department of Chemistry, Biochemistry Division, Hacettepe University, Ankara (Turkey)


    Naturally produced by the human immune system, immunoglobulin nowadays is widely used for in vivo and in vitro purposes. The increased needs for pure immunoglobulin have prompted researchers to find new immunoglobulin chromatographic separation processes. Cryogels as chromatographic adsorbents, congregate several mechanical features including good compatibility, large pore structure, flexibility, short diffusion pathway and stability. These different characteristics make them a good alternative to conventional chromatographic methods and allowing their potential use in separation technology. In the present study, two sets of poly(2-hydroxyethyl methacrylate) (PHEMA) based beads were prepared and functionalized with Reactive Red 120 (RR) and Reactive Green HE 4BD (RG) dyes, and then embedded into supermacroporous cryogels. The morphology, physical and chemical features of the prepared bead embedded composite cryogel discs (CCDs) were performed by scanning electron microscopy (SEM), swelling test, elemental analysis and Fourier transform infrared spectroscopy (FTIR). The results showed that the embedded composite cryogel discs have a specific surface area of 192.0 m{sup 2}/g with maximum adsorption capacity of HIgG 239.8 mg/g for the RR functionalized CCD and 170 mg/g for RG functionalized CCD columns, both at pH 6.2. - Highlights: • Dye attached composite cryogel discs were prepared to separate HIgG subclasses. • Composite cryogels characterized by swelling, FTIR, SEM and elemental analysis. • Reactive Green HE 4B and Reactive Red 120 dyes were used as the affinity ligand. • HIgG and subclasses were separate from both aqueous solution and human plasma.

  8. Comparative quantification of umbilical cord blood CD34+ and CD34+ bright cells using the ProCount™-BD and ISHAGE protocols

    Directory of Open Access Journals (Sweden)

    P. Pranke


    Full Text Available The total number of CD34+ cells is the most relevant clinical parameter when selecting human umbilical cord blood (HUCB for transplantation. The objective of the present study was to compare the two most commonly used CD34+ cell quantification methods (ISHAGE protocol and ProCount™ - BD and analyze the CD34+ bright cells whose 7-amino actinomycin D (7AAD analysis suggests are apoptotic or dead cells. Twenty-six HUCB samples obtained at the Placental Blood Program of New York Blood Center were evaluated. The absolute numbers of CD34+ cells evaluated by the ISHAGE (with exclusion of 7AAD+ cells and ProCount™ (with exclusion of CD34+ bright cells were determined. Using the ISHAGE protocol we found 35.6 ± 19.4 CD34+ cells/µL and with the ProCount™ method we found 36.6 ± 23.2 CD34+ cells/µL. With the ProCount™ method, CD34+ bright cell counts were 9.3 ± 8.2 cells/µL. CD34+ bright and regular cells were individually analyzed by the ISHAGE protocol. Only about 1.8% of the bright CD34+ cells are alive, whereas a small part (19.0% is undergoing apoptosis and most of them (79.2% are dead cells. Our study showed that the two methods produced similar results and that 7AAD is important to exclude CD34 bright cells. These results will be of value to assist in the correct counting of CD34+ cells and to choose the best HUCB unit for transplantation, i.e., the unit with the greatest number of potentially viable stem cells for the reconstitution of bone marrow. This increases the likelihood of success of the transplant and, therefore, the survival of the patient.

  9. Affinity composite cryogel discs functionalized with Reactive Red 120 and Green HE 4BD dye ligands: Application on the separation of human immunoglobulin G subclasses

    International Nuclear Information System (INIS)

    Naturally produced by the human immune system, immunoglobulin nowadays is widely used for in vivo and in vitro purposes. The increased needs for pure immunoglobulin have prompted researchers to find new immunoglobulin chromatographic separation processes. Cryogels as chromatographic adsorbents, congregate several mechanical features including good compatibility, large pore structure, flexibility, short diffusion pathway and stability. These different characteristics make them a good alternative to conventional chromatographic methods and allowing their potential use in separation technology. In the present study, two sets of poly(2-hydroxyethyl methacrylate) (PHEMA) based beads were prepared and functionalized with Reactive Red 120 (RR) and Reactive Green HE 4BD (RG) dyes, and then embedded into supermacroporous cryogels. The morphology, physical and chemical features of the prepared bead embedded composite cryogel discs (CCDs) were performed by scanning electron microscopy (SEM), swelling test, elemental analysis and Fourier transform infrared spectroscopy (FTIR). The results showed that the embedded composite cryogel discs have a specific surface area of 192.0 m2/g with maximum adsorption capacity of HIgG 239.8 mg/g for the RR functionalized CCD and 170 mg/g for RG functionalized CCD columns, both at pH 6.2. - Highlights: • Dye attached composite cryogel discs were prepared to separate HIgG subclasses. • Composite cryogels characterized by swelling, FTIR, SEM and elemental analysis. • Reactive Green HE 4B and Reactive Red 120 dyes were used as the affinity ligand. • HIgG and subclasses were separate from both aqueous solution and human plasma

  10. Multicenter evaluation of the BD max enteric bacterial panel PCR assay for rapid detection of Salmonella spp., Shigella spp., Campylobacter spp. (C. jejuni and C. coli), and Shiga toxin 1 and 2 genes. (United States)

    Harrington, S M; Buchan, B W; Doern, C; Fader, R; Ferraro, M J; Pillai, D R; Rychert, J; Doyle, L; Lainesse, A; Karchmer, T; Mortensen, J E


    Diarrhea due to enteric bacterial pathogens causes significant morbidity and mortality in the United States and worldwide. However, bacterial pathogens may be infrequently identified. Currently, culture and enzyme immunoassays (EIAs) are the primary methods used by clinical laboratories to detect enteric bacterial pathogens. We conducted a multicenter evaluation of the BD Max enteric bacterial panel (EBP) PCR assay in comparison to culture for the detection of Salmonella spp., Shigella spp., Campylobacter jejuni, and Campylobacter coli and an EIA for Shiga toxins 1 and 2. A total of 4,242 preserved or unpreserved stool specimens, including 3,457 specimens collected prospectively and 785 frozen, retrospective samples, were evaluated. Compared to culture or EIA, the positive percent agreement (PPA) and negative percent agreement (NPA) values for the BD Max EBP assay for all specimens combined were as follows: 97.1% and 99.2% for Salmonella spp., 99.1% and 99.7% for Shigella spp., 97.2% and 98.4% for C. jejuni and C. coli, and 97.4% and 99.3% for Shiga toxins, respectively. Discrepant results for prospective samples were resolved with alternate PCR assays and bidirectional sequencing of amplicons. Following discrepant analysis, PPA and NPA values were as follows: 97.3% and 99.8% for Salmonella spp., 99.2% and 100% for Shigella spp., 97.5% and 99.0% for C. jejuni and C. coli, and 100% and 99.7% for Shiga toxins, respectively. No differences in detection were observed for samples preserved in Cary-Blair medium and unpreserved samples. In this large, multicenter study, the BD Max EBP assay showed superior sensitivity compared to conventional methods and excellent specificity for the detection of enteric bacterial pathogens in stool specimens. PMID:25740779

  11. Simultaneous determination of gamma-Hydroxybutyrate (GHB) and its analogues (GBL, 1.4-BD, GVL) in whole blood and urine by liquid chromatography coupled to tandem mass spectrometry

    DEFF Research Database (Denmark)

    Johansen, Sys Stybe; Windberg, Charlotte Norup


    A simple liquid chromatography-tandem mass spectrometry (LC-MS-MS) method has been developed and validated for simultaneous identification and quantification of ¿-hydroxybutyrate (GHB), ¿-butyrolactone (GBL), 1.4-butanediol (1.4-BD), and ¿-valerolactone (GVL) in whole blood from forensic cases. The...... sample preparation of whole blood involved protein precipitation by acidic methanol. Urine samples were diluted and evaluated in relation to a control at the cutoff concentration. Hexadeutero GHB (GHB-d(6)) was used as the internal standard. Separation was achieved by reversed-phase chromatography, and...

  12. The discovery of a new infrared emission feature at 1905 wavenumbers (5.25 microns) in the spectrum of BD + 30 deg 3639 and its relation to the polycyclic aromatic hydrocarbon model (United States)

    Allamandola, L. J.; Bregman, J. D.; Sandford, S. A.; Tielens, A. G. G. M.; Witteborn, F. C.


    A new IR emission feature at 1905/cm (5.25 microns) has been discovered in the spectrum of BD + 30 deg 3639. This feature joins the family of well-known IR emission features at 3040, 2940, 1750, 1610, '1310', 1160, and 890/cm. The origin of this new feature is discussed and it is assigned to an overtone or combination band involving C-H bending modes of polycyclic aromatic hydrocarbons (PAHs). Laboratory work suggests that spectral studies of the 2000-1650/cm region may be very useful in elucidating the molecular structure of interstellar PAHs. The new feature, in conjunction with other recently discovered spectral structures, suggests that the narrow IR emission features originate in PAH molecules rather than large carbon grains.

  13. Insights into the Hydrocarbon Tolerance of Two Devosia Isolates, D. chinhatensis Strain IPL18T and D. geojensis Strain BD-c194T, via Whole-Genome Sequence Analysis. (United States)

    Hassan, Yousef I; Lepp, Dion; Li, Xiu-Zhen; Zhou, Ting


    Hexachlorocyclohexane (HCH) was among the most commonly used pesticides after the Second World War. The extensive use of this hydrocarbon for almost six decades has created a contamination problem on a global scale, and bioremediation methods are being extensively explored. The reported ability of some Devosia species to grow in the presence of appreciable amounts of hydrocarbons (2,000 mg/kg of contaminated soil) is attracting closer attention. Here, we report the de novo genome assembly of two hydrocarbon-tolerating Devosia isolates, D. chinhatensis strain IPL18(T) and D. geojensis strain BD-c194(T), as a first step toward understanding the metabolic pathways involved in their environmental adaptation and tolerance toward hydrocarbons. PMID:26251505


    Energy Technology Data Exchange (ETDEWEB)

    Hareter, M.; Weiss, W. [Department of Astronomy, University of Vienna, Tuerkenschanzstrasse 17, A-1180 Wien (Austria); Fossati, L. [Department of Physics and Astronomy, Open University, Walton Hall, Milton Keynes MK6 7AA (United Kingdom); Suarez, J. C. [Instituto de Astrofisica de Andalucia (CSIC), Glorieta de la Astronomia S/N, 18008, Granada (Spain); Uytterhoeven, K. [Kiepenheuer-Institut fuer Sonnenphysik, Schoeneckstr. 6, D-79104 Freiburg (Germany); Rainer, M.; Poretti, E., E-mail: [INAF-Osservatorio Astronomico di Brera, Via E. Bianchi 46, 23807, Merate (Saint Lucia) (Italy)


    {delta} Sct-{gamma} Dor hybrids pulsate simultaneously in p- and g-modes, which carry information on the structure of the envelope as well as to the core. Hence, they are key objects for investigating A and F type stars with asteroseismic techniques. An important requirement for seismic modeling is small errors in temperature, gravity, and chemical composition. Furthermore, we want to investigate the existence of an abundance indicator typical for hybrids, something that is well established for the roAp stars. Previous to the present investigation, the abundance pattern of only one hybrid and another hybrid candidate has been published. We obtained high-resolution spectra of HD 114839 and BD +18 4914 using the SOPHIE spectrograph of the Observatoire de Haute-Provence and the HARPS spectrograph at ESO La Silla. For each star we determined fundamental parameters and photospheric abundances of 16 chemical elements by comparing synthetic spectra with the observations. We compare our results to that of seven {delta} Sct and nine {gamma} Dor stars. For the evolved BD +18 4914 we found an abundance pattern typical for an Am star, but could not confirm this peculiarity for the less evolved star HD 114839, which is classified in the literature as uncertain Am star. Our result supports the concept of evolved Am stars being unstable. With our investigation we nearly doubled the number of spectroscopically analyzed {delta} Sct-{gamma} Dor hybrid stars, but did not yet succeed in identifying a spectroscopic signature for this group of pulsating stars. A statistically significant spectroscopic investigation of {delta} Sct- {gamma} Dor hybrid stars is still missing, but would be rewarding considering the asteroseismological potential of this group.

  15. Simultaneous high-resolution pH and spectrophotometric recordings of oxygen binding in blood microvolumes. (United States)

    Oellermann, Michael; Pörtner, Hans-O; Mark, Felix C


    Oxygen equilibrium curves have been widely used to understand oxygen transport in numerous organisms. A major challenge has been to monitor oxygen binding characteristics and concomitant pH changes as they occur in vivo, in limited sample volumes. Here we report a technique allowing highly resolved and simultaneous monitoring of pH and blood pigment saturation in minute blood volumes. We equipped a gas diffusion chamber with a broad-range fibre-optic spectrophotometer and a micro-pH optode and recorded changes of pigment oxygenation along oxygen partial pressure (PO2) and pH gradients to test the setup. Oxygen binding parameters derived from measurements in only 15 μl of haemolymph from the cephalopod Octopus vulgaris showed low instrumental error (0.93%) and good agreement with published data. Broad-range spectra, each resolving 2048 data points, provided detailed insight into the complex absorbance characteristics of diverse blood types. After consideration of photobleaching and intrinsic fluorescence, pH optodes yielded accurate recordings and resolved a sigmoidal shift of 0.03 pH units in response to changing PO2 from 0 to 21 kPa. Highly resolved continuous recordings along pH gradients conformed to stepwise measurements at low rates of pH changes. In this study we showed that a diffusion chamber upgraded with a broad-range spectrophotometer and an optical pH sensor accurately characterizes oxygen binding with minimal sample consumption and manipulation. We conclude that the modified diffusion chamber is highly suitable for experimental biologists who demand high flexibility, detailed insight into oxygen binding as well as experimental and biological accuracy combined in a single setup. PMID:24436387

  16. The effects of a family non-universal Z' boson in the B-bars→πK, πK*, ρK decays and Bd-B-bard mixing

    International Nuclear Information System (INIS)

    We revisit B-bars→πK, πK* and ρK decays within QCDF formalism and examine the possible effects of a family non-universal Z' boson in these decays. In our evaluations, the strong constraints from Bd-B-bard mixing on the strength of the left-handed flavor-changing d-b-Z' coupling BdbL (∼0.2x10-3) is also included. Numerically, we find that a new weak phase φdL∼-50o involved in BdbL, the negative combination of the u-u-Z' and d-d-Z' couplings PudR and/or DudL with larger absolute value are crucial to improve the agreement of B(B-bars→π-K+) between the SM prediction and the experimental measurement. Generally, B(B-bars→π-K+) could be reduced by about 18% at most by Z' contributions. Moreover, combining with the recent updated measurement on βs by CDF and D0 Collaborations, we also find that Z' effects in B-bars→π-K+ decays are very important for examining whether the CKM-like hierarchy persists in a family non-universal Z' coupling matrix.

  17. 用二乙烯基苯与丁苯共聚方法研制充油SSBR%The study and preparation of oil-extended SSBR with copolymerization of BD-ST-DVB

    Institute of Scientific and Technical Information of China (English)

    计福春; 李伟; 王雪; 刘天鹤; 梁爱民


    在n-BuLi/THF引发体系中,采用DVB与丁二烯、苯乙烯共聚方法合成高门尼、多支化的SSBR.考察了共聚单体组分的活性大小、DVB用量及反应时间对聚合物支化度的影响并用该共聚物制备充油SSBR.结果表明Kp″(p-DVB)> Kp″(m-DVB)> Kp″(Bd)> Kp″(St)> Kp″(m-EVB)> Kp″(p-EVB).DVB用量、反应时间增加,聚合物的支化度增大,分子量分布加宽.填充不同油品制备的充油SSBR和国内外同类产品相比综合性能优异.用"一步合成法"合成高门尼SSBR,工艺方法简单,门尼粘度及支化度控制较为稳定.

  18. Plutarque, Sur l' E de Delphes 390 B 6-8 et l'explication de  la vision en Timée 45 b-d*

    Directory of Open Access Journals (Sweden)

    Alain Lernould


    Full Text Available Le traité (ou dialogue « pythique » du platonicien Plutarque de Chéronée (Iier – IIe s. ap. J.-C. intitulé Sur l’E de Delphes est consacré à l’élucidation de la signification de l’E (la cinquième lettre de l’alphabet grec consacré à Apollon Pythien. Une des interprétations (d’inspiration pythagoricienne est que cet E désigne le nombre cinq, le nombre de l’univers. Dans le cadre de l’exposé de cette interprétation est fait état de l’opinion « de certains » selon laquelle il existe une correspondance entre les cinq sens et les cinq éléments. L’A. montre que les deux lignes où il est question de la vue (E 390b6-8 s’inspirent essentiellement de l’explication qu’en Timée 45b-d Platon donne du mécanisme de la vision en termes de mélange du feu pur émis par l’œil avec le feu pur extérieur qui produit la lumière du jour. L’extrême brièveté de ce résumé (empreint d’aristotélisme, l’élément associé à la vue étant ici l’éther considéré comme cinquième corps, d’un passage dans Platon offrant lui-même bon nombre de difficultés, explique que ces deux lignes énigmatiques n’aient jamais été bien comprises. Au passage, l’A. revient sur les notions d’homoiopatheia (d’homogénéité et de summetria (de commensurabilité en Timée 45b-d et 67c-e pour en proposer une interprétation qui souligne et éclaire d’un jour nouveau le caractère dynamique de l’explication platonicienne de la vision. Un Appendice donne un aperçu des différentes lectures d’E 390b6-8 depuis les premières éditions imprimées à la Renaissance jusqu’aux éditions critiques des 19e et 20e siècles.The essay (or dialogue On the E at Delphi of the Platonist Plutarch of Chaeronea (c. 50 – c. 125 A.D. is devoted to the elucidation of the mysterious E – the fifth letter of the Greek alphabet – that is dedicated to Apollo. According to one interpretation the E is, in a Pythagorean

  19. The discovery of a new infrared emission feature at 1905 wavenumbers (5.25 microns) in the spectrum of BD +30 degrees 3639 and its relation to the polycyclic aromatic hydrocarbon model (United States)

    Allamandola, L. J.; Bregman, J. D.; Sandford, S. A.; Tielens, A. G.; Witteborn, F. C.; Wooden, D. H.; Rank, D.


    We have discovered a new IR emission feature at 1905 cm-1 (5.25 microns) in the spectrum of BD +30 degrees 3639. This feature joins the family of well-known IR emission features at 3040, 2940, 1750, 1610, "1310," 1160, and 890 cm-1 (3.3, 3.4, 5.7, 6.2, "7.7," 8.6, and 11.2 microns). The origin of this new feature is discussed and it is assigned to an overtone or combination band involving C-H bending modes of polycyclic aromatic hydrocarbons (PAHs). Laboratory work suggests that spectral studies of the 2000-1650 cm-1 (5.0-6.1 microns) region may be very useful in elucidating the molecular structure of interstellar PAHs. The new feature, in conjunction with other recently discovered spectral structure, suggests that the narrow IR emission features originate in PAH molecules rather than large carbon grains. Larger species are likely to be the source of the broad underlying "plateaus" seen in many of the spectra.

  20. Brief introduction of the systematic treatment enhancement program for bipolar disorder%双相障碍系统治疗的增强计划(STEP-BD)简介

    Institute of Scientific and Technical Information of China (English)



    @@ 双相障碍系统治疗的增强计划(systematic treatment enhancement program for bipolar disorder,STEP-BD)是由美国国立精神卫生研究所出资进行的研究(REP98-DS-0001),以探讨治疗双相障碍有效的共同的干预模式.该研究从1999年正式启动,历时6年之久,由哈佛医学院、马萨诸塞洲医院的Sachs教授总负责.目前根据所收集的资料已发表了70余篇相关的研究文献,并且仍有资料在分析中.在此,本文对于STEP-BP的研究背景、研究目的、研究设计和主要研究结果作一简述.

  1. Prompt detection of influenza A and B viruses using the BD Veritor™ System Flu A+B, Quidel® Sofia® Influenza A+B FIA, and Alere BinaxNOW® Influenza A&B compared to real-time reverse transcription-polymerase chain reaction (RT-PCR). (United States)

    Dunn, Jim; Obuekwe, Joy; Baun, Traci; Rogers, Justin; Patel, Twinkle; Snow, Linda


    The performance characteristics of rapid influenza diagnostic tests vary widely. This study evaluated the BD Veritor™ System Flu A+B (Veritor; BD Diagnostics, Sparks, MD, USA), Quidel® Sofia® Influenza A+B FIA (Sofia; Quidel Corp., San Diego, CA, USA), and Alere BinaxNOW® Influenza A&B (Binax; Alere Scarborough, Inc., Scarborough, ME, USA) compared to reverse transcription-polymerase chain reaction (RT-PCR) for detection of influenza viruses in nasal wash specimens from 240 pediatric patients. Positive percent agreements for influenza A and B virus detection were 93.8% and 94.2%, 95.8% and 98.1%, and 79.2% and 80.8% for Veritor, Sofia, and Binax, respectively. The Veritor and Binax tests demonstrated negative percent agreements >97.9% for detection of both influenza viruses, but the negative percent agreement of the Sofia test was 91.1% for influenza A and 70.7% for influenza B virus. Overall, the Veritor and Sofia tests were nearly as sensitive as RT-PCR and considerably more sensitive than Binax for detection of influenza viruses. However, the accuracy of the Sofia test was significantly lower than either Veritor or Binax. PMID:24582581

  2. Measurement of the Semileptonic Decays B->D tau nu and B->D* tau nu

    Energy Technology Data Exchange (ETDEWEB)

    Aubert, : B.


    The authors present measurements of the semileptonic decays B{sup -} {yields} D{sup 0} {tau}{sup -} {bar {nu}}{sub {tau}}, B{sup -} {yields} D*{sup 0} {tau}{sup -}{bar {nu}}{sub {tau}}, {bar B}{sup 0} {yields} D{sup +} {tau}{sup -} {bar {nu}}{sub {tau}}, and {bar B}{sup 0} {yields} D*{sup +} {tau}{sup -}{bar {nu}}{sub {tau}}, which are sensitive to non-Standard Model amplitudes in certain scenarios. The data sample consists of 232 x 10{sup 6} {Upsilon}(4S) {yields} B{bar B} decays collected with the BABAR detector at the PEP-II e{sup +}e{sup -} collider. They select events with a D or D* meson and a light lepton ({ell} = e or {mu}) recoiling against a fully reconstructed B meson. They perform a fit to the joint distribution of lepton momentum and missing mass squared to distinguish signal B {yields} D{sup (*)}{tau}{sup -} {bar {nu}}{sub {tau}} ({tau}{sup -} {yields} {ell}{sup -} {bar {nu}}{sub {ell}}{nu}{sub {tau}}) events from the backgrounds, predominantly B {yields} D{sup (*)} {ell}{sup -}{bar {nu}}{sub {ell}}. They measure the branching-fraction ratios R(D) {triple_bond} {Beta}(B {yields} D{tau}{sup -} {bar {nu}}{sub {tau}})/{Beta}(B {yields} D{ell}{sup -} {bar {nu}}{sub {ell}}) and R(D*) {triple_bond} {Beta}(B {yields} D*{tau}{sup -} {bar {nu}}{sub {tau}})/{Beta}(B {yields} D* {ell}{sup -} {bar {nu}}{sub {ell}}) and, from a combined fit to B{sup -} and {bar B}{sup 0} channels, obtain the results R(D) = (41.6 {+-} 11.7 {+-} 5.2)% and R(D*) = (29.7 {+-} 5.6 {+-} 1.8)%, where the uncertainties are statistical and systematic. Normalizing to measured B{sup -} {yields} D{sup (*)0} {ell}{sup -} {bar {nu}}{sub {ell}} branching fractions, they obtain {Beta}(B {yields} D{tau}{sup -} {bar {nu}}{sub {tau}}) = (0.86 {+-} 0.24 {+-} 0.11 {+-} 0.06)% and {Beta}(B {yields} D*{tau}{sup -} {bar {nu}}{sub {tau}}) = (1.62 {+-} 0.31 {+-} 0.10 {+-} 0.05)%, where the additional third uncertainty is from the normalization mode. They also present, for the first time, distributions of the lepton momentum, |P*{sub {ell}}|, and the squared momentum transfer, q{sup 2}.

  3. [Rezension zu:] Schopenhauer, Arthur. Sämtliche Werke, herausgegeben von Paul Deußen. Verlag von R. Piper & Comp., München, Bd. VI, 1923: Über das Sehn und die Farben. - Theoria. colorum physiologica. Balthazar Gracians Handorakel und Kunst der Weltklugheit. Über das Interessante. Eristische Dialektik. Über die Verhunzung der deutschen Sprache. Herausgegeben von Franz Mockrauer. (XXXIX und 875 S.)


    Hasse, Heinrich


    Rezension zu: Schopenhauer, Arthur. Sämtliche Werke, herausgegeben von Paul Deußen. Verlag von R. Piper & Comp., München, Bd. VI, 1923: Über das Sehn und die Farben. - Theoria. colorum physiologica. Balthazar Gracians Handorakel und Kunst der Weltklugheit. Über das Interessante. Eristische Dialektik. Über die Verhunzung der deutschen Sprache. Herausgegeben von Franz Mockrauer. (XXXIX und 875 S.)

  4. Otto Hansmann: Jean-Jacques Rousseau (1712–1778). (Basiswissen Pädagogik – Teilbereich Historische Pädagogik, Bd. 1.) Baltmannsweiler: Schneider 2002. 232 S., EUR 16,–. Hartmut von Hentig: Rousseau oder Die wohlgeordnete Freiheit. München: Beck 2003. 124 S., EUR 14,90. Alfred Schäfer: Jean-Jacques Rousseau. Ein pädagogisches Porträt. Weinheim/Basel: Beltz 2002. 156 S., EUR 14,90 [Rezension


    Tenorth, Heinz-Elmar


    Sammelrezension zu: Otto Hansmann: Jean-Jacques Rousseau (1712–1778). (Basiswissen Pädagogik – Teilbereich Historische Pädagogik, Bd. 1.) Baltmannsweiler: Schneider 2002. 232 S., EUR 16,–. Hartmut von Hentig: Rousseau oder Die wohlgeordnete Freiheit. München: Beck 2003. 124 S., EUR 14,90. Alfred Schäfer: Jean-Jacques Rousseau. Ein pädagogisches Porträt. Weinheim/Basel: Beltz 2002. 156 S., EUR 14,90

  5. Evaluation of microvolume regenerated cellulose (RC) microdialysis fibers for the sampling and detection of ammonia in air. (United States)

    Tang, Hao; Thompson, Jonathan E


    We have explored use of perfused regenerated cellulose (RC) microdialysis tubing (216microm o.d./200microm i.d.) as sampling probes for gaseous ammonia. The probes functioned by allowing the gas to diffuse through the permeable membrane into a stream of de-ionized water which continually perfused the tubing at 10-20microLmin(-1). The resulting ammonium in the perfusate was determined through a fluorimetric method (OPA-sulfite) with LED excitation at lambda(ex)=365+/-10nm and measurement of fluorescence emission at lambda(em)=425+/-20nm. By shielding the sampling membrane with a Plexiglas tube purged under laminar flow conditions, the potential interference of particulate ammonium depositing on the probe was minimized. The RC microdialysis tube was found to act as an efficient sampling device since it exhibits a very high surface-area-to-volume ratio (approximately 200cm(2)mL(-1)). As a result, aqueous concentrations of >100microM NH(4)(+) per ppm NH(3) (g) have been observed. In addition, the fluorogenic OPA-sulfite reaction is demonstrated to be very selective for ammonia over amines that have been measured in the atmosphere. This feature of the derivatization chemistry allows analysis of ammonia by fluorimetry without need for a separation step. The method developed has been applied to field measurements of ammonia at a swine barn facility with quantitative results agreeing with a reference method. PMID:20441906

  6. Robust dipstick urinalysis using a low-cost, micro-volume slipping manifold and mobile phone platform. (United States)

    Smith, Gennifer T; Dwork, Nicholas; Khan, Saara A; Millet, Matthew; Magar, Kiran; Javanmard, Mehdi; Ellerbee Bowden, Audrey K


    We introduce a novel manifold and companion software for dipstick urinalysis that eliminate many of the aspects that are traditionally plagued by user error: precise sample delivery, accurate readout timing, and controlled lighting conditions. The proposed all-acrylic slipping manifold is reusable, reliable, and low in cost. A simple timing mechanism ensures results are read out at the appropriate time. Results are obtained by capturing videos using a mobile phone and by analyzing them using custom-designed software. We show that the results obtained with the proposed device are as accurate and consistent as a properly executed dip-and-wipe method, the industry gold-standard, suggesting the potential for this strategy to enable confident urinalysis testing in home environments. PMID:27166097

  7. Application of Three-Dimensionally Printed Probe and Reservoir to Critical Micelle Concentration Determination by Microvolume Surface Tension Measurement. (United States)

    Horiuchi, Shohei; Choda, Naoki; Takahashi, Haruyuki; Sato, Tomomi; Taira, Hikaru; Mukai, Kei


    It is important to determine a critical micelle concentration (CMC) of a surfactant in a protein formulation for stabilizing the protein at maximum by preventing it from interfacial denaturation. There are several techniques for CMC determination. Among them, surface tensiometry is the most common approach because this has a long history and much data at many research fields. However, large amount of sample solution is usually required for the measurement (e.g., more than 1 mL is necessary when a standard reservoir like a glass petri dish is used). This is one of the hurdles for protein formulators because only a small amount of protein could be used at the early-stage development. In this research, we tried to minimize the required amount of sample solution for surface tension measurement by developing appropriate probe and reservoir using a three-dimensional printer (3D printer). The advantages and capabilities of 3D printer are (1) to control the shape and size of the printed material precisely, (2) to change the figure freely, and (3) to prepare the prototype quickly. After the experiments and thereby the refinement of probe as well as reservoir, we found that CMCs of polysorbate 20, polysorbate 80, and poloxamer 188 in water and protein formulations could be precisely detected using a probe 0.5 mm in diameter and small reservoir with a pocket of 7.5 mm in diameter/0.25 mm in depth which were made by a 3D printer. Furthermore, the required sample solution per each measurement could be reduced to 80 μL, which means more than 90% reduction against a standard reservoir. PMID:27321235

  8. Etude de la mesure du paramètre alpha dans le cadre de la violation de la symétrie CP à l'aide du canal $B_{d}^{0} \\to \\pi^{+} \\pi^{-}\\pi^{0}$ dans l'expérience LHCb

    CERN Document Server

    Robert, Arnaud


    L'analyse temporelle du correlogramme de Dalitz du canal a trois corps Bd en pi+ pi- pi0 conduit a l'extraction de l'un des parametres definissant la violation de la symetrie CP dans le Modele Standard Electrofaible, l'angle alpha, exempte d'ambiguites discretes entre 0 et pi. Elle permet, entre autres, d'acceder independamment aux valeurs des principaux parametres QCD regissant la desintegration. La contrepartie experimentale repose cependant sur une statistique de signal suffisamment pure et importante et une maitrise precise de la phenomenologie associee. Combines a un rapport d'embranchement de l'ordre de 2.10^{-5}, ces deux arguments justifient a eux seuls le caractere non trivial d'une telle analyse dans l'environnement hadronique de l'experience dediee LHCb. A partir de la reponse simulee du detecteur, et en particulier des performances du calorimetre electromagnetique, cette these montre l'interet essentiel de la reconstruction specifique des pions neutres tres energiques et la necessite d'introduire ...

  9. Contribution to the electromagnetic calorimeter calibration of the LHCb detector- Sensibility to the measurement of the angle βeff in the decay Bd0 → J/ψπ0 and of the angle χ in the decay Bs0→J/ψη

    International Nuclear Information System (INIS)

    LHCb has been designed in order to perform precise measurements of CP violation and rare decays with B mesons. At the LHC start-up, one of the first tasks will be to check the expected apparatus performances. This thesis looks to the first recorded data by the LHCb experiment for two of the subjects developed: the photon reconstruction in the electromagnetic calorimeter assuming different experimental situations, and the calibration of the calorimeter. A photon identification tool is developed based on a Fisher discriminant method using informations from all the calorimeter sub-detectors (SPD, PS, ECAL, HCAL). The reconstructed photons are used for π0 mass reconstruction parameters, able to evaluate the overall calibration level. For individual cell calibration, the constraint from the reconstructed π0 mass is used. A 1% calibration can be achieved even starting from a 30% spread cell to cell calibration within a few tenth hours at the LHCb nominal luminosity. Two physics channels, for which the calorimeter calibration and neutral mesons decaying into photon pair reconstruction are key points, are studied. The channel Bd0 →p J/ψπ to measure β angle, where unexpected contributions beyond the standard model may occur. The channel Bs0 → J/ψη measures the χ angle. (author)



    Сысоева, Светлана


    В статье даны общие рекомендации по выбору датчиков давления и представлен краткий обзор продукции международной группы компаний BD Sensors RUS, специализирующейся на разработке и производстве датчиков давления для промышленности, энергетики и ЖКХ. Российская компания BD Sensors RUS предлагает широкую линейку датчиков давленияя - от экономичных приборов дл ЖКХ до интеллектуальных настраиваемых датчиков дифференциального давления во взрывозащищенном исполнении для нефтяной и газовой промышленн...

  11. The Chemical Composition of Cernis 52 (BD+31 640)

    CERN Document Server

    Hernandez, J I Gonzalez; Rebolo, R; García-Hernandez, D A; Manchado, A; Lambert, D L


    We present an abundance analysis of the star Cernis 52 in whose spectrum we recently reported the napthalene cation in absorption at 6707.4 {\\AA}. This star is on a line of sight to the Perseus molecular complex. The analysis of high-resolution spectra using a chi^2-minimization procedure and a grid of synthetic spectra provides the stellar parameters and the abundances of O, Mg, Si, S, Ca, and Fe. The stellar parameters of this star are found to be T_{eff} = 8350 +- 200 K, logg= 4.2 +- 0.4 dex. We derived a metallicity of [Fe/H] = -0.01 +- 0.15. These stellar parameters are consistent with a star of $\\sim 2$ \\Msun in a pre-main-sequence evolutionary stage. The stellar spectrum is significantly veiled in the spectral range 5150-6730 {\\AA} up to almost 55 per cent of the total flux at 5150 {\\AA} and decreasing towards longer wavelengths. Using Johnson-Cousins and 2MASS photometric data, we determine a distance to Cernis 52 of 231$^{+135}_{-85}$ pc considering the error bars of the stellar parameters. This dete...

  12. Energy from waste. Vol. 6; Energie aus Abfall. Bd. 6

    Energy Technology Data Exchange (ETDEWEB)

    Thome-Kozmiensky, Karl J.; Beckmann, Michael


    This book deals with waste incineration from different perspectives. It contains articles on the following subtopics: 1. Strategies; 2. Combustion of household waste and substitute fuels; 3. District heating and district cooling through household waste combustion; 4. Emission control; 5. Corrosion diagnosis; 6. Corrosion control through protective coatings; 7. Operator strategies for minimising corrosion; 8. Hazardous waste incineration. All 34 articles have been abstracted for the ENERGY database. [German] Dieses Buch, welches sich mit der Optimierung der Abfallverbrennung aus verschiedenen Blickwinkeln befasst, enthaelt Beitraege zu folgenden Schwerpunktthemen: 1. Strategien; 2. Verbrennung von Siedlungsabfaellen und Ersatzbrennstoffen; 3. Fernwaerme und Fernkaelte durch Siedlungsabfallverbrennung; 4. Immissionsschutz; 5. Korrosionsdiagnose; 6. Korrosionsminderung durch Schutzschichten; 7. Strategien der Betreiber fuer Korrosionsminderung; 8. Sonderabfallverbrennung. Alle 34 Beitraege wurden fuer die Datenbank ENERGY aufgenommen.

  13. Energy from waste. Vol. 9; Energie aus Abfall. Bd. 9

    Energy Technology Data Exchange (ETDEWEB)

    Thome-Kozmiensky, Karl J.; Beckmann, Michael


    This book reports on a further optimization of the waste incineration from different perspectives. Under this aspect, a lot of contributions to the following aspects are presented: energetic waste utilization, fires in silos and fire prevention, energy efficiency, process regulation, steam generators, materials for waste incinerators, exhaust gas treatment, production of substitute fuels. [German] Dieses Buch, welches sich mit der Optimierung der Abfallverbrennung aus verschiedenen Blickwinkeln befasst, enthaelt Beitraege zu folgenden Schwerpunktthemen: 1. Energetische Abfallverwertung; 2. Bunkerbraende und Brandvermeidung; 3. Energieeffizienz; 4. Prozessregelung; 5. Dampferzeuger; 6. Werkstoffe fuer Abfallverbrennungsanlagen; 7. Abgasbehandlung; 8. Herstellung von Ersatzbrennstoffen. Alle 46 Beitraege wurden fuer die Datenbank ENERGY aufgenommen.

  14. Energy from waste. Vol. 8; Energie aus Abfall. Bd. 8

    Energy Technology Data Exchange (ETDEWEB)

    Thome-Kozmiensky, Karl J.; Beckmann, Michael


    The central theme of the book under consideration is the optimization of waste incinerators. Energy efficiency, pollution abatement and availability are the focus. At the beginning, the authors report on the use of energy indicators as a basis for the exploration of optimization potentials. On the basis of current examples of plant from Germany and other European countries notable projects such as new construction, retrofitting and restoration of incineration plants are shown. In connection with the energy efficiency and availability, among other things the contributions are devoted to major thermal processes. The development and the status of pyrolysis, gasification or plasma processes for the treatment of waste are presented. Then, two practical examples pyrolysis of sewage sludge are described. In addition, specific aspects of the purification of exhaust gases are considered such as the grinding of additives and the security technology in the use of carbon-based sorbents.

  15. Energy from waste. Vol. 7; Energie aus Abfall. Bd. 7

    Energy Technology Data Exchange (ETDEWEB)

    Thome-Kozmiensky, Karl J.; Beckmann, Michael


    Energy efficiency, quality management and plant availability are the main themes of the contributions in the book under consideration. This refers to organizational, legal and technical measures for complete systems and unit resources. Contributions to the following topic areas are presented: (a) Optimization of combustion plants; (b) Steam generator; (c) turbines; (d) Alternative procedures; (e) Efficiency of the treatment of exhaust gases.

  16. Energy from waste. Vol. 10; Energie aus Abfall. Bd. 10

    Energy Technology Data Exchange (ETDEWEB)

    Thome-Kozmiensky, Karl J.; Beckmann, Michael (eds.)


    This book reports on a further optimization of the waste incineration from different perspectives. Under this aspect, a lot of contributions to the following aspects are presented: (a) Establishment, strengthening, operation and process regulation; (b) Energy efficiency; (c) Steam generator and corrosion protection; (d) Exhaust gas after-treatment; (e) Biologic and mechanical-biologic waste treatment; (f) Utilization of substitute fuels; (g) Sewage sludge.

  17. Energy from waste. Vol. 5; Energie aus Abfall. Bd. 5

    Energy Technology Data Exchange (ETDEWEB)

    Thome-Kozmiensky, Karl J.; Beckmann, Michael


    The fifth volume to the topic 'Energy from waste' contains the following contributions: (1) Combustion of mixed and recovered wastes - acceptance in the Federal Republic of Germany (Karl J. Thome-Kozmiensky); (2) Strategies for energetic use of biomass (M. Beckmann, M. Klemm); (3) Conversion from corporate strategies to an optimized power supply under consideration of the Renewable Energy Resources Act - five years operational experiences (J. Guenther); (4) Optimization of mechanical-biological waste treatment plants (K. Ketelsen); (5) Importance of a rapid test for substitute fuels (S. Rotter, A. Lehmann, T. Marzi, E. Moehle, D. Schingnitz, G. Hoffmann); (6) Filtering technology for substitute fuels - Experience report with control filters in power plants (C. Lake, E. Hacke); (7) The fuel processing plant Weidenhausen - Substitute fuel based power supply of the paper plant of SCA Witzenhausen (A. Puchelt); (8) Energy efficiency at the mechanical biological residual waste processing (R. Wallmann); (9) Planning of substitute fuel based power plants for power plant (M. Horeni, M. Walther); (10) Fluidized bed combustion for municipal and industrial wastes - Substitute fuel based power plants in the industrial park Hoechst (D. Lorbach); (11) Multistage steam superheating - Increase of efficiency of substitute fuel based, biomass based and solar thermal power plants (R. Schu, R. Leithner); (12) Energetic utilization of biomass in Austria (D. Sager, J. Bleeker); (m) First operational experiences at the combustion of biomass in the biomass cogeneration plant Emden (H. Braeuer, J. Bleeker); (13) Use of biomass and substitute fuels in fluidized bed combustions (F. Winter, P. Szentannai); (14) Costs of biomass combustion - Procurement, operational costs, returns (W. Schumacher, D. Schwier); (15) Generation of substitutes of natural gas (SNG) from gasification gases (S. Biollaz); (16) Reduction of tar in the gasification gas from biomass by means of catalytical and non-catalytical partial oxidation (D. Boehning, M. Klemm, M. Beckmann); (17) Decentral gasification of biomass (J. Kark); (18) Newest results of gasification in the circulating fluid bed (S. Vodegel, A.K. Grove, B. Benker); (18) Entrained-flow gasification of biomass-based slurry - investigations on atomization and fuel conversion (T. Kolb, H. Seifert, N. Zarzalis, U. Santo, E. Pantouflas); (19) Energy from biomass -Problem areas and necessity of research (D. Thraen); (20) Corrosion in biomass combustion plants and strategies for minimization (W. Spiegel, T. Herzog, R. Jordan, G. Magel, W. Mueller, W. Schmidl); (21) Fuel-specific on-load cleaning solutions in waste incineration plants - demands, concepts, experiences (C. Mueller, M. Frach, M. Tirkschleit, Dimitri Mousko); (22) Sense of a further reduction of limiting values for emission from thermal waste treatment (M. Loeschau); (23) The limiting values of the 37th Emission Control Ordinance by means of the SCNR technique (T. Reynolds); (24) Regeneration of DeNOx catalysts - a contribution to increase the economical utilization of substitute fuels and biomasses (M. Ebinger, A. Schluttig); (25) Examples for the use of catalysts in the treatment of exhaust air by means of combustion plants (W. Schuettelhelm); (26) Potentials for the generation of biogas in the German waste economy (M. Kern, J. Siepenkothen); (27) The market for producers of fermentation plants - Federal Republic of Germany and residual Europe (G. Langhans); (28) Utilization of organic wastes in bed steam reform in plants - Report on the conception of biogas plant (A. Gosten); (29) Potential of optimisation of a fermentation plant in a mechanical and biological waste treatment plant - MBA Hannover-Lahe as an example (B. Vielhaber, K. Huelter); (30) Balancing of biogas plants - Consideration of the mass flow using nitrogen and sulphur as an example (C. Dornack); (31) Siloxane in biogas and in the waste air of biological waste treatment plants (S. Mattersteig, L. Brunn, F. Hohmann, M. Friese, B. Bilitewski); (32) Technical fundamentals of the feeding of biogas into natural gas grids - Background, regulatory guide and aspects of conditioning (F. Burmeister); (33) Technologies and costs of generation of natural gas substitutes on the base of biomass; (34) Thermochemical utilization of residual fermentation (M. Huelscher).

  18. Energy from waste. Vol. 2; Energie aus Abfall. Bd. 2

    Energy Technology Data Exchange (ETDEWEB)

    Thome-Kozmiensky, K.J.; Beckmann, M.


    In the book under consideration, the thermal treatment in waste incinerators, in industrial power stations and in coal-fired power stations is in the foreground. Possibilities of gasification are described. The chapter 'Developments of thermal waste treatment' consists of the following chapter: (a) Maximal size of waste incineration plants (Johannes J.E. Martin); (b) Trends and highlights of the thermal waste treatment in Europe (Martin Brunner); (c) Utilization of waste heat from Vienna waste incinerators for the operation of a district cooling grid - Effects on the primary energy efficiency of district heating and district cooling in Vienna (Franz Schindelar, Alexander Wallisch); (d) Evolutionary plant development based on experiences (Hans-Peter Buechner); (e) Effects of increased chlorine freights at the cocombustion of secondary fuels at the site of the brown coal fired power station Jaenschwalde (Frank Mielke, Andreas Sparmann, Sven Kappa); (f) Refuse-fueled power stations and waste incinerators - different plant technology? (Hendrik Seeger); (g) Generation of fuel gas from high calorific wastes (Udo Hellwig, Michael Beyer); (h) Strength testing of steam vessels with increased testing pressure (Wolfgang Rossmaier). The chapter 'Energy efficiency of waste incinerators' consists the following contributions: (a) Evaluation of energy efficiency in plants of thermal waste treatment; (b) Scientific-technical and juridical rationality - a contradiction? Comments to the judgement o the VGH Baden-Wuerttemberg according to waste incineration (Bodo A. Baars and Adolf Nottrodt); (c) Determination of the energy efficiency in plants of thermal waste incineration - To the difficulties of equivalent values and calculation of the calorific value (Michael Beckmann, Reinhard Scholz). The chapter 'Optimization of the plant technology' contains the following contributions: (a) Stay a while - Considerations according to the first tank of thermal waste treatment plants with grate firing (Michael Mueck, Werner Hansen, Hans-Peter Alessio); (b) BWV-combustion technology for energy production from waste - a case study: Reno North, line 4. Waste incineration plant with a high effiency (Hans Boegh Andersen); (c) Determination of operational parameters in waste incinerators as a prerequisite for further optimisation (Martin Horeni, Michael Beckmann, Hans Fleischmann, Erhard Barth); (d) Optimization of thermal waste treatment with the INSPECT system by camera based characteristic values and Fuzzy Control (Hubert B. Keller, Joerg Matthes, Holger Schoeenecker, Tristan Krakau); (e) Renewal of process control systems in the waste incineration plant Ruhleben (Thomas Kempin, Henrik Zahn); (f) Fuzzy Control in the waste incineration plant of BSR under consideration of process optimization and economy (Thomas Kempin, Peter Knoop, Henrik Zahn, Christian Gierend). The next chapter 'New plants and extension of plants' contains the following plants: (a) New construction of a waste incinerator in Delfzijl/NL (Matthias Elfers); (b) Replace of waste incinerators at existing sites (Gert Riemenschnieder, Walter Schaefer); (c) Modernisation of the waste-fired cogeneration plant Frankfurt (Gerhard Lohe); (d) Design of plants, supply of fuels and quality control for waste incinerators (Reinhard Schu, Jens Niestroj); (e) Utilization of a water-cooled cooking grate - concept and operating experiences (Werner Auel, Manfred Kuehl); (f) The forward moving combustion grate from Jakob Stiefel GmbH - concept, plants and experiences (Martin Stiefel). The following chapter 'Exhaust gas purification' consists of the following chapters: (a) Does there exist a problem of fine dust or mercury at the waste incineration? (Heidi Foth); (b) Trends in the exhaust gas purification according to the control of the problem of fine dust or mercury - technical solutions (Christoph Mueller, Reiner Stark); (c) Measures and experiments to the reduction of mercury in the waste recycling plant Bonn (Ruediger Heidrich); (d) Considerable exhaust gas cleaning with economical process engineering (Georg Schuster); (e) ALSTOM-NID a process of conditioned dry sorption for biomass, refuse-derived fuels and domestic waste incineration plants (Uwe Gansel, Juergen Gottschalk); (f) Concepts for exhaust gas purification by the example of waste incineration in Premnitz (Ruediger Margraf); (g) Concepts for exhaust gas purification for high-calorific fuels from municipal wastes and trade waste - Waste incinerator Hannover as an example (Christian Fuchs, Thomas Feilenreiter). The last chapter 'Materials and corrosion reduction' contains the following contributions: (a) Fundamentals of refractory applications at waste incineration plants (Peter Fruehauf); (b) New developments at tube liner systems for waste incinerators (Hans Petschauer); (c) Corrosion by utilization of biomass fuels and refuse-derived fuels: Demand for layer supported characteristic corrosion values (Wolfgang Spiegel, Thomas Herzog, Renate Jordan, Gabi Magel, Wolfgang Mueller, Werner Schmidl); (d) Technology upgrade in the scope of sanitation of protection systems for tube walls of a waste boiler in the case of TREA Breisgau (Karl-Ulrich Martin, Oliver Seibel, Bernd Bastian); (e) Cladding in the boiler construction and plant engineering - newest developments (Wolfgang Hoffmeister); (f) Online evaluation of the thermal flow on the walls of a membrane evaporator of steam generators (Michael Beckmann, Sascha Krueger, Gabi Magel, Wolfgang Spiegel); (g) Extension of the reactor runs by effective cleaning in empty trains of incineration plants for wastes and biomass (Stephan Simon).

  19. Boilet et l’envers de la Bd


    Paugam, Guillaume


    Un exemple parmi d’autres : Les Mondes Manga, à l’instar de tout récent ouvrage un peu panoramique sur le sujet, entre visite au musée du manga de Kawasaki, présentation de séries adolescentes emblématiques et autres descriptions illustrées de cosplay, réserve un chapitre à Frédéric Boilet. Sans que l’on sache très bien si c’est pour son œuvre propre, son installation au Japon et rôle subséquent de passeur entre les deux cultures ou sa tonitruante prise de position contre le manga commercial,...

  20. Indirect CP Violation in the Bd-system


    Bernabeu, J.; Banuls, M. C.


    Recently a rephasing invariant definition of the CP-mixing parameter for Indirect CP Violation has been introduced. This is made possible by the explicit use of the CP operator into the analysis. The problem is then that of the determination of the CP operator for a CP violating scenario. We discuss it and provide a definite solution.

  1. Die Korrespondenz Ferdinands I. Familienkorrespondenz Bd. 5: 1535 und 1536


    Hofinger, B. (Bernadette); Kufner, H. (Harald); Laferl, C. (Christopher F. ); Moser-Kroiss, J. (Judith); Tschugmell, N. (Nicola)


    Der in diesem Band edierte Briefverkehr zwischen Ferdinand I. und seinen Geschwistern Karl V. und Maria von Ungarn, wird von den folgenden Problemkreisen bestimmt: von Ferdinands Versuchen, mit Johann Szapolyai einen Frieden in Ungarn zu erreichen; von den Auseinandersetzungen mit den Osmanen und dem Tunis-Feldzug Karls V.; vom Konflikt mit Franz I. von Frankreich nach dem Tod des letzten Sforza-Herzogs in Mailand; und von der konfessionellen Spaltung im Reich.

  2. Die Korrespondenz Ferdinands I. Familienkorrespondenz Bd. 5: 1535 und 1536


    Hofinger, Bernadette; Tschugmell, Nicola; Moser-Kroiss, Judith; Laferl, Christopher F.; Kufner, Harald


    The main topics of the correspondence between Ferdinand I and his siblings Charles V and Mary of Hungary edited in this volume are Ferdinand's attempts to achieve peace with Johann Szapolyai in Hungary; the clashes with the Ottomans; the Tunis campaign of Charles V; the conflict with Francis I of France after the death of the last Sforza Duke of Milan; and the confessional division in the Holy Roman Empire.

  3. The Width difference of $B_{d}$ mesons

    CERN Document Server

    Dighe, Amol S; Kim, C S; Yoshikawa, T; Dighe, Amol; Hurth, Tobias; Kim, Choong Sun; Yoshikawa, Tadashi


    We estimate $\\dg/\\Gamma_d$, including $1/m_b$ contributions and part of the next-to-leading order QCD corrections. We find that adding the latter corrections decreases the value of $\\dg/\\Gamma_d$ computed at the leading order by a factor of almost 2. We also show that under certain conditions an upper bound on the value of $\\dg/\\Gamma_d$ in the presence of new physics can be derived. With the high statistics and accurate time resolution of the upcoming LHC experiment, the measurement of $\\dg$ seems to be possible. This measurement would be important for an accurate measurement of $\\sin(2\\beta)$ at the LHC. In addition, we point out the possibility that the measurement of the width difference leads to a clear signal for new physics.

  4. Measurement of Bd mixing using opposite-side flavor tagging

    CERN Document Server

    Abazov, V M; Abolins, M; Acharya, B S; Adams, M; Adams, T; Agelou, M; Aguiló, E; Ahn, S H; Ahsan, M; Alexeev, G D; Alkhazov, G; Alton, A; Alverson, G; Alves, G A; Anastasoaie, M; Andeen, T; Anderson, S; Andrieu, B; Anzelc, M S; Arnoud, Y; Arov, M; Askew, A; Åsman, B; Assis-Jesus, A C S; Atramentov, O; Autermann, C; Avila, C; Ay, C; Badaud, F; Baden, A; Bagby, L; Baldin, B; Bandurin, D V; Banerjee, P; Banerjee, S; Barberis, E; Bargassa, P; Baringer, P; Barnes, C; Barreto, J; Bartlett, J F; Bassler, U; Bauer, D; Beale, S; Bean, A; Begalli, M; Begel, M; Belanger-Champagne, C; Bellantoni, L; Bellavance, A; Benítez, J A; Beri, S B; Bernardi, G; Bernhard, R; Berntzon, L; Bertram, I; Besançon, M; Beuselinck, R; Bezzubov, V A; Bhat, P C; Bhatnagar, V; Binder, M; Biscarat, C; Black, K M; Blackler, I; Blazey, G; Blekman, F; Blessing, S; Bloch, D; Bloom, K; Blumenschein, U; Böhnlein, A; Boeriu, O; Bolton, T A; Borissov, G; Bos, K; Bose, T; Brandt, A; Brock, R; Brooijmans, G; Bross, A; Brown, D; Buchanan, N J; Buchholz, D; Bühler, M; Büscher, V; Burdin, S; Burke, S; Burnett, T H; Busato, E; Buszello, C P; Butler, J M; Calfayan, P; Calvet, S; Cammin, J; Caron, S; Carvalho, W; Casey, B C K; Cason, N M; Castilla-Valdez, H; Chakrabarti, S; Chakraborty, D; Chan, K M; Chandra, A; Charles, F; Cheu, E; Chevallier, F; Cho, D K; Choi, S; Choudhary, B; Christofek, L; Claes, D; Clement, B; Clément, C; Coadou, Y; Cooke, M; Cooper, W E; Coppage, D; Corcoran, M; Cousinou, M C; Cox, B; Crepe-Renaudin, S; Cutts, D; Cwiok, M; Da Motta, H; Das, A; Das, M; Davies, B; Davies, G; Davis, G A; De, K; de Jong, P; De Jong, S J; De La Cruz-Burelo, E; De Oliveira Martins, C; Degenhardt, J D; Déliot, F; Demarteau, M; Demina, R; Demine, P; Denisov, D; Denisov, S P; Desai, S; Diehl, H T; Diesburg, M; Doidge, M; Dominguez, A; Dong, H; Dudko, L V; Duflot, L; Dugad, S R; Duggan, D; Duperrin, A; Dyer, J; Dyshkant, A; Eads, M; Edmunds, D; Edwards, T; Ellison, J; Elmsheuser, J; Elvira, V D; Eno, S; Ermolov, P; Evans, H; Evdokimov, A; Evdokimov, V N; Fatakia, S N; Feligioni, L; Ferapontov, A V; Ferbel, T; Fiedler, F; Filthaut, F; Fisher, W; Fisk, H E; Fleck, I; Ford, M; Fortner, M; Fox, H; Fu, S; Fuess, S; Gadfort, T; Galea, C F; Gallas, E; Galyaev, E; García, C; García-Bellido, A; Gardner, J; Gavrilov, V; Gay, A; Gay, P; Gelé, D; Gelhaus, R; Gerber, C E; Gershtein, Yu; Gillberg, D; Ginther, G; Gollub, N; Gómez, B; Goussiou, A; Grannis, P D; Greenlee, H; Greenwood, Z D; Gregores, E M; Grenier, G; Gris, P; Grivaz, J F; Grünendahl, S; Grünewald, M W; Guo, F; Guo, J; Gutíerrez, G; Gutíerrez, P; Haas, A; Hadley, N J; Haefner, P; Hagopian, S; Haley, J; Hall, I; Hall, R E; Han, L; Hanagaki, K; Hansson, P; Harder, K; Harel, A; Harrington, R; Hauptman, J M; Hauser, R; Hays, J; Hebbeker, T; Hedin, D; Hegeman, J G; Heinmiller, J M; Heinson, A P; Heintz, U; Hensel, C; Herner, K; Hesketh, G; Hildreth, M D; Hirosky, R; Hobbs, J D; Hoeneisen, B; Hoeth, H; Hohlfeld, M; Hong, S J; Hooper, R; Houben, P; Hu, Y; Hubacek, Z; Hynek, V; Iashvili, I; Illingworth, R; Ito, A S; Jabeen, S; Jaffré, M; Jain, S; Jakobs, K; Jarvis, C; Jenkins, A; Jesik, R; Johns, K; Johnson, C; Johnson, M; Jonckheere, A; Jonsson, P; Juste, A; Käfer, D; Kahn, S; Kajfasz, E; Kalinin, A M; Kalk, J M; Kalk, J R; Kappler, S; Karmanov, D; Kasper, J; Kasper, P; Katsanos, I; Kau, D; Kaur, R; Kehoe, R; Kermiche, S; Khalatyan, N; Khanov, A; Kharchilava, A I; Kharzheev, Yu M; Khatidze, D; Kim, H; Kim, T J; Kirby, M H; Klima, B; Kohli, J M; Konrath, J P; Kopal, M; Korablev, V M; Kotcher, J; Kothari, B; Koubarovsky, A; Kozelov, A V; Krop, D; Kryemadhi, A; Kühl, T; Kumar, A; Kunori, S; Kupco, A; Kurca, T; Kvita, J; Lammers, S; Landsberg, G L; Lazoflores, J; Le Bihan, A C; Lebrun, P; Lee, W M; Leflat, A; Lehner, F; Lesne, V; Lévêque, J; Lewis, P; Li, J; Li, Q Z; Lima, J G R; Lincoln, D; Linnemann, J; Lipaev, V V; Lipton, R; Liu, Z; Lobo, L; Lobodenko, A; Lokajícek, M; Lounis, A; Love, P; Lubatti, H J; Lynker, M; Lyon, A L; Maciel, A K A; Madaras, R J; Mättig, P; Magass, C; Magerkurth, A; Magnan, A M; Makovec, N; Mal, P K; Malbouisson, H B; Malik, S; Malyshev, V L; Mao, H S; Maravin, Y; Martens, M; McCarthy, R; Meder, D; Melnitchouk, A; Mendes, A; Mendoza, L; Merkin, M; Merritt, K W; Meyer, A; Meyer, J; Michaut, M; Miettinen, H; Millet, T; Mitrevski, J; Molina, J; Mondal, N K; Monk, J; Moore, R W; Moulik, T; Muanza, G S; Mulders, M; Mulhearn, M; Mundal, O; Mundim, L; Mutaf, Y D; Nagy, E; Naimuddin, M; Narain, M; Naumann, N A; Neal, H A; Negret, J P; Neustroev, P; Nöding, C; Nomerotski, A; Novaes, S F; Nunnemann, T; O'Dell, V; O'Neil, D C; Obrant, G; Oguri, V; Oliveira, N; Onoprienko, D; Oshima, N; Otec, R; Oteroy-Garzon, G J; Owen, M; Padley, P; Parashar, N; Park, S J; Park, S K; Parsons, J; Partridge, R; Parua, N; Patwa, A; Pawloski, G; Perea, P M; Pérez, E; Peters, K; Petroff, P; Petteni, M; Piegaia, R; Piper, J; Pleier, M A; Podesta-Lerma, P L M; Podstavkov, V M; Pogorelov, Y; Pol, M E; Pompos, A; Pope, B G; Popov, A V; Potter, C; Prado da Silva, W L; Prosper, H B; Protopopescu, S D; Qian, J; Quadt, A; Quinn, B; Rangel, M S; Rani, K J; Ranjan, K; Ratoff, P N; Renkel, P; Reucroft, S; Rijssenbeek, M; Ripp-Baudot, I; Rizatdinova, F K; Robinson, S; Rodrigues, R F; Royon, C; Rubinov, P; Ruchti, R; Rud, V I; Sajot, G; Sánchez-Hernández, A; Sanders, M P; Santoro, A F S; Savage, G; Sawyer, L; Scanlon, T; Schaile, A D; Schamberger, R D; Scheglov, Y; Schellman, H; Schieferdecker, P; Schmitt, C; Schwanenberger, C; Schwartzman, A; Schwienhorst, R; Sekaric, J; Sen-Gupta, S; Severini, H; Shabalina, E; Shamim, M; Shary, V; Shchukin, A A; Shephard, W D; Shivpuri, R K; Shpakov, D; Siccardi, V; Sidwell, R A; Simák, V; Sirotenko, V I; Skubic, P L; Slattery, P F; Smith, R P; Snow, G R; Snow, J; Snyder, S; Söldner-Rembold, S; Song, X; Sonnenschein, L; Sopczak, A; Sosebee, M; Soustruznik, K; Souza, M; Spurlock, B; Stark, J; Steele, J; Stolin, V; Stone, A; Stoyanova, D A; Strandberg, J; Strandberg, S; Strang, M A; Strauss, M; Ströhmer, R; Strom, D; Strovink, M; Stutte, L; Sumowidagdo, S; Svoisky, P; Sznajder, A; Talby, M; Tamburello, P; Taylor, W; Telford, P; Temple, J; Tiller, B; Titov, M; Tokmenin, V V; Tomoto, M; Toole, T; Torchiani, I; Towers, S; Trefzger, T; Trincaz-Duvoid, S; Tsybychev, D; Tuchming, B; Tully, C; Turcot, A S; Tuts, P M; Unalan, R; Uvarov, L; Uvarov, S; Uzunyan, S; Vachon, B; vanden Berg, P J; Van Kooten, R; Van Leeuwen, W M; Varelas, N; Varnes, E W; Vartapetian, A H; Vasilyev, I A; Vaupel, M; Verdier, P; Vertogradov, L S; Verzocchi, M; Villeneuve-Séguier, F; Vint, P; Vlimant, J R; Von Törne, E; Voutilainen, M; Vreeswijk, M; Wahl, H D; Wang, L; Wang, M H L; Warchol, J; Watts, G; Wayne, M; Weber, G; Weber, M; Weerts, H; Wermes, N; Wetstein, M; White, A; Wicke, D; Wilson, G W; Wimpenny, S J; Wobisch, M; Womersley, J; Wood, D R; Wyatt, T R; Xie, Y; Xuan, N; Yacoob, S; Yamada, R; Yan, M; Yasuda, T; Yatsunenko, Y A; Yip, K; Yoo, H D; Youn, S W; Yu, C; Yu, J; Yurkewicz, A; Zatserklyaniy, A; Zeitnitz, C; Zhang, D; Zhao, T; Zhou, B; Zhu, J; Zielinski, M; Zieminska, D; Zieminski, A; Zutshi, V; Zverev, E G


    We report on a measurement of the $B^0_d$ mixing frequency and the calibration of an opposite-side flavor tagger in the D{\\O}experiment. Various properties associated with the $b$ quark on the opposite side of the reconstructed $B$ meson were combined using a likelihood-ratio method into a single variable with enhanced tagging power. Its performance was tested with data, using a large sample of reconstructed semileptonic $B \\to \\mu \\dzero X$ and $B \\to \\mu \\dst X$ decays, corresponding to an integrated luminosity of approximately 1 fb$^{-1}$. The events were divided into groups depending on the value of the combined tagging variable, and an independent analysis was performed in each group. Combining the results of these analyses, the overall effective tagging power was found to be eD^2 = (2.48 \\pm 0.21 (stat.) ^{+0.08}_{-0.06} (syst.))%. The measured $B^0_d$ mixing frequency dmd = 0.506 \\pm 0.020 {\\rm (stat) \\pm 0.016 (syst) ps}^{-1} is in good agreement with the world average value.

  5. Observation of a new D_sJ meson in B+->D0BD0K+ decays

    CERN Document Server

    Brodzicka, J; Adachi, I; Aihara, H; Aulchenko, V; Bakich, A M; Barberio, E; Bay, A; Bedny, I; Bitenc, U; Bondar, A; Bracko, M; Browder, T E; Chang, M C; Chang, P; Chen, A; Chen, W T; Cheon, B G; Chiang, C C; Chistov, R; Cho, I S; Choi, S K; Choi, Y; Dalseno, J; Danilov, M; Dash, M; Drutskoy, A; Eidelman, S; Gabyshev, N; Go, A; Gokhroo, G; Golob, B; Ha, H; Haba, J; Hara, T; Hayasaka, K; Hayashii, H; Hazumi, M; Heffernan, D; Hoshi, Y; Hou, W S; Hyun, H J; Iijima, T; Ikado, K; Inami, K; Ishikawa, A; Ishino, H; Itoh, R; Iwasaki, M; Iwasaki, Y; Joshi, N J; Kah, D H; Kang, J H; Kawai, H; Kawasaki, T; Kichimi, H; Kim, H O; Kim, S K; Kim, Y J; Kinoshita, K; Korpar, S; Krokovny, P; Kumar, R; Kuo, C C; Kwon, Y J; Lange, J S; Lee, J S; Lee, M J; Lee, S E; Lesiak, T; Limosani, A; Liventsev, D; Mandl, F; McOnie, S; Medvedeva, T; Mitaroff, W A; Miyabayashi, K; Miyake, H; Miyata, H; Mizuk, R; Mori, T; Nagasaka, Y; Nakano, E; Nakao, M; Natkaniec, Z; Nishida, S; Nitoh, O; Noguchi, S; Nozaki, T; Ogawa, S; Ohshima, T; Okuno, S; Ozaki, H; Pakhlov, P; Pakhlova, G; Park, C W; Park, H; Pestotnik, R; Piilonen, L E; Rózanska, M; Sakai, Y; Schneider, O; Seidl, R; Sekiya, A; Senyo, K; Sevior, M E; Shapkin, M; Shen, C P; Shibuya, H; Shiu, J G; Singh, J B; Sokolov, A; Somov, A; Stanic, S; Staric, M; Sumiyoshi, T; Takasaki, F; Tamai, K; Tanaka, M; Taylor, G N; Teramoto, Y; Tikhomirov, I; Uehara, S; Ueno, K; Uglov, T; Unno, Y; Uno, S; Urquijo, P; Varner, G; Vervink, K; Villa, S; Vinokurova, A; Wang, C C; Wang, C H; Wang, M Z; Wang, P; Watanabe, Y; Wedd, R; Won, E; Yabsley, B D; Yamaguchi, A; Yamashita, Y; Yamauchi, M; Yuan, C Z; Yusa, Y; Zhang, C C; Zhang, Z P; Zhilich, V; Zhulanov, V; Zupanc, A; Zwahlen, N


    We report the observation of a new $D_{sJ}$ meson produced in $B^{+} \\to \\bar{D}^{0} D_{sJ} \\to \\bar{D}^{0} D^{0} K^{+}$. This state has a mass of $M=2708 \\pm 9 ^{+11}_{-10} \\rm{MeV}/{\\it c}^{2}$, a width $\\Gamma = 108 \\pm 23 ^{+36}_{-31} ~\\rm{MeV}/ {\\it c}^{2}$ and a $1^{-}$ spin-parity. The results are based on an analysis of 449 million $B\\bar{B}$ events collected at the $\\Upsilon(4S)$ resonance with the Belle detector at the KEKB asymmetric-energy $e^{+} e^{-}$ collider.

  6. Drop-on-demand sample introduction system coupled with the flowing atmospheric-pressure afterglow for direct molecular analysis of complex liquid micro-volume samples (United States)

    Schaper, J. Niklas; Pfeuffer, Kevin P.; Shelley, Jacob T.; Bings, Nicolas H.


    One of the fastest developing fields in analytical spectrochemistry in recent years is ambient desorption/ionization mass spectrometry (ADI-MS). This burgeoning interest has been due to the demonstrated advantages of the method: simple mass spectra, little or no sample preparation, and applicability to samples in the solid, liquid, or gaseous state. One such ADI-MS source, the flowing atmospheric-pressure afterglow (FAPA), is capable of direct analysis of solids just by aiming the source at the solid surface and sampling the produced ions into a mass spectrometer. However, direct introduction of significant volumes of liquid samples into this source has not been possible, as solvent loads can quench the afterglow and, thus, the formation of reagent ions. As a result, the analysis of liquid samples is preferably carried out by analyzing dried residues or by desorbing small amounts of liquid samples directly from the liquid surface. In the former case, reproducibility of sample introduction is crucial if quantitative results are desired. In the present study, introduction of liquid samples as very small droplets helps overcome the issues of sample positioning and reduced levels of solvent intake. A recently developed “drop-on-demand” (DOD) aerosol generator is capable of reproducibly producing very small volumes of liquid (~17 pL). In this paper, the coupling of FAPA-MS and DOD is reported and applications are suggested. Analytes representing different classes of substances were tested and limits of detections were determined. Matrix tolerance was investigated for drugs of abuse and their metabolites by analyzing raw urine samples and quantification without the use of internal standards. Limits of detection below 2 µg/mL, without sample pretreatment, were obtained. PMID:23025277

  7. Drop-on-demand sample introduction system coupled with the flowing atmospheric-pressure afterglow for direct molecular analysis of complex liquid microvolume samples. (United States)

    Schaper, J Niklas; Pfeuffer, Kevin P; Shelley, Jacob T; Bings, Nicolas H; Hieftje, Gary M


    One of the fastest developing fields in analytical spectrochemistry in recent years is ambient desorption/ionization mass spectrometry (ADI-MS). This burgeoning interest has been due to the demonstrated advantages of the method: simple mass spectra, little or no sample preparation, and applicability to samples in the solid, liquid, or gaseous state. One such ADI-MS source, the flowing atmospheric-pressure afterglow (FAPA), is capable of direct analysis of solids just by aiming the source at the solid surface and sampling the produced ions into a mass spectrometer. However, direct introduction of significant volumes of liquid samples into this source has not been possible, as solvent loads can quench the afterglow and, thus, the formation of reagent ions. As a result, the analysis of liquid samples is preferably carried out by analyzing dried residues or by desorbing small amounts of liquid samples directly from the liquid surface. In the former case, reproducibility of sample introduction is crucial if quantitative results are desired. In the present study, introduction of liquid samples as very small droplets helps overcome the issues of sample positioning and reduced levels of solvent intake. A recently developed "drop-on-demand" (DOD) aerosol generator is capable of reproducibly producing very small volumes of liquid (∼17 pL). In this paper, the coupling of FAPA-MS and DOD is reported and applications are suggested. Analytes representing different classes of substances were tested and limits of detections were determined. Matrix tolerance was investigated for drugs of abuse and their metabolites by analyzing raw urine samples and quantification without the use of internal standards. Limits of detection below 2 μg/mL, without sample pretreatment, were obtained. PMID:23025277

  8. Preliminary results from a microvolume, dynamically heated analytical column for preconcentration and separation of simple gases prior to stable isotopic analysis (United States)

    Panetta, Robert James; Seed, Mike


    Stable isotope applications that call for preconcentration (i.e., greenhouse gas measurements, small carbonate samples, etc.) universally call for cryogenic fluids such as liquid nitrogen, dry ice slurries, or expensive external recirculation chillers. This adds significant complexity, first and foremost in the requirements to store and handle such dangerous materials. A second layer of complexity is the instrument itself - with mechanisms to physically move either coolant around the trap, or move a trap in or out of the coolant. Not to mention design requirements for hardware that can safely isolate the fluid from other sensitive areas. In an effort to simplify the isotopic analysis of gases requiring preconcentration, we have developed a new separation technology, UltiTrapTM (patent pending), which leverage's the proprietary Advanced Purge & Trap (APT) Technology employed in elemental analysers from Elementar Analysensysteme GmbH products. UltiTrapTM has been specially developed as a micro volume, dynamically heated GC separation column. The introduction of solid-state cooling technology enables sub-zero temperatures without cryogenics or refrigerants, eliminates all moving parts, and increases analytical longevity due to no boiling losses of coolant . This new technology makes it possible for the system to be deployed as both a focussing device and as a gas separation device. Initial data on synthetic gas mixtures (CO2/CH4/N2O in air), and real-world applications including long-term room air and a comparison between carbonated waters of different origins show excellent agreement with previous technologies.

  9. Fast and direct screening of copper in micro-volumes of distilled alcoholic beverages by high-resolution continuum source graphite furnace atomic absorption spectrometry. (United States)

    Ajtony, Zsolt; Laczai, Nikoletta; Dravecz, Gabriella; Szoboszlai, Norbert; Marosi, Áron; Marlok, Bence; Streli, Christina; Bencs, László


    HR-CS-GFAAS methods were developed for the fast determination of Cu in domestic and commercially available Hungarian distilled alcoholic beverages (called pálinka), in order to decide if their Cu content exceeds the permissible limit, as legislated by the WHO. Some microliters of samples were directly dispensed into the atomizer. Graphite furnace heating programs, effects/amounts of the Pd modifier, alternative wavelengths (e.g., Cu I 249.2146nm), external calibration and internal standardization methods were studied. Applying a fast graphite furnace heating program without any chemical modifier, the Cu content of a sample could be quantitated within 1.5min. The detection limit of the method is 0.03mg/L. Calibration curves are linear up to 10-15mg/L Cu. Spike-recoveries ranged from 89% to 119% with an average of 100.9±8.5%. Internal calibration could be applied with the assistance of Cr, Fe, and/or Rh standards. The accuracy of the GFAAS results was verified by TXRF analyses. PMID:27451250

  10. 78 FR 75285 - Special Conditions: Bombardier Inc., Models BD-500-1A10 and BD-500-1A11 Series Airplanes; Flight... (United States)


    ... April 11, 2000 (65 FR 19477-19478), as well as at . Docket: Background... name of the individual sending the comment (or signing the comment for an association, business, labor... control systems (mechanical linkages) are limited in the pitch axis only by the elevator surface area...

  11. 77 FR 69568 - Special Conditions: Bombardier Aerospace, Model BD-500-1A10 and BD-500-1A11 Airplanes; Sidestick... (United States)


    ..., 2000 (65 FR 19477-19478), as well as at . Docket: Background documents or... the individual sending the comment (or signing the comment for an association, business, labor union... including the handle and its control stops. Pitch Roll Nose up 200 pounds force (lbf) Nose Left 100...

  12. 78 FR 75287 - Special Conditions: Bombardier Inc., Models BD-500-1A10 and BD-500-1A11 Series Airplanes; Flight... (United States)


    ... the comment (or signing the comment for an association, business, labor union, etc.). DOT's complete Privacy Act Statement can be found in the Federal Register published on April 11, 2000 (65 FR 19477-19478... load factor, bank angle, pitch angle, and speed. To accomplish this flight envelope limiting,...

  13. 78 FR 75284 - Special Conditions: Bombardier Inc., Models BD-500-1A10 and BD-500-1A11 Series Airplanes; Flight... (United States)


    ... electronic flight control system that contains fly-by-wire control laws, including envelope protections, for the overspeed protection and roll limiting function. The applicable airworthiness regulations do not... regulatory adequacy under Sec. 611 of Public Law 92-574, the ``Noise Control Act of 1972.'' The FAA...

  14. Measurement of the B_d0 lifetime using B_d0 to J/psi K0_S decays at Dzero

    Energy Technology Data Exchange (ETDEWEB)

    Balm, Paul W


    This thesis describes a measurement of the B{sub d}{sup 0} lifetime in the decay to (J/{psi}K{sub S}{sup 0}), using 114 pb{sup -1} of data collected by the D0 experiment at the Tevatron from October 15, 2002, to June 10, 2003. The measurement is motivated by the tests of the Standard Model that it makes possible. These include tests of Heavy Quark Effective Theory predicting B-meson lifetimes, and of the complex phase in the CKM-matrix as the source of CP-violation in B{sub d}{sup 0} decays to (J/{psi}K{sub S}{sup 0}).

  15. 76 FR 17062 - Special Conditions: Bombardier Model BD-700-1A10 and BD-700-1A11 Airplanes, Head-Up Display (HUD... (United States)


    ..., individual, stroke-written symbols on the HUD, the pilot may not be able to see around or through the image..., such ] as alerts, airspeed, attitude, altitude and direction, approach guidance, windshear guidance... conditions encountered during a time-critical, high-workload phase of flight (e.g., low-visibility...

  16. 76 FR 17582 - Special Conditions: Bombardier Model BD-700-1A10 and BD-700-1A11 Airplanes, Head-Up Display (HUD... (United States)


    ..., individual, stroke-written symbols on the HUD, the pilot may not be able to see around or through the image... information displayed on the HUD, such as alerts, airspeed, attitude, altitude and direction, approach... range of lighting conditions encountered during a time-critical, high-workload phase of flight...

  17. 78 FR 76734 - Special Conditions: Bombardier Inc., Models BD-500-1A10 and BD-500-1A11 Series Airplanes; Seats... (United States)


    ... be found in the Federal Register published on April 11, 2000 (65 FR 19477-19478), as well as at http... not address seats. The preambles to both the Notice of Proposed Rule Making, Notice No. 85-10 (50 FR 15038, April 16, 1985) and the Final Rule at Amendment 25-61 (51 FR 26206, July 21, 1986),...

  18. DECHEMA annual conference in 1998; DECHEMA-Jahrestagungen `98. Bd. 1. 16. Jahrestagung der Biotechnologen. Kurzfassungen

    Energy Technology Data Exchange (ETDEWEB)

    Hess, C. [comp.


    In a versatile, often multidisciplinary programme the DECHEMA annual conferences in 1998 present new results from research, the state of the art, and, not least, the persons, companies, and institutions active in various disciplines. This volume contains shortened versions of the lectures and posters presented at the 16th Annual Conference of Biotechnologists. [Deutsch] Die DECHEMA-Jahrestagungen `98 stellen in einem vielseitigen, oft interdisziplinaeren Programm neue Ergebnisse aus der Forschung, den aktuellen Stand der Technik und nicht zuletzt auch die auf den jeweiligen Gebieten aktiven Personen, Firmen und Institutionen vor. In diesem Band sind die Kurzfassungen der Vortraege und Poster der 16. Jahrestagung der Biotechnologen enthalten. (orig.)

  19. Experimental radiotherapy and clinical radiobiology. Vol. 22. Proceedings; Experimentelle Strahlentherapie und Klinische Strahlenbiologie. Bd. 22. Proceedings

    Energy Technology Data Exchange (ETDEWEB)

    Baumann, Michael; Cordes, Nils; Dikomey, Ekkehard; Krause, Mechthild; Petersen, Cordula; Rodemannn, H. Peter; Zips, Daniel (eds.)


    The proceedings of the 22th Symposium on experimental radiotherapy and clinical radiotherapy contain lectures and poster on the following issues: Radiation induced immuno-targeting of tumors; targeting in the radiotherapy; biomarkers; targeting; radio-oncological therapy of rectal carcinoma - contribution of radiobiology for therapy optimization; biomarkers for radiation sensibility; resistance mechanisms of tumors; resistance mechanisms of normal tissue; micro ambience, P13L inhibition in radiotherapy: improvement of the local tumor control by molecular mechanisms or the influence of the tumor micro-ambience? DNA repair; radiation effects and technical development.

  20. Excercises in diagnostic radiology. Vol. 8. Uebungen in radiologischer Diagnostik. Bd. 8. Notfaelle

    Energy Technology Data Exchange (ETDEWEB)

    Langston, C.S.; Squire, L.F.


    Diagnostic radiology in emergency patients as a supplement to anamnesis and examination has gained increasing importance in the last few years. Usually, the physician in charge has only few signs to go by when a patient is sent to radiology. The most frequent signs are pectoral pain, headache, dyspenea, etc. The cases in this book have been selected accordingly. Although the names have been invented the case histories presented have not been greatly changed. The original 'negatives' of the anamnesis are not presented in most cases as they would have taken up too much space. No important information has been omitted. A typical and unusual cases are characterized as such.

  1. USDA FSIS, FDA BAM, AOAC, and ISO culture methods BD BBL CHROMagar Listeria Media. (United States)

    Ritter, Vicki; Kircher, Susan; Sturm, Krista; Warns, Patty; Dick, Nancy


    BBL CHROMagar Listeria Media (CL) was evaluated for detection of Listeria monocytogenes in raw ground beef, smoked salmon, lettuce, and Brie cheese. The recovery of L. monocytogenes on CL was compared to the U.S. Food and Drug Administration (FDA) Bacteriological Analytical Manual (BAM), U.S. Department of Agriculture (USDA) Food Safety and Inspection Service (FSIS), AOAC, and International Organization for Standardization (ISO) reference-plated media using the recommended pre-enrichments and selective enrichments. Of the 265 food samples tested, 140 were tested using BAM, USDA, or AOAC methods and 125 were tested using ISO methods. CL produced comparable results with the reference methods on all matrixes with a sensitivity of 99.3% and a specificity of 100%. No false negatives were found in testing the food matrixes. There was no statistical difference in recovery based on Chi-square analysis. Known isolates were evaluated, and CL had a sensitivity and specificity of 100%. The results of this study demonstrate that CL is an effective medium for the recovery and detection of L. monocytogenes in raw ground beef, smoked salmon, lettuce, and Brie cheese using FDA BAM, USDA FSIS, AOAC, and ISO culture methods. PMID:19714979

  2. Papers of the Braunschweigische Wissenschaftliche Gesellschaft. Vol. LIX; Abhandlungen der Braunschweigischen Wissenschaftlichen Gesellschaft. Bd. LIX

    Energy Technology Data Exchange (ETDEWEB)

    Scheier, Claus-Artur (ed.)


    The topic of this symposium is global change and biological invasion. Looking back on earth history to get a rule for the dynamic of changes to be watched today. The science history with contributions on Leibnitz, Euler and Moses Mendelsohn is also presented, and finally presented are contributions on theology and cognition theory. (orig./GL)

  3. Experimental radiotherapy and clinical radiobiology. Vol. 22. Proceedings; Experimentelle Strahlentherapie und Klinische Strahlenbiologie. Bd. 25. Proceedings

    Energy Technology Data Exchange (ETDEWEB)

    Baumann, Michael; Krause, Mechthild [Universitaetsklinikum Technische Univ. Dresden (Germany). Klinik und Poliklinik fuer Strahlentherapie und Radiologie; Cordes, Nils [Universitaetsklinikum Technische Univ. Dresden (Germany). OncoRay - Nationales Zentrum fuer Strahlenforschung in der Radioonkologie; Helmholtz-Zentrum Dresden-Rossendorf e.V., Dresden (Germany); Petersen, Cordula [Universitaetsklinikum Hamburg-Eppendorf, Hamburg (Germany). Klinik und Poliklinik fuer Strahlentherapie und Radioonkologie; Rodemann, H. Peter [Universitaetsklinikum Tuebingen (Germany). Sektion fuer Strahlenbiologie; Rothkamm, Kai [Universitaetsklinikum Hamburg-Eppendorf, Hamburg (Germany). Lab. fuer Strahlentherapie und Experimentelle Radioonkologie; Zips, Daniel (ed.) [Tuebingen Univ. (Germany). Universitaetsklinik fuer Radioonkologie


    The proceedings of the 25th symposium on experimental radiotherapy and clinical radiobiology include papers on the following issues: radiotherapy individualization based on imaging; pre-clinic imaging and new experimental methods; methods and models, micromilieu and metabolism, combined therapy; secondary tumors following radiotherapy; radiogenic effects in normal tissue; resistance mechanism of tumors and normal tissue; personalized radio-oncology - which biological data are needed; pre-clinic and personalized radio-oncology; biomarkers - pre-clinic and translational; translational examinations for personalized radio-oncology.

  4. Experimental radiotherapy and clinical radiobiology. Vol. 19. Proceedings; Experimentelle Strahlentherapie und Klinische Strahlenbiologie. Bd. 19. Proceedings

    Energy Technology Data Exchange (ETDEWEB)

    Baumann, Michael; Dahm-Daphi, Jochen; Dikomey, Ekkehard; Petersen, Cordula; Rodemann, H. Peter; Zips, Daniel (eds.)


    The proceedings include review contributions on radio-oncology, and new radiation technologies and molecular prediction; and poster sessions on the following topics: hypoxia; molecular mechanisms of radiation resistance; molecular targeting; DNA repair; biological imaging; biology of experimental radiations; normal tissue toxicity; modern radiotherapy; tumor hypoxia and metabolic micro milieu; immune system and radiotherapy.

  5. Dicty_cDB: FC-BD11 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available gsry*titr*dvtrsslllsryssssfrcklstnpsqlsirrkgwc*klpt*wfhg cqw*ww*rsklstklfrwsratsricst*i*rlwfrcsstiqssk*rlcst...A gene and menE gene, wild type. 76 6e-10 1 BX564920 |BX564920.1 Glossina morsitans morsitans (Tseats...4 3e-09 1 BX554380 |BX554380.1 Glossina morsitans morsitans (Tseatse fly) EST from adult infected midgut lib...rary, clone Tse15b01_q1c. 74 3e-09 1 BX554266 |BX554266.1 Glossina morsitans morsitans (Tseatse fly) EST fro...3.1 Glossina morsitans morsitans (Tseatse fly) EST from adult infected midgut library, clone Tse14g12_q1c. 7

  6. Cavaire ~ Bonafos, "Bonafos, yeu vos envit" (BdT 111.1= 99.1

    Directory of Open Access Journals (Sweden)

    Rosa María Medina Granda


    Full Text Available The aim of this paper is to study the use of the senhal Bonafos, that occurs in l. 27 of the partimen between Cavaire and Bonafos, as a satirical-parodic senhal. We propose to analyse Bonafos in the same way as we previously examined the use of its opposite, Malafos, in contexts containing a discourse that is far from that of the Canso. This would be the case of the pastorela and the partimen. The use of an echoing irony and its interaction with parody and satire would have made possible the conversion of a previous discursive modalizer into a satirical-parodic senhal in this partimen. We also take into account the use that Jews from the south of France made of the anthroponym Bonafos. The conclusions from previous works as well as the data deriving from the Geopatronyme have provided us with this interesting information. However, we do not believe that in this partimen Bonafos is the real name of the jongleur. On the contrary, we argue that Bonafos, even if an anthroponym, might have continued to ‘encapsulate’ the echo of its hypothetical origin: the discursive modalizer (anc bona fos.

  7. Repositori d'arbres genealògics en BD NoSQL


    Lozano Moya, Javier


    Aplicación web creada para convertir ficheros GEDCOM en datos estructurados en una base de datos orientada a grafos NoSQL, llamada Neo4j. Ha sido creada utilizando Neo4j, Node.js, Express y AngularJS.

  8. The NIH BD2K center for big data in translational genomics. (United States)

    Paten, Benedict; Diekhans, Mark; Druker, Brian J; Friend, Stephen; Guinney, Justin; Gassner, Nadine; Guttman, Mitchell; Kent, W James; Mantey, Patrick; Margolin, Adam A; Massie, Matt; Novak, Adam M; Nothaft, Frank; Pachter, Lior; Patterson, David; Smuga-Otto, Maciej; Stuart, Joshua M; Van't Veer, Laura; Wold, Barbara; Haussler, David


    The world's genomics data will never be stored in a single repository - rather, it will be distributed among many sites in many countries. No one site will have enough data to explain genotype to phenotype relationships in rare diseases; therefore, sites must share data. To accomplish this, the genetics community must forge common standards and protocols to make sharing and computing data among many sites a seamless activity. Through the Global Alliance for Genomics and Health, we are pioneering the development of shared application programming interfaces (APIs) to connect the world's genome repositories. In parallel, we are developing an open source software stack (ADAM) that uses these APIs. This combination will create a cohesive genome informatics ecosystem. Using containers, we are facilitating the deployment of this software in a diverse array of environments. Through benchmarking efforts and big data driver projects, we are ensuring ADAM's performance and utility. PMID:26174866

  9. A partially bilayered smectic B (Bd) phase of a thermochromic mesogen


    Bazuin, C.G.; Guillon, D.; Skoulios, A.; Zana, R.


    N-hexadecyl-p-cyanopyridinium iodide was studied using X-ray scattering, differential scanning calorimetry and polarized light microscopy. Preliminary results reveal that the material is thermochromic, turning from yellow to red upon entering a liquid crystal phase at 104°C. The mesophase is of the smectic B type, where the lamellar spacing is between one and two molecular lengths. A structural model is proposed that can be described as a honeycomb arrangement of unpaired molecules with their...

  10. Experimental radiotherapy and clinical radiobiology. Vol. 16; Experimentelle Strahlentherapie und Klinische Strahlenbiologie. Bd. 16. Proceedings

    Energy Technology Data Exchange (ETDEWEB)

    Baumann, M.; Dahm-Daphi, J.; Dikomey, E.; Petersen, C.; Rodemann, H.P.; Zips, D. (eds.)


    The following topics were dealt with: DNA repair as therapeutical target in radiation therapy, biological imaging and tumor microenvironment, molecular factors of radiation therapy, molecular factors and modulation of the radiation reaction of normal tissues, experimental tumor therapy, EGFR inhibition, the endothel cell as primary target of radiation therapy, molecular and cellular foundations of the radiation biology of protons and ions. (HSI)

  11. ALA-PDT of glioma cell micro-clusters in BD-IX rat brain (United States)

    Madsen, Steen J.; Angell-Petersen, Even; Spetalen, Signe; Carper, Stephen W.; Ziegler, Sarah A.; Hirschberg, Henry


    A significant contributory factor to the poor prognosis of patients with glioblastoma multiforme is the inability of conventional treatments to eradicate infiltrating glioma cells. A syngeneic rat brain tumor model is used to investigate the effects of aminolevulinic acid (ALA)-mediated photodynamic therapy (PDT) on small clusters of tumor cells sequestered in normal brain. The intrinsic sensitivity of rat glioma cells to PDT was investigated by exposing ALA-incubated cells to a range of radiant exposures and irradiances using 635 nm light. Biodistribution studies were undertaken on tumor-bearing animals in order to determine the tumor selectivity of the photosensitizer following systemic administration (i.p.) of ALA. Effects of ALA-PDT on normal brain and gross tumor were evaluated using histopathology. Effects of PDT on isolated glioma cells in normal brain were investigated by treating animals 48 h after tumor cell implantation: a time when the micro-clusters of cells are protected by an intact blood-brain-barrier (BBB). Rat glioma cells in monolayer are susceptible to ALA-PDT - lower irradiances are more effective than higher ones. Fluorescence microscopy of frozen tissue sections showed that photosensitizer is produced with better than 200:1 tumor-to-normal tissue selectivity following i.p. ALA administration. ALA-PDT resulted in significant damage to both gross tumor and normal brain, however, the treatment failed to prolong survival of animals with newly implanted glioma cells compared to non-treated controls if the drug was delivered either i.p. or directly into the brain. In contrast, animals inoculated with tumor cells pre-incubated in vitro with ALA showed a significant survival advantage in response to PDT.

  12. Near-Earth Asteroids 2006 RH120 And 2009 BD: Proxies For Maximally Accessible Objects? (United States)

    Barbee, Brent W.; Chodas, Paul W.


    Near-Earth Object Human Space Flight Accessible Targets Study(NHATS): http://neo.jpl.nasa.govnhats/. As of mid-July 2015: 1,434 of the 12,778 currently known NEAs are more astrodynamically accessible than is Mars (requiring less Delta v and or less flight time for round-trip missions). Within those 1,434 NEAs: 605 NEAs can be visited round-trip for less Delta v (9 km/s) than the lunar surface. 51 NEAs can be visited round-trip for less v (5 km/s) than low circular lunar orbit. NEO population statistical models:Tens of thousands of NEAs greater than 100 m yet to be discovered. At least several million NEAs less than or equal to100 m in size (down to approximately 3 m in size) yet to be discovered. How accessible are the NEAs that haven't yet been discovered?

  13. Chemical Characterization of an Envelope B/D Sample from Hanford Tank 241-AZ-102

    International Nuclear Information System (INIS)

    A sample from Hanford waste tank 241-AZ-102 was received at the Savannah River Technology Center (SRTC) and chemically characterized. The sample containing supernate and a small amount of sludge solids was analyzed as-received. The filtered supernatant liquid, the total dried solids of the sample, and the washed insoluble solids obtained from filtration of the sample were analyzed. A mass balance calculation of the three fractions of the sample analyzed indicate the analytical results appear relatively self-consistent for major components of the sample. However, some inconsistency was observed between results were more than one method of determination was employed and for species present in low concentrations. The actinides isotopes, plutonium, americium, and curium, present analytical challenges due to the low concentration of these species and the potential for introduction of small amounts of contamination during sampling handling resulting in large uncertainties. A direct comparison to previous analyses of material from tank 241-AZ-102 showed good agreement with the filtered supernatant liquid. However, the comparison of solids data showed poor agreement. The poor agreement shown between the current results for the solids samples and previous analyses most likely results from the uncertainties associated with obtaining small solids samples from a large non-homogenized waste tank

  14. Raimbaut de Vaqueiras, “Domna, tant vos ai prejada” (BdT 392.7

    Directory of Open Access Journals (Sweden)

    Gilda Caiti-Russo


    Full Text Available This paper will attempt to read Raimbaut de Vaqueiras’ ‘contrasto’ from the viewpoint of its explicit addressees: the late twelfth-century imperial nobility of north-western Italy, as embodied by the Malaspina family. The text’s distinctive bilingualism thus assumes social and political significance since it pits the claims of the feudal aristocracy of the hinterland against the power of the Genoese bankers and merchants. The dialectical relationship of the two sides involved, played out by the voices of the jongleur and the Genoese lady, is nevertheless also literary: Raimbaut appears to match popular poetry, poetry which is «non regulata» as Dante would later call it, against a century of courtly Occitan poetry distinguished by an extremely formal tradition. A carnivalesque dimension is thus present in the reciprocal illumination of the two poetic voices: if popular poetry is unregulated despite its expressive qualities, troubadour poetry is confined, by means of the parody of the genre of the ‘salut’, to topics far-removed from reality. Raimbaut’s aim then is to restructure trobar by going back to the beginning: to the Count of Poitiers and his political and cultural act of inventing a secular poetry of aristocratic inspiration and in the vernacular. A ‘male’ poetry that will be formulated by the surprising gap at the end of the poem.

  15. Mixing and CPV in the Bd and Bs systems at ATLAS

    CERN Document Server

    AUTHOR|(INSPIRE)INSPIRE-00211684; The ATLAS collaboration


    The most recent results on mixing and $CP$ violation in the $B^0$ and $B_s^0$ systems, published by the ATLAS experiment at the LHC, are presented. The measurement of the $B_s^0 \\to J/\\psi \\phi$ decay parameters, using data collected in $p p$ collisions at $\\sqrt{s} = 7$ TeV and $\\sqrt{s} = 8$ TeV and corresponding to 4.9 fb$^{-1}$ and 14.3 fb$^{-1}$ of integrated luminosity, includes the $CP$-violating phase $\\phi_s$ and the width difference of the mass eigenstates $\\Delta\\Gamma_s$. The combined Run-1 results are $\\phi_s = -0.098 \\pm 0.084 \\mbox{(stat.)} \\pm 0.040 \\mbox{(syst.)}$ rad and $\\Delta\\Gamma_s = 0.083 \\pm 0.011 \\mbox{(stat.)} \\pm 0.007 \\mbox{(syst.)} ~\\mbox{ps}^{-1}$. The measured values agree with the Standard Model predictions. The second result presented is the measurement of the relative width difference $\\Delta \\Gamma_d / \\Gamma_d$ of the $B^0$--$\\bar B^0$ system, using data collected in $p p$ collisions at $\\sqrt{s} = 7$ TeV and $\\sqrt{s} = 8$ TeV, and corresponding to a total integrated lumi...

  16. Theory of nuclear reactors. Vol. 1. Theorie der Kernreaktoren. Bd. 1. Der stationaere Reaktor

    Energy Technology Data Exchange (ETDEWEB)

    Emendoerfer, D.; Hoecker, K.H.


    An introduction is given to the elements of reactor physics and reactor calculation which refers to practice from the present point of view. It is demonstrated to the reader how the reactor characteristics relevant to construction can be calculated from atomic factors by means of neutron transport and diffusion theory; these reactor characteristics are: multiplication factor, power density distribution, burn-up, plutonium build-up, xenon vibrations, short-time behaviour. The interaction between thermo- and fluid-dynamic processes is important for this calculation. On grounds of didactics the crucial point of this book is the establishment and calculation of simple models which give a clear description of all important characteristics of the events. Attempts for more exact simulation by computer are dealt with including typical solutions.

  17. Transactions of the Gesellschaft fuer Oekologie. Vol. 22; Verhandlungen der Gesellschaft fuer Oekologie. Bd. 22

    Energy Technology Data Exchange (ETDEWEB)

    Pfadenhauer, J. [ed.; Kappen, L. [ed.; Mahn, E.G. [ed.; Otte, A. [ed.; Plachter, H. [ed.; Seitz, A. [ed.


    This conference volume contains 75 contributions on the following major subjects: Extensification in cultivated areas (24); ecological compensation areas (12); revitalization of rivers and lakes and the banks of rivers and lakes (4); ecology of the Alpine region (2); ecology of the tropics (4); population ecology of plants (4); didactics and translation into practice of ecological knowledge (7); theory in ecology (3); independent subjects and other contributions (15). (vhe) [Deutsch] Der vorliegende Tagungsband enthaelt insgesamt 75 Beitraege zu den folgenden Schwerpunktthemen: Extensivierung in der Kulturlandschaft (24); Oekologische Ausgleichsflaechen (12); Revitalisierung von Gewaessern und Uferzonen (4); Oekologie des Alpenraumes (2); Tropenoekologie (4); Populationsoekologie der Pflanzen (4); Didaktik und Umsetzung oekologischer Erkenntnisse (7); Theorie in der Oekologie (3), Freie Themen und andere Beitraege (15). (vhe)

  18. Measurement of branching fraction and CP asymmetries in B->D0(cp)K decays

    CERN Document Server

    Aubert, B; Boutigny, D; Karyotakis, Yu; Lees, J P; Poireau, V; Prudent, X; Tisserand, V; Zghiche, A; Garra Tico, J; Graugès-Pous, E; López, L; Palano, A; Pappagallo, M; Eigen, G; Stugu, B; Sun, L; Abrams, G S; Battaglia, M; Brown, D N; Button-Shafer, J; Cahn, R N; Groysman, Y; Jacobsen, R G; Kadyk, J A; Kerth, L T; Kolomensky, Yu G; Kukartsev, G; Lopes-Pegna, D; Lynch, G; Mir, L M; Orimoto, T J; Osipenkov, I L; Ronan, M T; Tackmann, K; Tanabé, T; Wenzel, W A; Del Amo-Sánchez, P; Hawkes, C M; Watson, A T; Koch, H; Schröder, T; Walker, D; Asgeirsson, D J; Çuhadar-Dönszelmann, T; Fulsom, B G; Hearty, C; Mattison, T S; McKenna, J A; Khan, A; Saleem, M; Teodorescu, L; Blinov, V E; Bukin, A D; Druzhinin, V P; Golubev, V B; Onuchin, A P; Serednyakov, S I; Skovpen, Yu I; Solodov, E P; Todyshev, K Yu; Bondioli, M; Curry, S; Eschrich, I; Kirkby, D; Lankford, A J; Lund, P; Mandelkern, M; Martin, E C; Stoker, D P; Abachi, S; Buchanan, C; Foulkes, S D; Gary, J W; Liu, F; Long, O; Shen, B C; Vitug, G M; Zhang, L; Paar, H P; Rahatlou, S; Sharma, V; Berryhill, J W; Campagnari, C; Cunha, A; Dahmes, B; Hong, T M; Kovalskyi, D; Richman, J D; Beck, T W; Eisner, A M; Flacco, C J; Heusch, C A; Kroseberg, J; Lockman, W S; Schalk, T; Schumm, B A; Seiden, A; Wilson, M G; Winstrom, L O; Chen, E; Cheng, C H; Fang, F; Hitlin, D G; Narsky, I; Piatenko, T; Porter, F C; Andreassen, R; Mancinelli, G; Meadows, B T; Mishra, K; Sokoloff, M D; Blanc, F; Bloom, P C; Chen, S; Ford, W T; Hirschauer, J F; Kreisel, A; Nagel, M; Nauenberg, U; Olivas, A; Smith, J G; Ulmer, K A; Wagner, S R; Zhang, J; Gabareen, A M; Soffer, A; Toki, W H; Wilson, R J; Winklmeier, F; Altenburg, D D; Feltresi, E; Hauke, A; Jasper, H; Karbach, M; Merkel, J; Petzold, A; Spaan, B; Wacker, K; Klose, V; Kobel, M J; Lacker, H M; Mader, W F; Nogowski, R; Schubert, J; Schubert, K R; Schwierz, R; Sundermann, J E; Volk, A; Bernard, D; Bonneaud, G R; Latour, E; Lombardo, V; Thiebaux, C; Verderi, M; Clark, P J; Gradl, W; Muheim, F; Playfer, S; Robertson, A I; Watson, J E; Xie, Y; Andreotti, M; Bettoni, D; Bozzi, C; Calabrese, R; Cecchi, A; Cibinetto, G; Franchini, P; Luppi, E; Negrini, M; Petrella, A; Piemontese, L; Prencipe, E; Santoro, V; Anulli, F; Baldini-Ferroli, R; Calcaterra, A; De Sangro, R; Finocchiaro, G; Pacetti, S; Patteri, P; Peruzzi, I M; Piccolo, M; Rama, M; Zallo, A; Buzzo, A; Contri, R; Lo Vetere, M; Macri, M M; Monge, M R; Passaggio, S; Patrignani, C; Robutti, E; Santroni, A; Tosi, S; Chaisanguanthum, K S; Morii, M; Wu, J; Dubitzky, R S; Marks, J; Schenk, S; Uwer, U; Bard, D J; Dauncey, P D; Flack, R L; Nash, J A; Panduro-Vazquez, W; Tibbetts, M; Behera, P K; Chai, X; Charles, M J; Mallik, U; Cochran, J; Crawley, H B; Dong, L; Eyges, V; Meyer, W T; Prell, S; Rosenberg, E I; Rubin, A E; Gao, Y Y; Gritsan, A V; Guo, Z J; Lae, C K; Denig, A G; Fritsch, M; Schott, G; Arnaud, N; Bequilleux, J; D'Orazio, A; Davier, M; Grosdidier, G; Höcker, A; Lepeltier, V; Le Diberder, F; Lutz, A M; Pruvot, S; Rodier, S; Roudeau, P; Schune, M H; Serrano, J; Sordini, V; Stocchi, A; Wang, W F; Wormser, G; Lange, D J; Wright, D M; Bingham, I; Burke, J P; Chavez, C A; Fry, J R; Gabathuler, E; Gamet, R; Hutchcroft, D E; Payne, D J; Schofield, K C; Touramanis, C; Bevan, A J; George, K A; Di Lodovico, F; Sacco, R; Cowan, G; Flächer, H U; Hopkins, D A; Paramesvaran, S; Salvatore, F; Wren, A C; Brown, D N; Davis, C L; Allison, J; Bailey, D; Barlow, N R; Barlow, R J; Chia, Y M; Edgar, C L; Lafferty, G D; West, T J; Yi, J I; Anderson, J; Chen, C; Jawahery, A; Roberts, D A; Simi, G; Tuggle, J M; Blaylock, G; Dallapiccola, C; Hertzbach, S S; Li, X; Moore, T B; Salvati, E; Saremi, S; Cowan, R; Dujmic, D; Fisher, P H; Koeneke, K; Sciolla, G; Spitznagel, M; Taylor, F; Yamamoto, R K; Zhao, M; Zheng, Y; Mclachlin, S E; Patel, P M; Robertson, S H; Lazzaro, A; Palombo, F; Bauer, J M; Cremaldi, L; Eschenburg, V; Godang, R; Kroeger, R; Sanders, D A; Summers, D J; Zhao, H W; Brunet, S; Côté, D; Simard, M; Taras, P; Viaud, F B; Nicholson, H; De Nardo, Gallieno; Fabozzi, F; Lista, L; Monorchio, D; Sciacca, C; Baak, M A; Raven, G; Snoek, H L; Jessop, C P; Knoepfel, K J; LoSecco, J M; Benelli, G; Corwin, L A; Honscheid, K; Kagan, H; Kass, R; Morris, J P; Rahimi, A M; Regensburger, J J; Sekula, S J; Wong, Q K; Blount, N L; Brau, J E; Frey, R; Igonkina, O; Kolb, J A; Lu, M; Rahmat, R; Sinev, N B; Strom, D; Strube, J; Torrence, E; Gagliardi, N; Gaz, A; Margoni, M; Morandin, M; Pompili, A; Posocco, M; Rotondo, M; Simonetto, F; Stroili, R; Voci, C; Ben-Haim, E; Briand, H; Calderini, G; Chauveau, J; David, P; Del Buono, L; De La Vaissière, C; Hamon, O; Leruste, P; Malcles, J; Ocariz, J; Pérez, A; Prendki, J; Gladney, L; Biasini, M; Covarelli, R; Manoni, E; Angelini, C; Batignani, G; Bettarini, S; Carpinelli, M; Cenci, R; Cervelli, A; Forti, F; Giorgi, M A; Lusiani, A; Marchiori, G; Mazur, M A; Morganti, M; Neri, N; Paoloni, E; Rizzo, G; Walsh, J J; Biesiada, J; Elmer, P; Lau, Y P; Lü, C; Olsen, J; Smith, A J S; Telnov, A V; Baracchini, E; Bellini, F; Cavoto, G; Del Re, D; Di Marco, E; Faccini, R; Ferrarotto, F; Ferroni, F; Gaspero, M; Jackson, P D; Li Gioi, L; Mazzoni, M A; Morganti, S; Piredda, G; Polci, F; Renga, F; Voena, C; Ebert, M; Hartmann, T; Schröder, H; Waldi, R; Adye, T; Castelli, G; Franek, B; Olaiya, E O; Röthel, W; Wilson, F F; Emery, S; Escalier, M; Gaidot, A; Ganzhur, S F; Hamel de Monchenault, G; Kozanecki, W; Vasseur, G; Yéche, C; Zito, M; Chen, X R; Liu, H; Park, W; Purohit, M V; White, R M; Wilson, J R; Allen, M T; Aston, D; Bartoldus, R; Bechtle, P; Claus, R; Coleman, J P; Convery, M R; Dingfelder, J C; Dorfan, J; Dubois-Felsmann, G P; Dunwoodie, W; Field, R C; Glanzman, T; Gowdy, S J; Graham, M T; Grenier, P; Hast, C; Innes, W R; Kaminski, J; Kelsey, M H; Kim, H; Kim, P; Kocian, M L; Leith, D W G S; Li, S; Luitz, S; Lüth, V; Lynch, H L; MacFarlane, D B; Marsiske, H; Messner, R; Müller, D R; O'Grady, C P; Ofte, I; Perazzo, A; Perl, M; Pulliam, T; Ratcliff, B N; Roodman, A; Salnikov, A A; Schindler, R H; Schwiening, J; Snyder, A; Su, D; Sullivan, M K; Suzuki, K; Swain, S K; Thompson, J M; Vavra, J; Wagner, A P; Weaver, M; Wisniewski, W J; Wittgen, M; Wright, D H; Yarritu, A K; Yi, K; Young, C C; Ziegler, V; Burchat, P R; Edwards, A J; Majewski, S A; Miyashita, T S; Petersen, B A; Wilden, L; Ahmed, S; Alam, M S; Bula, R; Ernst, J A; Jain, V; Pan, B; Saeed, M A; Wappler, F R; Zain, S B; Krishnamurthy, M; Spanier, S M; Eckmann, R; Ritchie, J L; Ruland, A M; Schilling, C J; Schwitters, R F; Izen, J M; Lou, X C; Ye, S; Bianchi, F; Gallo, F; Gamba, D; Pelliccioni, M; Bomben, M; Bosisio, L; Cartaro, C; Cossutti, F; Della Ricca, G; Lanceri, L; Vitale, L; Azzolini, V; Lopez-March, N; Martínez-Vidal, F; Milanes, D A; Oyanguren, A; Albert, J; Banerjee, Sw; Bhuyan, B; Hamano, K; Kowalewski, R; Nugent, I M; Roney, J M; Sobie, R J; Harrison, P F; Ilic, J; Latham, T E; Mohanty, G B; Band, H R; Chen, X; Dasu, S; Flood, K T; Hollar, J J; Kutter, P E; Pan, Y; Pierini, M; Prepost, R; Wu, S L; Neal, H


    We present a preliminary study of $B^- \\to D^0_{CP} \\pi^-$ and $B^- \\to D^0_{CP} K^-$ decays, with the $D^0_{CP}$ reconstructed in the CP-odd eigenstates $K_s \\pi^0$, $K_s \\omega$, in the CP-even eigenstates $K^+ K^-$, $\\pi^+ \\pi^-$, and in the (non-CP) flavor eigenstate $K^\\mp \\pi^\\pm$. Using a sample of about 382 million Y(4S) decays into BBbar pairs, collected with the BABAR detector operating at the PEP-II asymmetric-energy B Factory at SLAC, we measure the ratios of the branching fractions R_CP+- and the direct CP asymmetries A_CP+-. The results are: R_CP- = 0.81 \\pm 0.10 (stat) \\pm 0.05 (syst) R_CP+ = 1.07 \\pm 0.10 (stat) \\pm 0.04 (syst) A_CP- = -0.19 \\pm 0.12 (stat) \\pm 0.02 (syst) A_CP+ = 0.35 \\pm 0.09 (stat) \\pm 0.05 (syst)

  19. Exercises in dental radiology. Vol. 3. Uebungen in zahnaerztlicher Roentgenologie. Bd. 3. Intraorale Roentgendiagnostik

    Energy Technology Data Exchange (ETDEWEB)

    Dixter, C.; Langlais, R.P.; Lichty, G.C.


    The book is addressed to paediatric dentists and other dentists who have children among their patients; it presents a survey of normal and pathological development of teeth and surrounding tissues. Imaging errors, eruption problems, anomalies the radiological picture of primary and secondary crowding during eruption, analysis of the deciduous teeth, teleradiography, traumas and temporomandibular diseases are discussed. Each chapter contains questions concerning the interpretation of the radiological findings.

  20. Comparativa entre dues BD semàntiques : OWLIM-Lite i Virtuoso


    Olascoaga Figuerola, Pello


    L'objectiu fonamental d'aquest treball és estudiar els conceptes bàsics de la web semàntica mitjançant l'estudi de dos sistemes de gestió de bases de dades (SGBD) utilitzats en el context de la web semàntica, OWLIM-Lite i Virtuoso, que ens permetran dissenyar i implementar una ontologia. El objetivo fundamental de este trabajo es estudiar los conceptos básicos de la web semántica mediante el estudio de dos sistemas de gestión de bases de datos (SGBD) utilizados en el contexto de la web sem...

  1. Micro-Eukaryote Diversity in Freshwater Ponds That Harbor the Amphibian Pathogen "Batrachochytrium Dendrobatidis" ("Bd") (United States)

    Lauer, Antje; McConnel, Lonnie; Singh, Navdeep


    We designed a microbiology project that fully engaged undergraduate biology students, high school students, and their teachers in a summer research program as part of the Research Education Vitalizing Science University Program conducted at California State University Bakersfield. Modern molecular biological methods and microscopy were used to…

  2. Experimental radiotherapy and clinical radiobiology. Vol. 20. Proceedings; Experimentelle Strahlentherapie und Klinische Strahlenbiologie. Bd. 20. Proceedings

    Energy Technology Data Exchange (ETDEWEB)

    Baumann, Michael; Dahm-Daphi, Jochen; Dikomey, Ekkehard; Petersen, Cordula; Rodemannn, Hans-Peter; Zips, Daniel (eds.)


    The proceedings include contributions on the following issues: laser driven proton accelerators on the way for radiotherapy, radiobiological evaluation of new radiations; molecular factors of radiation response; biological targeting; EGFR epidermal growth factor receptor/targeting - combined internal and external irradiation, radiobiology of normal tissues; dose-volume histograms for the radiotherapy: curves without radiobiological relevance or important information for the therapy planning; HPV (human papilloma virus) and radiation sensitivity of HNSCC (head and neck squamous cell carcinomas): evidence, radiobiological mechanism, clinical consequences and perspectives; mechanisms of action and intertumoral heterogeneity of response to EGFR inhibition in radiotherapy of solid tumors; evaluation of biomarkers for radiotherapy.

  3. Waiting for the discovery of $B_{d}^{0} \\to K^{0}K^{0}$

    CERN Document Server

    Fleischer, Robert


    The CP asymmetries of the decay B/sub d//sup 0/ to K/sup 0/K/sup 0/, which originates from b to dss flavor-changing neutral-current processes, and its CP-averaged branching ratio BR(B/sub d/ to K/sup 0 /K/sup 0/) offer interesting avenues to explore flavor physics. We show that we may characterize this channel, within the standard model, in a theoretically clean manner through a surface in observable space. In order to extract the relevant information from BR(B/sub d/ to K/sup 0/K/sup 0/), further information is required, which is provided by the B to pi pi system and the SU(3) flavor symmetry, where we include the leading factorizable SU(3)-breaking corrections and discuss how experimental insights into nonfactorizable effects can be obtained. We point out that the standard model implies a lower bound for BR(B/sub d/ to K/sup 0/K/sup 0/), which is very close to its current experimental upper bound, thereby suggesting that this decay should soon be observed. Moreover, we explore the implications for "color su...

  4. Experimental radiotherapy and clinical radiobiology. Vol. 18. Proceedings; Experimentelle Strahlentherapie und Klinische Strahlenbiologie. Bd. 18. Proceedings

    Energy Technology Data Exchange (ETDEWEB)

    Baumann, Michael; Dahm-Daphi, Jochen; Dikomey, Ekkehard; Petersen, Cordula; Rodemann, H. Peter; Zips, Daniel (eds.)


    The proceedings on experimental radiotherapy and clinical radiobiology contain two review articles (prediction of normal tissue reactions after radiotherapy, ?H2AX foci as a marker for DNA double-strand breaks) and 34 contributions to the following topics: Hypoxia and molecular mechanisms of radiation resistance; biological imaging of the tumor micromilieu; DNA repair, genomic instability and carcerogenesis; molecular factors of radiation resistance; actual controversial discussion on possible irradiation caused metastasis risk enhancement; EGFR inhibition and irradiation; biology of experimental radiation/ normal tissue toxicity.

  5. The Bifidobacterium dentium Bd1 Genome Sequence Reflects Its Genetic Adaptation to the Human Oral Cavity


    Ventura, Marco; Turroni, Francesca; Zomer, Aldert; Foroni, Elena; Giubellini, Vanessa; Bottacini, Francesca; Canchaya, Carlos; Claesson, Marcus J.; He, Fei; Mantzourani, Maria; Mulas, Laura; Ferrarini, Alberto; Gao, Beile; Delledonne, Massimo; Henrissat, Bernard


    Bifidobacteria, one of the relatively dominant components of the human intestinal microbiota, are considered one of the key groups of beneficial intestinal bacteria (probiotic bacteria). However, in addition to health-promoting taxa, the genus Bifidobacterium also includes Bifidobacterium dentium, an opportunistic cariogenic pathogen. The genetic basis for the ability of B. dentium to survive in the oral cavity and contribute to caries development is not understood. The genome of B. dentium B...

  6. Combined cloud point-solid phase extraction by dispersion of TiO₂ nanoparticles in micellar media followed by semi-microvolume UV-vis spectrophotometric detection of zinc. (United States)

    Pourreza, Nahid; Naghdi, Tina


    A new approach is presented in this paper by using dispersed TiO2 nanoparticles (TiO2-NPs) in a combined cloud point and solid phase extraction for the efficient preconcentration and determination of Zn(2+) in various samples. In this method Zn(2+) ions are adsorbed on TiO2-NPs and transferred into surfactant rich phase. Subsequently the Zn(2+) ions are desorbed from TiO2-NPs by a dithizone solution via forming a color complex which could be detected colorimetrically. The influence of chemical variables such as pH of the sample solution, electrolyte, amount of TiO2-NPs, type and volume of the eluent on the extraction system was studied. The calibration graph was linear in the range of 0.5-90.0 µg L(-1) of Zn(2+) (r=0.9996). An enrichment factor of 80 was achieved and the limit of detection for Zn(2+) was 0.33 µg L(-1). The relative standard deviation (RSD) for eight replicate measurements of 10 µg L(-1) and 60 µg L(-1) of Zn(2+) was 1.8% and 1.5% respectively. The proposed method was successfully applied to the quantitative determination of Zn(2+) in tap water, powder milk and Zinc sulfate tablet with satisfactory results. PMID:25059144

  7. Measurement of the Ratios of Branching Fractions B(Bs -> Ds pi pi pi) / B(Bd -> Dd pi pi pi) and B(Bs -> Ds pi) / B(Bd -> Dd pi)

    Energy Technology Data Exchange (ETDEWEB)

    Abulencia, A.; /Illinois U., Urbana; Adelman, J.; /Chicago U.; Affolder, T.; /UC, Santa Barbara; Akimoto, T.; /Tsukuba U.; Albrow, M.G.; /Fermilab; Ambrose, D.; /Fermilab; Amerio, S.; /Padua U.; Amidei, D.; /Michigan U.; Anastassov, A.; /Rutgers U., Piscataway; Anikeev, K.; /Fermilab; Annovi, A.; /Frascati /Taiwan, Inst. Phys.


    Using 355 pb{sup -1} of data collected by the CDF II detector in p{bar p} collisions at {radical}s = 1.96 TeV at the Fermilab Tevatron, they study the fully reconstructed hadronic decays B{sub (s)}{sup 0} {yields} D{sub (s)}{sup -}{pi}{sup +} and B{sub (s)}{sup 0} {yields} D{sub (s)}{sup -} {pi}{sup +}{pi}{sup +}{pi}{sup -}. They present the first measurement of the ratio of branching fractions {Beta}(B{sub s}{sup 0} {yields} D{sub s}{sup -}{pi}{sup +}{pi}{sup +}{pi}{sup -})/{Beta}(B{sup 0} {yields} D{sup -} {pi}{sup +}{pi}{sup +}{pi}{sup -}) = 1.05 {+-} 0.10(stat.) {+-} 0.22(syst.). They also update their measurement of {Beta}(B{sub s}{sup 0} {yields} D{sub s}{sup -} {pi}{sup +})/{Beta}(B{sup 0} {yields} D{sup -} {pi}{sup +}) to 1.13 {+-} 0.08(stat.) {+-} 0.23(syst.) improving the statistical uncertainty by more than a factor of two. They find {Beta}(B{sub s}{sup 0} {yields} D{sub s}{sup -} {pi}{sup +}) = [3.8 {+-} 0.3(stat.) {+-} 1.3(syst.)] x 10{sup -3} and {Beta}(B{sub s}{sup 0} {yields} D{sub s}{sup -} {pi}{sup +}{pi}{sup +}{pi}{sup -}) = [8.4 {+-} 0.8(stat.) {+-} 3.2(syst.)] x 10{sup -3}.

  8. Experimental study on 2BD-7 type multifunctional precision seed spacing drill%2BD-7型多功能精密耕播机的试验研究

    Institute of Scientific and Technical Information of China (English)

    张伟; 王福林; 汪春; 李玉清



  9. Guglielmo di Poitiers, “Ab la dolchor del temps novel” (BdT 183.1

    Directory of Open Access Journals (Sweden)

    Francesca Gambino


    Full Text Available This paper will put forward some possible new interpretations for selected passages in “Ab la douzor del temps novel” by William of Aquitaine. The term ‘vers’, for example, has always been paraphrased in different ways, but its primary meaning might be that provided by the naturalistic context: in the spring birds twitter among the branches, they produce a ‘verse’. Thus the literal meaning of ‘vers’ could be that of ‘a characteristic sound produced by the vocal organs of a particular animal (mainly a bird’. As for l. 15, instead of the traditional image of the hawthorn branch ‘tremblan’ (‘trembling’ on the tree, the alternative reading entrenan (the branch ‘stands firmly on the tree’, ‘resists the elements’ is preferred, which could well be a lectio difficilior. The paper will end by providing a commentary to the text. The edition used is Eusebi, with some corrections.

  10. Differential diagnosis in pediatric radiology. Vol. 1. Skull, spine, skeleton; Differentialdiagnostik in der paediatrischen Radiologie. Bd. 1. Schaedel, Wirbelsaeule, Skelett

    Energy Technology Data Exchange (ETDEWEB)

    Ebel, K.D. [ed.; Willich, E. [ed.; Richter, E. [ed.; Benz-Bohm, G.; Bliesener-Harzheim, J.A.; Ebel, K.D.; Oestreich, A.E.; Reinwein, H.; Schaper, J.; Schumacher, R.; Stoever, B.


    The book presents in-depth material covering the full scope of tasks and problems of differential diagnostic radiology in children. The particular approach chosen by the authors provides information that will solve even the most difficult cases, guiding the reader on his way from radiographic findings to appropriate diagnosis. All radiographic findings have been characterized and classified and put into a tabulated system relating them to the relevant differential diagnosis. The system of reference adopted specifies a given lesion or disease by reference to the most significant diagnostic keywords obtained from anamnesis, clinical data, and further diagnostic evaluation. The tentative diagnosis is taken as the basis for further specification illustrated by the characteristic X-ray pictures and full-text descriptions. Almost all diagnoses are accompanied by a comprehensive image documentation obtained by all currently available imaging methods. (MG) [Deutsch] Das vorliegende Buch gibt einen kompletten Ueberblick ueeber die gesamte Bandbreite der Differentialdiagnostik in der Paediatrischen Radiologie und soll so auch in schwierigen Faeellen den Weg vom Roentgensymptom zur Diagnose ermoeglichen. Alle relevanten Roentgensymptome werden systematisch charakterisiert und die entsprechenden Differentialdiagnosen tabellarisch zusammengestellt. Jede Erkrankung wird durch Verweise auf die wichtigsten differentialdiagnostischen Stichworte aus Anamnese, Klinik und weiterfuehrende Diagnostik naeher eingegrenzt. Ausgehend von der Verdachtsdiagnose werden wegweisende Roentgenbefunde in Wort und Bild dargestellt. Fast alle erwaehnten Befunde werden durch Abbildungen unter Beruecksichtigung aller moderner bildgebenden Verfahren dokumentiert. (MG)

  11. Evaluation of BD BBL CHROMagar Staph aureus medium using AOAC and ISO culture methods. Performance tested method 100503. (United States)

    Ritter, Vicki; Kircher, Susan; Sturm, Krista; Warns, Patty; Dick, Nancy


    BBL CHROMagar Staph aureus (CSA) medium was evaluated internally and externally for the isolation and enumeration of Staphylococcus aureus in cooked roast beef, smoked salmon, and shell eggs. All food matrixes were processed according to the AOAC Official Method 975.55 and ISO 6888-1:1999. Bacterial counts of S. aureus were compared on CSA to the reference media, Baird-Parker, at low, medium, and high contamination levels. Colony counts were converted to log10 for statistical analysis. Based on the paired t-test and one-way analysis of variance, no statistical difference was noted with the CSA method compared to the AOAC Official Method for the recovery of S. aureus for all food types and contamination levels. Compared to the ISO reference method, no statistical difference was found with the CSA method for any food type or contamination level, with the exception of low-level smoked salmon. A statistical difference was seen in the internal testing with the low-level contaminated smoked salmon where CSA recovered more colonies. The external testing showed no statistical difference with smoked salmon at the low level. The correlation coefficients ranged from 92.6 to 99.4%, demonstrating good correlation for overall levels in all food types and methods. The sensitivity and specificity of the CSA method using known isolates was 100%. The results of this study demonstrate that CSA is an effective medium for the isolation, enumeration, and presumptive identification of S. aureus in cooked roast beef, smoked salmon, and shell eggs in 24 h using ISO and AOAC official methods. PMID:19916382

  12. Power plant engineering. Safe and sustainable energy supply. Vol. 3; Kraftwerkstechnik. Sichere und nachhaltige Energieversorgung. Bd. 3

    Energy Technology Data Exchange (ETDEWEB)

    Beckmann, Michael; Hurtado, Antonio


    Within the 43rd power plant engineering colloquium from 18th to 19th October, 2011 in Dresden (Federal Republic of Germany), numerous lectures were presented to the themes: fossile power plants; pilot projects and new building projects; gas and steam turbines; solar power plants; slag formation and corrosion; networks and storage systems; wind power; measurement technology/simulation; CCS technology.

  13. Power plant engineering. Vol. 2. Safe and sustainable energy supply; Kraftwerkstechnik. Bd. 2. Sichere und nachhaltige Energieversorgung

    Energy Technology Data Exchange (ETDEWEB)

    Beckmann, Michael; Hurtado, Antonio


    Power plant engineering, volume 2 covers scientific, economical and political contributions on the actual development of energy economy. Maint topics are: fossil-fuel power plants, pilot- and new construction projects, CCS-technologies, gas- and steam turbines, coal drying, slugging and corrosion, regenerative energy, nuclear power plants as measuring engineering. (orig./GL) [German] Kraftwerkstechnik, Band 2 umfasst wissenschaftliche, oekonomische und politische Beitraege zu aktuellen Entwicklungen der Energiewirtschaft. Themenschwerpunkte sind fossile Kraftwerke, Pilot- und Neubauprojekte, CCS-Technologien, Gas- und Dampfturbinen, Kohletrocknung, Verschlackung und Korrosion, regenerative Energie, Kernkraftwerke sowie Messtechnik. (orig.)

  14. Power plant engineering. Safe and sustainable energy supply. Vol. 4; Kraftwerkstechnik. Sichere und nachhaltige Energieversorgung. Bd. 4

    Energy Technology Data Exchange (ETDEWEB)

    Beckmann, Michael; Hurtado, Antonio (eds.)


    Within the 44th power plant engineering colloquium from 23rd to 24th October, 2012 in Dresden (Federal Republic of Germany), numerous lectures were presented to the themes: fossil power plants; pilot projects and new building projects; slag formation and corrosion; solar power plants; CCS technology; nitrogen oxide reduction SCR/SNCR; wind power; flexible power plants; emissions; geothermal power plants; gas and steam turbines; coal drying; dry brown coal; energetic utilization of biomass; networks and storage systems; coal as a raw material.

  15. Salt Lake City Area Integrated Projects Electric Power Marketing. Draft environmental impact statement: Volume 4, Appendixes B-D

    Energy Technology Data Exchange (ETDEWEB)


    The Salt Lake City Area Office of the Western Area Power Administration (Western) markets electricity produced at hydroelectric facilities operated by the Bureau of Reclamation. The facilities are known collectively as the Salt Lake City Area Integrated Projects (SLCA/IP) and include dams equipped for power generation on the Green, Gunnison, Rio Grande, and Colorado rivers and on Deer and Plateau creeks in the states of Wyoming, Utah, Colorado, Arizona, and New Mexico. Of these facilities, only the Glen Canyon Unit, the Flaming Gorge Unit, and the Aspinall Unit (which includes Blue Mesa, Morrow Point, and Crystal dams;) are influenced by Western power scheduling and transmission decisions. The EIS alternatives, called commitment-level alternatives, reflect combinations of capacity and energy that would feasibly and reasonably fulfill Westerns firm power marketing responsibilities, needs, and statutory obligations. The viability of these alternatives relates directly to the combination of generation capability of the SLCA/IP with energy purchases and interchange. The economic and natural resource assessments in this environmental impact statement (EIS) include an analysis of commitment-level alternatives. Impacts of the no-action alternative are also assessed. Supply options, which include combinations of electrical power purchases and hydropower operational scenarios reflecting different operations of the dams, are also assessed. The EIS evaluates the impacts of these scenarios relative to socioeconomics, air resources, water resources, ecological resources, cultural resources, land use, recreation, and visual resources.

  16. Search for the decays B$_{d}^{0}$ --> $\\gamma\\gamma$ and B$_{s}^{0}$ --> $\\gamma\\gamma$

    CERN Document Server

    Acciarri, M; Adriani, O; Aguilar-Benítez, M; Ahlen, S P; Alpat, B; Alcaraz, J; Allaby, James V; Aloisio, A; Alverson, G; Alviggi, M G; Ambrosi, G; Anderhub, H; Andreev, V P; Angelescu, T; Antreasyan, D; Arefev, A; Azemoon, T; Aziz, T; Bagnaia, P; Baksay, L; Ball, R C; Banerjee, S; Banicz, K; Barillère, R; Barone, L; Bartalini, P; Baschirotto, A; Basile, M; Battiston, R; Bay, A; Becattini, F; Becker, U; Behner, F; Bencze, G L; Berdugo, J; Berges, P; Bertucci, B; Betev, B L; Biasini, M; Biland, A; Bilei, G M; Bizzarri, R; Blaising, J J; Bobbink, Gerjan J; Böck, R K; Böhm, A; Borgia, B; Boucham, A; Bourilkov, D; Bourquin, Maurice; Boutigny, D; Brambilla, Elena; Branson, J G; Brigljevic, V; Brock, I C; Buijs, A; Bujak, A T; Burger, J D; Burger, W J; Burgos, C; Busenitz, J K; Buytenhuijs, A O; Cai, X D; Capell, M; Cara Romeo, G; Caria, M; Carlino, G; Cartacci, A M; Casaus, J; Castellini, G; Castello, R; Cavallari, F; Cavallo, N; Cecchi, C; Cerrada-Canales, M; Cesaroni, F; Chamizo-Llatas, M; Chan, A; Chang, Y H; Chaturvedi, U K; Chemarin, M; Chen, A; Chen, C; Chen, G; Chen, G M; Chen, H F; Chen, H S; Chen, M; Chiefari, G; Chien, C Y; Choi, M T; Cifarelli, Luisa; Cindolo, F; Civinini, C; Clare, I; Clare, R; Coan, T E; Cohn, H O; Coignet, G; Colijn, A P; Colino, N; Commichau, V; Costantini, S; Cotorobai, F; de la Cruz, B; Dai, T S; D'Alessandro, R; De Asmundis, R; De Boeck, H; Degré, A; Deiters, K; Dénes, E; Denes, P; De Notaristefani, F; DiBitonto, Daryl; Diemoz, M; Van Dierendonck, D N; Di Lodovico, F; Dionisi, C; Dittmar, Michael; Dominguez, A; Doria, A; Dorne, I; Dova, M T; Drago, E; Duchesneau, D; Duinker, P; Durán, I; Dutta, S; Easo, S; Efremenko, Yu V; El-Mamouni, H; Engler, A; Eppling, F J; Erné, F C; Ernenwein, J P; Extermann, Pierre; Fabbretti, R; Fabre, M; Faccini, R; Falciano, S; Favara, A; Fay, J; Felcini, Marta; Ferguson, T; Fernández, D; Fernández, G; Ferroni, F; Fesefeldt, H S; Fiandrini, E; Field, J H; Filthaut, Frank; Fisher, P H; Forconi, G; Fredj, L; Freudenreich, Klaus; Gailloud, M; Galaktionov, Yu; Ganguli, S N; García-Abia, P; Gau, S S; Gentile, S; Gerald, J; Gheordanescu, N; Giagu, S; Goldfarb, S; Goldstein, J; Gong, Z F; González, E; Gougas, Andreas; Goujon, D; Gratta, Giorgio; Grünewald, M W; Gupta, V K; Gurtu, A; Gustafson, H R; Gutay, L J; Hartmann, B; Hasan, A; He, J T; Hebbeker, T; Hervé, A; Hilgers, K; Van Hoek, W C; Hofer, H; Hoorani, H; Hou, S R; Hu, G; Ilyas, M M; Innocente, Vincenzo; Janssen, H; Jin, B N; Jones, L W; de Jong, P; Josa-Mutuberria, I; Kasser, A; Khan, R A; Kamyshkov, Yu A; Kapinos, P; Kapustinsky, J S; Karyotakis, Yu; Kaur, M; Kienzle-Focacci, M N; Kim, D; Kim, J K; Kim, S C; Kim, Y G; Kinnison, W W; Kirkby, A; Kirkby, D; Kirkby, Jasper; Kittel, E W; Klimentov, A; König, A C; Koffeman, E; Kornadt, O; Koutsenko, V F; Koulbardis, A; Krämer, R W; Kramer, T; Krenz, W; Kuijten, H; Kunin, A; Ladrón de Guevara, P; Landi, G; Lapoint, C; Lassila-Perini, K M; Laurikainen, P; Lebeau, M; Lebedev, A; Lebrun, P; Lecomte, P; Lecoq, P; Le Coultre, P; Lee Jae Sik; Lee, K Y; Leggett, C; Le Goff, J M; Leiste, R; Lenti, M; Leonardi, E; Levchenko, P M; Li Chuan; Lieb, E H; Lin, W T; Linde, Frank L; Lindemann, B; Lista, L; Liu, Z A; Lohmann, W; Longo, E; Lu, W; Lü, Y S; Lübelsmeyer, K; Luci, C; Luckey, D; Ludovici, L; Luminari, L; Lustermann, W; Ma Wen Gan; Macchiolo, A; Maity, M; Malgeri, L; Malinin, A; Maña, C; Mangla, S; Maolinbay, M; Marchesini, P A; Marin, A; Martin, J P; Marzano, F; Massaro, G G G; Mazumdar, K; McNally, D; Mele, S; Merola, L; Meschini, M; Metzger, W J; Mi, Y; Mihul, A; Van Mil, A J W; Mirabelli, G; Mnich, J; Möller, M; Monteleoni, B; Moore, R; Morand, R; Morganti, S; Mount, R; Muheim, F; Müller, S; Nagy, E; Nahn, S; Napolitano, M; Nessi-Tedaldi, F; Newman, H; Nippe, A; Nowak, H; Organtini, G; Ostonen, R; Pandoulas, D; Paoletti, S; Paolucci, P; Pascale, G; Passaleva, G; Patricelli, S; Paul, T; Pauluzzi, M; Paus, C; Pauss, Felicitas; Pei, Y J; Pensotti, S; Perret-Gallix, D; Petrak, S; Pevsner, A; Piccolo, D; Pieri, M; Pinto, J C; Piroué, P A; Pistolesi, E; Plyaskin, V; Pohl, M; Pozhidaev, V; Postema, H; Produit, N; Raghavan, R; Rahal-Callot, G; Rancoita, P G; Rattaggi, M; Raven, G; Razis, P A; Read, K; Redaelli, M; Ren, D; Rescigno, M; Reucroft, S; Ricker, A; Riemann, S; Riemers, B C; Riles, K; Rind, O; Ro, S; Robohm, A; Rodin, J; Rodríguez-Calonge, F J; Roe, B P; Röhner, M; Röhner, S; Romero, L; Rosier-Lees, S; Rosselet, P; Van Rossum, W; Roth, S; Rubio, Juan Antonio; Rykaczewski, H; Salicio, J; Salicio, J M; Sánchez, E; Santocchia, A; Sarakinos, M E; Sarkar, S; Sassowsky, M; Sauvage, G; Schäfer, C; Shchegelskii, V; Schmitz, D; Schmitz, P; Schneegans, M; Schöneich, B; Scholz, N; Schopper, Herwig Franz; Schotanus, D J; Schulte, R; Schultze, K; Schwenke, J; Schwering, G; Sciacca, C; Seiler, P G; Sens, Johannes C; Servoli, L; Shevchenko, S; Shivarov, N; Shoutko, V; Shukla, J; Shumilov, E; Son, D; Sopczak, André; Soulimov, V; Smith, B; Spickermann, T; Spillantini, P; Steuer, M; Stickland, D P; Sticozzi, F; Stone, H; Stoyanov, B; Strauch, K; Sudhakar, K; Sultanov, G G; Sun, L Z; Susinno, G F; Suter, H; Swain, J D; Tang, X W; Tauscher, Ludwig; Taylor, L; Ting, Samuel C C; Ting, S M; Toker, O; Tonisch, F; Tonutti, M; Tonwar, S C; Tóth, J; Tsaregorodtsev, A Yu; Tsipolitis, G; Tully, C; Tuchscherer, H; Ulbricht, J; Urbàn, L; Uwer, U; Valente, E; Van de Walle, R T; Vetlitskii, I; Viertel, Gert M; Vivargent, M; Völkert, R; Vogel, H; Vogt, H; Vorobev, I; Vorobyov, A A; Vuilleumier, L; Wadhwa, M; Wallraff, W; Wang, J C; Wang, X L; Wang, Y F; Wang, Z M; Weber, A; Weill, R; Willmott, C; Wittgenstein, F; Wu, S X; Wynhoff, S; Xu, J; Xu, Z Z; Yang, B Z; Yang, C G; Yao, X Y; Ye, J B; Yeh, S C; You, J M; Zaccardelli, C; Zalite, A; Zemp, P; Zeng, J Y; Zeng, Y; Zhang, Z; Zhang, Z P; Zhou, B; Zhou, G J; Zhou, J F; Zhou, Y; Zhu, G Y; Zhu, R Y; Zichichi, Antonino; Van der Zwaan, B C C


    A search for the decays \\Bdsgg in 2.95 million hadronic \\rm Z decays has been performed using the L3 detector at LEP. No candidates are found in the signal region and upper limits have been set on the branching ratios: \\Brdgg < 3.9\\times 10^{-5} and \\Brsgg < 14.8\\times 10^{-5} at 90\\% CL. These are the first limits set on these exclusive rare decays.

  17. Falquet de Romans, “Ma bella dompna, per vos dei esser gais” (BdT 156.8

    Directory of Open Access Journals (Sweden)

    Paolo Di Luca


    Full Text Available “Ma bella dompna per vos dei esser gais” by Falquet de Romans has been taken for a courtly song for a long time. However, the poem’s metrical form is derived directly from that of the epic, as illustrated by the use of monorhymed ‘décasyllabes’ with non-systematic epic caesura and the presence of a ‘petit vers’ at the end of each stanza. The poem may thus be defined as stanzaic but not lyric because its versification is that of the chanson de geste and its music must be that of an epic chant. Moreover, its content reflects the rhetorical structure of the ‘salut d’amor’, an epistolary genre in which the lover sends a letter to his lady asking her to respond to his love. Thus, “Ma bella dompna” should be considered a formal hybrid between ‘salut d’amor’ and ‘chanson de geste’; in this sense it is to be compared to those few compositions of an epistolary nature that employ epic form, such as Raimbaut de Vaqueiras’ famous letter to the Marquis Boniface of Monferrato, which is probably the prototype of this poetic experiment, along with two pairs of ‘laisses’ exchanged between Gui de Cavaillon and Bertran Folco d’Avignon.

  18. Renewable energy. Part 6. Biomass and biogas, substitute fuels, wind power; Erneuerbare Energien. Bd. 6. Biomasse und Biogas, Ersatzbrennstoffe, Windenergie

    Energy Technology Data Exchange (ETDEWEB)

    Thome-Kozmiensky, Karl J.; Beckmann, Michael


    The authors of the book under consideration report on the technical implementation of projects to produce electricity and heat from renewable energies. In particular, the issues biomass, production and utilization of biogas, materials recycling and energy recovery of substitute fuels and wind energy are discussed.

  19. Achieving a production goal of 1 million B/D of coal liquids by 1990. [Impediments and constraints

    Energy Technology Data Exchange (ETDEWEB)

    Miller, Charles; LaRosa, Dr., P. J.; Coles, E. T.; Fein, H. L.; Petros, J. J.; Iyer, R. S.; Merritt, R. T.


    Under this contract, Bechtel analyzed the resource requirements and reviewed major obstacles to the daily production of several million barrels of synthetic coal liquids. Further, the study sought to identify the industry infrastructure needed to support the commercial readiness of the coal liquefaction process. A selected list of critical resource items and their domestic/international availability was developed and examined, and the impact of their supply on the various synthetic coal liquids programs was evaluated. The study approach was to develop representative, or generic, direct and indirect coal liquefaction conceptual designs from available technology and costs data. The generic processes were to employ technology that would be considered commercial by the mid- or late-1980s. The size of the generic construction mobilization was considered reasonable at the outset of the program. The product slate was directed toward unrefined liquid fuels rather than diesel oil or gasoline. The generic processes were to use a wide range of coals to permit siting in most coal-producing regions across the country. Because of the dearth of conceptual design data in the literature, Bechtel developed generic plant designs by using in-house design expertise. Bechtel assumed that because it is first generation technology, the indirect process will be used at the outset of the liquids program, and the direct process will be introduced two to four years later as a second generation technology. The products of either of these processes will be limited to boiler fuels and/or other liquid products which require further upgrading. Cost estimates were developed from equipment lists, as well as material and labor estimates, which enabled the determination of an order-of-magnitude cost estimate and target plant construction schedule for both processes.

  20. Salt Lake City Area Integrated Projects electric power marketing final environmental impact statement. Volume 4: Appendixes B-D

    International Nuclear Information System (INIS)

    The Colorado River Storage Project Customer Office of the Western Area Power Administration (Western) markets electricity produced at hydroelectric facilities operated by the Bureau of Reclamation. The facilities are known collectively as the Salt Lake City Area Integrated Projects (SLCA/IP) and include dams equipped for power generation on the Colorado, Green, Gunnison, and Rio Grande rivers and on Plateau Creek in Arizona, Colorado, Utah, Wyoming, and New Mexico. Of these facilities, only the Glen Canyon Unit, the Flaming Gorge Unit, and the Aspinall Unit (which includes Blue Mesa, Morrow Point, and Crystal dams) are influenced by Western power scheduling and transmission decisions. The environmental impact statement (EIS) alternatives, called commitment-level alternatives, reflect combinations of capacity and energy that would feasibly and reasonably fulfill Western's firm power marketing responsibilities, needs, and statutory obligations. The viability of these alternatives relates directly to the combination of generation capability of the SLCA/IP with energy purchases and interchange. The economic and natural resource assessments in this EIS include an analysis of commitment-level alternatives. Impacts of the no-action alternative are also assessed. Supply options, which include combinations of electrical power purchases and hydropower operational scenarios reflecting different operations of the dams, are also assessed. The EIS evaluates the impacts of these scenarios relative to socioeconomics, air resources, water resources, ecological resources, cultural resources, land use, recreation, and visual resources. Western has identified commitment-level alternative 1, the Post-1989 commitment level, as its preferred alternative. The impact evaluations indicate that this commitment level is also the environmentally preferred alter native

  1. Cerveri de Girona, “Entr’Arago e Navarra jazia” (BdT 434.7a

    Directory of Open Access Journals (Sweden)

    Marco Grimaldi


    Full Text Available The rubric in Chansonnier Sg classifies “Entr’Arago e Navarra jazia” by Cerveri de Girona as a ‘sompni’ (‘dream’. Thirteenth-century Occitan and Catalan arts of poetry define the ‘sompni’ as a minor thematic genre in which the poet recounts events which took place in a dream (“en durmen”. On the basis of the rubric in Sg and the definition in the treatises, the only hints at the existence of the genre, this paper will outline a small corpus of five/six troubadour poems based on the narration of a dream and significant examples of ‘sompni’. The hypothesis that a ‘genre’ defined as sompni exsisted and circulated beyond Occitania is furthermore linked to similar compositions by Paolo Lanfranchi, a thirteenth-century poet from Pistoia, and to some ‘cantigas de amigo’ by Johan Mendiz de Briteyros, a Galician-Portuguese troubadour. The paper will also seek to demonstrate the loss of a line in the final stanza, so far unnoticed by previous editors, and suggest a date for the poem around 1276.

  2. Search for Bs --> mu+mu- and Bd --> mu+mu- Decays with 2fb-1 of ppbar Collisions

    Energy Technology Data Exchange (ETDEWEB)

    Collaboration, CDF; Aaltonen, T.


    The authors have performed a search for B{sub s}{sup 0} {yields} {mu}{sup +}{mu}{sup -} and B{sup 0} {yields} {mu}{sup +}{mu}{sup -} decays in p{bar p} collisions at {radical}s = 1.96 TeV using 2 fb{sup -1} of integrated luminosity collected by the CDF II detector at the Fermilab Tevatron Collider. The observed number of B{sub s}{sup 0} and B{sup 0} candidates is consistent with background expectations. The resulting upper limits on the branching fractions are {Beta}(B{sub s}{sup 0} {yields} {mu}{sup +}{mu}{sup -}) < 5.8 x 10{sup -8} and {Beta}(B{sup 0} {yields} {mu}{sup +}{mu}{sup -}) < 1.8 x 10{sup -8} at 95% C.L.

  3. Ricau de Tarascon ~ Cabrit, “Cabrit, al meu veiaire” (BdT 422.2 = 105.1

    Directory of Open Access Journals (Sweden)

    Walter Meliga


    Full Text Available The article provides a commentary and a new critical edition of an Occitan tenso between Ricau de Tarascon and Cabrit. The latter, previously identified with the troubadour Gui de Cavaillon, is now generally believed to be a noble man from Arles. Built as a judicial duel, the tenso is started by Ricau who accuses Cabrit of misconduct in his regards. Cabrit’s defense is based on comic ordeals, which are rejected by Ricau, who aims instead for a resolution of the conflict by combat. This dispute probably was caused by real private controversies that arose between two landowners, though in the tenso allusions to two ladies romantically involved with them, as well as the jongleuresque tone of the entire dialogue poem, transpose their conflict into a courtly and somehow ironic context.

  4. BMBF status seminar: Bodies of landfills. Vol. 1. Conference report; BMBF-Statusseminar: Deponiekoerper. Bd. 1. Tagungsband

    Energy Technology Data Exchange (ETDEWEB)



    This conference report contains the lectures presented at the BMBF status seminar on the cooperative project ``Bodies of landfills``, which took place at Wuppertal on 25th and 26th April 1995. The cooperative project was started in autumn 1993 and studies the long-term behaviour of wastes deposited at landfills in general. Inorganic and municipal wastes are studied separately. (orig./SR) [Deutsch] Der vorliegende Tagungsband enthaelt die Vortraege des BMBF-Statusseminars zum Verbundvorhaben `Deponiekoerper` vom 25. und 26. April 1995 in Wuppertal. Das Verbundvorhaben `Deponiekoerper` wurde im Herbst 1993 begonnen und befasst sich ganz generell mit dem langfristigen Deponieverhalten von Abfaellen. Es ist unterteilt in die Untersuchung von anorganischen Abfaellen und von Siedlungsabfaellen. (orig./SR)

  5. Premarket Evaluations of the IMDx C. difficile for Abbott m2000 Assay and the BD Max Cdiff Assay


    Stellrecht, K A; Espino, A. A.; Maceira, V. P.; Nattanmai, S. M.; Butt, S. A.; Wroblewski, D.; Hannett, G. E.; Musser, K. A.


    Clostridium difficile-associated diarrhea is a well-recognized complication of antibiotic use. Historically, diagnosing C. difficile has been difficult, as antigen assays are insensitive and culture-based methods require several days to yield results. Nucleic acid amplification tests (NAATs) are quickly becoming the standard of care. We compared the performance of two automated investigational/research use only (IUO/RUO) NAATs for the detection of C. difficile toxin genes, the IMDx C. diffici...

  6. 34{sup th} international Vienna motor symposium. Vol. 2. Second day; 34. Internationales Wiener Motorensymposium. Bd. 2. Zweiter Tag

    Energy Technology Data Exchange (ETDEWEB)

    Lenz, Hans Peter (comp.)


    This two-volume report makes the presentations of the 34th International Vienna Motor Symposium (April 25-26, 2013) available to a wider audience. The objective of the Vienna Motor Symposia is to examine current topics of particular interest. Among others, the work examines the above mentioned topics. Included is a CD-ROM containing the presentations in their original form and in English translation. Edited by Univ.-Prof. Dr. techn. Dipl.-Ing. H. P. Lenz, VDI, Chairman of the OeVK (Austrian Society of Automotive Engineers, Vienna).

  7. 34{sup th} international Vienna motor symposium. Vol. 1. First day; 34. Internationales Wiener Motorensymposium. Bd. 1. Erster Tag

    Energy Technology Data Exchange (ETDEWEB)

    Lenz, Hans Peter (comp.)


    This two-volume report makes the presentations of the 34th International Vienna Motor Symposium (April 25-26, 2013) available to a wider audience. The objective of the Vienna Motor Symposia is to examine current topics of particular interest. Among others, the work examines the above mentioned topics. Included is a CD-ROM containing the presentations in their original form and in English translation. Edited by Univ.-Prof. Dr. techn. Dipl.-Ing. H. P. Lenz, VDI, Chairman of the OeVK (Austrian Society of Automotive Engineers, Vienna).

  8. Signs of Δm and Δγ of the Bd-B bar d system

    International Nuclear Information System (INIS)

    The B-B bar mixing system with two eigenstates called B+ and B- is considered. We have the well-defined quantities Δm=m+-m-, Δγ=γ+-γ-, ηλ=l angle λ, CP=+|B-r angle/l angle λ,CP =+|B+r angle. The sign of Δm(1-|ηλ|) is in principle measurable. We find, in the standard Kobayashi-Maskawa (KM) model, that this sign depends on the sign of the BB parameter, in addition to the sign of the relevant rephasing invariant of the KM matrix marked by ReΔiα. We suggest that a natural definition for B+ is to take it as nearly the CP-even eigenstate of the effective Hamiltonian, in order to guarantee a ''correct'' behavior of ηλ, ηλ∝ImΔiα other than (ImΔiα)-1. The sign of Δm gains an absolute meaning in this sense. A phase-convention-independent condition to determine the sign of Δm is given. This condition involves some decay amplitudes in addition to M12 (or Γ12). Some ηλ may be larger than 1, depending on the values of unknown KM parameters. In addition, we explore the phase-convention dependence of the ''CP impurity parameter,'' convenient phase conventions for the B systems, similar to the Wu-Yang convention for the K system, and a simplified formula to calculate the effect of π0-η mixing on the difference between η+- and η00

  9. Handbook on criticality. Vol. 1. Criticality and nuclear safety; Handbuch zur Kritikalitaet. Bd. 1. Kritikalitaet und nukleare Sicherheit

    Energy Technology Data Exchange (ETDEWEB)



    This handbook was prepared primarily with the aim to provide information to experts in industry, authorities or research facilities engaged in criticality-safety-related problems that will allow an adequate and rapid assessment of criticality safety issues already in the planning and preparation of nuclear facilities. However, it is not the intention of the authors of the handbook to offer ready solutions to complex problems of nuclear safety. Such questions have to remain subject to an in-depth analysis and assessment to be carried out by dedicated criticality safety experts. Compared with the previous edition dated December 1998, this handbook has been further revised and supplemented. The proven basic structure of the handbook remains unchanged. The handbook follows in some ways similar criticality handbooks or instructions published in the USA, UK, France, Japan and the former Soviet Union. The expedient use of the information given in this handbook requires a fundamental understanding of criticality and the terminology of nuclear safety. In Vol. 1, ''Criticality and Nuclear Safety'', therefore, first the most important terms and fundamentals are introduced and explained. Subsequently, experimental techniques and calculation methods for evaluating criticality problems are presented. The following chapters of Vol. 1 deal i. a. with the effect of neutron reflectors and absorbers, neutron interaction, measuring methods for criticality, and organisational safety measures and provide an overview of criticality-relevant operational experience and of criticality accidents and their potential hazardous impact. Vol. 2 parts 1 and 2 finally compile criticality parameters in graphical and tabular form. The individual graph sheets are provided with an initially explained set of identifiers, to allow the quick finding of the information of current interest. Part 1 includes criticality parameters for systems with {sup 235}U as fissile material, while part 2 deals with systems comprising {sup 233}U, plutonium and higher actinides.

  10. Effects of monopropanediamino-beta-cyclodextrin on the denaturation process of the hybrid protein BlaPChBD.


    Vandevenne, Marylène; GASPARD, Genevieve; Belgsir, E. M.; Ramnath, M.; Cenatiempo, Y; Delneuville, Delphine; Dumoulin, Mireille; Frère, Jean-Marie; Matagne, André; Galleni, Moreno; Filee, P.


    Irreversible accumulation of protein aggregates represents an important problem both in vivo and in vitro. The aggregation of proteins is of critical importance in a wide variety of biomedical situations, ranging from diseases (such as Alzheimer's and Parkinson's diseases) to the production (e.g. inclusion bodies), stability, storage and delivery of protein drugs. beta-Cyclodextrin (beta-CD) is a circular heptasaccharide characterized by a hydrophilic exterior and a hydrophobic interior ring ...

  11. International scientific conference biogas science 2009. Vol. 1. Lectures; Internationale Wissenschaftstagung Biogas Science 2009. Bd. 1. Vortraege

    Energy Technology Data Exchange (ETDEWEB)



    Within the international conference of the Bavarian State Research Center for Agriculture (Munich, Federal Republic of Germany) at 2nd to 4th December, 2009, in Erding (Federal Republic of Germany), the following lectures were held: (1) Significance of the sector biogas within the scope of renewable energies (P. Schuesseler); (2) Anaerobic digestion, a superior renewable energy degradation method (G. Lettinga); (3) Trends of the biogas technology - Challenges for the practice (J. Pellmeyer); (4) Extensification of cultivation procedures for the production of biogas substrates (K. Deiglmayer et al.); (5) Approaches for the optimization of crop rotations for biogas plants at Bavarian conditions of cultivation (E. Sticksel et al.); (6) Development and comparison of site specific production systems for energy crops (Ch. Strauss et al.); (7) Which type of maize is useful for the production of biogas? (B. Eder et al.); (8) Fermentation of interim fruits, food stocks and residues of harvest: Review on the possibilities of power generation and avoidance of direct and indirect emissions of climatic gases (W. Stinner et al.); (9) Optimization of anaerobic fermentation by means of mineral additives (H. Heuwinkel et al.); (10) The accuracy of the measurement of gas yields of substrates using the batch method (H. Heuwinkel et al.); (11) Combined mechanical-enzymatic pre-treatment of an improved digestion of substrates during the fermentation of renewable raw materials (D. Schiedr et al.); (12) Anaerobic semi-continuous co-digestion of dairy cattle manure and agricultural residues: Effect of operational parameters (E. Alkaya et al.); (13) Do hydrolytic enzymes enhance methane formation of agricultural feedstock? (T. Suarez Quinones et al.); (14) DAUMEN-Energy ''Design fo Separation and Augmented Methanisation of Fibres Substrates - Contribution to sustainable biogas production'' (P. Stopp et al.); (15) Continuous two-phase solid-state anaerobic digestion: Model-based optimisation (J. Mumme et al.); (16) Investigations according to a comparison of material and energy flows of biogas plants for the fermentation of renewable raw materials (V. Aschmann et al.); (17) Problem of emissions and energy efficiency of biogas operated cogeneration plants during the lifetime (T. Lehmann); (18) Biogas plant construction - the digestion is decisive, new results according to bioextrusion (K.D.N. Weerasinghe et al.); (19) Appropriate bio gas generators for resource poor farmers in Sri Lanka to meet home energy and organic fertilizer needs (R. Kissel et al.); (20) Degree of utilization and causes for yield reduction at biogas plants of different design (R. Kissel et al.); (21) Monitoring and assessment of three biogas plants in Italy (S. Piccinini et al.).

  12. Blacasset, “Se·l mals d’amor m’auzi ni m’es noisens” (BdT 96.10a; Pujol, “Dieus es amors e verais salvamens” (BdT 386.2; Alaisina ~ Carenza, “Na Carenza al bel cors avenenç” (BdT 12.1 = 108.1

    Directory of Open Access Journals (Sweden)

    Paolo Di Luca


    Full Text Available This paper provides a new critical edition of “Se·l mals d’amor m’auzi ni m’es noisens” by Blacasset and “Dieus es amors e verais salvamens by Pujol”. These two poets discuss a topic that is entirely new to Occitan lyric poetry: two young women about to enter a convent. While Blacasset expresses sadness about their choice of life in a convent, using elements of the funeral lament, Pujol praises it and believes it to be the only remedy for the corruption of the world. The tenso between women “Na Carenza al bel cors avenenç” seems to be conceived as a parody of this lyric debate: in the dialogue Alaisina and Yselda, who have doubts about becoming mothers, ask Na Carenza whether it is better to stay virgins or to marry; the latter advises them, in cryptic terms that are difficult to interpret, to become nuns, thereby gaining a husband (God but not children. I will suggest that the question of female authorship for this text be reconsidered, while proposing a new interpretation in the light of the lively debate in the medieval period about the suitability and prerogatives of virginity.

  13. Instruments and scope of possible action of the Federal States for global climate protection. Vol. 1: Analysis. Vol. 2: Baseline data. Vol. 3: Legal opinion; Instrumente und Handlungsmoeglichkeiten der Bundeslaender zum Klimaschutz. Bd. 1: Analyseband. Bd. 2: Materialband. Bd. 3: Rechtsgutachten

    Energy Technology Data Exchange (ETDEWEB)

    Blechschmidt, K.; Herbert, W.; Barzantny, K.; Dittmann, W.; Gehm, C.; Menges, R.; Moehring-Hueser, W.; Wortmann, K.; Herbert, W. [Energiestiftung Schleswig-Holstein, Kiel (Germany); Penschke, A. [Zentrum fuer Rationelle Energieanwendung und Umwelt GmbH, Regensburg (Germany); Groth, A.; Kusche, C.


    In the analysis volume, (vol. 1), the legal and political frameworks governing the greenhouse gas reduction policy adopted by the Federal states of Germany are explained. The evolution of the policies, goals pursued and points of major emphasis, the orientation for the future and existing impediments for implementation are analysed. Volume 2 contains a comprehensive baseline data library characterising the present situation, as well as examples selected by the Federal states, illustrating policy schemes which proved to be successful. The legal opinion presented in volume 3 explains the distribution of competences for climate policy of the Federal Government and the state governments in accordance with constitutional law, as well as channels of implementing policy schemes via legislation issued by the Federal states, or administrative action in execution of the law, or other administrative action. (orig./CB) [German] Im Analyseband (Band 1) werden die rechtlichen und politischen Rahmenbedingungen der Landesklimaschutzpolitik dargestellt, gefolgt von einer Analyse dieser Politik hinsichtlich ihrer Entwicklung, Ziele und Schwerpunkte, bestehenden Hindernissen, zukuenftiger Ausrichtung, Handlungsoptionen und Beispiele fuer die Erschliessung neuer Taetigkeitsgebiete der Laender. Der Materialband (Band 2) enthaelt neben umfassenden Daten zur Schilderung der Situation auch von den Laendern ausgewaehlte, erfolgreiche Beispiele fuer die Durchfuehrung von Klimaschutzmassnahmen. In einem Rechtsgutachten (Band 3) werden die verfassungsrechtlichen Grundlagen der Kompetenzverteilung zwischen Bund und Laendern auf dem Gebiet des Klimaschutzes detailliert dargelegt und Moeglichkeiten der Umsetzung von Klimaschutzpolitik durch Landesgesetzgebung sowie gesetzesvollziehende und nicht-gesetzesvollziehende Verwaltungstaetigkeit untersucht. (orig./CB)

  14. Cross-sectional environmental study comparing two highly polluted areas in Germany (Bitterfeld and Hettstedt) with a control region; Umweltmedizinische Untersuchungen im Raum Bitterfeld, im Raum Hettstedt und einem Vergleichsgebiet 1992-2000. Bd. 1: Textband. Bd. 2: Publikationen. Bd. 3: Untersuchungsdokumente und Frageboegen. Abschlussbericht

    Energy Technology Data Exchange (ETDEWEB)

    Heinrich, J.; Frye, C.; Hoelscher, B.; Meyer, I.; Pitz, M.; Cyrys, J.; Schneller, H.; Wjst, M.; Wichmann, H.E.


    The aim of the environmental epidemiologic study was to determine possible negative effects on the health of children in the very polluted areas of Bitterfeld and Hettstedt in comparison to the less polluted areas of Anhalt-Zerbst (Eastern Germany). The time changes of the health parameters were recorded along with the running redevelopments during the time period of 6 years. The study design consisted of three repeated regional cross sectional studies in 1992/93, 1995/96 and 1998/99. In all, there was information of 7.611 questionnaires to be analysed (participation rate: 89%, 75% and 75%). Children living in the most polluted area of Hettstedt had a noticeable higher risk for non allergic respiratory diseases and symptoms compared to children living in the control area of Anhalt-Zerbst. During the time of the examinations in 1992 till 1999 a clear statistically significant decrease in the prevalences of these restrictions of health could be shown. Children without indoor pollutants in their homes profited most by the improvement of ambient air quality. The better lung function (FVC, FEV{sub 1}) between 1992 and 1999 underlines the improvement of the respiratory health. Children living in both polluted ares have allergies more often (physician's diagnosis, symptoms, allergy specific antibodies). The incidence of asthma, the bronchial hyperreactivity and atopic exzema increased, the prevalence of rhinitis and allergic sensitization did not increase. The body burden with lead and cadmium was higher in children living in polluted areas, but it decreased during the period of observation. In 1997, however, the lead concentration in blood increased a little, parallel to the higher lead concentration in settled dust in Hettstedt at that time. (orig.) [German] Ziel der umweltepidemiologischen Studie war es, moegliche gesundheitliche Beeitraechtigungen von Kindern in den Belastungsgebieten Bitterfeld und Hettstedt i. Vgl. zu dem wenig belasteten Gebiet Anhalt-Zerbst zu ermitteln. Darueber hinaus wurden die zeitlichen Veraenderungen der Gesundheitsparameter begleitend zu den laufenden Sanierungsmassnahmen ueber den Zeitraum von 6 Jahren erfasst. Das Studiendesign bestand aus 3 wiederholten regionalen Querschnittsuntersuchungen in den Jahren 1992/93, 1995/96 und 1998/99. Insgesamt lagen Informationen von 7611 Frageboegen zur Auswertung vor (Beteiligungsrate: 89%, 75% bzw. 75%). Fuer die Belastungsregion Hettstedt waren deutlich hoehere Risiken fuer nicht allergische respiratorische Erkrankungen und Symptome im Vergleich zu Kindern des Kontrollgebietes Anhalt-Zerbst nachweisbar. Waehrend des Untersuchungszeitraumes 1992-1999 zeigte sich eine deutlich statistisch signifikante Abnahme der Praevalenz dieser gesundheitlichen Einschraenkungen, Kinder ohne Exposition mit Innenraumschadstoffen im haeuslichen Bereich profitieren von der Verbesserung der Aussenluftbelastung am meisten. Fuer die Verbesserung der Atemwegsgesundheit sprachen auch bessere Lungenfunktionswerte (FVC, FEV{sub 1}) im Laufe des Beobachtungszeitraumes 1992-1999. Kinder aus den beiden Belastungsregionen hatten haeufiger Allergien (Arztdiagnose, Symptome, allergenspezifischer Antikoerper-Nachweis). Die Haeufigkeit des Asthmas, der bronchialen Hyperreaktivitaet und der Neurodermitis nahm zu; die Praevalenz des Heuschnupfens und der allergischen Sensibilisierung nicht. Die korporale Belastung mit Blei und Cadmium war bei Kindern in den belasteten Regionen erhoeht, nahm aber im Verlauf des Beobachtungszeitraumes ab. Allerdings folgten gestiegenen Bleigehalten im Sedimentationsstaub in Hettstedt im Jahre 1997 leicht gestiegene Blutbleikonzentrationen. (orig.)

  15. Blacasset, “Se·l mals d’amor m’auzi ni m’es noisens” (BdT 96.10a); Pujol, “Dieus es amors e verais salvamens” (BdT 386.2); Alaisina ~ Carenza, “Na Carenza al bel cors avenenç” (BdT 12.1 = 108.1)


    Paolo Di Luca


    This paper provides a new critical edition of “Se·l mals d’amor m’auzi ni m’es noisens” by Blacasset and “Dieus es amors e verais salvamens by Pujol”. These two poets discuss a topic that is entirely new to Occitan lyric poetry: two young women about to enter a convent. While Blacasset expresses sadness about their choice of life in a convent, using elements of the funeral lament, Pujol praises it and believes it to be the only remedy for the corruption of the world. The tenso between women “...

  16. Increased Intrasubject Variability in Response Time in Youths with Bipolar Disorder and At-Risk Family Members (United States)

    Brotman, Melissa A.; Rooney, Melissa H.; Skup, Martha; Pine, Daniel S.; Leibenluft, Ellen


    Intrasubject variability in response time (ISV-RT) was higher in youths with bipolar disorder (BD) and those with first-degree relatives with BD compared to youths without BD. ISV-RT may be a risk marker for BD.

  17. Austorc de Segret, “[No s]ai qui·m so tan suy [des]conoyssens” (BdT 41.1

    Directory of Open Access Journals (Sweden)

    Linda Paterson


    Full Text Available Discussion of this ‘sirventes’, composed in the aftermath of Louis IX’s second crusade and death at Tunis in 1270, raises two main issues: the identity of “Haenric”, and Austorc’s introduction of his song as a ‘devinalh’ in the tradition of Guilhem de Peitieus and Raimbaut d’Aurenga. Contrary to the hypothesis that “Haenric” is the Infant Henry of Castile, the lines “qu’era de sen e de saber ses par / e tot lo mielhs era de sos parens” point conclusively towards the son of Richard of Cornwall, Henry of Almain. The speaker’s mental and spiritual confusion faced with the defeat of the Christian faith is attributed to some unknown force, either God Himself or a devil, and following on from this unspecified “dïables”, “esperitz” suggests an evil spirit and may refer back to Charles of Anjou. The rhetorical evocation of the ‘devinalh’ tradition serves both to express dismay at Louis’ failure and to focus blame on his brother. Essentially propagandistic, it lacks the subtlety of earlier examples of the riddling tradition, though the undeveloped potential for this hovers around the possibility of God destroying his own religion.

  18. Handbook of environmental protection and environmental protection technology. Vol. 1. Emission and its effects; Handbuch des Umweltschutzes und der Umweltschutztechnik. Bd. 1. Emissionen und ihre Wirkungen

    Energy Technology Data Exchange (ETDEWEB)

    Brauer, H. [ed.] [Technische Univ. Berlin (Germany). Inst. fuer Verfahrenstechnik


    This book is the first volume of the Handbook of Environmental Protection and Environment Protection Technology. After a short introduction, emission and its effect on the environmental media of air, water and soil are dealt with separately. Further, acoustic emission and the possibilities of noise reduction and radio-active emission and corresponding radiation protection measures are shown. The controversial discussed subject of electromagnetic fields and non-ionising radiation are also not excluded. The last chapter contains the effect of environmental contamination on psychic functions. This series of books will become an essential tool for every engineer and scientist who has to deal with environmental problems and environment protection. (orig.). 167 figs., 152 tabs. [Deutsch] Das vorliegende Buch ist der erste Band des Handbuchs des Umweltschutzes und der Umweltschutztechnik. Nach einem kurzen einfuehrenden Teil werden Emissionen und ihre Wirkung auf die Umweltmedien Luft, Wasser und Boden separat abgehandelt. Darueber hinaus werden aber auch akustische Emissionen und die Moeglichkeiten zur Laermminderung sowie radioaktive Emissionen und entsprechende Strahlenschutzmassnahmen aufgezeigt. Das kontrovers diskutierte Thema der elektromagnetischen Felder und nicht-ionisierender Strahlen wird ebenfalls nicht ausgespart. Das letzte Kapitel enthaelt die Wirkung von Umweltbelastungen auf psychische Funktionen. Diese Buchreihe wird jedem Ingenieur und Naturwissenschaftler, der sich mit Umweltproblemen und Umweltschutz auseinandersetzen muss, ein unentbehrliches Werkzeug. (orig.)

  19. Raimbaut de Vaqueiras, “Era·m requier sa costum’e son us” (BdT 392.2

    Directory of Open Access Journals (Sweden)

    Federico Saviotti


    Full Text Available The lack of studies on the more traditional love songs composed by Raimbaut de Vaqueiras, compared with the great success of his more experimental poems amongst scholars, has been repeatedly stigmatized. This paper offers a global and detailed reading of a ‘canso’ which is emblematic in the troubadour’s poetry. The vocabulary and stylistic features have been analyzed comparatively in order to correct an erroneous interpretation based on the story told by the ‘razo’ and to recognize the poem’s importance within Raimbaut’s production. This poem, no less than others by the same poet, reveals the most significant marks of its author’s poetic spirit: his curiosity towards reality and his receptiveness. A new critical edition of the text is provided here, based on the revision and a more extensive study of the manuscript tradition.

  20. Evaluation of direct inoculation of the BD PHOENIX system from positive BACTEC blood cultures for both Gram-positive cocci and Gram-negative rods

    Directory of Open Access Journals (Sweden)

    Wolffs Petra FG


    Full Text Available Abstract Background Rapid identification (ID and antibiotic susceptibility testing (AST of the causative micro-organism of bloodstream infections result in earlier targeting of antibiotic therapy. In order to obtain results of ID and AST up to 24 hours earlier, we evaluated the accuracy of direct inoculation of the Phoenix system from positive blood cultures (BACTEC by using Serum Separator Tubes to harvest bacteria from positive blood cultures. Results were compared to those of standard Phoenix procedure. Discrepancies between the two methods were resolved by using the API system, E-test or microbroth dilution. Results ID with the direct method was correct for 95.2% of all tested Enterobacteriaceae (n = 42 and 71.4% of Pseudomonas aeruginosa strains (n = 7. AST with the direct method showed a categorical agreement for Gram-negative rods (GNR of 99.0%, with 0.7% minor errors, 0.3% very major errors and no major errors. All antibiotics showed an agreement of >95%. The direct method for AST of Staphylococcus (n = 81 and Enterococcus (n = 3 species showed a categorical agreement of 95.4%, with a minor error rate of 1.1%, a major error rate of 3.1% and a very major error rate of 0.4%. All antibiotics showed an agreement of >90%, except for trimethoprim-sulfamethoxazole and erythromycin. Conclusions Inoculation of Phoenix panels directly from positive blood cultures can be used to report reliable results of AST of GNR a day earlier, as well as ID-results of Enterobacteriaceae. For Staphylococcus and Enterococcus species, results of AST can also be reported a day earlier for all antibiotics, except for erythromycin and trimethoprim-sulfamethoxazole.

  1. Evaluation of direct inoculation of the BD PHOENIX system from positive BACTEC blood cultures for both Gram-positive cocci and Gram-negative rods

    NARCIS (Netherlands)

    J. Beuving (Judith); C.F. van der Donk (Christina); C.F. Linssen (Catharina F.); P. Wolffs (Petra); A. Verbon (Annelies)


    textabstractBackground: Rapid identification (ID) and antibiotic susceptibility testing (AST) of the causative micro-organism of bloodstream infections result in earlier targeting of antibiotic therapy. In order to obtain results of ID and AST up to 24 hours earlier, we evaluated the accuracy of dir

  2. Endocrine-disrupting environmental chemicals - hazards to man and animal; Hormonell wirksame Umweltchemikalien - Gefahr fuer Mensch und Tier? Seminarband der Zentralen Informationsstelle Umweltberatung Bayern. Bd. 12

    Energy Technology Data Exchange (ETDEWEB)

    Behling, G.; Koller, U.; Klemmer, A.; Haury, H.J. [comps.


    The spectrum of problems relating to endocrine-disrupting environmental chemicals was presented by competent experts from public authorities and scientific institutions. The lecturers described the current stage and future tasks of research. Their lectures focused on effects of hormone-like substances on humans and animals and an assessment of risk factors on the basis of data from scientific tests and current environmental exposure. There was also a contribution presenting the chemical industry`s view of the matter. [Deutsch] Kompetente Sachverstaendige aus Behoerden und wissenschaftlichen Einrichtungen stellten das Themenspektrum vor, fuehrten in den Forschungsstand ein und zeigten den Forschungsbedarf auf. Der Schwerpunkt lag in der Darstellung der der Auswirkungen hormonell wirksamer Substanzen, wie z.B. DDT, Dioxinen und PCBs, auf Mensch und Tier sowie in der Abschaetzung der Risikofaktoren anhand der bekannten Daten aus wissenschaftlichen Tests sowie der aktuellen Exposition in der Umwelt. Mit einem Beitrag der chemischen Industrie wurde auch deren Einschaetzung der Umweltproblematik aufgezeigt. (orig./MG) m9

  3. « An Achaemenid Seal from the Lower City », Studia Troica, Bd., 7, (1997), pp. 355-362.


    Boucharlat, Rémy


    Aux confins occidentaux de l’empire perse, à Troie, ce sceau-cachet est malheureusement hors contexte. Il porte uniquement la représentation du buste ailé, que M.C.R. propose de dater, sur une base stylistique par comparaison avec les empreintes de tablettes de Persépolis (Fortification), du début du 5e s. ; cependant ce sceau est probablement un produit de l’ouest de l’empire. C’est un témoin à ajouter à la liste des contacts depuis le centre vers la périphérie de l’empire....

  4. Anàlisi i desenvolupament d¿un lloc web presencial amb BD low cost adaptada a les necessitats de les petites empreses


    Vilar Fibla, Joan Agustí


    Actualment quan a un propietari d'un petit negoci vol renovar la seva web, pensa en gastar el mínim possible per simplement tindre una mínima presència a internet, aquest projecte tracta sobre el desenvolupament d'aquesta idea.

  5. Solving the Big Data (BD) Problem in Advanced Manufacturing (Subcategory for work done at Georgia Tech. Study Process and Design Factors for Additive Manufacturing Improvement)

    Energy Technology Data Exchange (ETDEWEB)

    Clark, Brett W. [Sandia National Lab. (SNL-NM), Albuquerque, NM (United States); Diaz, Kimberly A. [Georgia Inst. of Technology, Atlanta, GA (United States); Ochiobi, Chinaza Darlene [Georgia Inst. of Technology, Atlanta, GA (United States); Paynabar, Kamran [Georgia Inst. of Technology, Atlanta, GA (United States)


    3D printing originally known as additive manufacturing is a process of making 3 dimensional solid objects from a CAD file. This ground breaking technology is widely used for industrial and biomedical purposes such as building objects, tools, body parts and cosmetics. An important benefit of 3D printing is the cost reduction and manufacturing flexibility; complex parts are built at the fraction of the price. However, layer by layer printing of complex shapes adds error due to the surface roughness. Any such error results in poor quality products with inaccurate dimensions. The main purpose of this research is to measure the amount of printing errors for parts with different geometric shapes and to analyze them for finding optimal printing settings to minimize the error. We use a Design of Experiments framework, and focus on studying parts with cone and ellipsoid shapes. We found that the orientation and the shape of geometric shapes have significant effect on the printing error. From our analysis, we also determined the optimal orientation that gives the least printing error.

  6. Renewable energies. Vol. 2. Surrogate fuels, biomass and biogas, solar and wind energy; Erneuerbare Energien. Bd. 2. Ersatzbrennstoffe, Biomasse und Biogas, Solar- und Windenergie

    Energy Technology Data Exchange (ETDEWEB)

    Thome-Kozmiensky, Karl J.; Beckmann, Michael


    The book on renewable energies, vol.2, surrogate fuels, biomass and biogas, solar and wind energy, covers the following chapters: analytics and sampling concerning the biogenic carbon content of surrogate fuels; processing of surrogate fuels for the energetic utilization; energetic utilization of surrogate fuels; energetic utilization of biomass; fermentation and biogas; solar energy (solar thermal power plant, photovoltaics); wind energy.

  7. Renewable energy sources. Vol. 3. Strategies and research, energy law and power industry; Erneuerbare Energien. Bd. 3. Strategien und Forschung, Energierecht und -wirtschaft

    Energy Technology Data Exchange (ETDEWEB)

    Thome-Kozmiensky, Karl J.; Beckmann, Michael


    The book focuses on the challenges of reliable energy supply and provides a contribution to the discussion of the role of renewable energy sources. It outlines chances, potentials, limits, and risks. Power supply strategies are discussed from the view of the Expert Council, the industrial associations, and the industry in general both with a view to communal power supply and to individual industrial organizations. Energy law is a key issue. Emission trading law and licensing problems are outlined. Who owns renewable power plants? Ownership structures are discussed in general, and a forecast is presented on the future market distribution and the share of the big energy utilities.

  8. Renewable energy. Part 4. Biomass and biogas, substitute fuels, solar energy and wind energy; Erneuerbare Energien. Bd. 4. Biomasse und Biogas, Ersatzbrennstoffe, Solar- und Windenergie

    Energy Technology Data Exchange (ETDEWEB)

    Thome-Kozmiensky, Karl J.; Beckmann, Michael


    The authors of the book under consideration report on different aspects of the realization of energy supply with renewable energies. Research results, process technologies and reports on the practical aspects are put for discussion and supplemented by overviews and legal aspects. This book is structured according to the topics bioenergy, substitute fuels as well as solar energy and wind energy.

  9. Solophenols B-D and solomonin: new prenylated polyphenols isolated from propolis collected from the Solomon Islands and their antibacterial activity. (United States)

    Inui, Saori; Hosoya, Takahiro; Shimamura, Yuko; Masuda, Shuichi; Ogawa, Takeshi; Kobayashi, Hirokazu; Shirafuji, Kenichi; Moli, Reuben Toli; Kozone, Ikuko; Shin-ya, Kazuo; Kumazawa, Shigenori


    Three new prenylated flavonoids, namely, solophenols B (1), C (2), and D (3), as well as a new prenylated stilbene, solomonin (4), were isolated from propolis collected from the Solomon Islands. In addition, 17 known compounds were identified. The structures of the new compounds were determined by a combination of methods, including mass spectrometry and NMR. These new compounds and several known compounds were tested for antibacterial activity against Staphylococcus aureus, Bacillus subtilis, and Pseudomonas aeruginosa. Most of them exhibited potent antibacterial activity. These findings may indicate that propolis from the Solomon Islands has potential applications as an ingredient in food additives or pharmaceuticals. PMID:23067056

  10. Réalisation d’un MOS à grande échelle à partir de la BD-Topo et du RPG : méthode et limites


    Tourneux, François-Pierre; Roy, Damien


    Cette expérience s’inscrit dans le cadre de recherches sur les réseaux écologiques, les paysages et la consommation des espaces agricoles, qui figurent parmi les nombreuses applications des modèles d’occupation du sol (MOS) à grande échelle. Les MOS utilisés sont fréquemment issus de classificationsd’images aériennes ou satellitaires : ils ont pour avantage de couvrir systématiquement le territoire étudié, mais pour inconvénient d’être peu reproductibles, etdifficilement comparables entre eux...

  11. Using $B_{d}^{0}$, $B_{s}^{0}$ Decays at Hadronic B-Factories to Determine CP Angles $\\alpha$ and $\\beta$

    CERN Document Server

    Kim, C S


    At the first PPPP workshop, I gave a review talk on physics of B and CP-phases. In my talk, I explained DRG method and our extension to extract CP angles $\\alpha$ and $\\gamma$ from measurements of the decay rates of $B_{d,s}^0 discrete ambiguities are removed, fewer assumptions are necessary, and the method works even if all strong phases vanish. I also talked on several other topics.

  12. 40kt/a硫回收联合装置烧氨实践%Practice of burning ammonia in a 800 b/d sulfur recovery unit

    Institute of Scientific and Technical Information of China (English)

    耿庆光; 李步; 黄占修


    The new sulfur recovery unit in SINOPEC Luoyang Company was designed to burn 0.5% 1.5% ammonia in sour gas. Due to the insufficient capacity of ammonia refining unit, 15% of ammonia in sour gas had to be burned for more than one year, thus balancing the ammonia gas produced by the new 11 t/h sour water stripper. The operation shows that the unit is reliable in design and has no plugging. The catalyst activity is normally maintained and sulfur quality and tail gas emission meet the specifications. Good operating experience has been accumulated.%中国石油化工股份有限公司洛阳分公司新建40 kt/a硫回收联合装置原设计酸性气中烧氨比例为0.5%~1.5%,因氨精制系统不匹配,进行了一年多的烧氨,烧氨比例达到15%,平衡了新建11t/h污水汽提装置产生的全部氨气.运行结果表明装置设计可靠,系统无堵塞,催化剂活性正常,硫黄质量正常,尾气排放达标,并积累了一定的生产操作经验.

  13. Development of high-speed high-performance engines in Friedrichshafen. Vols. 1 and 2. Die Entwicklung schnellaufender Hochleistungsmotoren in Friedrichshafen. Bd. 1 und 2

    Energy Technology Data Exchange (ETDEWEB)

    Zima, S.


    The publication abstracted traces and analyzes the development of high-performance combustion engines in Friedrichshafen over a period of 70 years. By way of introduction the author points out the peculiarity of combustion engines to be consisting in its quasi-negligible development and changes since its early days. Part one describes the chronological development of airplane engines, airship engines, motor vehicle and commercial vehicle engines, diesel engines and high-performance engines. The description is followed by a discussion of the requirements to be met by high-performance engines and a description of their development. The publication points out the design and construction of airplane engines as well as first operational results, increased performance, adaptability to operational conditions and the standardization of types. Moreover the author discusses the development of individual parts and functional components as well as the characteristics and features of the state of development. Part one of the thesis concludes with a discussion of general aspects of engine development. Volume 2 of the thesis presents a comprehensive set of diagrams, tables and graphs illustrating and elucidating the different sections contained in volume 1. The diagrams and tables refer to relevant technical publications dealing with the chronology of engine development, the nomenclature of Maybach-Motorenbau (MM) engines, Maybach-Mercedes-Benz (MMB) engines and Motoren- und Turbinen-Union Friedrichshafen (MTU) engines as well as production and employment data. Descriptions may be found of the major MM, MMB and MTU engines together with detailed sectional drawings, photographs, specifications and operational diagrams. Different sources may be referred to for engine performance data. Comprehensive references (journals, industrial reports) are annexed. (HWJ).

  14. Joan d’Albuzon ~ Nicolet de Turin, “En Nicolet, d’un sognie qu’ieu sognava” (BdT 265.2 = 310.1)


    Linda Paterson


    The article provides a commentary and a new critical edition of an Occitan tenso between two Italian troubadours, Joan d’Albuzon and Nicolet de Turin. The tenso presents a dream and its interpretation: Joan claims to have dreamt of a terrifying eagle flying through the air, accompanied by a huge ship of fire sailing across the land from Cologne. Nicolet in turn interprets the dream in terms of an emperor sweeping through Lombardy with a great army of German soldiers at his command, paid from ...

  15. Joan d’Albuzon ~ Nicolet de Turin, “En Nicolet, d’un sognie qu’ieu sognava” (BdT 265.2 = 310.1

    Directory of Open Access Journals (Sweden)

    Linda Paterson


    Full Text Available The article provides a commentary and a new critical edition of an Occitan tenso between two Italian troubadours, Joan d’Albuzon and Nicolet de Turin. The tenso presents a dream and its interpretation: Joan claims to have dreamt of a terrifying eagle flying through the air, accompanied by a huge ship of fire sailing across the land from Cologne. Nicolet in turn interprets the dream in terms of an emperor sweeping through Lombardy with a great army of German soldiers at his command, paid from his vast supply of treasure. Joan’s dream concludes with a vision of the eagle blowing out the fire, shining a great light over Montferrat, and settling in a high eyrie from which the whole world, now joyful, can be surveyed. Nicolet expounds this as the emperor’s desire for peace after vengeance, the Marquis of Montferrat’s submission, the emperor’s position of supreme command, and the prospect of appropriate rewards. The emperor is Frederick II Hohenstaufen and the author of the article proposes a new dating of the poem: it was probably composed in 1238 when the emperor, after his victory at the battle of Cortenuova in 1237 and subsequent subjection of several cities of the rebellious Lombard League, was arriving in Turin to receive the homage of Boniface II of Montferrat.

  16. Measurement of the Ratio of Branching Fractions B(D0 -> K+ pi-)/B(D0 -> K- pi+) using the CDF II Detector

    CERN Document Server

    Abulencia, A; Adelman, J; Affolder, T; Akimoto, T; Albrow, M G; Ambrose, D; Amerio, S; Amidei, D; Anastassov, A; Anikeev, K; Annovi, A; Antos, J; Aoki, M; Apollinari, G; Arguin, J F; Arisawa, T; Artikov, A; Ashmanskas, W; Attal, A; Azfar, F; Azzi-Bacchetta, P; Azzurri, P; Bacchetta, N; Bachacou, H; Badgett, W; Barbaro-Galtieri, A; Barnes, V E; Barnett, B A; Baroiant, S; Bartsch, V; Bauer, G; Bedeschi, F; Behari, S; Belforte, S; Bellettini, G; Bellinger, J; Belloni, A; Ben Haim, E; Benjamin, D; Beretvas, A; Beringer, J; Berry, T; Bhatti, A; Binkley, M; Bisello, D; Blair, R E; Blocker, C; Blumenfeld, B; Bocci, A; Bodek, A; Boisvert, V; Bölla, G; Bolshov, A; Bortoletto, D; Boudreau, J; Boveia, A; Brau, B; Bromberg, C; Brubaker, E; Budagov, Yu A; Budd, H S; Budd, S; Burkett, K; Busetto, G; Bussey, P; Byrum, K L; Cabrera, S; Campanelli, M; Campbell, M; Canelli, F; Canepa, A; Carlsmith, D; Carosi, R; Carron, S; Casarsa, M; Castro, A; Catastini, P; Cauz, D; Cavalli-Sforza, M; Cerri, A; Cerrito, L; Chang, S H; Chapman, J; Chen, Y C; Chertok, M; Chiarelli, G; Chlachidze, G; Chlebana, F; Cho, I; Cho, K; Chokheli, D; Chou, J P; Chu, P H; Chuang, S H; Chung, K; Chung, W H; Chung, Y S; Ciljak, M; Ciobanu, C I; Ciocci, M A; Clark, A; Clark, D; Coca, M; Compostella, G; Convery, M E; Conway, J; Cooper, B; Copic, K; Cordelli, M; Cortiana, G; Cresciolo, F; Cruz, A; Cuenca-Almenar, C; Cuevas-Maestro, J; Culbertson, R; Cyr, D; Da Ronco, S; D'Auria, S; D'Onofrio, M; Dagenhart, D; De Barbaro, P; De Cecco, S; Deisher, A; De Lentdecker, G; Dell'Orso, Mauro; Delli Paoli, F; Demers, S; Demortier, L; Deng, J; Deninno, M; De Pedis, D; Derwent, P F; Dionisi, C; Dittmann, J R; Di Turo, P; Dorr, C; Donati, S; Donega, M; Dong, P; Donini, J; Dorigo, T; Dube, S; Ebina, K; Efron, J; Ehlers, J; Erbacher, R; Errede, D; Errede, S; Eusebi, R; Fang, H C; Farrington, S; Fedorko, I; Fedorko, W T; Feild, R G; Feindt, M; Fernández, J P; Field, R; Flanagan, G; Flores-Castillo, L R; Foland, A; Forrester, S; Foster, G W; Franklin, M; Freeman, J C; Furic, I; Gallinaro, M; Galyardt, J; García, J E; García-Sciveres, M; Garfinkel, A F; Gay, C; Gerberich, H; Gerdes, D; Giagu, S; Giannetti, P; Gibson, A; Gibson, K; Ginsburg, C; Giokaris, N; Giolo, K; Giordani, M; Giromini, P; Giunta, M; Giurgiu, G; Glagolev, V; Glenzinski, D; Gold, M; Goldschmidt, N; Goldstein, J; Gómez, G; Gómez-Ceballos, G; Goncharov, M; González, O; Gorelov, I; Goshaw, A T; Gotra, Yu; Goulianos, K; Gresele, A; Griffiths, M; Grinstein, S; Grosso-Pilcher, C; Grundler, U; Guimarães da Costa, J; Gunay-Unalan, Z; Haber, C; Hahn, S R; Hahn, K; Halkiadakis, E; Hamilton, A; Han, B Y; Han, J Y; Handler, R; Happacher, F; Hara, K; Hare, M; Harper, S; Harr, R F; Harris, R M; Hatakeyama, K; Hauser, J; Hays, C; Heijboer, A; Heinemann, B; Heinrich, J; Herndon, M; Hidas, D; Hill, C S; Hirschbuehl, D; Höcker, A; Holloway, A; Hou, S; Houlden, M; Hsu, S C; Huffman, B T; Hughes, R E; Huston, J; Incandela, J R; Introzzi, G; Iori, M; Ishizawa, Y; Ivanov, A; Iyutin, B; James, E; Jang, D; Jayatilaka, B; Jeans, D; Jensen, H; Jeon, E J; Jindariani, S; Jones, M; Joo, K K; Jun, S Y; Junk, T R; Kamon, T; Kang, J; Karchin, P E; Kato, Y; Kemp, Y; Kephart, R; Kerzel, U; Khotilovich, V; Kilminster, B; Kim, D H; Kim, H S; Kim, J E; Kim, M J; Kim, S B; Kim, S H; Kim, Y K; Kirsch, L; Klimenko, S; Klute, M; Knuteson, B; Ko, B R; Kobayashi, H; Kondo, K; Kong, D J; Konigsberg, J; Korytov, A; Kotwal, A V; Kovalev, A; Kraan, A C; Kraus, J; Kravchenko, I; Kreps, M; Kroll, J; Krumnack, N; Kruse, M; Krutelyov, V; Kuhlmann, S E; Kusakabe, Y; Kwang, S; Laasanen, A T; Lai, S; Lami, S; Lammel, S; Lancaster, M; Lander, R L; Lannon, K; Lath, A; Latino, G; Lazzizzera, I; LeCompte, T; Lee, J; Lee, Y J; Lee, S W; Lefèvre, R; Leonardo, N; Leone, S; Levy, S; Lewis, J D; Lin, C; Lin, C S; Lindgren, M; Lipeles, E; Lister, A; Litvintsev, D O; Liu, T; Lockyer, N S; Loginov, A; Loreti, M; Loverre, P F; Lu, R S; Lucchesi, D; Lujan, P; Lukens, P; Lungu, G; Lyons, L; Lys, J; Lysak, R; Lytken, E; Mack, P; MacQueen, D; Madrak, R; Maeshima, K; Mäki, T; Maksimovic, P; Malde, S; Manca, G; Margaroli, F; Marginean, R; Marino, C; Martin, A; Martin, V; Martínez, M; Maruyama, T; Matsunaga, H; Mattson, M E; Mazini, R; Mazzanti, P; McFarland, K S; McIntyre, P; McNulty, R; Mehta, A; Menzemer, S; Menzione, A; Merkel, P; Mesropian, C; Messina, A; Von der Mey, M; Miao, T; Miladinovic, N; Miles, J; Miller, R; Miller, J S; Mills, C; Milnik, M; Miquel, R; Mitra, A; Mitselmakher, G; Miyamoto, A; Moggi, N; Mohr, B; Moore, R; Morello, M; Movilla-Fernández, P A; Mülmenstädt, J; Mukherjee, A; Müller, T; Mumford, R; Murat, P; Nachtman, J; Naganoma, J; Nahn, S; Nakano, I; Napier, A; Naumov, D; Necula, V; Neu, C; Neubauer, M S; Nielsen, J; Nigmanov, T; Nodulman, L; Norniella, O; Nurse, E; Ogawa, T; Oh, S H; Oh, Y D; Okusawa, T; Oldeman, R; Orava, R; Österberg, K; Pagliarone, C; Palencia, E; Paoletti, R; Papadimitriou, V; Paramonov, A A; Parks, B; Pashapour, S; Patrick, J; Pauletta, G; Paulini, M; Paus, C; Pellett, D E; Penzo, Aldo L; Phillips, T J; Piacentino, G; Piedra, J; Pinera, L; Pitts, K; Plager, C; Pondrom, L; Portell, X; Poukhov, O; Pounder, N; Prakoshyn, F; Pronko, A; Proudfoot, J; Ptohos, F; Punzi, G; Pursley, J; Rademacker, J; Rahaman, A; Rakitine, A; Rappoccio, S; Ratnikov, F; Reisert, B; Rekovic, V; Van Remortel, N; Renton, P B; Rescigno, M; Richter, S; Rimondi, F; Ristori, L; Robertson, W J; Robson, A; Rodrigo, T; Rogers, E; Rolli, S; Roser, R; Rossi, M; Rossin, R; Rott, C; Ruiz, A; Russ, J; Rusu, V; Saarikko, H; Sabik, S; Safonov, A; Sakumoto, W K; Salamanna, G; Salto, O; Saltzberg, D; Sánchez, C; Santi, L; Sarkar, S; Sartori, L; Sato, K; Savard, P; Savoy-Navarro, A; Scheidle, T; Schlabach, P; Schmidt, E E; Schmidt, M P; Schmitt, M; Schwarz, T; Scodellaro, L; Scott, A L; Scribano, A; Scuri, F; Sedov, A; Seidel, S; Seiya, Y; Semenov, A; Sexton-Kennedy, L; Sfiligoi, I; Shapiro, M D; Shears, T G; Shepard, P F; Sherman, D; Shimojima, M; Shochet, M; Shon, Y; Shreyber, I; Sidoti, A; Sinervo, P; Sisakian, A; Sjölin, J; Skiba, A; Slaughter, A J; Sliwa, K; Smith, J R; Snider, F D; Snihur, R; Söderberg, M; Soha, A; Somalwar, S; Sorin, V; Spalding, J; Spezziga, M; Spinella, F; Spreitzer, T; Squillacioti, P; Stanitzki, M; Staveris-Polykalas, A; Saint-Denis, R; Stelzer, B; Stelzer-Chilton, O; Stentz, D; Strologas, J; Stuart, D; Suh, J S; Sukhanov, A; Sumorok, K; Sun, H; Suzuki, T; Taffard, A; Takashima, R; Takeuchi, Y; Takikawa, K; Tanaka, M; Tanaka, R; Tanimoto, N; Tecchio, M; Teng, P K; Terashi, K; Tether, S; Thom, J; Thompson, A S; Thomson, E; Tipton, P; Tiwari, V; Tkaczyk, S; Toback, D; Tokar, S; Tollefson, K; Tomura, T; Tonelli, D; Tonnesmann, M; Torre, S; Torretta, D; Tourneur, S; Trischuk, W; Tsuchiya, R; Tsuno, S; Turini, N; Ukegawa, F; Unverhau, T; Uozumi, S; Usynin, D; Vaiciulis, A W; Vallecorsa, S; Varganov, A; Vataga, E; Velev, G; Veramendi, G; Veszpremi, V; Vidal, R; Vila, I; Vilar, R; Vine, T; Vollrath, I; Volobuev, I P; Volpi, G; Würthwein, F; Wagner, P; Wagner, R G; Wagner, R L; Wagner, W; Wallny, R; Walter, T; Wan, Z; Wang, S M; Warburton, A; Waschke, S; Waters, D; Wester, W C; Whitehouse, B; Whiteson, D; Wicklund, A B; Wicklund, E; Williams, G; Williams, H H; Wilson, P; Winer, B L; Wittich, P; Wolbers, S; Wolfe, C; Wright, T; Wu, X; Wynne, S M; Yagil, A; Yamamoto, K; Yamaoka, J; Yamashita, T; Yang, C; Yang, U K; Yang, Y C; Yao, W M; Yeh, G P; Yoh, J; Yorita, K; Yoshida, T; Yu, G B; Yu, I; Yu, S S; Yun, J C; Zanello, L; Zanetti, A; Zaw, I; Zetti, F; Zhang, X; Zhou, J


    We present a measurement of R_B, the ratio of the branching fraction for the rare decay D0 -> K+ pi- to that for the Cabibbo-favored decay D0 -> K- pi+. Charge conjugate decays are implicitly included. A signal of 2005 +/- 104 events for the decay D0 -> K+ pi- is obtained using the CDF II detector at the Fermilab Tevatron collider. The data set corresponds to an integrated luminosity of 0.35 1/fb produced in p-bar/p collisions at sqrt{s}=1.96 TeV. Assuming no mixing, we find R_B = [ 4.05 +/- 0.21 (stat) +/- 0.11 (syst) ] x 10(-3). This measurement is consistent with the world average, and comparable in accuracy with the best measurements from other experiments.

  17. Joint-research project. The world of renewable energies: powerado. Final report. Part 2; Verbundforschungsprojekt. Erlebniswelt erneuerbare Energien: powerado. Endbericht. Bd. 2

    Energy Technology Data Exchange (ETDEWEB)

    Scharp, Michael (ed.)


    The objective of the research project 'The world of renewable energies: Powerado' was to improve communication aimed at conveying renewable energies to children. In order to achieve his aim, materials for different age groups and multipliers have been developed. These helped determining successful strategies for communicating renewable energies. There were several reasons for the need of such a project. It may be the case that renewable energies have been included into the syllabus of primary schools, but they still have no prominent role at schools. Additionally, the training of multipliers for renewable energies shows severe deficits. The project consisted of ten interconnected modules which explicitly are described. Overall, the powerado project was a huge success. 58,000 estimated multipliers, children, adolescents and persons generally being interested in renewable energies have been reached by the project and its modules. So the powerado project achieved its main objective improving communication of renewable energies.

  18. Factores transcripcionales de la clase DOF en Brachypodium distachyon: caracterización molecular de BdDOF24 durante la germinación de las semillas


    González de la Calle, Virginia


    La semilla es el órgano que garantiza la propagación y continuidad evolutiva de las plantas espermatofitas y constituye un elemento indispensable en la alimentación humana y animal. La semilla de cereales acumula en el endospermo durante la maduración, mayoritariamente, almidón y proteínas de reserva. Estas reservas son hidrolizadas en la germinación por hidrolasas sintetizadas en la aleurona en respuesta a giberelinas (GA), siendo la principal fuente de energía hasta que la plántula emergent...

  19. Disseny BD : Activitat física i història mèdica dels ciutadans de la CEE


    Serrano de Arcayne, Sílvia


    Treball de fi de carrera dins de l'àrea de bases de dades relacionals. Es tracta del desenvolupament d'un projecte informàtic consistent en el disseny i implementació d'una base de dades, que en l'àmbit de la Comunitat Europea, permeti emmagatzemar i consultar informació sobre l'activitat física i certes dades de salut dels seus ciutadans.

  20. Innovationen im Netz : die Rolle von Beziehungen zwischen Wissenschaft und Wirtschaft für den Wissens- und Technologietransfer. Bd. 1, Theoretische und empirische Netzwerke im Hochtemperaturbereich


    Pechmann, Agnes; Ruddat, Michael; Sautter, Alexander; Tampe-Mai, Karolin


    Die Umsetzung der Ergebnisse aus der Grundlagenforschung in die Praxis bietet noch immer großes Verbesserungspotential. Der Druck, die Ergebnisse schneller (oder überhaupt) nutzbar zu machen, ist gestiegen. Verschiedene Förderinstrumente (Transferstellen, Transfer über Köpfe, Patentbörsen etc.) sollen den Technologietransfer unterstützen. Ist dies praktikabel? Wie funktionieren Innovationsnetzwerke überhaupt? Welche Beispiele von Transfer aus der Grundlagenforschung gibt es? Was motiviert For...

  1. The deployment of systems development methodologies at project level in software houses in South Africa / B.D. Janse van Rensburg


    Van Rensburg, Barend Daniël Janse


    This is a study of the deployment of systems development methodologies at project level in software houses in South Africa. This study extends previous research of Huisman and livari (2002a. 2002b) who studied the deployment of system development methodologies at organisational level and at individual level. More specifically, the author studied the context and the outsourcing environment in which system development takes place in software houses in South Africa. Furthermore, the use of syste...

  2. Tracking Advanced Planetary Systems (TAPAS) with HARPS-N. III. HD 5583 and BD+15 2375 - two cool giants with warm companions

    CERN Document Server

    Niedzielski, A; Nowak, G; Adamów, M; Kowalik, K; Wolszczan, A; Deka-Szymankiewicz, B; Adamczyk, M; Maciejewski, G


    Evolved stars are crucial pieces to understand the dependency of the planet formation mechanism on the stellar mass and to explore deeper the mechanism involved in star-planet interactions. Over the past ten years, we have monitored about 1000 evolved stars for radial velocity variations in search for low-mass companions under the Penn State - Torun Centre for Astronomy Planet Search program with the Hobby-Eberly Telescope. Selected prospective candidates that required higher RV precision measurements have been followed with HARPS-N at the 3.6 m Telescopio Nazionale Galileo under the TAPAS project. We aim to detect planetary systems around evolved stars to be able to build sound statistics on the frequency and intrinsic nature of these systems, and to deliver in-depth studies of selected planetary systems with evidence of star-planet interaction processes. For HD 5583 we obtained 14 epochs of precise RV measurements collected over 2313 days with the Hobby-Eberly Telescope (HET), and 22 epochs of ultra-precise...

  3. An Ultraviolet to Mid-Infrared Study of the Physical and Wind Properties of HD 164270 (WC9) and Comparison to BD+30 3639 ([WC9])


    Crowther, Paul; Morris, Pat; Smith, JD


    We present new Spitzer IRS observations of HD164270 (WC9, WR103). A quantitative analysis of the UV, optical, near- and mid-IR spectrum of HD164270 is presented, allowing for line blanketing and wind clumping, revealing T* ~ 48kK, log L/L_sun ~ 4.9, dM/dt ~ 1e-5 M_sun/yr for a volume filling factor of f \\~ 0.1. Our models predict that He is partially recombined in the outer stellar wind, such that recent radio-derived mass-loss rates of WC9 stars have been underestimated. We obtain C/He ~ 0.2...

  4. Energy saving in houses. Seminar of Zentrale Informationsstelle Umweltberatung Bayern, Vol. 19; Energiesparen rund ums Haus. Seminarband der Zentralen Informationsstelle Umweltberatung Bayern. Bd. 19

    Energy Technology Data Exchange (ETDEWEB)

    Stroh, K.; Behling, G; Koller, U.; Lattner, A. (eds.)


    Contents: Information on energy conservation and state funds, Energy management at communal level, eco-balance of power generation; The new Energy Conservation Ordinance; Energy conservation in domestic buildings; Low-consumption power supply systems; Potential savings resulting from consumption patterns; Eco-balances and preventive cost. [German] Referenten aus wissenschaftlichen und behoerdlichen Institutionen informierten ueber aktuelle Erkenntnisse zum Energiesparen in oeffentlichen und privaten Gebaeuden. Dabei wurden folgende Themen behandelt: - Informationen ueber Energiesparen und Foerderprogramme - Energiemanagement fuer Kommunen, Oekobilanz der Stromerzeugung - Die neue Energieeinsparverordnung - Energiesparen in Wohngebaeuden - Sparsame Energieversorgungssysteme - Verhaltensbedingte Einsparpotenziale - Oekobilanzen und Vermeidungskosten. (orig.)

  5. Assessment of the BD MGIT TBc Identification Test for the Detection of Mycobacterium tuberculosis Complex in a Network of Mycobacteriology Laboratories


    Diana Machado; Jorge Ramos; Isabel Couto; Nureisha Cadir; Inácio Narciso; Elizabeth Coelho; Sofia Viegas; Miguel Viveiros


    We evaluate the performance of the TBcID assay in a panel of 100 acid-fast bacilli cultures. Sixty-four isolates were TBcID positive for Mycobacterium tuberculosis complex (MTBC), whereas 36 gave negative results. These included 28 nontuberculous mycobacteria, one nonmycobacterial isolate, one M. tuberculosis, and six M. bovis BCG strains. This corresponds to a sensitivity of 90.14%, specificity of 100%, and positive and negative predictive values of 100% and 80.55%, respectively. The test is...

  6. Assessment of the BD MGIT TBc Identification Test for the Detection of Mycobacterium tuberculosis Complex in a Network of Mycobacteriology Laboratories

    Directory of Open Access Journals (Sweden)

    Diana Machado


    Full Text Available We evaluate the performance of the TBcID assay in a panel of 100 acid-fast bacilli cultures. Sixty-four isolates were TBcID positive for Mycobacterium tuberculosis complex (MTBC, whereas 36 gave negative results. These included 28 nontuberculous mycobacteria, one nonmycobacterial isolate, one M. tuberculosis, and six M. bovis BCG strains. This corresponds to a sensitivity of 90.14%, specificity of 100%, and positive and negative predictive values of 100% and 80.55%, respectively. The test is rapid, easy to perform and interpret, and does not require sample preparation or instrumentation. However, a negative result does not exclude the presence of a strain belonging to MTBC, especially when mutations in mpb64 gene are present or some M. bovis BCG strains are isolated. The TBcID showed potential to assist in the identification of MTBC when the implementation and usage of molecular methods are often not possible, principally in resource-limited countries.

  7. Radiation, fields and waves. Non-ionizing radiation in everyday life. Vol. 15. Seminar lectures; Strahlen, Felder und Wellen. Nichtionisierende Strahlung im taeglichen Umfeld. Bd. 15. Seminarband

    Energy Technology Data Exchange (ETDEWEB)

    Behling, G.; Koller, U.; Rauh, K.; Haury, H.J. [comps.


    Experts from science and administration informed the participants about recent results of scientific research and the applicable laws and regulations. Potential health hazards and recommended protective measures have been discussed. The publication presents the lectures held at the seminar. (orig./CB) [German] Fachleute aus Wissenschaft und von Behoerden informierten ueber aktuelle Erkenntnisse sowie das gesetzliche Regelwerk. Aus unterschiedlichen Blickwinkeln wurden moegliche gesundheitliche Risiken und vorgeschlagene Sicherheitsempfehlungen diskutiert. Der vorliegende Band enthaelt die ausgearbeiteten Vortraege. (orig./MG)

  8. Recent developments in Tswana literature : a narratological study of short stories of B.D. Magoleng and S.A. Moroke / Maserame Maria Letsie


    Letsie, Maserame Maria


    In this thesis some trends in Setswana literature of the past 50 years are described and analysed. Through the analyses of selected short stories by Moroke and Magoleng, thematic and stylistic aspects are discussed. The central problem, the aims and objectives are outlined and motivated in the first chapter. In chapter two, the historical background of Setswana as a language, the structure of traditional oral literature in Setswana as well as modern written Setswana literature ...

  9. Guillem Peire de Cazals, “Be·m plagr’ueymais qu’ab vos dona·m valgues” (BdT 227.6)


    Alessio Collura


    This paper proposes a new edition with commentary of the poem “Be·m plagr’ueymais qu’ab vos, dona, ·m valgues” by Guillem Peire de Cazals and represents a first critical and hermeneutical reassessment of the poetry of the troubadour from Cahors, that has long been neglected. The text presents the classical structure of a love-story (springtime exordium, singing brought on by love, the theme of improvement, courting with no hope of a reward, a request for mercé) and invites the fin aman to be ...

  10. Dicty_cDB: CFC256 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available nificant alignments: (bits) Value N BD092935 |BD092935.1 Methods and compositions... for synthesis of longfatty acids in plants. 1306 0.0 1 BD082645 |BD082645.1 Methods and compositions for sy...nthesis of long chain polyunsaturated fatty acids. 1306 0.0 1 BD082630 |BD082630.1 Methods and compositions

  11. Dicty_cDB: VFF201 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ore E Sequences producing significant alignments: (bits) Value N BD092935 |BD092935.1 Methods and composition...BD082645 |BD082645.1 Methods and compositions for synthesis of long chain polyunsaturated fatty acids. 1005 ...0.0 4 BD082630 |BD082630.1 Methods and compositions for synthesis of long chain poly-unsaturated fatty acids

  12. Dicty_cDB: VFD240 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ts: (bits) Value N BD092935 |BD092935.1 Methods and compositions for synthesis of... long chain polyunsaturated fatty acids in plants. 1316 0.0 1 BD082645 |BD082645.1 Methods and compositions ...for synthesis of long chain polyunsaturated fatty acids. 1316 0.0 1 BD082630 |BD082630.1 Methods and composition

  13. Dicty_cDB: VFA219 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available N BD092935 |BD092935.1 Methods and compositions for synthesis of long chain poly...unsaturated fatty acids in plants. 1213 0.0 3 BD082645 |BD082645.1 Methods and compositions for synthesis of... long chain polyunsaturated fatty acids. 1213 0.0 3 BD082630 |BD082630.1 Methods and compositions for synthe

  14. Dicty_cDB: SFJ777 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available nts: (bits) Value N BD092935 |BD092935.1 Methods and compositions for synthesis of longfatty acids in plants.... 70 6e-12 2 BD082645 |BD082645.1 Methods and compositions for synthesis of long chain polyunsaturated fatty... acids. 70 6e-12 2 BD082630 |BD082630.1 Methods and compositions for synthesis of

  15. Dicty_cDB: SFC674 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available s: (bits) Value N BD092935 |BD092935.1 Methods and compositions for synthesis of ...long chain polyunsaturated fatty acids in plants. 1118 0.0 3 BD082645 |BD082645.1 Methods and compositions f...or synthesis of long chain polyunsaturated fatty acids. 1118 0.0 3 BD082630 |BD082630.1 Methods and composition

  16. Dicty_cDB: AFI278 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available t alignments: (bits) Value N BD092935 |BD092935.1 Methods and compositions for synthesis of longfatty acids plants. 1132 0.0 2 BD082645 |BD082645.1 Methods and compositions for synthesis of long chain polyunsatura...ted fatty acids. 1132 0.0 2 BD082630 |BD082630.1 Methods and compositions for syn

  17. Dicty_cDB: VFH703 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available BD092935 |BD092935.1 Methods and compositions for synthesis of long chain polyunsaturated fatty acids in pla...nts. 1183 0.0 1 BD082645 |BD082645.1 Methods and compositions for synthesis of long chain polyunsaturated fa...tty acids. 1183 0.0 1 BD082630 |BD082630.1 Methods and compositions for synthesis

  18. Dicty_cDB: SLA256 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available oducing significant alignments: (bits) Value N BD092935 |BD092935.1 Methods and compositions for synthesis o...f longfatty acids in plants. 1479 0.0 1 BD082645 |BD082645.1 Methods and compositions for synthesis of long ...chain polyunsaturated fatty acids. 1479 0.0 1 BD082630 |BD082630.1 Methods and composition

  19. Clinical Implications of DSM-IV Subtyping of Bipolar Disorders in Referred Children and Adolescents (United States)

    Masi, Gabriele; Perugi, Giulio; Millepiedi, Stefania; Mucci, Maria; Pari, Cinzia; Pfanner, Chiara; Berloffa, Stefano; Toni, Cristina


    Objective: According to DSM-IV, bipolar disorders (BDs) include four subtypes, BD I, BD II, cyclothymic disorder, and BD not otherwise specified (NOS). We explore the clinical implications of this subtyping in a naturalistic sample of referred youths with BD I, BD II, and BD-NOS. Method: The sample consisted of 217 patients, 135 males and 82…

  20. Emission control measures for precursors of tropospheric ozone. Pt. 1 and 2; Emissionsminderungsmoeglichkeiten bei Vorlaeufersubstanzen von bodennahem Ozon. Bd. 1: Systemanalyse der Ozonminderungsmassnahmen in den USA. Bd. 2: Luftreinhaltemassnahmen in den USA zur Minderung von VOC-Emissionen aus Kleinanlagen und Produkten und Vergleich mit europaeischen Regelungen

    Energy Technology Data Exchange (ETDEWEB)

    Leclaire, T.; Schiefer, C.; Bergmann, S.; Hrabovski, Z. [Institut fuer Umwelttechnologie und Umweltanalytik e.V. (IUTA), Duisburg (Germany)


    For more than two decades now experiences of ozone reduction have been made in the USA. In many regions great efforts for VOC control are made to reduce their high ozone concentrations in ambient air that in some cases reach up to more than twice the German peak concentrations. This report places focus on small stationary sources and products, for these sources actually contribute more than half of the VOC emissions in Germany and are still not regulated under the German Immission Control Law. Therefore, main aim of this examination was to determine the major elements of VOC control strategies in the U.S. and to consider, whether strategies and measures are transferable taking into account German circumstances. Volume 1 describes the strategies and measures for ozone control in the U.S. (national) as well as in five regions with high ozone concentrations in ambient air. The authorities and responsbilities at federal, state, regional, and local levels are highlighted, legislation and different types of regulations are explained, priorities concerning VOC versus NO{sub x} related control are mentioned and the control measures on different sources for reducing VOC and NO{sub x} are summarized briefly. Volume 2 contains a detailed description of control measures for reducing VOC emissions from products and stationary sources, namely the proposed national VOC emission standards for coatings and consumer products, the California Consumer Products Regulations, the state-wide requirements for industrial and commercial sources in California and the VOC related rules of the South Coast Air Quality Management District (LA and surrounded Countries). The South Coast Rules were chosen as an example for District Rules for they were generally the most stringent because of the extreme ozone concentration in this area. Moreover, the regulations for VOC emission control in Europe concerning small stationary sources and products are mentioned. The different approaches to control VOC emissions are compared and discussed. Advantages and disadvantages of the described strategies are highlighted. Based on the actual VOC emission inventory of Germany suggestions for future reduction measures are supposed. (orig.) [Deutsch] In den USA liegen Erfahrungen aus der Ozonbekaempfung ueber einen Zeitraum von 20 bis 30 Jahren vor. Aufgrund besonders hoher Ozonbelastungen in vielen Regionen werden grosse Anstrengungen zur VOC-Minderung unternommen. Wesentliches Ziel des Vorhabens war es, die Schwerpunkt im Hinblick auf die Minderung von VOC-Emissionen herauzufinden und zu pruefen, ob und inwieweit eine Uebertragung von Strategien und Massnahmen auf die Verhaeltnisse in Deutschland moeglich ist. Hauptaugenmerk wurde auf kleinere Anlagen und Produkte gelegt, weil in diesen Bereichen in Deutschland momentan vordringlich Handlungsbedarf gesehen wird. Im ersten Band sind die Strategien und Massnahmen zur Ozonminderung in den USA (bundesweit) sowie in fuenf Regionen mit besonders hoher Ozonimmissionsbelastung beschrieben. Hierzu erfolgte eine Darstellung der Zustaendigkeitsbereiche auf nationaler, einzelstaatlicher, regionaler und lokaler Ebene, der Gesetzgebung und Regelwerke, der Schwerpunktsetzung hinsichtlich NO{sub x}- und VOC-Minderung und eine kurze Darstellung der quellenbezogenen Massnahmen auf nationaler Ebene und in den betrachteten Regionen. In Band 2 erfolgt eine ausfuehrliche Beschreibung der Massnahmen zur VOC-Emissionsminderung bei Produkten und im gewerblichen Bereich in den USA anhand der nationalen Regelungen fuer Anstrichstoffe und Konsumgueter, der von der kalifornischen Luftreinhaltebehoerde erlassenen VOC-bezogenen Regelungen fuer Anstrichstoffe, Konsumgueter und Gewerbebetriebe sowie der Regelungen des suedkalifornischen South Coast Air Quality Management Districts (Los Angeles und Umgebung). Zur Darstellung der regionalen Bestimmung wurde diese Region ausgewaehlt, da die Regelungen dort aufgrund der besonders hohen Immissionsbelastung grundsaetzlich am weitesten gehen. Darueber hinaus werden die Regelungen zur VOC-Emissionsminderung fuer den Bereich der Kleinanlagen und Produkte in Europa dargestellt. Die unterschiedlichen Ansaetze zur VOC-Emissionsminderung werden zusammenfassend diskutiert, Vor-und Nachteile herausgearbeitet und unter Beruecksichtigung der derzeitigen VOC-Emissionssituation in Deutschland Ansatzpunkte fuer zukuenftige Massnahmenschwerpunkte aufgezeigt. (orig.)

  1. Vitrification of isolated mice blastomeres using a closed loading device

    Directory of Open Access Journals (Sweden)

    Sharma Rakesh


    Full Text Available Abstract Isolated blastomeres obtained by embryo biopsy serve mainly for preimplantation genetic screening. Blastomeres are undifferentiated embryonic cells that include all the embryo genetic information. A lot of developing technologies may benefit by the efficient cryopreservation of blastomeres for future potential use, especially for stem cell culture and differentiation control. We are hereby reporting for the first time the feasibility of preserving individual isolated blastomeres in microvolumes in a closed vitrification system. Using a cryotip and propagation in microvolumes, isolated mice blastomeres were vitrified and warmed with 100% post-warming survival.

  2. Are bipolar II patients cognitively impaired? A systematic review


    Solé, B.; Martínez-Arán, Anabel; Torrent, C.; Bonnín Roig, Caterina del Mar; Reinares, M.; Popovic, D; Sánchez-Moreno, José; Vieta i Pascual, Eduard, 1963-


    BACKGROUND: There is evidence that bipolar disorder (BD) is associated with significant neurocognitive deficits and this occurs in individuals with BD type I (BD I) and with BD type II (BD II). Only a few studies have focused on cognitive impairment in BD II. The aim of this study was to describe the pattern of cognitive impairment in patients with BD II, in order to identify specific cognitive deficits that distinguish BD II from BD I patients as well as from healthy subjects. METHOD: We per...

  3. Dicty_cDB: SFG336 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 92935 |BD092935.1 Methods and compositions for synthesis of long chain polyunsatu...rated fatty acids in plants. 90 1e-46 5 BD082645 |BD082645.1 Methods and compositions for synthesis of long ...chain polyunsaturated fatty acids. 90 1e-46 5 BD082630 |BD082630.1 Methods and compositions for synthesis of

  4. Dicty_cDB: VFA327 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available icant alignments: (bits) Value N BD092935 |BD092935.1 Methods and compositions for synthesis of long chain p...olyunsaturated fatty acids in plants. 1011 0.0 5 BD082645 |BD082645.1 Methods and compositions for synthesis... of long chain polyunsaturated fatty acids. 1011 0.0 5 BD082630 |BD082630.1 Methods and composition

  5. Dicty_cDB: VFE188 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available gnments: (bits) Value N BD092935 |BD092935.1 Methods and compositions for synthesis of long chain polyunsatu...rated fatty acids in plants. 1338 0.0 1 BD082645 |BD082645.1 Methods and composition...s for synthesis of long chain polyunsaturated fatty acids. 1338 0.0 1 BD082630 |BD082630.1 Methods and composition

  6. Dicty_cDB: VHC494 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Patent EP1598422. 62 2e-14 4 BD092935 |BD092935.1 Methods and compositions for synthesis of long chain polyu...nsaturated fatty acids in plants. 62 2e-14 4 BD082645 |BD082645.1 Methods and compositions for synthesis of ...long chain polyunsaturated fatty acids. 62 2e-14 4 BD082630 |BD082630.1 Methods and composition

  7. Dicty_cDB: VFA320 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ogy vs DNA Score E Sequences producing significant alignments: (bits) Value N BD092935 |BD092935.1 Methods and composition.... 1213 0.0 3 BD082645 |BD082645.1 Methods and compositions for synthesis of long chain polyunsaturated fatty... acids. 1213 0.0 3 BD082630 |BD082630.1 Methods and compositions for synthesis of long chain poly-unsaturate

  8. Dicty_cDB: [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available acids in plants. 1312 0.0 2 BD082645 |BD082645.1 Methods and compositions for synthesis of long chain polyu...nsaturated fatty acids. 1312 0.0 2 BD082630 |BD082630.1 Methods and compositions for synthesis of long chain...2004.12.25 Homology vs DNA Score E Sequences producing significant alignments: (bits) Value N BD092935 |BD092935.1 Methods and compos...itions for synthesis of long chain polyunsaturated fatty

  9. Dicty_cDB: SFF147 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 6 11 BD092935 |BD092935.1 Methods and compositions for synthesis of long chain polyunsaturated fatty acids i...n plants. 90 9e-47 6 BD082645 |BD082645.1 Methods and compositions for synthesis of long chain polyunsaturat...ed fatty acids. 90 9e-47 6 BD082630 |BD082630.1 Methods and compositions for synthesis of long chain poly-un

  10. Dicty_cDB: SSB813 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available urase, complete cds. 2137 0.0 3 BD092935 |BD092935.1 Methods and compositions for... synthesis of long chain polyunsaturated fatty acids in plants. 1471 0.0 1 BD082645 |BD082645.1 Methods and composition...s for synthesis of long chain polyunsaturated fatty acids. 1471 0.0 1 BD082630 |BD082630.1 Methods and composition

  11. Dicty_cDB: SSD596 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available cds. 670 0.0 1 BD092935 |BD092935.1 Methods and compositions for synthesis of long chain polyunsaturated fat...ty acids in plants. 90 9e-40 3 BD082645 |BD082645.1 Methods and compositions for ...synthesis of long chain polyunsaturated fatty acids. 90 9e-40 3 BD082630 |BD082630.1 Methods and composition

  12. Dicty_cDB: VSC833 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ficant alignments: (bits) Value N BD092935 |BD092935.1 Methods and compositions for synthesis of long chain ...polyunsaturated fatty acids in plants. 1130 0.0 1 BD082645 |BD082645.1 Methods and compositions for synthesi...s of long chain polyunsaturated fatty acids. 1130 0.0 1 BD082630 |BD082630.1 Methods and compositions for sy

  13. Dicty_cDB: SLA259 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 3 0.0 1 BD092935 |BD092935.1 Methods and compositions for synthesis of long chain... polyunsaturated fatty acids in plants. 1471 0.0 1 BD082645 |BD082645.1 Methods and compositions for of long chain polyunsaturated fatty acids. 1471 0.0 1 BD082630 |BD082630.1 Methods and compositions for s

  14. Dicty_cDB: VFA388 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available nments: (bits) Value N BD092935 |BD092935.1 Methods and compositions for synthesi...s of long chain polyunsaturated fatty acids in plants. 1281 0.0 2 BD082645 |BD082645.1 Methods and composition...s for synthesis of long chain polyunsaturated fatty acids. 1281 0.0 2 BD082630 |BD082630.1 Methods and composition

  15. Dicty_cDB: VFF662 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available DNA Score E Sequences producing significant alignments: (bits) Value N BD092935 |BD092935.1 Methods and composition...0.0 2 BD082645 |BD082645.1 Methods and compositions for synthesis of long chain polyunsaturated fatty acids.... 1296 0.0 2 BD082630 |BD082630.1 Methods and compositions for synthesis of long chain poly-unsaturated fatty

  16. Dicty_cDB: VSF218 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available significant alignments: (bits) Value N BD092935 |BD092935.1 Methods and compositions for synthesis of long c...hain polyunsaturated fatty acids in plants. 936 0.0 1 BD082645 |BD082645.1 Methods and composition...s for synthesis of long chain polyunsaturated fatty acids. 936 0.0 1 BD082630 |BD082630.1 Methods and composition

  17. Dicty_cDB: SFJ773 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available elium discoideum Dd des5 gene for fatty acid desaturase, complete cds. 113 e-114 12 BD092935 |BD092935.1 Methods and composition...plants. 90 2e-46 6 BD082645 |BD082645.1 Methods and compositions for synthesis of long chain polyunsaturated... fatty acids. 90 2e-46 6 BD082630 |BD082630.1 Methods and compositions for synthesis of long chain poly-unsa

  18. Dicty_cDB: VFC660 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available m FadA gene for fatty acid desaturase, complete cds. 1033 0.0 5 BD092935 |BD092935.1 Methods and composition...s for synthesis of long chain polyunsaturated fatty acids in plants. 402 e-162 2 BD082645 |BD082645.1 Methods and composition...-162 2 BD082630 |BD082630.1 Methods and compositions for synthesis of long chain poly-unsaturated fatty acid

  19. Dicty_cDB: SLG383 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ynthesizing the nucleic acid. 80 4e-29 2 BD083024 |BD083024.1 Method of detecting difference between gene se...1652.1 Method for synthesizing the nucleic acid. 80 8e-29 2 BD083026 |BD083026.1 Method of detecting diffe...rence between gene sequences. 80 8e-29 2 BD181438 |BD181438.1 Method for synthesizi

  20. Electrochemical migration of tin in electronics and microstructure of the dendrites

    DEFF Research Database (Denmark)

    Minzari, Daniel; Grumsen, Flemming Bjerg; Jellesen, Morten Stendahl;


    heterogeneous microstructure along the growth direction, which is attributed to unstable growth conditions inside the micro-volume of electrolyte. Selected area electron diffraction showed that the dendrites are metallic tin having sections of single crystal orientation and lead containing intermetallic...

  1. 11B NMR study of easter formation and complexing in the polyborate existence region of H3BO3-NaOH-H2O-2,3-butanediol system

    International Nuclear Information System (INIS)

    Interactions in concentrated solutions of boric acid and sodium hydroxide mixtures at pH 9 with 2,3-butanediol (BD) have been studied by 11B NMR spectroscopy method. With an increase in BD concentration a cyclic esters of boric acid (BD)BOH is formed, as well as complex anions [(BD)B(OH)2]-, [(BD)2B]- and [(BD)B3O3(OH)2]-. Polyion [B5O6(OH)4]- with addition of BD excess is partially hydrolyzed into monoborate-ion and boric acid, which react instantly with BD excess giving rise to formation of the relevant complex anions and ester

  2. Neurocognitive features in subgroups of bipolar disorder


    Aminoff, Sofie Ragnhild; Hellvin, Tone; Lagerberg, Trine Vik; Berg, Akiah Ottesen; Andreassen, Ole A; Melle, Ingrid


    Objective To examine which subgroups of DSM-IV bipolar disorder (BD) [BD type I (BD-I) or BD type II (BD-II), and subgroups based on history of psychosis, presenting polarity, and age at onset] differentiate best regarding neurocognitive measures. Methods A total of 199 patients with BD were characterized by clinical and neurocognitive features. The distribution of subgroups in this sample was: BD-I, 64% and BD-II, 36%; 60% had a history of psychosis; 57% had depression as the presenting pola...

  3. Determination and calculation of hazardous incident scenarios in accordance with the 3rd hazardous incident administrative instruction. Vol. 1; Ermittlung und Berechnung von Stoerfallablaufszenarien nach Massgabe der 3. Stoerfallverwaltungsvorschrift. Bd. 1: Methodischer Teil zum Erarbeiten von Stoerfallablaufszenarien

    Energy Technology Data Exchange (ETDEWEB)

    Kaiser, W.; Rogazewski, P.; Schindler, M. [TUeV Anlagentechnik GmbH, Berlin-Schoeneberg (Germany). Unternehmensgruppe TUeV Rheinland/Berlin-Brandenburg; Acikalin, A.; Albrecht, M.; Lambert, M.; Steinbach, J. [Technische Univ. Berlin (Germany)


    At present there are used various procedures, calculation methods, models and model equations for hazardous incident scenarios. The procedure on principle is varying often. This guideline explains in one main part and six appendixes the methodical procedure to select specifications and assumptions on hazardous incident scenarios and their processing. Hazardous incident scenarios lead to information on emergency preparedness planning. Both general viewpoints and possibilities are shown, how to find necessary basic assumptions on a hazardous incident scenario from information on hazardous substances, on comparable hazardous incidents and on conditions of the site and the plant. Appendixes deal with precise instructions distinguished between substance release, explosion and fire (App. 1: Assessment of source terms, App. 2: Assessment of dispersion, App. 3: Assessment of effects). Appendix 4 gives explanations to appendixes 1, 2 and 3. Appendix 5 contains a collection of 15 examples of hazardous incident scenarios, which illustrate and comment the methodical procedure. Appendix 6 describes and comments software available on German market which assists the calculating of hazardous incidents. Volume 2 determines procedures with regard to methods of calculation, current models and model equations from scientists' point of view. (orig.) [German] Derzeit wird eine Vielzahl von Vorgehensweisen, Berechnungsmethoden, Modellen und Modellgleichungen fuer Stoerfallablaufszenarien verwendet. Das prinzipielle Vorgehen ist haeufig unterschiedlich. Dieser Leitfaden enthaelt in einem Hauptteil und sechs Anhaengen das methodische Vorgehen zur Auswahl von Angaben und Annahmen fuer Stoerfallablaufszenarien sowie deren Bearbeitung. Stoerfallablaufszenarien fuehren zu Angaben fuer die Gefahrenabwehrplanung. Fuer das Ableiten von Stoerfallablaufszenarien sind sowohl allgemeine Gesichtspunkte als auch Moeglichkeiten dargelegt, wie man aus Angaben zu Gefahrstoffen, zu vergleichbaren Stoerfaellen sowie zu Bedingungen des Standortes und der Anlage die erforderlichen Grundannahmen zum Stoerfallablauf gewinnen kann. Unterschieden nach Stofffreisetzungen, Explosionen und Braenden wird jeweils auf die konkreteren Hinweise im Anhang 1 zur Abschaetzung von Quelltermen, im Anhang 2 zur Abschaetzung der Ausbreitung und im Anhang 3 zur Abschaetzung der Auswirkungen verwiesen. Der Anhang 4 enthaelt einige Erlaeuterungen zu den Anhaengen 1 bis 3. Mit einer Sammlung von 15 Beispielen fuer Stoerfallablaufszenarien wird im Anhang 5 das im Leitfaden beschriebene methodische Vorgehen veranschaulicht und erlaeutert. Im Anhang 6 werden die auf dem deutschen Markt erhaeltlichen DV-Programme (Software) zur Berechnung von Stoerfallablaufszenarien beschrieben und kommentiert. Der Band 2 untermauert das Vorgehen im Hinblick auf Berechnungsmethoden, aktuelle Modelle und Modellgleichungen aus wissenschaftlicher Sicht. (orig.)

  4. Caracterización del alergeno principal de soja Gly m Bd 30K como proteína de reactividad cruzada con caseínas bovinas y su potencial aplicación en inmunoterapias


    Candreva, Ángela María


    El objetivo general de este trabajo de tesis fue desarrollar diferentes metodologías que permitan explicar las bases moleculares de las alergias alimentarias a proteínas de leche de vaca y a soja e identificar potenciales proteínas de reactividad cruzada entre ambos sistemas, con el fin último de aplicar estos nuevos conocimientos para el desarrollo de técnicas de inmunointervención destinadas a establecer tolerancia oral a leche de vaca. Los objetivos particulares fueron:  Empleando t...

  5. The BdV screen of memory and Ciutat d'Asunción boulevard at the Baró de Viver neighborhood (Barcelona: (rethinking citizens' participation in urban design

    Directory of Open Access Journals (Sweden)

    Tomeu Vidal


    Full Text Available We present a case of citizen participation to design some public spaces in Baró de Viver, a neighbourhood of the city of Barcelona. Our aim is to reflect on the ways to understand citizen participation in political and academic agenda, the role of different actors (citizens, professionals, politicians... and strategies and methods used in participatory urban planning. The experience showed in this paper is located in a scale of urban design very close and well known to the people. We begin with a brief historical overview of the neighborhood where the project arose. Then we give an account of the stages of the participatory process, showing the main milestones, features and methods. Finally we propose some ideas to rethink the conceptual and methodological aspects of the intervention and urban research in environmental psychology and people-environment studies.

  6. Renewable energy sources. Vol. 5. Strategies and research, energy law and power industry, grids and storage facilities; Erneuerbare Energien. Bd. 5. Strategien und Forschung, Energierecht und -wirtschaft, Netze und Speicher

    Energy Technology Data Exchange (ETDEWEB)

    Thome-Kozmiensky, Karl J.; Beckmann, Michael


    The book presents the key goals and challenges of supranational and national plans for the promotion of renewable energy sources. Climate protection aspects of a mix of renewable and conventional energy sources are discussed, and an expert opinion on 100 percent renewable power supply is presented. Further chapters discuss concepts and strategies of the power industry and the German government. Trends and perspectives of renewable energy sources are outlined from the view of science and engineering. All experts agree that renewable energy sources necessitate large-scale modification of the power supply grids. Demands on power transmission systems for power from renewables are presented, and legal aspects are discussed as well. Of the economic factors, the role of exports of German environmental technologies, financial incentives, and the initiation of new projects are gone into. (orig./RHM)

  7. Ecological sanitation and development concept Leipzig/Bitterfeld/Halle/Merseburg. Vol. A 2: Environmental sectors. Oekologisches Sanierungs- und Entwicklungskonzept Leipzig/ Bitterfeld/ Halle/ Merseburg. Bd. A 2: Umweltbereiche; Teilvorhaben Abfall, Teilvorhaben Altlasten, Teilvorhaben Bergbaufolgelasten. Integrales Fallbeispiel Deponie Dessau

    Energy Technology Data Exchange (ETDEWEB)


    This contribution discusses the waste management situation in the region of Leipzig/Bitterfeld/Halle/Merseburg and presents perspectives for the reorganisation of this important sector. The partners decided to take a pragmatic course and to treat domestic and industrial waste as separate fields. (orig.)

  8. Determination and calculation of hazardous incident scenarios in accordance with the 3rd hazardous incident administrative instruction. Vol. 2; Ermittlung und Berechnung von Stoerfallablaufszenarien nach Massgabe der 3. Stoerfallverwaltungsvorschrift. Bd. 2: Berechnungsmethoden, aktuelle Modelle und Modellgleichungen

    Energy Technology Data Exchange (ETDEWEB)

    Kaiser, W.; Rogazewski, P.; Schindler, M. [TUeV Anlagentechnik GmbH, Berlin-Schoeneberg (Germany). Unternehmensgruppe TUeV Rheinland/Berlin-Brandenburg; Acikalin, A.; Albrecht, M.; Lambert, M.; Steinbach, J. [Technische Univ. Berlin (Germany)


    At present there are used various of procedures, calculation methods, models and model equations for hazardous incident scenarios. The procedure on principle is varying often. This guideline explains in one main part and six appendixes the methodical procedure to select specifications and assumptions on hazardous incident scenarios and their processing. Hazardous incident scenarios lead to information on emergency preparedness planning. Both general viewpoints and possibilities are shown, how to find necessary basic assumptions on a hazardous incident scenario from information on hazardous substances, on comparable hazardous incidents and on conditions of the site and the plant. Appendixes deal with precise instructions distinguished between substance release, explosion and fire (app. 1: Assessment of source terms, app. 2: Assessment of dispersion, app. 3: Assessment of effects). Appendix 4 gives explanations to appendixes 1, 2 and 3. Appendix 5 contains a collection of 15 examples of hazardous incident scenarios, which illustrate and comment the methodical procedure. Appendix 6 describes and comments software available on German market which assists the calculating of hazardous incidents. Volume 2 determines procedures with regard to methods of calculation, current models and model equations from scientists point of view. (orig.) [German] Derzeit wird eine Vielzahl von Vorgehensweisen, Berechnungsmethoden, Modellen und Modellgleichungen fuer Stoerfallablaufszenarien verwendet. Das prinzipielle Vorgehen ist haeufig unterschiedlich. Dieser Leitfaden enthaelt in einem Hauptteil und sechs Anhaengen das methodische Vorgehen zur Auswahl von Angaben und Annahmen fuer Stoerfallablaufszenarien sowie deren Bearbeitung. Stoerfallablaufszenarien fuehren zu Angaben fuer die Gefahrenabwehrplanung. Fuer das Ableiten von Stoerfallablaufszenarien sind sowohl allgemeine Gesichtspunkte als auch Moeglichkeiten dargelegt, wie man aus Angaben zu Gefahrstoffen, zu vergleichbaren Stoerfaellen sowie zu Bedingungen des Standortes und der Anlage die erforderlichen Grundannahmen zum Stoerfallablauf gewinnen kann. Unterschieden nach Stofffreisetzungen, Explosionen und Braenden wird jeweils auf die konkreteren Hinweise im Anhang 1 zur Abschaetzung von Quelltermen, im Anhang 2 zur Abschaetzung der Ausbreitung und im Anhang 3 zur Abschaetzung der Auswirkungen verwiesen. Der Anhang 4 enthaelt einige Erlaeuterungen zu den Anhaengen 1 bis 3. Mit einer Sammlung von 15 Beispielen fuer Stoerfallablaufszenarien wird im Anhang 5 das im Leitfaden beschriebene methodische Vorgehen veranschaulicht und erlaeutert. Im Anhang 6 werden die auf dem deutschen Markt erhaeltlichen DV-Programme (Software) zur Berechnung von Stoerfallablaufszenarien beschrieben und kommentiert. Der Band 2 untermauert das Vorgehen im Hinblick auf Berechnungsmethoden, aktuelle Modelle und Modellgleichungen aus wissenschaftlicher Sicht. (orig.)

  9. Rezension zu: Emilija Mitrović, Dorothea Müller (Hg.: Sexarbeit – ein Beruf mit Interessensvertretung? Working in the sex industry – Jobs with representation of interests? Marburg: BdWi-Verlag 2009.

    Directory of Open Access Journals (Sweden)

    Wiebke Dierkes


    Full Text Available Der Band versammelt in internationaler Perspektive die sich teils diametral entgegenstehenden Positionen zur Sexarbeit im Allgemeinen sowie zur Frage der gewerkschaftlichen Interessenvertretung im Besonderen und lässt die Brisanz der Diskussion sowohl im feministischen als auch im arbeits(marktpolitischen Diskurs erkennen. Leider bleibt die Debatte in einem grundsätzlichen Für und Wider verhaftet und vernachlässigt die Diskussion und Evaluation konkreter Bemühungen gewerkschaftlicher Organisierungsstrategien in der Sexindustrie. Zu Wort kommen fast ausschließlich Vertreterinnen von Gewerkschaften oder Organisationen, die Sexarbeiter/-innen unterstützen. Nur zwei Beiträge stammen von Sexarbeiterinnen selbst.

  10. Climate protection by reducing the emissions of greenhouse gases in households and the tertiary sector through climate-conscious behaviour. Vol. 1; Klimaschutz durch Minderung von Treibhausgasemissionen im Bereich Haushalte und Kleinverbrauch durch klimagerechtes Verhalten. Bd. 1. Private Haushalte

    Energy Technology Data Exchange (ETDEWEB)

    Brohmann, B.; Cames, M.


    The aim of the project was to identify areas in households and the tertiary sector in which changes in behaviour could result in energy conservation and thus a reduction of greenhouse gas emissions, and to quantify the potentials for 1995, 2005 and 2020. A second focus was on the analysis and evaluation of programmes and instruments to realise the potentials. With literature evaluation, expert interviews, and a household servey potentials and further technical development have been identified. In sum, behavioural measures can contribute to the CO2 reduction by 64 million tons in 1995 in households and 27 in the commercial sector in which the potential decreases to 18 million tons in 2020 due to the autonomous technical development. Adequate promotion programmes can help to realise 20-30% of the potential by 2020. (orig.) [German] Ziel des Vorhabens war, im Sektor private Haushalte und Kleinverbrauch Bereiche zu identifizieren, in denen Verhaltensaenderungen zur Energieeinsparung fuehren koennen, und diese Potenziale fuer 1995, 2005 und 2020 zu quantifizieren. Darauf aufbauend waren Programme und Instrumente zur Umsetzung aufzuzeigen und zu bewerten. Gestuetzt auf Literaturrecherchen und Expertengespraeche wurden Einzelpotenziale, Rahmenbedingungen, Entwicklungstrends in der Technik und im Ausstattungsgrad ermittelt. Insgesamt koennten Verhaltensmassnahmen im Haushaltssektor die CO2-Emissionen im Basisjahr 1995 um 64 Mio, im Kleinverbrauch um 27 Mio t vermindern. Bis 2020 bleibt dieses Potenzial im Haushaltssektor in etwa gleich. Im Kleinverbrauch sinkt es infolge der autonomen Technikentwicklung auf 18 Mio t ab. Durch geeignete Programme koennen bis 2020 etwa 20-30% des Potenzials erreicht werden. (orig.)

  11. Genital and extra-genital screening for gonorrhoea using the BD Probetec ET system with an in-house PCR method targeting the porA pseudogene as confirmatory test

    DEFF Research Database (Denmark)

    Skovgaard, Sissel; Larsen, Helle Kiellberg; Sand, Carsten;


    Diagnosing gonorrhoea from extra-genital as well as genital sites is important in managing this sexually transmitted disease. In this study we evaluated a screening procedure for Neisseria gonorrhoeae (GC) from all sample sites in a low-prevalence setting. A total of 69,252 specimens submitted for...

  12. Scenarios for an integrated sustainability policy - using the example of the ''Sustainable City 2030''. Vol. 1; Szenarien fuer eine integrierte Nachhaltigkeitspolitik - am Beispiel: Die nachhaltige Stadt 2030. Bd. 1. Ueberblick und Fazit

    Energy Technology Data Exchange (ETDEWEB)

    Gassner, Robert [Institut fuer Zukunftsstudien und Technologiebewertung gGmbH (IZT), Berlin (Germany)


    On behalf of the German Federal Environment Agency, this project was supposed to enhance the further development of an integrated sustainability policy in Germany. Focus of the project was the design of sustainable urban living environments, as everyday life related views of for example citizens, consumers, employees, traffic participants etc. can serve as a consistency check for an integrated sustainability policy. Political topics and stakeholders within the German environment department and beyond were analyzed in order to enhance an effective integrated sustainability policy and to identify potential synergies. For this as well as for the resolution of possible trade-offs a systematic and empirically based scenario process has been used. In the introductory empirical and planning phase the fundamentals were elaborated: Desk research, interviews and workshops were conducted to identify political topics and strategic fields, which then were checked for trade-offs and potential cooperations. For this first phase of the project stakeholders, as well as their motivations and underlying expectations for the future were identified. In the main phase of the project two complementary topics (''Recycling City'' and ''Sustainable Economy in the City'') were jointly selected and elaborated in two parallel conducted systematic and participatory scenario processes to generate integrated images of the future in 2030. Furthermore, options for action, strategic elements and potentials for networking were derived and concretized with regard to practical cooperation in the German Department of the Environment.

  13. Comparison of the Denka-Seiken INFLU A·B-Quick and BD Directigen Flu A+B Kits with Direct Fluorescent-Antibody Staining and Shell Vial Culture Methods for Rapid Detection of Influenza Viruses (United States)

    Dunn, James J.; Gordon, Chris; Kelley, Christy; Carroll, Karen C.


    The INFLU A·B-Quick and Directigen Flu A+B enzyme immunoassays were compared with direct immunofluorescence and cell culture for detection of influenza A and B viruses in a total of 255 patient specimens. Both assays identified 23 of 42 influenza A viruses (sensitivity, 54.8%; specificity, 100%; positive predictive value [PPV], 100%; negative predictive value [NPV], 91.8%). The INFLU A·B-Quick assay identified 10 of 16 influenza B viruses (sensitivity, 62.5%; specificity, 99.6%; PPV, 90.9%; NPV, 97.5%), and the Directigen Flu A+B assay detected 9 of 16 influenza B viruses (sensitivity, 56.3%; specificity, 99.6%; PPV, 90%; NPV, 97.1%). PMID:12734274

  14. Refrigeration plant technology by questions and answers. Work and exercise book with tasks and solutions. Vol. 2. Special knowledge. 4. rev. ed.; Kaelteanlagentechnik in Fragen und Antworten. Arbeits- und Uebungsbuch mit Aufgaben und Loesungen. Bd. 2. Fachwissen

    Energy Technology Data Exchange (ETDEWEB)

    Planck, Erhard; Schmidt, Dieter (eds.)


    The qualified refrigeration plant constructor must have an expert theoretical knowledge in many fields, e.g. metal technology, mechanics and flow mechanics, thermo dynamics, process technology, electronics and control technology, chemistry and environmental protection. This book covers the field of refrigeration plant technology (refrigeration technology, electronics and control technology) by questions and answers and is oriented at the educational plan for the apprenticeship as refrigeration plant constructor. Volume 2, special knowledge, covers the themes: (1) Coolant cycle process in lg p,h diagram; (2) Main components of a refrigeration plant; (3) Other components in coolant cycle processes; (4) Control of refrigeration plants; (5) Assembly, set-up, maintenance and disposal; (5) Safety regulations; (6) Application of refrigeration; (7) Further processes of cold generation; (8) Technical communication; (9) Air conditioning engineering; (10) Regulation of refrigeration; (11) Standardized circuit diagrams.

  15. 27. MPA-Seminar - Safety and reliability in energy technology. Vol. 2: Papers 27-45; 27. MPA-Seminar - Sicherheit und Verfuegbarkeit in der Energietechnik. Bd. 2: Vortraege 27-45

    Energy Technology Data Exchange (ETDEWEB)



    The proceedings of the 27th MPA Seminar on 'Safety and Reliability in Energy Technology' were issued in two volumes. The main topics of the second volume are: 1. Material behaviour in the creep regime; 2. Fracture machanics; 3. Reliability analysis and 4. Failure analysis.

  16. Analysis and comparison. Bd. 1 - Longlife. Report on the analysis of state of technology, administrative and legal procedures, financial situation, demographic needs, similarities and differences in the participating countries Denmark, Germany, Lithuania, Poland and Russia. Formulations and benchmarks

    Energy Technology Data Exchange (ETDEWEB)

    Rueckert, Klaus (ed.)


    Environmental considerations are becoming one of the key features in the design when it comes to constructing modern, sustainable residential buildings. In an effort to streamline procedures and practices, the project Longlife has conducted a comparative review of these among the countries Denmark, Germany, Lithuania, Poland and Russia (associated organizations). The countries involved have shared knowledge and experiences with each other about how their respective building processes operate. These are collated and analysed. There are differences and commonness in the state of technology, administrative and legal procedures, financial situation, demographic needs, and how a 'housing project' functions. With this exercise Longlife has started to ensure that differences across the Baltic Sea Region will be minimised as regards environmentally-friendly residential constructions. This initial comparative stage covers planning, building permit and tendering procedures, practices for developing and operating housing and construction technologies. The report reflects the currently most applicable features of the participating countries' processes. Longlife project partners work in three competence teams to use the special know how and experiences and to cooperate in the public private partnership composition. The report analyses in the competence team 1 - Engineering and building technology, design standards - the engineering and technology standards in the countries Denmark, Germany, Lithuania, Poland and Russia. The report shows for the competence team 2 - Administration procedures, licensing rules, tendering rules, laws - the comparison and investigations of administration procedures, building permit rules, tendering rules and laws in the participating countries. The report provides for competence team 3 - Economical and financial basis - a general and a specific overview about economical and financial issues, sustainability and quality aspects in the involved countries. This report is basis for the next work package: development of standards, criteria and specifications for a sustainable, resource saving residential building. (orig.)

  17. Sewage and sludge treatment process - additive and process-integrated measures. Vol. 1-3. Preprints; Verfahrenstechnik der Abwasser- und Schlammbehandlung - additive und prozessintegrierte Massnahmen. Bd. 1-3. Preprints

    Energy Technology Data Exchange (ETDEWEB)



    This fourth GVC congress again deals with all aspects of industrial and municipal waste water and sludge treatment; the spectrum ranges from unit operations and segmets of the process line over special treatments of problematic constituents, adapted solutions for measuring and control-technical problems to innovative overall concepts and the operating results of executed plants. Novel programme elements are process-integrated measures for water and waste water treatment aiming to minimize the consumption of the water resource and to recycle it. (orig.) [German] Auch dieser 4. GVC-Abwasser-Kongress behandelt die volle Breite der industriellen und kommunalen Abwasser- und Schlammbehandlung; das Spektrum reicht von den unit operations und Prozessstrecken, ueber die spezielle Behandlung von problematischen Inhaltstoffen, ueber adaptierte messtechnische und regelungstechnische Problemloesungen bis hin zu innovativen Gesamtkonzepten und den Betriebsergebnissen von ausgefuehrten Anlagen. Neu im Programm sind die produktionsintegrierten Massnahmen zur Wasser- und Abwasserbehandlung, die darauf abzielen, die Ressource Wasser zu minimieren und zu recyclieren. (orig.)

  18. DYSMON II. Dynamics in sulphide and methane biotopes of the Baltic Sea and North Sea. Final report. Vol. 1; DYSMON II. Dynamik in Sulfid- und Methanbiotopen der Ost- und Nordsee. Abschlussbericht. Bd. 1

    Energy Technology Data Exchange (ETDEWEB)

    Jeroschewski, P.; Braun, S.; Steuckart, C.; Baars, B.; Bartenwerfer, M. [Rostock Univ. (Germany); Michaelis, W.; Seifert, R.; Hauke, V.; Hefter, J.; Roos, C.; Steiner, U.; Beckmann, S. [Hamburg Univ. (Germany); Imhoff, J.F.; Gocke, K.; Podgorsek, L.; Schneider, A.; Paparoni de Rothe, I.; Piker, L.; Schmaljohann, R. [Kiel Univ. (Germany); Fischer, U.; Rethmeier, J.; Rabenstein, A.; Potthoff, A.; Vogt, C.; Storm, T.; Mikolajczak, A.; Langer, M.; Mueller Wuensch, S.; Stickan, M. [Bremen Univ. (Germany)


    Working from the results of DYSMON I the purpose of the DYSMON II project was to examine the emergence of sulphidic, low-oxygen environments and microorganismic and faunal responses to this. The focus was on determining the resilience of ecologically important organisms after sudden drops in sulphide concentration and tolerance of oxygen deficiency and sulphide. Whereas in DYSMON I samples had largely been taken from natural sites, DYSMON II made use of ecological manipulation experiments (tarpaulin covers) so as to simulate natural covering with algae. A real-life experiment took place at Hiddensee in May 1995 when the effects of a very thick layer of algae were examined. This natural occurrence of an anoxic, sulphidic environment permitted a comparison with the experimentally induced anoxia in the sediments. (orig.) [Deutsch] Das Projekt DYSMON II untersuchte, aufbauend auf den Ergebnissen von DYSMON I, die Entstehung sulfidischer, sauerstoffarmer Lebensbereiche und die darauf folgende Reaktion von Mikroorganismen und Fauna. Schwerpunkte lagen dabei auf der Ermittlung der Resilienz oekologisch wichtiger Organismen nach `Sulfideinbruechen` und auf Untersuchungen zur Toleranz gegenueber Sauerstoffmangel und Sulfid. Waren waehrend DYSMON I ueberwiegend natuerliche Standorte beprobt worden, so konnten waehrend DYSMON II oekologische Manipulationsexperimente (Planenabdeckung) vorgenommen werden, um natuerliche Algenabdeckungen zu simulieren. Als Realexperiment gelang es, im Mai 1995 am Standort Hiddensee die Auswirkung einer sehr dicken Algenschicht zu erfassen. Diese natuerliche Entstehung von anoxischen, sulfidischen Bedingungen erlaubte einen Vergleich mit der experimentell induzierten Anoxie in den Sedimenten. (orig.)

  19. DYSMON II. Dynamics in sulphide and methane biotopes of the Baltic Sea and North Sea. Final report. Vol. 2; DYSMON II. Dynamik in Sulfid- und Methanbiotopen der Ost- und Nordsee. Abschlussbericht. Bd. 2

    Energy Technology Data Exchange (ETDEWEB)

    Arlt, G.; Vopel, K. [Rostock Univ. (Germany); Grieshaber, M.K.; Voelkel, S.; Hauschild, K.; Wohlgemuth, S.; Haas, D.; Jakob, S. [Duesseldorf Univ. (Germany); Theede, H.; Bittkau, C.; Jahn, A. [Kiel Univ. (Germany); Giere, O.; Gamenick, I.; Windoffer, R.; Wetzel, M.; Burmester, C.; Mueller, E.; Wegener, G. [Hamburg Univ. (Germany); Heyer, J.; Berger, U.; Bodenbender, J.; Mueller, S.; Buechsenschuetz, D.; Siemens, J.; Boess, A. [Fraunhofer-Institut fuer Atmosphaerische Umweltforschung (IFU), Garmisch-Partenkirchen (Germany); Schiedek, D.; Arndt, C.; Schmidt, R.; Hahlbeck, E.; Daunys, D.; Kuester, E.; Schwartinski, A. [Rostock Univ., Warnemuende (Germany). Inst. fuer Ostseeforschung


    Working from the results of DYSMON I the purpose of the DYSMON II project was to examine the emergence of sulphidic, low-oxygen environments and microorganismic and faunal responses to this. The focus was on determining the resilience of ecologically important organisms after sudden drops in sulphide concentration and tolerance of oxygen deficiency and sulphide. Whereas in DYSMON I samples had largely been taken from natural sites, DYSMON II made use of ecological manipulation experiments (tarpaulin covers) so as to simulate natural covering with algae. A real-life experiment took place at Hiddensee in May 1995 when the effects of a very thick layer of algae were examined. This natural occurrence of an anoxic, sulphidic environment permitted a comparison with the experimentally induced anoxia in the sediments. (orig.) [Deutsch] Das Projekt DYSMON II untersuchte, aufbauend auf den Ergebnissen von DYSMON I, die Entstehung sulfidischer, sauerstoffarmer Lebensbereiche und die darauf folgende Reaktion von Mikroorganismen und Fauna. Schwerpunkte lagen dabei auf der Ermittlung der Resilienz oekologisch wichtiger Organismen nach `Sulfideinbruechen` und auf Untersuchungen zur Toleranz gegenueber Sauerstoffmangel und Sulfid. Waren waehrend DYSMON I ueberwiegend natuerliche Standorte beprobt worden, so konnten waehrend DYSMON II oekologische Manipulationsexperimente (Planenabdeckung) vorgenommen werden, um natuerliche Algenabdeckungen zu simulieren. Als Realexperiment gelang es, im Mai 1995 am Standort Hiddensee die Auswirkung einer sehr dicken Algenschicht zu erfassen. Diese natuerliche Entstehung von anoxischen, sulfidischen Bedingungen erlaubte einen Vergleich mit der experimentell induzierten Anoxie in den Sedimenten. (orig.)

  20. Fiche pratique: La peche aux mots; Faire parler les BD; Rubrique evenement; Les droits de l'homme (Practical Ideas: Fishing for Words; Making Comic Strips Talk; Events Report; The Rights of Man). (United States)

    Timbal-Doclaux, Louis; And Others


    Four activities for classroom French instruction are described: a board game for children's vocabulary development; a sentence and dialogue construction exercise using comic strips (existing or student-made); a discussion of the treatment of the notion of "event" in different journalistic contexts; and an exercise in debating skills and language.…

  1. Scientific measurement and evaluation programme (WMEP). Phase 3. Vol. 1 and 2. Final report; Wissenschaftliches Mess- und Evaluierungsprogramm (WMEP) zum Breitentest ''250 MW Wind''. Phase 3. Bd. 1 und 2. Abschlussbericht

    Energy Technology Data Exchange (ETDEWEB)

    Doepfer, R.; Durstewitz, M.; Ensslin, C. [and others


    The Federal Ministry for Economics and Technology (BMWi) funds the '250 MW Wind' test programme. This programme is designed to acquire statistically relevant data concerning the practical use of wind energy converters (WEC) in the Federal Republic of Germany. The technological and scientific areas of this supportive measure, the so called 'Wissenschaftliches Mess- und Evaluierungsprogramm' (WMEP - Scientific Measurement and Evaluation Programme), are implemented by the Institut fuer Solar Energieversorgungstechnik (ISET - Institute for Solar Energy Supply Technology) in Kassel. The WMEP acquires performance data concerning all funded WECs for a ten year period. The final report on hand describes the results of the 3rd project phase (01/07/96 - 30/06/00) of the WMEP including four annual reports and a summary of the most important fields of work. In this phase, for the first time all evaluations could be based upon the complete plant stock since all funded projects were represented in the programme. As of 30/06/00, a total of 1,497 wind turbines with an installed capacity of 349.5 MW at approx. 1,100 different locations are under supervision. During the whole project phase a maximum of 1,557 turbines was supervised. The rated power of the turbines ranges from 2.5 kW up to 1.5 MW. Evaluations regarding the economy, the estimated lifetime and long-term reliability as well as the power performance of widely dispersed wind turbine systems could be initiated in this project phase. It should also be mentioned, that the WMEP evaluations do now include all wind turbines operated in Germany. (orig.) [German] Das Bundesministerium fuer Wirtschaft und Technologie (BMWi) foerdert mit dem Breitentest '250 MW Wind' die Einfuehrung der Windenergienutzung in Deutschland. Zur Gewinnung statistisch relevanter Erfahrungswerte aus dem praktischen Einsatz von Windenergieanlagen (WEA) wurde das Institut fuer Solare Energieversorgungstechnik e.V. (ISET), Kassel, mit der begleitenden Durchfuehrung des 'Wissenschaftlichen Mess- und Evaluierungsprogramms' (WMEP) beauftragt. Im Rahmen dieses Programms werden von allen gefoerderten WEA fuer einen Zeitraum von zehn Jahren ausgewaehlte Betriebsdaten und -ergebnisse erfasst und ausgewertet. Der vorliegende Abschlussbericht beschreibt die Ergebnisse der 3. Durchfuehrungsphase (01.07.1996 - 30.06.2000) des WMEP in vier Jahresberichten und einer Zusammenfassung der wichtigsten Arbeitsschwerpunkte. In der dritten Projektphase konnten erstmals Jahresauswertungen mit dem vollstaendigen Anlagenbestand druchgefuehrt werden, da alle bewilligten Projekte ins WMEP aufgenommen werden konnten. Zum 30.06.2000 betraegt der Anlagenbestand 1497 WEA mit einer installierten Nennleistung von insgesamt 349,5 MW, der an ca. 1.100 unterschiedlichen Standorten installiert ist. Insgesamt wurden im WMEP bis zu 1557 WEA messtechnisch begleitet. Das Leistungsspektrum der einzelnen WEA reicht dabei von 2,5 kW bis 1,5 MW. In der Projektphase III des WMEP standen besonders erste Auswertungen zur Wirtschaftlichkeit, zum Langzeitverhalten sowie zum Leistungsbeitrag der Windenergie im Vordergrund. Besonders hervorzuheben sind noch die ebenfalls in dieser Phase begonnenen Auswertungen zur zeitlichen Entwicklung der Windenergienutzung, die nunmehr alle in Deutschland betriebenen WEA umfassen. (orig.)

  2. Looking for a connection between the Am phenomenon and hybrid delta Sct - gamma Dor pulsation: a determination of the fundamental parameters and abundances of HD 114839 and BD +18 4914


    Hareter, M.; L. Fossati; Weiss, W.; Suárez, J. C.; Uytterhoeven, K; Rainer, M.; Poretti, E.


    Delta Sct - gamma Dor hybrids pulsate simultaneously in p- and g-modes, which carry information on the structure of the envelope as well as to the core. Hence they are key objects for investigating A and F type stars with asteroseismic techniques. An important requirement for seismic modeling are small errors in temperature, gravity and chemical composition. Furthermore, we want to investigate the existence of an abundance indicator typical for hybrids, something that is well established for ...

  3. 100eme anniversaire de la théorie de la relativité Une BD romande : Mélanges Einstein (Albert) et l'histoire de la physique

    CERN Multimedia

    Tesnier, Grégory


    2005 has been delcared "Year of Physics" by UNESCO and ONU to celebrate the 100th anniversary of the theory of relativity, elaborated by Einstein (who lived in Bern). To hon. Einstein, an historical comic strip has been published (1 page)

  4. Dictionary of the energy-producing industry. Nuclear and non-nuclear energy sources. Vol. 1. Fachwoerterbuch zur Energiewirtschaft. Nukleare und nichtnukleare Energietraeger. Bd. 1. Deutsch-Englisch/Englisch-Deutsch

    Energy Technology Data Exchange (ETDEWEB)

    Mannhardt, K.H.


    This technical dictionary, compiled in everyday practice, gives an outline of the terminology and phraseology of a modern field of engineering. Users should have some basic knowledge of the English language and also of engineering as well as access to standard-language dictionaries. Core subjects of the dictionary are nuclear power, reactor engineering, fusion technology, solar energy, wind energy, tidal energy, radiation protection, nuclear safety, coal gasification and coal liquefaction, cooperative agreements and managerial problems.

  5. Detecting imipenem resistance in Acinetobacter baumannii by automated systems (BD Phoenix, Microscan WalkAway, Vitek 2); high error rates with Microscan WalkAway


    Ozlu Nagihan; Comert Fusun; Aktas Elif; Kulah Canan; Akyar Isin; Ankarali Handan


    Abstract Background Increasing reports of carbapenem resistant Acinetobacter baumannii infections are of serious concern. Reliable susceptibility testing results remains a critical issue for the clinical outcome. Automated systems are increasingly used for species identification and susceptibility testing. This study was organized to evaluate the accuracies of three widely used automated susceptibility testing methods for testing the imipenem susceptibilities of A. baumannii isolates, by comp...

  6. Environmental survey 1998. Vol. 3: Human biomonitoring. Concentrations of substances in blood and urine of the German population; Umwelt-Survey 1998. Bd. 3: Human-Biomonitoring. Stoffgehalte in Blut und Urin der Bevoelkerung in Deutschland

    Energy Technology Data Exchange (ETDEWEB)

    Becker, K.; Kaus, S.; Krause, C.; Lepom, P.; Schulz, C.; Seiwert, M.; Seifert, B.


    The occurrence of precious metals in the environment is increasing, due primarily to their use in catalytic converters for motor vehicles, and they were therefore integrated into the study programme in 1998. Urine samples of 1080 subjects were analysed for gold, platinum and iridium, resulting in mean concentrations of 46 ng/l, 2.2 ng/l and 0.2 ng/l. The number of dental inlays, crowns and bridge elements has a clear influence on the mean levels of gold and platinum in urine. Road traffic was not found to be a signficant factor. Nicotine and cotinine are common markers for exposure to tobacco smoke. Non-smokers exhibit a mean nicotine level in urine of less than 2 {mu}g/l and a cotinine level of less than 4 {mu}gl. Nicotine and cotinine levels in urine increase as a function of the number of cigarettes smoked per day, reaching values of 1080 {mu}g/l and 2060 {mu}g/l, respectively, when consumption exceeds 20 cigarettes per day. Exposure to environmental tobacco smoke is also reflected by nicotine and cotinine levels in urine. The present report provides representative data for environmentally related health monitoring and reporting at national level. The data serve as the basis for the formulation of reference values characterising the population's internal exposure to environmental contaminants. The report shows trends over time and regional differences in pollution, and identifies exposure pathways. The results of the Environmental Survey serve inter alia to achieve nationally harmonised methodologies for assessment, health-related environmental reporting, and the development and monitoring of prevention, intervention and abatement strategies within the scope of health and environmental policy actions. (orig.)

  7. Sustainable development - theory and practice of environmental consulting. Proceedings of a seminar of Zentrale Informationsstelle Umweltberatung Bayern. Vol. 11; Nachhaltige Entwicklung - Theorie und Praxis fuer die Umweltberatung. Seminarband der Zentralen Informationsstelle Umweltberatung Bayern. Bd. 11

    Energy Technology Data Exchange (ETDEWEB)

    Koller, U.; Behling, G.; Klemmer, A.; Haury, H.J. [comps.


    On 25/26 November, 1997, Zentrale Informationsstelle, Umweltberatung Bayern held its 11th seminar under the title ``Sustainable development - theory and practice of environmental consulting. Subjects related to the Agenda 21 were discussed in lectures and workshops. [Deutsch] Am 25. und 26. November 1997 veranstaltete die Zentrale Informationsstelle, Umweltberatung Bayern ihr elftes Seminar mit dem Thema ``Nachhaltige Entwicklung- Theorie und Praxis fuer die Umweltberatung``. In Fachvortraegen und Workshops wurden Themen zur Agenda 21 behandelt. (ABI)

  8. Global and local - air pollution abatement in the 21st century. Seminar No. 14 of Zentrale Informationsstelle Umweltberatung Bayern; Global und Lokal - Klimaschutz fuer das 21. Jahrhundert. Seminarband der Zentralen Informationsstelle Umweltberatung Bayern. Bd. 14

    Energy Technology Data Exchange (ETDEWEB)

    Koller, U.; Behling, G.; Rauh, K.; Haury, H.J. (comps.)


    Scientists of Germany's major climate research institutes and an expert of the world climate research programme presented current information on climate trends. They informed on the results of international efforts to prevent global warming after the Buenos Aires conference and presented global climate scenarios of the future. Further issues were local air pollution abatement (energy management, thermal insulation), communal air pollution abatement concepts, and state funding in Bavaria and elsewhere. [German] Wissenschaftler aus den bedeutendsten Instituten deutscher Klimaforschung sowie ein Vertreter des Weltklimaforschungsprogramms stellten aktuelle Erkenntnisse zur Entwicklung unseres Klimas vor. Sie informierten ueber Ergebnisse internationaler Klimaschutzpolitik nach der Klimakonferenz in Buenos Aires und praesentierten Szenarien fuer das globale Klima der Zukunft. Sie widmeten sich ausserdem Fragen des lokalen Klimaschutzes unter den Aspekten Energiemanagement, Waermeschutz und diskutierten ueber kommunale Klimaschutzkonzepte sowie Foerdermoeglichkeiten in und ausserhalb Bayerns. (orig.)

  9. Insights into the Hydrocarbon Tolerance of Two Devosia Isolates, D. chinhatensis Strain IPL18T and D. geojensis Strain BD-c194T, via Whole-Genome Sequence Analysis


    Hassan, Yousef I.; Lepp, Dion; Li, Xiu-Zhen; Zhou, Ting


    Hexachlorocyclohexane (HCH) was among the most commonly used pesticides after the Second World War. The extensive use of this hydrocarbon for almost six decades has created a contamination problem on a global scale, and bioremediation methods are being extensively explored. The reported ability of some Devosia species to grow in the presence of appreciable amounts of hydrocarbons (2,000 mg/kg of contaminated soil) is attracting closer attention. Here, we report the de novo genome assembly of ...

  10. Food guide: Constituents, additives, residues. Vol. 1. Fruit, vegetables, cereals, bread, biscuits, cakes and pastries, honey, sweets. 2. rev. ed.; Lebensmittelfuehrer: Inhalte, Zusaetze, Rueckstaende. Bd. 1. Obst, Gemuese, Getreide, Brot, Gebaeck, Knabberartikel, Honig, Suesswaren

    Energy Technology Data Exchange (ETDEWEB)

    Vollmer, G.; Josst, G.; Schenker, D.; Sturm, W.; Vreden, N.


    It is not easy for the consumer to select the right food. Supermarket displays, packaging or an attractive appearance may induce him to buy without reflecting. Food labels often present more problems than they propose to solve. Knowledge about food constituents is the best way to select food. Once the consumer knows what is inside food, and which of these substances are classified substances, it is easier for him to select the best food for his purposes and needs. The book therefore classifies fruit, vegetables, peas and beans potatoes and mushrooms, cereals, cakes and biscuits, sugar, chocolate, sweets, icecream, honey, marmalades, jellies and new foods according to their constituents. This includes nutrients (proteins, carbohydrates, fats, vitamins, minerals, roughage), additives (listed and unlisted), pollutants (natural, environmental and synthetic pollutants). The nature and function of the ingredients are explained in an introductory chapter. Agricultural and chemical production processes are discussed, and the range of products available on the market is listed alphabetically by groups of products or trade classes. Each chapter also contains information and practical household hints. [German] Aus der Fuelle des Lebensmittelangebots das Richtige auszuwaehlen, ist nicht leicht. Die Plazierung in den Regalen der Supermaerkte, die Verpackung oder das aeussere Erscheinungsbild verleiten den Verbraucher oft zu einem unueberlegten Einkauf. Auch die Kennzeichnung von Lebensmitteln gibt haeufig mehr Probleme auf, als dass sie Klarheit schafft. Am verlaesslichsten ist eine Beurteilung von Lebensmitteln anhand ihrer Inhaltsstoffe. Kennt sie der Verbraucher und weiss er, welche davon (nicht) kennzeichnungspflichtig sind, kann er sich leichter orientieren und besser nach seinen Beduerfnissen auswaehlen. In diesem Band werden deshalb Obst, Gemuese und Huelsenfruechte, Kartoffeln und Pilze, Getreide, Backwaren und Knabbererzeugnisse, Zucker, Schokolade, Zuckerwaren, Speiseeis, Honig, Konfituere, andere suesse Brotaufstriche und neuartige Lebensmittel nach ihren Inhaltsstoffen bewertet. Dabei sind die Inhalts- und Naehrstoffe (Eiweiss, Kohlenhydrate, Fette, Vitamine, Mineralstoffe, Ballaststoffe) der jeweiligen Lebensmittel, die (nicht) zugelassenen Zusatzstoffe und die moeglicherweise enthaltenen Schadstoffe (natuerliche Schadstoffe oder umweltbedingte wie Schwermetalle und synthetische wie Pflanzenbehandlungsmittel) angegeben und ihre Bedeutung am Anfang des Buches in einem einfuehrenden Kapitel erlaeutert. Des weiteren gibt der Band Auskunft ueber Anbaumethoden beziehungsweise Herstellungsverfahren sowie ueber das Warensortiment des Handels (eingeteilt nach Warengruppen oder Handelsklassen bzw. alphabetisch geordnet). Informationen und praktische Hinweise fuer den Haushalt runden die einzelnen Kapitel ab. (orig.)

  11. Dicty_cDB: VFC458 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available genes, complete cds. 40 0.53 2 BD061986 |BD061986.1 Antigenic composition and method of detection for Helic...obacter Pylori. 40 0.53 2 BD061673 |BD061673.1 Antigenic composition and method of detection for Helicobacte

  12. Dicty_cDB: CHB226 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available BD183626 |BD183626.1 Material for diagnosing malaria and immune antigen for suppressing growth of plasmodium.... 76 2e-49 8 BD183625 |BD183625.1 Material for diagnosing malaria and immune antigen for suppressing growth of plasmodium

  13. Dicty_cDB: SFA886 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 0 9 BD183626 |BD183626.1 Material for diagnosing malaria and immune antigen for suppressing growth of plasmodium.... 76 2e-56 9 BD183625 |BD183625.1 Material for diagnosing malaria and immune antigen for suppressing growth of plasmodium

  14. Dicty_cDB: VFE233 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 1 BD183626 |BD183626.1 Material for diagnosing malaria and immune antigen for suppressing growth of plasmodium.... 76 6e-61 10 BD183625 |BD183625.1 Material for diagnosing malaria and immune antigen for suppressing growth of plasmodium

  15. Dicty_cDB: SSM734 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available BD183626 |BD183626.1 Material for diagnosing malaria and immune antigen for suppressing growth of plasmodium.... 76 4e-58 9 BD183625 |BD183625.1 Material for diagnosing malaria and immune antigen for suppressing growth of plasmodium

  16. Dicty_cDB: CFG491 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 70 4e-20 3 BD183626 |BD183626.1 Material for diagnosing malaria and immune antigen for suppressing growth of plasmodium.... 58 4e-18 6 BD183625 |BD183625.1 Material for diagnosing malaria and immune antigen for suppressing growth of plasmodium

  17. Dicty_cDB: Contig-U16267-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 8208 ) Adenovirus vector, packaging cell line, compositi... 258 e-160 4 ( BD021940 ) Packaging cell systems ...from Patent WO2004099422. 258 e-160 4 ( BD268238 ) Adenovirus vector, packaging cell line, compositi... 258 ...8 e-159 4 ( BD268211 ) Adenovirus vector, packaging cell line, compositi... 258 e-159 4 ( BD021943 ) Packagi

  18. Dicty_cDB: SFC621 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available -binding proteins from staphylococcus aureus. 40 5e-04 2 BD245131 |BD245131.1 Pol... 40 5e-04 2 AJ005646 |AJ005646.1 Staphylococcus aureus sdrD gene. 40 5e-04 2 BD140512 |BD140512.1 Fibrinogen

  19. Dicty_cDB: AHA238 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 8 5 BD160804 |BD160804.1 Method for identifying and detecting Candida yeast with II type topoisomerase gene ...nce. 38 0.002 16 BD160798 |BD160798.1 Method for identifying and detecting Candid

  20. Dicty_cDB: VSG302 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ZMMBMa0497N13, genomic survey sequence. 46 0.23 1 BD251969 |BD251969.1 Artificial matrix attachment region ...for increasing expression of genes introduced in plant cells. 46 0.23 1 BD251970 |BD251970.1 Artificial matr

  1. Family Functioning, Social Impairment, and Symptoms Among Adolescents with Bipolar Disorder (United States)

    Keenan-Miller, Danielle; Peris, Tara; Axelson, David; Kowatch, Robert A.; Miklowitz, David J.


    Objective: Impaired social functioning is common among youth with bipolar disorder (BD), emerges in multiple settings, and persists over time. However, little is known about factors associated with poor peer and family functioning in the early-onset form of BD. Using a sample of adolescents with BD I or II, we examined which symptoms of BD,…

  2. Memory in Early Onset Bipolar Disorder and Attention-Deficit/Hyperactivity Disorder: Similarities and Differences (United States)

    Udal, Anne H.; Oygarden, Bjorg; Egeland, Jens; Malt, Ulrik F.; Groholt, Berit


    Differentiating between early-onset bipolar disorder (BD) and attention-deficit/hyperactivity disorder (ADHD) can be difficult. Memory problems are commonly reported in BD, and forgetfulness is among the diagnostic criteria for ADHD. We compared children and adolescents with BD (n = 23), ADHD combined type (ADHD-C; n = 26), BD + ADHD-C (n = 15),…

  3. Cannabis involvement in individuals with Bipolar Disorder


    Agrawal, Arpana; Nurnberger, John I.; Lynskey, Michael T.


    In a study of 471 BD cases and 1761 controls, individuals with BD were 6.8 times more likely to report a lifetime history of cannabis use. Rates of DSM-IV cannabis use disorders in those with BD were 29.4% and were independently and significantly associated with increased suicide attempts, experience mixed episodes and disability attributable to BD.

  4. Dicty_cDB: SLA205 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ynthesizing the nucleic acid. 52 3e-11 2 BD083024 |BD083024.1 Method of detecting difference between gene se...083025 |BD083025.1 Method of detecting difference between gene sequences. 52 5e-1...1652.1 Method for synthesizing the nucleic acid. 52 5e-11 2 BD083026 |BD083026.1 Method of detecting diffe...rence between gene sequences. 52 5e-11 2 BD181438 |BD181438.1 Method for synthesizi

  5. Substance Use Disorders and Suicide Attempts in Bipolar Subtypes


    Sublette, M Elizabeth; Carballo, Juan J; Moreno, Carmen; Galfalvy, Hanga C.; Brent, David A.; BIRMAHER, BORIS; Mann, J. John; OQUENDO, MARIA A.


    Bipolar disorder (BD) is associated with high rates of suicide attempt and completion. Substance use disorders (SUD) have been identified as potent risk factors for suicidal behavior in BD. However, little is known concerning differences between BD subtypes with regard to SUD as a risk factor for suicidal behavior. We studied previous suicidal behavior in adults with a major depressive episode in context of BD type I (BD-I; N=96) or BD type II (BD-II; N=42), with and without history of SUD. L...

  6. Caregiving burden and psychological distress among spouses of bipolar patients – comparative analysis of subtype I and II


    Aleksandra Izabela Arciszewska; Marcin Siwek; Dominika Dudek


    Objectives To assess the level of caregiving burden and psychological distress among spouses of bipolar disorder – BD (type I and II) patients. Methods 77 subjects (41 women and 36 men) were enrolled in the study – 44 spouses of bipolar I (BD I) patients and 33 spouses of bipolar II (BD II). The whole group was divided into 4 subgroups: (I) the wives of BD I patients: n=27, (II) the husbands of BD I patients: n=17, (III) the wives of BD II patients: n=14, (IV) the husbands of BD II ...

  7. Dicty_cDB: VSD576 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available delta 5 fatty acid desaturase, complete cds. 1021 0.0 3 BD092935 |BD092935.1 Methods and compositions for sy...nthesis of long chain polyunsaturated fatty acids in plants. 90 4e-47 5 BD082645 |BD082645.1 Methods and composition...82630 |BD082630.1 Methods and compositions for synthesis of long chain poly-unsaturated fatty acids. 90 4e-4

  8. Dicty_cDB: VSC371 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 35 |BD092935.1 Methods and compositions for synthesis of long chain polyunsaturat...ed fatty acids in plants. 658 0.0 1 BD082645 |BD082645.1 Methods and compositions for synthesis of long chai...n polyunsaturated fatty acids. 658 0.0 1 BD082630 |BD082630.1 Methods and compositions for synthesis of long

  9. Widespread presence of the pathogenic fungus Batrachochytrium dendrobatidis in wild amphibian communities in Madagascar


    Bletz, Molly C.; Rosa, Gonçalo M.; Andreone, Franco; Elodie A. Courtois; Schmeller, Dirk S; Nirhy H C Rabibisoa; Rabemananjara, Falitiana C. E.; Raharivololoniaina, Liliane; Vences, Miguel; Weldon, Ché; Edmonds, Devin; Raxworthy, Christopher J.; Harris, Reid N.; Fisher, Matthew C; Crottini,Angelica


    Amphibian chytridiomycosis, an emerging infectious disease caused by the fungus Batrachochytrium dendrobatidis (Bd), has been a significant driver of amphibian declines. While globally widespread, Bd had not yet been reported from within Madagascar. We document surveys conducted across the country between 2005 and 2014, showing Bd's first record in 2010. Subsequently, Bd was detected in multiple areas, with prevalence reaching up to 100%. Detection of Bd appears to be associated with mid to h...

  10. Birth prevalence of selected external structural birth defects at four hospitals in Dar es Salaam, Tanzania, 2011–2012


    Rogath Kishimba; Rose Mpembeni; Mghamba, Janneth M; David Goodman; Diana Valencia


    Background 94% of all birth defects (BD) and 95% of deaths due to the BD occur in low and middle income countries, many of which are preventable. In Tanzania, there is currently a paucity of BD data necessary to develop data informed prevention activities. Methods A cross-sectional analysis was conducted of deliveries identified with BD in the labor ward registers at four Dar es Salaam hospitals between October, 2011 and February, 2012. The birth prevalence of structural BD, case fatality pro...

  11. Neurocognitive profiles in treatment-resistant bipolar I and bipolar II disorder depression


    Kessler, Ute; Schøyen, Helle Kristine; Andreassen, Ole Andreas; Eide, Geir Egil; Hammar, Åsa; MALT, ULRIK F; Ødegaard, Ketil Joachim; Morken, Gunnar; Sundet, Kjetil; Vaaler, Arne E


    Background: The literature on the neuropsychological profiles in Bipolar disorder (BD) depression is sparse. The aims of the study were to assess the neurocognitive profiles in treatment-resistant, acutely admitted BD depression inpatients, to compare the neurocognitive functioning in patients with BD I and II, and to identify the demographic and clinical illness characteristics associated with cognitive functioning.Methods: Acutely admitted BD I (n = 19) and BD II (n = 32) inp...

  12. Effect of probiotic and prebiotic inclusion in weaned piglet diets on structure and ultra-structure of small intestine


    Fábio Enrique Lemos Budiño; Maria Cristina Thomaz; Rodolfo Nascimento Kronka; Laura Satiko Okada Nakaghi; Fernanda Marcussi Tucci; Alessandro Luís Fraga; Antônio João Scandolera; Rizal Alcides Robles Huaynate


    Forty-four piglets weaned were distributed in a complete randomized blocks in factorial scheme. Experimental diets were: T1 = Basal Diet (BD); T2 = BD + Antibiotic; T3 = BD + Probiotic; T4 = BD + Prebiotic; T5 = BD + Symbiotic (T3+T4). As control, four piglets were slaughtered at weaning. Seven and 14 days after weaning, four animals per treatment were slaughtered. Small intestine segments were sampled from each animal for electron and light microscopy evaluation. The evaluated micro-ingredie...

  13. Sleep disturbances in pediatric bipolar disorder: A comparison between Bipolar I and Bipolar NOS

    Directory of Open Access Journals (Sweden)



    Full Text Available Introduction: The diagnosis of Bipolar Disorder (BD in youths has been controversial, especially for the subtype BD Not Otherwise Specified (BD-NOS. In spite of growing evidence that sleep is a core feature of BD, few studies characterize and compare sleep disturbances in youth with BD type I (BD-I and BD-NOS. Sleep disturbances are frequently reported in clinical descriptions of children and adolescents with BD, however the reporting of the frequency and characteristics of sleep symptoms in youth with BD NOS and BD I during episodes remain poor. This study compares symptom of sleep disturbance as occurring in manic and depressive episodes in BD I and BD NOS youth using KSADS-PL interview data. The study also addresses whether symptoms of sleep disturbance vary in different age groups. Material and Methods: The sample consisted of 70 children and adolescent outpatients at an urban specialty clinic (42M/28F, 10.8±3.6 years old including 24 BP-I and 46 BP-NOS assessed using K-SADS-PL-parent interview. Results: Sleep disturbances including insomnia and decreased need for sleep were reported by 84.3% of the sample. Enuresis was diagnosed in 27% of sample. There were no significant differences in frequency of sleep symptoms between BD-I and BD-NOS. Regardless of BD subtype, current functioning was negatively correlated with decreased need for sleep but not insomnia, and regardless of BD subtype. Conclusion: The majority of youth with BD presents with sleep symptoms during mood episodes. BD NOS presents with the same proportion of sleep symptoms as BD I in our sample.

  14. Study of positron annihilation in three-dimensional oligoester acrylates polymers

    International Nuclear Information System (INIS)

    Distributions of positron annihilation according to life times in tree-dimensional polymers of oligoester acrylates (OEA) with different degree of crosslinking varying from 0.45 x 1021 to (8-9) x 1021 cm-3 have been measured. The data obtained have been used to study the size, concentration and distribution of free microvolumes in the polymers. Crosslinking gives rise to simultaneous suppression of two long-lived components in the measured distributions of annihilation. The effect is very clearly pronounced at high degrees of crosslinking in polymers on the basis of diacetylene-containing OEA. At a preset degree of crosslinking the influence of polymer composition and intermolecular interaction on the number of microvolumes was observed. 20 refs., 1 tab

  15. Application of synchrotron through-the-substrate microdiffraction to crystals in polished thin sections

    Directory of Open Access Journals (Sweden)

    Jordi Rius


    Full Text Available The synchrotron through-the-substrate X-ray microdiffraction technique (tts-μXRD is extended to the structural study of microvolumes of crystals embedded in polished thin sections of compact materials [Rius, Labrador, Crespi, Frontera, Vallcorba & Melgarejo (2011. J.Synchrotron Rad. 18, 891–898]. The resulting tts-μXRD procedure includes some basic steps: (i collection of a limited number of consecutive two-dimensional patterns (frames for each randomly oriented crystal microvolume; (ii refinement of the metric from the one-dimensional diffraction pattern which results from circularly averaging the sum of collected frames; (iii determination of the reciprocal lattice orientation of each randomly oriented crystal microvolume which allows assigning the hkl indices to the spots and, consequently, merging the intensities of the different frames into a single-crystal data set (frame merging; and (iv merging of the individual crystal data sets (multicrystal merging to produce an extended data set suitable for structure refinement/solution. Its viability for crystal structure solution by Patterson function direct methods (δ recycling and for accurate single-crystal least-squares refinements is demonstrated with some representative examples from petrology in which different glass substrate thicknesses have been employed. The section of the crystal microvolume must be at least of the same order of magnitude as the focus of the beam (15 × 15 µm in the provided examples. Thanks to its versatility and experimental simplicity, this methodology should be useful for disciplines as disparate as petrology, materials science and cultural heritage.

  16. Application of synchrotron through-the-substrate microdiffraction to crystals in polished thin sections. (United States)

    Rius, Jordi; Vallcorba, Oriol; Frontera, Carlos; Peral, Inmaculada; Crespi, Anna; Miravitlles, Carles


    The synchrotron through-the-substrate X-ray microdiffraction technique (tts-μXRD) is extended to the structural study of microvolumes of crystals embedded in polished thin sections of compact materials [Rius, Labrador, Crespi, Frontera, Vallcorba & Melgarejo (2011 ▸). J.Synchrotron Rad. 18, 891-898]. The resulting tts-μXRD procedure includes some basic steps: (i) collection of a limited number of consecutive two-dimensional patterns (frames) for each randomly oriented crystal microvolume; (ii) refinement of the metric from the one-dimensional diffraction pattern which results from circularly averaging the sum of collected frames; (iii) determination of the reciprocal lattice orientation of each randomly oriented crystal microvolume which allows assigning the hkl indices to the spots and, consequently, merging the intensities of the different frames into a single-crystal data set (frame merging); and (iv) merging of the individual crystal data sets (multicrystal merging) to produce an extended data set suitable for structure refinement/solution. Its viability for crystal structure solution by Patterson function direct methods (δ recycling) and for accurate single-crystal least-squares refinements is demonstrated with some representative examples from petrology in which different glass substrate thicknesses have been employed. The section of the crystal microvolume must be at least of the same order of magnitude as the focus of the beam (15 × 15 µm in the provided examples). Thanks to its versatility and experimental simplicity, this method-ology should be useful for disciplines as disparate as petrology, materials science and cultural heritage. PMID:26175904

  17. Performance Studies on the Transmitted Light Drop Analyser

    International Nuclear Information System (INIS)

    The testing of a new microvolume spectrometer instrument, the Transmitted Light Drop Analyser (TLDA) is based on drop physics. The advantages, benefits and features of this spectroscopic accessory are elucidated for the first time. The performance of the instrument with regard to drop evaporation, carry-over, calibration standards, photometric accuracy and photometric reproducibility are presented. The paper ends with a brief discussion on the practical significance of the test programme taken as a whole.

  18. Micromechanical characterization of small volumes by means of nanoindentation


    Cuadrado Lafoz, Núria


    Mechanical characterization of micro-volume systems, as thin films or micro-sized phases embedded in multiphase materials, has attracted special interest in the last decades since different micromechanical techniques have been developed to characterize microdevices and materials at the micro and nano scale and it has become apparent that mechanical properties may depend on the analysis scale. An example is the way a crack grows in a bulk material that is likely to be different from crack ...

  19. The use of the Clock Drawing Test in bipolar disorder with or without dementia of Alzheimer’s type

    Directory of Open Access Journals (Sweden)

    Ivan Aprahamian


    Full Text Available There is limited data regarding the cognitive profile from screening tests of older adults with bipolar disorder (BD with dementia. Objective To investigate the Clock Drawing Test (CDT among older adults with BD with and without Alzheimer’s disease (AD. Method 209 older adults (79 with BD without dementia and 70 controls; 60 with AD, being 27 with BD were included to evaluate the performance of three CDT scoring scales, beyond the Mini-Mental State Examination (MMSE and verbal fluency (VFT. Results Patients with BD without dementia presented with lower scores in MMSE, VF and one CDT scoring scale than controls. Patients with BD and AD presented with lower scores in VF and CDT scoring scales than patients with only AD. All CDT scales presented similar sensitivity and specificity for BD and non-BD groups. Conclusion Elderly subjects with BD showed greater impairment in CDT in both groups of normal cognition and AD.

  20. Relationship Between Breast Density and Selective Estrogen-Receptor Modulators, Aromatase Inhibitors, Physical Activity, and Diet: A Systematic Review. (United States)

    Ekpo, Ernest U; Brennan, Patrick C; Mello-Thoms, Claudia; McEntee, Mark F


    Background Lower breast density (BD) is associated with lower risk of breast cancer and may serve as a biomarker for the efficacy of chemopreventive strategies. This review explores parameters that are thought to be associated with lower BD. We conducted a systematic review of articles published to date using the PRISMA strategy. Articles that assessed change in BD with estrogen-receptor modulators (tamoxifene [TAM], raloxifene [RLX], and tibolone) and aromatase inhibitors (AIs), as well as cross-sectional and longitudinal studies (LSs) that assessed association between BD and physical activity (PA) or diet were reviewed. Results Ten studies assessed change in BD with TAM; all reported TAM-mediated BD decreases. Change in BD with RLX was assessed by 11 studies; 3 reported a reduction in BD. Effect of tibolone was assessed by 5 RCTs; only 1 reported change in BD. AI-mediated BD reduction was reported by 3 out of 10 studies. The association between PA and BD was assessed by 21 studies; 4 reported an inverse association. The relationship between diet and BD was assessed in 34 studies. All studies on calcium and vitamin D as well as vegetable intake reported an inverse association with BD in premenopausal women. Two RCTs demonstrated BD reduction with a low-fat, high-carbohydrate intervention. Conclusion TAM induces BD reduction; however, the effect of RLX, tibolone, and AIs on BD is unclear. Although data on association between diet and BD in adulthood are contradictory, intake of vegetables, vitamin D, and calcium appear to be associated with lower BD in premenopausal women. PMID:27130722

  1. Basic characterization of avian β-defensin genes in the Japanese quail, Coturnix japonica. (United States)

    Ishige, Taichiro; Hara, Hiromi; Hirano, Takashi; Mannen, Hideyuki; Kono, Tomohiro; Hanzawa, Kei


    In this study, we identified a cluster of 14 avian β-defensins (AvBD; approximately 66 kbp) in the Japanese quail, Coturnix japonica. Except for AvBD12 (CjAvBD12) and -13, the CjAvBDs coding sequences exhibited greater than 78.0% similarity to the respective orthologous chicken AvBD genes (GgAvBD). The putative amino acid sequence encoded by each CjAvBD contained six cysteine residues and the GXC (X1-2) motif considered essential for the β-defensin family. Each CjAvBDs also formed a sub-group with the respective orthologous genes of various bird species in a phylogenetic tree analysis. Synteny between the CjAvBD cluster and GgAvBD cluster was confirmed. The CjAvBD cluster was mapped on the long-arm end of chromosome 3 by linkage analysis based on single nucleotide polymorphisms (SNPs) of CjAvBD1 and CjAvBD12 (approximately 46 kbp), as well as GgAvBD cluster. We also confirmed that CjAvBD1, -4, -5, -9, and -10 are transcribed in 20 tissues, including immune and digestive tissues. However, our experimental data indicated that the CjAvBD cluster lacks the AvBD3 and -7 loci, whereas the CjAvBD101α, -101β, and -101θ loci arose from gene duplication of the AvBD6 orthologous locus in the CjAvBD cluster after differentiation between Coturnix - Gallus. PMID:26338292

  2. Effetto della memantina su modelli animali di disturbi dell'umore


    Demontis, Francesca


    AIM: Mood disorders are one of the leading causes of morbidity, disability and premature mortality contributing for about 50% of the non-fatal burden of mental disorders. Bipolar disorder (BD) has a lifetime prevalence of approximately 1.0% for BD-I, 1.1% for BD-II and 2.4% for BD-NOS. Eighty-three percent of BD cases are classified as “seriously severe” and 17.1% as “moderately severe”. Long-term prophylactic treatment of BD aimed at preventing recurrences of the various phases is a le...

  3. Dicty_cDB: Contig-U16474-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available BD178398 ) Novel clock gene promoter. 50 0.052 1 ( BD168833 ) Antibody inhibiting VPLF activity. 50 0.052 1.... 50 0.052 1 ( DD222392 ) Polypeptide having phosphodiesterase activity. 50 ...1 ( BD105348 ) Novel insulin-like growth factor-binding proteins. 50 0.052 1 ( BD102128 ) A polypeptide having a phosphodies...ike protein. 50 0.052 1 ( BD012411 ) Novel genes encoding ADP-ribosylation factors(ARF... 50 0.052 1 ( BD012404 ) Novel genes encodi... = 328 Score = 551 bits (278), Expect = e-157 Identities = 294/302 (97%) Strand = Plus / Plus Query: 17 ctct

  4. Dicty_cDB: VFF269 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available BD082645 |BD082645.1 Methods and compositions for synthesis of long chain polyuns...aturated fatty acids. 1304 0.0 2 BD082630 |BD082630.1 Methods and compositions for synthesis of long chain p...04.12.25 Homology vs DNA Score E Sequences producing significant alignments: (bits) Value N BD092935 |BD092935.1 Methods and composit...ions for synthesis of long chain polyunsaturated fatty acids in plants. 1304 0.0 2

  5. Dicty_cDB: CHB310 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available oideum FadB mRNA for delta 5 fatty acid desaturase, complete cds. 68 9e-18 3 BD092935 |BD092935.1 Methods and composition...acids. 70 3e-17 4 BD082630 |BD082630.1 Methods and compositions for synthesis of long chain poly-unsaturated...s for synthesis of long chain polyunsaturated fatty acids in plants. 70 3e-17 4 BD082645 |BD082645.1 Methods and composi...tions for synthesis of long chain polyunsaturated fatty

  6. Dicty_cDB: SSG614 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ty acid desaturase, complete cds. 113 e-126 13 BD092935 |BD092935.1 Methods and composition...s for synthesis of long chain polyunsaturated fatty acids in plants. 90 1e-54 7 BD082645 |BD082645.1 Methods and compositio...ositions for synthesis of long chain poly-unsaturated fatty acids. 90 1e-54 7 BM161...ns for synthesis of long chain polyunsaturated fatty acids. 90 1e-54 7 BD082630 |BD082630.1 Methods and comp

  7. Dicty_cDB: VSF803 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available for fatty acid desaturase, complete cds. 583 0.0 6 BD092935 |BD092935.1 Methods and compositions for synthe...0 |BD082630.1 Methods and compositions for synthesis of long chain poly-unsaturated fatty acids. 1019 0.0 2 ...sis of long chain polyunsaturated fatty acids in plants. 1019 0.0 2 BD082645 |BD082645.1 Methods and compo...sitions for synthesis of long chain polyunsaturated fatty acids. 1019 0.0 2 BD08263

  8. Heterogeneous occupancy and density estimates of the pathogenic fungus Batrachochytrium dendrobatidis in waters of North America.

    Directory of Open Access Journals (Sweden)

    Tara Chestnut

    Full Text Available Biodiversity losses are occurring worldwide due to a combination of stressors. For example, by one estimate, 40% of amphibian species are vulnerable to extinction, and disease is one threat to amphibian populations. The emerging infectious disease chytridiomycosis, caused by the aquatic fungus Batrachochytrium dendrobatidis (Bd, is a contributor to amphibian declines worldwide. Bd research has focused on the dynamics of the pathogen in its amphibian hosts, with little emphasis on investigating the dynamics of free-living Bd. Therefore, we investigated patterns of Bd occupancy and density in amphibian habitats using occupancy models, powerful tools for estimating site occupancy and detection probability. Occupancy models have been used to investigate diseases where the focus was on pathogen occurrence in the host. We applied occupancy models to investigate free-living Bd in North American surface waters to determine Bd seasonality, relationships between Bd site occupancy and habitat attributes, and probability of detection from water samples as a function of the number of samples, sample volume, and water quality. We also report on the temporal patterns of Bd density from a 4-year case study of a Bd-positive wetland. We provide evidence that Bd occurs in the environment year-round. Bd exhibited temporal and spatial heterogeneity in density, but did not exhibit seasonality in occupancy. Bd was detected in all months, typically at less than 100 zoospores L(-1. The highest density observed was ∼3 million zoospores L(-1. We detected Bd in 47% of sites sampled, but estimated that Bd occupied 61% of sites, highlighting the importance of accounting for imperfect detection. When Bd was present, there was a 95% chance of detecting it with four samples of 600 ml of water or five samples of 60 mL. Our findings provide important baseline information to advance the study of Bd disease ecology, and advance our understanding of amphibian exposure to free

  9. Heterogeneous occupancy and density estimates of the pathogenic fungus Batrachochytrium dendrobatidis in waters of North America (United States)

    Chestnut, Tara E.; Anderson, Chauncey; Popa, Radu; Blaustein, Andrew R.; Voytek, Mary; Olson, Deanna H.; Kirshtein, Julie


    Biodiversity losses are occurring worldwide due to a combination of stressors. For example, by one estimate, 40% of amphibian species are vulnerable to extinction, and disease is one threat to amphibian populations. The emerging infectious disease chytridiomycosis, caused by the aquatic fungus Batrachochytrium dendrobatidis (Bd), is a contributor to amphibian declines worldwide. Bd research has focused on the dynamics of the pathogen in its amphibian hosts, with little emphasis on investigating the dynamics of free-living Bd. Therefore, we investigated patterns of Bd occupancy and density in amphibian habitats using occupancy models, powerful tools for estimating site occupancy and detection probability. Occupancy models have been used to investigate diseases where the focus was on pathogen occurrence in the host. We applied occupancy models to investigate free-living Bd in North American surface waters to determine Bd seasonality, relationships between Bd site occupancy and habitat attributes, and probability of detection from water samples as a function of the number of samples, sample volume, and water quality. We also report on the temporal patterns of Bd density from a 4-year case study of a Bd-positive wetland. We provide evidence that Bd occurs in the environment year-round. Bd exhibited temporal and spatial heterogeneity in density, but did not exhibit seasonality in occupancy. Bd was detected in all months, typically at less than 100 zoospores L−1. The highest density observed was ∼3 million zoospores L−1. We detected Bd in 47% of sites sampled, but estimated that Bd occupied 61% of sites, highlighting the importance of accounting for imperfect detection. When Bd was present, there was a 95% chance of detecting it with four samples of 600 ml of water or five samples of 60 mL. Our findings provide important baseline information to advance the study of Bd disease ecology, and advance our understanding of amphibian exposure to free-living Bd in aquatic

  10. Biodiesel versus diesel exposure: Enhanced pulmonary inflammation, oxidative stress, and differential morphological changes in the mouse lung

    Energy Technology Data Exchange (ETDEWEB)

    Yanamala, Naveena, E-mail: [Pathology and Physiology Research Branch/NIOSH/CDC, Morgantown, WV 26505 (United States); Hatfield, Meghan K., E-mail: [Pathology and Physiology Research Branch/NIOSH/CDC, Morgantown, WV 26505 (United States); Farcas, Mariana T., E-mail: [Pathology and Physiology Research Branch/NIOSH/CDC, Morgantown, WV 26505 (United States); Schwegler-Berry, Diane [Pathology and Physiology Research Branch/NIOSH/CDC, Morgantown, WV 26505 (United States); Hummer, Jon A., E-mail: [Office of Mine Safety and Health Research/NIOSH/CDC, Pittsburgh, PA 15236 (United States); Shurin, Michael R., E-mail: [Department of Pathology, University of Pittsburgh Medical Center, Pittsburgh, PA (United States); Birch, M. Eileen, E-mail: [NIOSH/CDC, 4676 Columbia Parkway, Cincinnati, OH 45226 (United States); Gutkin, Dmitriy W., E-mail: [Department of Pathology, University of Pittsburgh Medical Center, Pittsburgh, PA (United States); Kisin, Elena, E-mail: [Pathology and Physiology Research Branch/NIOSH/CDC, Morgantown, WV 26505 (United States); Kagan, Valerian E., E-mail: [Department of Environmental and Occupational Health, University of Pittsburgh, PA (United States); Bugarski, Aleksandar D., E-mail: [Office of Mine Safety and Health Research/NIOSH/CDC, Pittsburgh, PA 15236 (United States); Shvedova, Anna A., E-mail: [Pathology and Physiology Research Branch/NIOSH/CDC, Morgantown, WV 26505 (United States); Department Physiology and Pharmacology, WVU, Morgantown, WV 26505 (United States)


    The use of biodiesel (BD) or its blends with petroleum diesel (D) is considered to be a viable approach to reduce occupational and environmental exposures to particulate matter (PM). Due to its lower particulate mass emissions compared to D, use of BD is thought to alleviate adverse health effects. Considering BD fuel is mainly composed of unsaturated fatty acids, we hypothesize that BD exhaust particles could induce pronounced adverse outcomes, due to their ability to readily oxidize. The main objective of this study was to compare the effects of particles generated by engine fueled with neat BD and neat petroleum-based D. Biomarkers of tissue damage and inflammation were significantly elevated in lungs of mice exposed to BD particulates. Additionally, BD particulates caused a significant accumulation of oxidatively modified proteins and an increase in 4-hydroxynonenal. The up-regulation of inflammatory cytokines/chemokines/growth factors was higher in lungs upon BD particulate exposure. Histological evaluation of lung sections indicated presence of lymphocytic infiltrate and impaired clearance with prolonged retention of BD particulate in pigment laden macrophages. Taken together, these results clearly indicate that BD exhaust particles could exert more toxic effects compared to D. - Highlights: • Exposure of mice to BDPM caused higher pulmonary toxicity compared to DPM. • Oxidative stress and inflammation were higher in BD vs to D exposed mice. • Inflammatory lymphocyte infiltrates were seen only in lungs of mice exposed to BD. • Ineffective clearance, prolonged PM retention was present only after BD exposure.

  11. Dicty_cDB: AFB731 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available alaria and immune antigen for suppressing growth of plasmodium. 58 4e-19 6 BD1836...26 |BD183626.1 Material for diagnosing malaria and immune antigen for suppressing growth of plasmodium. 58 4

  12. Dicty_cDB: CFJ407 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available laria and immune antigen for suppressing growth of plasmodium. 58 3e-24 7 BD183625 |BD183625.1 Material for ...diagnosing malaria and immune antigen for suppressing growth of plasmodium. 58 3e

  13. Dicty_cDB: CFH624 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available l for diagnosing malaria and immune antigen for suppressing growth of plasmodium.... 58 9e-19 6 BD183626 |BD183626.1 Material for diagnosing malaria and immune antigen for suppressing growth of plasmodium

  14. Dicty_cDB: AFJ620 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available rial for diagnosing malaria and immune antigen for suppressing growth of plasmodium.... 76 2e-56 10 BD183625 |BD183625.1 Material for diagnosing malaria and immune antigen for suppressing growth of plasmodium

  15. Dicty_cDB: SFC877 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available aterial for diagnosing malaria and immune antigen for suppressing growth of plasmodium. 62 2e-17 3 BD183625 ...|BD183625.1 Material for diagnosing malaria and immune antigen for suppressing growth of plasmodium

  16. Dicty_cDB: SFC750 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available for diagnosing malaria and immune antigen for suppressing growth of plasmodium. 76 2e-45 7 BD183625 |BD1836...25.1 Material for diagnosing malaria and immune antigen for suppressing growth of plasmodium

  17. Dicty_cDB: AFI164 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available sing malaria and immune antigen for suppressing growth of plasmodium. 62 1e-29 6 BD183625 |BD183625.1 for diagnosing malaria and immune antigen for suppressing growth of plasmodium

  18. Dicty_cDB: CHC316 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available malaria and immune antigen for suppressing growth of plasmodium. 58 9e-19 6 BD183...625 |BD183625.1 Material for diagnosing malaria and immune antigen for suppressing growth of plasmodium. 58

  19. Dicty_cDB: AFK881 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available gnosing malaria and immune antigen for suppressing growth of plasmodium. 76 4e-57... 10 BD183626 |BD183626.1 Material for diagnosing malaria and immune antigen for suppressing growth of plasmodium

  20. Dicty_cDB: SFB722 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available aria and immune antigen for suppressing growth of plasmodium. 76 1e-62 10 BD183625 |BD183625.1 Material for ...diagnosing malaria and immune antigen for suppressing growth of plasmodium. 76 1e

  1. Dicty_cDB: CHD848 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available osing malaria and immune antigen for suppressing growth of plasmodium. 58 4e-16 5 BD183625 |BD183625.1 Mater...ial for diagnosing malaria and immune antigen for suppressing growth of plasmodium

  2. Dicty_cDB: CFK240 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available for diagnosing malaria and immune antigen for suppressing growth of plasmodium. 5...8 3e-16 5 BD183625 |BD183625.1 Material for diagnosing malaria and immune antigen for suppressing growth of plasmodium

  3. Dicty_cDB: SFC432 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ia and immune antigen for suppressing growth of plasmodium. 76 5e-50 9 BD183625 |...BD183625.1 Material for diagnosing malaria and immune antigen for suppressing growth of plasmodium. 76 5e-50

  4. Dicty_cDB: SFH339 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available mune antigen for suppressing growth of plasmodium. 76 1e-62 10 BD183625 |BD183625.1 Material for diagnosing ...malaria and immune antigen for suppressing growth of plasmodium. 76 1e-62 10 AB02

  5. Dicty_cDB: AFK138 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available diagnosing malaria and immune antigen for suppressing growth of plasmodium. 76 3...e-58 9 BD183625 |BD183625.1 Material for diagnosing malaria and immune antigen for suppressing growth of plasmodium

  6. Dicty_cDB: AFF763 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available diagnosing malaria and immune antigen for suppressing growth of plasmodium. 58 8e...-19 6 BD183625 |BD183625.1 Material for diagnosing malaria and immune antigen for suppressing growth of plasmodium

  7. Dicty_cDB: AFI668 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available igen for suppressing growth of plasmodium. 76 1e-60 10 BD183625 |BD183625.1 Material for diagnosing malaria ...and immune antigen for suppressing growth of plasmodium. 76 1e-60 10 AB026051 |AB

  8. Dicty_cDB: SFJ731 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available g malaria and immune antigen for suppressing growth of plasmodium. 58 7e-19 6 BD1...83625 |BD183625.1 Material for diagnosing malaria and immune antigen for suppressing growth of plasmodium. 5

  9. Dicty_cDB: SFE744 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available and immune antigen for suppressing growth of plasmodium. 76 1e-62 10 BD183625 |BD183625.1 Material for diag...nosing malaria and immune antigen for suppressing growth of plasmodium. 76 1e-62

  10. Trypan blue dye is an effective and inexpensive way to determine the viability of Batrachochytrium dendrobatidis zoospores. (United States)

    McMahon, Taegan A; Rohr, Jason R


    Batrachochytrium dendrobatidis (Bd) has been implicated in hundreds of amphibian declines and is the focus of a vast amount of research. Despite this, there is no reported efficient way to assess Bd viability. Discriminating between live and dead Bd would help determine the dose of live Bd zoospores and whether factors have lethal or sublethal effects on Bd. We tested whether trypan blue, a common stain to discriminate live and dead cells, could be used to assess Bd viability. We show that the proportion of live zoospores (zoospores that excluded the trypan blue dye) matched the proportion of known live zoospores added to cultures. In contrast, all of the zoosporangia stages of Bd stained blue. These results demonstrate that trypan blue can be used to determine the viability of Bd zoospores but not zoosporangia. We recommend using trypan blue to report the number of live zoospores to which hosts are exposed. PMID:24519684

  11. Dicty_cDB: VFC590 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available for gene expression in pichia ciferri and transformation method using the same. ...ciparum glyceraldehyde-3-phosphate dehydrogenase mRNA, complete cds. 78 3e-49 7 BD218177 |BD218177.1 Plasmid

  12. Early Maladaptive Schemas in Bipolar Disorder Patients With and Without Suicide Attempts. (United States)

    Nilsson, Kristine Kahr


    Patients with bipolar disorder (BD) are at an increased risk of attempted and completed suicide. To elucidate the beliefs and assumptions associated with suicidality in BD, the present study compared BD patients with and without a history of suicide attempt in terms of early maladaptive schemas (EMSs). The sample consisted of 49 remitted BD patients who completed the Young Schema Questionnaire-Short Version. Information on suicide attempts was obtained through interviews combined with medical records. Compared with BD patients without suicide attempts, the BD patients with suicide attempts scored significantly higher on 3 EMSs: social isolation, practical incompetence, and entitlement. The findings suggest that specific EMSs may be implicated in suicidal behaviors in BD. These results have implications for the assessment and treatment of suicidality in BD. PMID:26919302

  13. What is bizarre in bizarre delusions? A critical review

    DEFF Research Database (Denmark)

    Cermolacce, Michel René Joseph; Jensen, Lars Meldgaard Sass; Parnas, J


    or incomprehensible. Then, we provide a critical review of contemporary studies on the reliability of BD and their methodological and conceptual limitations. Current approaches have focused intensely on BD's reliability and have defined BD strictly in terms of delusional content--mainly in terms of the physical...... impossibility or the cultural or historical incomprehensibility of the delusional claims. These approaches have neglected formal features of experience that underlie BD and the crucial issue of the nature and validity of BD. In the discussion, we argue that clinical diagnosis of BD cannot be limited...... to delusional contents alone and requires taking into account the subjective side of BD (how altered experience manifests itself) as well as the conditions of intersubjective encounter (how BD are expressed to and experienced by the clinician). The notion of "bizarreness" in schizophrenia is not purely...

  14. HPRT Mutations in Lymphocytes from 1,3-Butadiene-Exposed Workers in China


    Liu, Shengxue; Ao, Lin; Du, Bing; Zhou, Yanhong; Yuan, Jian; Bai, Yang; Zhou, Ziyuan; Cao, Jia


    Background 1,3-Butadiene (BD) is an important industrial chemical and an environmental and occupational pollutant. The carcinogenicity of BD in rodents has been proved, but its carcinogenic and mutagenic molecular mechanism(s) are not fully elucidated in humans. Objectives In the present study, we compared the mutation frequencies and exon deletions of BD-exposed workers with that of control subjects in China to identify the characteristic mutations associated with BD exposure in the human HP...

  15. Dicty_cDB: AFH493 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available AF (Link to library) AFH493 (Link to dictyBase) - G02985 DDB0185150 Contig-U16068-1 AFH493P (Lin ... ingle nucleotide polymorphisms (SNPs) on genes and use ... thereof. 44 3e-07 3 BD365143 |BD365143.1 Newly fou ... ingle nucleotide polymorphisms (SNPs) on genes and use ... thereof. 44 3e-07 3 BD365137 |BD365137.1 Newly fou ...

  16. Dicty_cDB: AFB145 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available AF (Link to library) AFB145 (Link to dictyBase) - - - Contig-U16391-1 AFB145Z (Link to Original ... 451.1 Primer for synthesizing full-length cDNA and use ... thereof. 54 2e-10 3 BD125185 |BD125185.1 Primer fo ... r synthesizing full-length cDNA and use ... thereof. 54 2e-10 3 BD126332 |BD126332.1 Primer fo ...

  17. Dicty_cDB: CHA261 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CH (Link to library) CHA261 (Link to dictyBase) - - - Contig-U11577-1 | Contig-U16068-1 CHA261P ... ingle nucleotide polymorphisms (SNPs) on genes and use ... thereof. 44 4e-07 3 BD365143 |BD365143.1 Newly fou ... ingle nucleotide polymorphisms (SNPs) on genes and use ... thereof. 44 4e-07 3 BD365137 |BD365137.1 Newly fou ...

  18. Dicty_cDB: CFC263 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CF (Link to library) CFC263 (Link to dictyBase) - - - Contig-U16068-1 CFC263P (Link to Original ... ingle nucleotide polymorphisms (SNPs) on genes and use ... thereof. 44 2e-07 3 BD365143 |BD365143.1 Newly fou ... ingle nucleotide polymorphisms (SNPs) on genes and use ... thereof. 44 2e-07 3 BD365137 |BD365137.1 Newly fou ...

  19. Dicty_cDB: CFC364 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CF (Link to library) CFC364 (Link to dictyBase) - - - Contig-U16068-1 CFC364P (Link to Original ... ingle nucleotide polymorphisms (SNPs) on genes and use ... thereof. 44 3e-07 3 BD365143 |BD365143.1 Newly fou ... ingle nucleotide polymorphisms (SNPs) on genes and use ... thereof. 44 3e-07 3 BD365137 |BD365137.1 Newly fou ...

  20. Dicty_cDB: AFB673 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available diagnosing malaria and immune antigen for suppressing growth of plasmodium. 76 4e-61 10 AB026051 |AB026051....r suppressing growth of plasmodium. 76 4e-61 10 BD183625 |BD183625.1 Material for...ans mRNA for enolase. 86 1e-72 11 BD183626 |BD183626.1 Material for diagnosing malaria and immune antigen fo

  1. Dicty_cDB: SFG643 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available se. 86 1e-75 12 BD183626 |BD183626.1 Material for diagnosing malaria and immune antigen for suppressing growth of plasmodium.... 76 2e-60 10 BD183625 |BD183625.1 Material for diagnosing malaria and immune antigen for suppressing growth of plasm...odium. 76 2e-60 10 AB026051 |AB026051.1 Plasmodium falciparum mRNA for enolase, com

  2. Dicty_cDB: AFG235 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available se. 86 2e-65 11 BD183626 |BD183626.1 Material for diagnosing malaria and immune antigen for suppressing growth of plasmodium.... 76 1e-57 9 BD183625 |BD183625.1 Material for diagnosing malaria and immune antigen for suppressing growth of plasmo...dium. 76 1e-57 9 AB026051 |AB026051.1 Plasmodium falcipa

  3. Excessive substance use in bipolar disorder is associated with impaired functioning rather than clinical characteristics, a descriptive study


    Larsson Sara; Berg Akiah O; Ringen Petter A; Andreassen Ole A; Lagerberg Trine V; Agartz Ingrid; Sundet Kjetil; Melle Ingrid


    Abstract Background There is a strong association between bipolar disorder (BD) and substance use disorder (SUD). The clinical and functional correlates of SUD in BD are still unclear and little is known about the role of excessive substance use that does not meet SUD criteria. Thus, the aims of the current study were to investigate lifetime rates of illicit substance use in BD relative to the normal population and if there are differences in clinical and functional features between BD patien...

  4. White matter pathology – an endophenotype for bipolar disorder?


    Borgwardt Stefan; Fusar-Poli Paolo


    Abstract Background Neuroimaging investigations of white matter abnormalities in subjects at genetic risk for bipolar disorders (BD) potentially predating the onset of BD offer several advantages. They are not confounded by the presence of illness duration or previous treatment with medication and may ultimately inform evaluation of risk for subsequent development of BD and subsequent therapeutic intervention. Discussion Although a number of imaging studies in subjects at genetic risk for BD ...

  5. Verbal and Visual Memory Impairments in Bipolar I and II Disorder


    Ha, Tae Hyon; Kim, Ji Sun; Chang, Jae Seung; Oh, Sung Hee; Her, Ju Young; Cho, Hyun Sang; Park, Tae Sung; Shin, Soon Young; Ha, Kyooseob


    Objective To compare verbal and visual memory performances between patients with bipolar I disorder (BD I) and patients with bipolar II disorder (BD II) and to determine whether memory deficits were mediated by impaired organizational strategies. Methods Performances on the Korean-California Verbal Learning Test (K-CVLT) and the Rey-Osterrieth Complex Figure Test (ROCF) in 37 patients with BD I, 46 patients with BD II and 42 healthy subjects were compared. Mediating effects of impaired organi...

  6. Evaluation of Arterial Stiffness in Patients with Behçet's Disease by Using Noninvasive Radiological Methods such as Intima-Media Thickness of the Carotid, Ankle-Brachial Pressure Index, Coronary Artery Calcium Scoring, and Their Relation to Serum Fetuin-A Levels: A Case-Control Study


    Uyar, Belkız; Solak, Aynur; Genç, Berhan; Akyıldız, Muhittin; Şahin, Neslin; UYAR, İhsan Sami; Saklamaz, Ali


    Background Behçet's disease (BD) is a chronic, recurrent inflammatory systemic vasculitis. Evidence for increased atherosclerosis in BD has been observed. The relation between cardiovascular risk factors and increased atherosclerosis in patients with BD is still controversial. Objective We performed this study to evaluate arterial stiffness in patients with BD by using noninvasive radiological methods such as carotid artery intima-media thickness (CIMT), ankle-brachial pressure index (ABPI), ...

  7. Global gene expression profiles for life stages of the deadly amphibian pathogen Batrachochytrium dendrobatidis


    Rosenblum, Erica Bree; Stajich, Jason E.; Maddox, Nicole; Eisen, Michael B


    Amphibians around the world are being threatened by an emerging pathogen, the chytrid fungus Batrachochytrium dendrobatidis (Bd). Despite intensive ecological study in the decade since Bd was discovered, little is known about the mechanism by which Bd kills frogs. Here, we compare patterns of global gene expression in controlled laboratory conditions for the two phases of the life cycle of Bd: the free-living zoospore and the substrate-embedded sporangia. We find zoospores to be transcription...

  8. Germ Tube Mediated Invasion of Batrachochytrium dendrobatidis in Amphibian Skin Is Host Dependent


    Van Rooij, Pascale; Martel, An; D'Herde, Katharina; Brutyn, Melanie; Croubels, Siska; Ducatelle, Richard; Haesebrouck, Freddy; Pasmans, Frank


    Batrachochytrium dendrobatidis (Bd) is the causative agent of chytridiomycosis, a fungal skin disease in amphibians and driver of worldwide amphibian declines. We focussed on the early stages of infection by Bd in 3 amphibian species with a differential susceptibility to chytridiomycosis. Skin explants of Alytes muletensis, Litoria caerulea and Xenopus leavis were exposed to Bd in an Ussing chamber for 3 to 5 days. Early interactions of Bd with amphibian skin were observed using light microsc...

  9. The genetic association between personality and major depression or bipolar disorder. A polygenic score analysis using genome-wide association data


    Middeldorp, C M; Moor, M.H.M.; McGrath, L M; Gordon, S.D.; Blackwood, D H; Costa, P.T.; Terracciano, A; Krueger, R.F.; de Geus, E J C; Nyholt, D. R.; Tanaka, T.; T. Esko; Madden, P A F; Derringer, J; Amin, N.


    The relationship between major depressive disorder (MDD) and bipolar disorder (BD) remains controversial. Previous research has reported differences and similarities in risk factors for MDD and BD, such as predisposing personality traits. For example, high neuroticism is related to both disorders, whereas openness to experience is specific for BD. This study examined the genetic association between personality and MDD and BD by applying polygenic scores for neuroticism, extraversion, openness...

  10. Dicty_cDB: SSH467 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSH467 (Link to dictyBase) - - - Contig-U11117-1 | Contig-U12627-1 SSH467P ... ow=J, DNA sequence. 46 0.68 1 BD265981 |BD265981.1 Schizophrenia ... associated genes, proteins and biallelic markers. ... 40 0.80 2 BD265980 |BD265980.1 Schizophrenia ... associated genes, proteins and biallelic markers. ...

  11. A Comparative Metabolomic Evaluation of Behcet’s Disease with Arthritis and Seronegative Arthritis Using Synovial Fluid


    Joong Kyong Ahn; Sooah Kim; Jungyeon Kim; Jiwon Hwang; Kyoung Heon Kim; Hoon-Suk Cha


    Behcet's disease (BD) with arthritis is often confused with seronegative arthritis (SNA) because of shared clinical symptoms and the lack of definitive biomarkers for BD. To investigate possible metabolic patterns and potential biomarkers of BD with arthritis, metabolomic profiling of synovial fluid (SF) from 6 patients with BD with arthritis and 18 patients with SNA was performed using gas chromatography/time-of-flight mass spectrometry in conjunction with univariate and multivariate statist...

  12. Multiple Pigmented Bowen's Disease: A Diagnostic and Therapeutic Dilemma


    Pratik Gahalaut; Madhur Kant Rastogi; Nitin Mishra; Sandhya Chauhan


    Bowens' disease (BD) is a precancerous condition of skin and/or mucosa with a predilection towards sun-exposed areas. Extensive literature research failed to reveal any case of multiple pigmented BD in type V Fitzpatrick skin. Multiple BD is a therapeutic challenge with a tendency to recur. Here we present an otherwise healthy Indian male having multiple pigmented lesions of BD on sun-protected sites of the body mimicking malignant melanoma. These lesions were refractory to treatment with dif...

  13. Prebiotic, probiotic and symbiotic as alternative to Antibiotics on the Performance and Immune Response of Broiler Chickens


    VDA Murarolli; MFC Burbarelli; GV Polycarpo; PAP Ribeiro; MEG Moro; R de Albuquerque


    This study aimed to evaluate diets supplemented with prebiotic, probiotic and symbiotic as an alternative to antibiotics on the performance and immune response against the virus of Newcastle disease in broiler chickens. 1,400 one-day old male Cobb 500 chicks were raised until 42 days old in a completely randomized design with 2x2+1 factorial scheme with seven replications. The treatments were: diet without supplementation (base diet - BD), BD + prebiotic, BD + probiotic, BD + symbiotic (prebi...

  14. Selective DNA Methylation of BDNF Promoter in Bipolar Disorder: Differences Among Patients with BDI and BDII


    D'Addario, Claudio; Dell'Osso, Bernardo; Palazzo, Maria Carlotta; Benatti, Beatrice; Lietti, Licia; Cattaneo, Elisabetta; Galimberti, Daniela; Fenoglio, Chiara; Cortini, Francesca; Scarpini, Elio; Arosio, Beatrice; Di Francesco, Andrea; Di Benedetto, Manuela; Romualdi, Patrizia; Candeletti, Sanzio


    The etiology of bipolar disorder (BD) is still poorly understood, involving genetic and epigenetic mechanisms as well as environmental contributions. This study aimed to investigate the degree of DNA methylation at the promoter region of the brain-derived neurotrophic factor (BDNF) gene, as one of the candidate genes associated with major psychoses, in peripheral blood mononuclear cells isolated from 94 patients with BD (BD I=49, BD II=45) and 52 healthy controls. A significant BDNF gene expr...

  15. The Relationship between Impulsivity and Quality of Life in Euthymic Patients with Bipolar Disorder


    Kim, Yoon-Seok; Cha, Boseok; Lee, Dongyun; Kim, Sun-Mi; Moon, Eunsoo; Park, Chul-Soo; Kim, Bong-Jo; Lee, Cheol-Soon; Lee, Sojin


    Objective Bipolar disorder (BD) is characterized by elevated impulsivity, even during periods of remission. Many recovered BD patients have functional impairments, which can lead to poor quality of life (QoL). The aim of this study was to investigate the association between impulsivity and QoL in euthymic BD patients. Methods A total of 56 remitted or recovered patients with type I or II BD, diagnosed based on Diagnostic and Statistical Manual of Mental Disorders, Fourth Edition (DSM-IV) crit...

  16. Extra dimensions in all aspects of life—the meaning of life with bipolar disorder


    Rusner, Marie; Carlsson, Gunilla; Brunt, David; Nyström, Maria


    Living with Bipolar Disorder (BD) greatly affects the whole life; still the meaning of it is poorly explored from the perspective of the individuals actually living with it. The aim of this study is thus to explore the existential meaning of life with BD. Ten persons, six women and four men, (aged 30–61), diagnosed with BD were interviewed. A reflective lifeworld perspective based on phenomenological philosophy was used. The findings show that living with BD entails experiencing extra dimensi...

  17. Extra dimensions in all aspects of life - the meaning of life with bipolar disorder


    Rusner, Marie; Carlsson, Gunilla; Brunt, David; Nyström, Maria


    Living with Bipolar Disorder (BD) greatly affects the whole life; still the meaning of it is poorly explored from the perspective of the individuals actually living with it. The aim of this study is thus to explore the existential meaning of life with BD. Ten persons, six women and four men, (aged 30_61), diagnosed with BD were interviewed. A reflective lifeworld perspective based on phenomenological philosophy was used. The findings show that living with BD entails experiencing extra dimensi...

  18. Delineating ADHD and bipolar disorder:A comparison of clinical profiles in adult women


    Kitsune, Glenn L; Kuntsi, Jonna; Costello, Helen; Frangou, Sophia; Hosang, Georgina M.; McLoughlin, Gráinne; Asherson, Philip


    OBJECTIVE: Overlapping symptoms can make the diagnostic differentiation of attention-deficit/hyperactivity disorder (ADHD) and bipolar disorder (BD) challenging in adults using current clinical assessments. This study sought to determine if current clinical measures delineate ADHD from BD in adults, comparing relative levels of ADHD, BD and emotional lability (EL) symptoms. METHODS: Sixty adult women with ADHD, BD or controls were compared on self-report and interview measures for ADHD sy...

  19. Spatiotemporal pattern of bacillary dysentery in China from 1990 to 2009: what is the driver behind?

    Directory of Open Access Journals (Sweden)

    Zhiwei Xu

    Full Text Available Little is known about the spatiotemporal pattern of bacillary dysentery (BD in China. This study assessed the geographic distribution and seasonality of BD in China over the past two decades.Data on monthly BD cases in 31 provinces of China from January 1990 to December 2009 obtained from Chinese Center for Disease Control and Prevention, and data on demographic and geographic factors, as well as climatic factors, were compiled. The spatial distributions of BD in the four periods across different provinces were mapped, and heat maps were created to present the seasonality of BD by geography. A cosinor function combined with Poisson regression was used to quantify the seasonal parameters of BD, and a regression analysis was conducted to identify the potential drivers of morbidity and seasonality of BD.Although most regions of China have experienced considerable declines in BD morbidity over the past two decades, Beijing and Ningxia still had high BD morbidity in 2009. BD morbidity decreased more slowly in North-west China than other regions. BD in China mainly peaked from July to September, with heterogeneity in peak time between regions. Relative humidity was associated with BD morbidity and peak time, and latitude was the major predictor of BD amplitude.The transmission of BD was heterogeneous in China. Improved sanitation and hygiene in North-west China, and better access to clean water and food in the big floating population in some metropolises could be the focus of future preventive interventions against BD. BD control efforts should put more emphasis on those dry areas in summer.

  20. Dicty_cDB: VSH813 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available EP1598422. 1178 0.0 3 ( BD092935 ) Methods and compositions for synthesis of long ch... 1178 0.0 3 ( BD082645 ) Methods and compositi...ons for synthesis of long ch... 1178 0.0 3 ( BD082630 ) Methods and composition