WorldWideScience

Sample records for bd imagn microvolume

  1. Element isotope composition definition in solid microvolumes

    International Nuclear Information System (INIS)

    Kaviladze, M.Sh.; Melashvili, T.A.; Kviriya, M.S.

    1977-01-01

    A method for the mass-spectrometric isotopic analysis of solid microvolumes is described which allows to obtain both high analysis localization and high accuracy of the results. The underlying idea is that a laser beam is used to transfer the sample layer-wise onto the evaporator film directly in the ion source. To effect this mass-spectrometric analysis an apparatus has been developed comprising a mass-spectrometer, a ruby laser, a feedback circuit from the amplifier of the ion current of a more common isotope and a replaceable-vaporizer ion source. The composition of each microvolume having a mass about 10 -13 g. is measured in relation to the model specimen, whereby a relative measurement accuracy of about 0.1% is achieved

  2. Microvolume protein concentration determination using the NanoDrop 2000c spectrophotometer.

    Science.gov (United States)

    Desjardins, Philippe; Hansen, Joel B; Allen, Michael

    2009-11-04

    Traditional spectrophotometry requires placing samples into cuvettes or capillaries. This is often impractical due to the limited sample volumes often used for protein analysis. The Thermo Scientific NanoDrop 2000c Spectrophotometer solves this issue with an innovative sample retention system that holds microvolume samples between two measurement surfaces using the surface tension properties of liquids, enabling the quantification of samples in volumes as low as 0.5-2 microL. The elimination of cuvettes or capillaries allows real time changes in path length, which reduces the measurement time while greatly increasing the dynamic range of protein concentrations that can be measured. The need for dilutions is also eliminated, and preparations for sample quantification are relatively easy as the measurement surfaces can be simply wiped with laboratory wipe. This video article presents modifications to traditional protein concentration determination methods for quantification of microvolume amounts of protein using A280 absorbance readings or the BCA colorimetric assay.

  3. Headspace single-drop microextraction coupled to microvolume UV-vis spectrophotometry for iodine determination

    International Nuclear Information System (INIS)

    Pena-Pereira, Francisco; Lavilla, Isela; Bendicho, Carlos

    2009-01-01

    Headspace single-drop microextraction has been combined with microvolume UV-vis spectrophotometry for iodine determination. Matrix separation and preconcentration of iodide following in situ volatile iodine generation and extraction into a microdrop of N,N'-dimethylformamide is performed. An exhaustive characterization of the microextraction system and the experimental variables affecting iodine generation from iodide was carried out. The procedure employed consisted of exposing 2.5 μL of N,N'-dimethylformamide to the headspace of a 10 mL acidic (H 2 SO 4 2 mol L -1 ) aqueous solution containing 1.7 mol L -1 Na 2 SO 4 for 7 min. Addition of 1 mL of H 2 O 2 1 mol L -1 for in situ iodine generation was performed. The limit of detection was determined as 0.69 μg L -1 . The repeatability, expressed as relative standard deviation, was 4.7% (n = 6). The calibration working range was from 5 to 200 μg L -1 (r 2 = 0.9991). The large preconcentration factor obtained, ca. 623 in only 7 min, compensate for the 10-fold loss in sensitivity caused by the decreased optical path, which results in improved detection limits as compared to spectrophotometric measurements carried out with conventional sample cells. The method was successfully applied to the determination of iodine in water, pharmaceutical and food samples

  4. Cytochrome bd Displays Significant Quinol Peroxidase Activity

    NARCIS (Netherlands)

    Al-attar, S.; Yu, Y.; Pinkse, M.W.H.; Hoeser, Jo; Friedrich, Thorsten; Bald, Dirk; de Vries, S.

    2016-01-01

    Cytochrome bd is a prokaryotic terminal oxidase that catalyses the electrogenic reduction of oxygen to water using ubiquinol as electron donor. Cytochrome bd is a tri-haem integral membrane enzyme carrying a low-spin haem b558, and two high-spin haems: b595 and d. Here we

  5. The cytochrome bd respiratory oxygen reductases.

    Science.gov (United States)

    Borisov, Vitaliy B; Gennis, Robert B; Hemp, James; Verkhovsky, Michael I

    2011-11-01

    Cytochrome bd is a respiratory quinol: O₂ oxidoreductase found in many prokaryotes, including a number of pathogens. The main bioenergetic function of the enzyme is the production of a proton motive force by the vectorial charge transfer of protons. The sequences of cytochromes bd are not homologous to those of the other respiratory oxygen reductases, i.e., the heme-copper oxygen reductases or alternative oxidases (AOX). Generally, cytochromes bd are noteworthy for their high affinity for O₂ and resistance to inhibition by cyanide. In E. coli, for example, cytochrome bd (specifically, cytochrome bd-I) is expressed under O₂-limited conditions. Among the members of the bd-family are the so-called cyanide-insensitive quinol oxidases (CIO) which often have a low content of the eponymous heme d but, instead, have heme b in place of heme d in at least a majority of the enzyme population. However, at this point, no sequence motif has been identified to distinguish cytochrome bd (with a stoichiometric complement of heme d) from an enzyme designated as CIO. Members of the bd-family can be subdivided into those which contain either a long or a short hydrophilic connection between transmembrane helices 6 and 7 in subunit I, designated as the Q-loop. However, it is not clear whether there is a functional consequence of this difference. This review summarizes current knowledge on the physiological functions, genetics, structural and catalytic properties of cytochromes bd. Included in this review are descriptions of the intermediates of the catalytic cycle, the proposed site for the reduction of O₂, evidence for a proton channel connecting this active site to the bacterial cytoplasm, and the molecular mechanism by which a membrane potential is generated. 2011 Elsevier B.V. All rights reserved.

  6. BD monomer and elastomer production processes.

    Science.gov (United States)

    Lynch, J

    2001-06-01

    The monomer 1,3 butadiene (BD) is a product of the petrochemical industry. It is used to make several elastomers including the very high volume styrene butadiene rubber (SBR) that comprises the bulk of automobile tires. It is also used to make polybutadiene rubber that is used in parts of tires, coatings, composites and other products. The monomer can be converted to chlorobutadiene (chloroprene) and used to make polychloroprene (neoprene). BD is one of the several olefins created by cracking hydrocarbons in the presence of steam. A mixed C4 stream from the steam cracker is then sent to a BD monomer extraction unit. Modern units typically use dimethyl formamide as the extraction solvent. SBR is commonly made by the copolymerization of BD and styrene, along with various additives to control the reaction, in a water emulsion. The reaction proceeds in a continuous chain of reactors until it is 'shortstopped' by a strong reducing agent. After removing unreacted monomers from the stabilized latex, it is blended, coagulated and dewatered. The resulting dry rubber crumb is bailed, film wrapped and stored in crates. The polymerization of BD to make polybutadiene rubber can be conducted as a water suspension type polymerization similar to SBR or in a solvent system followed by solvent recovery and transfer into water suspension.

  7. Far ultraviolet spectrophotometry of BD +28 4211

    Science.gov (United States)

    Cook, Timothy A.; Cash, Webster; Green, James C.

    1991-01-01

    The results are reported of a November 1989 rocket flight which recorded a flux-calibrated spectrum of BD +28 4211 from 912 to 1150 A with 1A resolution. BD +28 4211, an SdO-type star, is commonly used as an ultraviolet calibration source in the IUE wavelength band. The present work extends the useful range of this standard shortward of Lyman-alpha. Since previous experiments show marked disparity, this study can be useful in determining a standard in the 912 to 1216 A band.

  8. Concentration Determination of Nucleic Acids and Proteins Using the Micro-volume Bio-spec Nano Spectrophotometer

    Science.gov (United States)

    Sukumaran, Suja

    2011-01-01

    Nucleic Acid quantitation procedures have advanced significantly in the last three decades. More and more, molecular biologists require consistent small-volume analysis of nucleic acid samples for their experiments. The BioSpec-nano provides a potential solution to the problems of inaccurate, non-reproducible results, inherent in current DNA quantitation methods, via specialized optics and a sensitive PDA detector. The BioSpec-nano also has automated functionality such that mounting, measurement, and cleaning are done by the instrument, thereby eliminating tedious, repetitive, and inconsistent placement of the fiber optic element and manual cleaning. In this study, data is presented on the quantification of DNA and protein, as well as on measurement reproducibility and accuracy. Automated sample contact and rapid scanning allows measurement in three seconds, resulting in excellent throughput. Data analysis is carried out using the built-in features of the software. The formula used for calculating DNA concentration is: Sample Concentration = DF · (OD260-OD320)· NACF (1) Where DF = sample dilution factor and NACF = nucleic acid concentration factor. The Nucleic Acid concentration factor is set in accordance with the analyte selected1. Protein concentration results can be expressed as μg/ mL or as moles/L by entering e280 and molecular weight values respectively. When residue values for Tyr, Trp and Cysteine (S-S bond) are entered in the e280Calc tab, the extinction coefficient values are calculated as e280 = 5500 x (Trp residues) + 1490 x (Tyr residues) + 125 x (cysteine S-S bond). The e280 value is used by the software for concentration calculation. In addition to concentration determination of nucleic acids and protein, the BioSpec-nano can be used as an ultra micro-volume spectrophotometer for many other analytes or as a standard spectrophotometer using 5 mm pathlength cells. PMID:21372788

  9. Concentration determination of nucleic acids and proteins using the micro-volume BioSpec-nano-spectrophotometer.

    Science.gov (United States)

    Sukumaran, Suja

    2011-02-17

    Nucleic acid quantitation procedures have advanced significantly in the last three decades. More and more, molecular biologists require consistent small-volume analysis of nucleic acid samples for their experiments. The BioSpec-nano provides a potential solution to the problems of inaccurate, non-reproducible results, inherent in current DNA quantitation methods, via specialized optics and a sensitive PDA detector. The BioSpec-nano also has automated functionality such that mounting, measurement, and cleaning are done by the instrument, thereby eliminating tedious, repetitive, and inconsistent placement of the fiber optic element and manual cleaning. In this study, data is presented on the quantification of DNA and protein, as well as on measurement reproducibility and accuracy. Automated sample contact and rapid scanning allows measurement in three seconds, resulting in excellent throughput. Data analysis is carried out using the built-in features of the software. The formula used for calculating DNA concentration is: Sample Concentration = DF · (OD260-OD320)· NACF (1) Where DF = sample dilution factor and NACF = nucleic acid concentration factor. The Nucleic Acid concentration factor is set in accordance with the analyte selected. Protein concentration results can be expressed as μg/mL or as moles/L by entering e280 and molecular weight values respectively. When residue values for Tyr, Trp and Cysteine (S-S bond) are entered in the e280Calc tab, the extinction coefficient values are calculated as e280 = 5500 x (Trp residues) + 1490 x (Tyr residues) + 125 x (cysteine S-S bond). The e280 value is used by the software for concentration calculation. In addition to concentration determination of nucleic acids and protein, the BioSpec-nano can be used as an ultra micro-volume spectrophotometer for many other analytes or as a standard spectrophotometer using 5 mm pathlength cells.

  10. Widespread occurrence of bd in French Guiana, South America.

    Directory of Open Access Journals (Sweden)

    Elodie A Courtois

    Full Text Available The amphibian chytrid fungus Batrachochytrium dendrobatidis (Bd is a purported agent of decline and extinction of many amphibian populations worldwide. Its occurrence remains poorly documented in many tropical regions, including the Guiana Shield, despite the area's high amphibian diversity. We conducted a comprehensive assessment of Bd in French Guiana in order to (1 determine its geographical distribution, (2 test variation of Bd prevalence among species in French Guiana and compare it to earlier reported values in other South American anuran species (http://www.bd-maps.net; 123 species from 15 genera to define sentinel species for future work, (3 track changes in prevalence through time and (4 determine if Bd presence had a negative effect on one selected species. We tested the presence of Bd in 14 species at 11 sites for a total of 1053 samples (306 in 2009 and 747 in 2012. At least one Bd-positive individual was found at eight out of 11 sites, suggesting a wide distribution of Bd in French Guiana. The pathogen was not uniformly distributed among the studied amphibian hosts, with Dendrobatidae species displaying the highest prevalence (12.4% as compared to Bufonidae (2.6 % and Hylidae (1.5%. In contrast to earlier reported values, we found highest prevalence for three Dendrobatidae species and two of them displayed an increase in Bd prevalence from 2009 to 2012. Those three species might be the sentinel species of choice for French Guiana. For Dendrobates tinctorius, of key conservation value in the Guiana Shield, smaller female individuals were more likely to be infected, suggesting either that frogs can outgrow their chytrid infections or that the disease induces developmental stress limiting growth. Generally, our study supports the idea that Bd is more widespread than previously thought and occurs at remote places in the lowland forest of the Guiana shield.

  11. Widespread occurrence of bd in French Guiana, South America.

    Science.gov (United States)

    Courtois, Elodie A; Gaucher, Philippe; Chave, Jérôme; Schmeller, Dirk S

    2015-01-01

    The amphibian chytrid fungus Batrachochytrium dendrobatidis (Bd) is a purported agent of decline and extinction of many amphibian populations worldwide. Its occurrence remains poorly documented in many tropical regions, including the Guiana Shield, despite the area's high amphibian diversity. We conducted a comprehensive assessment of Bd in French Guiana in order to (1) determine its geographical distribution, (2) test variation of Bd prevalence among species in French Guiana and compare it to earlier reported values in other South American anuran species (http://www.bd-maps.net; 123 species from 15 genera) to define sentinel species for future work, (3) track changes in prevalence through time and (4) determine if Bd presence had a negative effect on one selected species. We tested the presence of Bd in 14 species at 11 sites for a total of 1053 samples (306 in 2009 and 747 in 2012). At least one Bd-positive individual was found at eight out of 11 sites, suggesting a wide distribution of Bd in French Guiana. The pathogen was not uniformly distributed among the studied amphibian hosts, with Dendrobatidae species displaying the highest prevalence (12.4%) as compared to Bufonidae (2.6 %) and Hylidae (1.5%). In contrast to earlier reported values, we found highest prevalence for three Dendrobatidae species and two of them displayed an increase in Bd prevalence from 2009 to 2012. Those three species might be the sentinel species of choice for French Guiana. For Dendrobates tinctorius, of key conservation value in the Guiana Shield, smaller female individuals were more likely to be infected, suggesting either that frogs can outgrow their chytrid infections or that the disease induces developmental stress limiting growth. Generally, our study supports the idea that Bd is more widespread than previously thought and occurs at remote places in the lowland forest of the Guiana shield.

  12. Wormhole solution of BD theory in an anisotropic radiation background

    Directory of Open Access Journals (Sweden)

    B. Nasre Esfahani

    2001-06-01

    Full Text Available   Time-dependent wormhole solution of the BD theory in an anisotropic radiation background is presented. It is also found that the BD scalar field depends only on time. This time dependency is in power-law form. It is shown that the wormhole geometry is valid for ω ≥ -3/2, and for any arbitrary positive values of . The GR limit of our solution is obtained for ω=0 , not for ω→∞ . Though the BD field can be non-exotic, the background material is entirely exotic.

  13. On-line micro-volume introduction system developed for lower density than water extraction solvent and dispersive liquid-liquid microextraction coupled with flame atomic absorption spectrometry.

    Science.gov (United States)

    Anthemidis, Aristidis N; Mitani, Constantina; Balkatzopoulou, Paschalia; Tzanavaras, Paraskevas D

    2012-07-06

    A simple and fast preconcentration/separation dispersive liquid-liquid micro extraction (DLLME) method for metal determination based on the use of extraction solvent with lower density than water has been developed. For this purpose a novel micro-volume introduction system was developed enabling the on-line injection of the organic solvent into flame atomic absorption spectrometry (FAAS). The effectiveness and efficiency of the proposed system were demonstrated for lead and copper preconcentration in environmental water samples using di-isobutyl ketone (DBIK) as extraction solvent. Under the optimum conditions the enhancement factor for lead and copper was 187 and 310 respectively. For a sample volume of 10 mL, the detection limit (3 s) and the relative standard deviation were 1.2 μg L(-1) and 3.3% for lead and 0.12 μg L(-1) and 2.9% for copper respectively. The developed method was evaluated by analyzing certified reference material and it was applied successfully to the analysis of environmental water samples. Copyright © 2012 Elsevier B.V. All rights reserved.

  14. Measurement of the B$_{d}^{0}$ meson oscillation frequency

    CERN Document Server

    Acciarri, M; Aguilar-Benítez, M; Ahlen, S P; Alpat, B; Alcaraz, J; Alemanni, G; Allaby, James V; Aloisio, A; Alverson, G; Alviggi, M G; Ambrosi, G; Anderhub, H; Andreev, V P; Angelescu, T; Antreasyan, D; Arefev, A; Azemoon, T; Aziz, T; Bagnaia, P; Baksay, L; Ball, R C; Banerjee, S; Banicz, K; Barillère, R; Barone, L; Bartalini, P; Baschirotto, A; Basile, M; Battiston, R; Bay, A; Becattini, F; Becker, U; Behner, F; Berdugo, J; Berges, P; Bertucci, B; Betev, B L; Biasini, M; Biland, A; Bilei, G M; Blaising, J J; Blyth, S C; Bobbink, Gerjan J; Böck, R K; Böhm, A; Borgia, B; Boucham, A; Bourilkov, D; Bourquin, Maurice; Boutigny, D; Brambilla, Elena; Branson, J G; Brigljevic, V; Brock, I C; Buijs, A; Burger, J D; Burger, W J; Busenitz, J K; Buytenhuijs, A O; Cai, X D; Campanelli, M; Capell, M; Cara Romeo, G; Caria, M; Carlino, G; Cartacci, A M; Casaus, J; Castellini, G; Castello, R; Cavallari, F; Cavallo, N; Cecchi, C; Cerrada-Canales, M; Cesaroni, F; Chamizo-Llatas, M; Chan, A; Chang, Y H; Chaturvedi, U K; Chemarin, M; Chen, A; Chen, G; Chen, G M; Chen, H F; Chen, H S; Chen, M; Chiefari, G; Chien, C Y; Choi, M T; Cifarelli, Luisa; Cindolo, F; Civinini, C; Clare, I; Clare, R; Cohn, H O; Coignet, G; Colijn, A P; Colino, N; Costantini, S; Cotorobai, F; de la Cruz, B; Csilling, Akos; Dai, T S; D'Alessandro, R; De Asmundis, R; De Boeck, H; Degré, A; Deiters, K; Denes, P; De Notaristefani, F; DiBitonto, Daryl; Diemoz, M; Van Dierendonck, D N; Di Lodovico, F; Dionisi, C; Dittmar, Michael; Dominguez, A; Doria, A; Dorne, I; Dova, M T; Drago, E; Duchesneau, D; Duinker, P; Durán, I; Dutta, S; Easo, S; Efremenko, Yu V; El-Mamouni, H; Engler, A; Eppling, F J; Erné, F C; Ernenwein, J P; Extermann, Pierre; Fabre, M; Faccini, R; Falciano, S; Favara, A; Fay, J; Fedin, O; Felcini, Marta; Ferguson, T; Fernández, D; Ferroni, F; Fesefeldt, H S; Fiandrini, E; Field, J H; Filthaut, Frank; Fisher, P H; Forconi, G; Fredj, L; Freudenreich, Klaus; Furetta, C; Galaktionov, Yu; Ganguli, S N; Gau, S S; Gentile, S; Gerald, J; Gheordanescu, N; Giagu, S; Goldfarb, S; Goldstein, J; Gong, Z F; Gougas, Andreas; Gratta, Giorgio; Grünewald, M W; Gupta, V K; Gurtu, A; Gutay, L J; Hangarter, K; Hartmann, B; Hasan, A; Hebbeker, T; Hervé, A; Van Hoek, W C; Hofer, H; Hoorani, H; Hou, S R; Hu, G; Ilyas, M M; Innocente, Vincenzo; Janssen, H; Jin, B N; Jones, L W; de Jong, P; Josa-Mutuberria, I; Kasser, A; Khan, R A; Kamyshkov, Yu A; Kapinos, P; Kapustinsky, J S; Karyotakis, Yu; Kaur, M; Kienzle-Focacci, M N; Kim, D; Kim, J K; Kim, S C; Kim, Y G; Kinnison, W W; Kirkby, A; Kirkby, D; Kirkby, Jasper; Kiss, D; Kittel, E W; Klimentov, A; König, A C; Korolko, I; Koutsenko, V F; Krämer, R W; Kramer, T; Krenz, W; Kuijten, H; Kunin, A; Ladrón de Guevara, P; Landi, G; Lapoint, C; Lassila-Perini, K M; Laurikainen, P; Lebeau, M; Lebedev, A; Lebrun, P; Lecomte, P; Lecoq, P; Le Coultre, P; Lee Jae Sik; Lee, K Y; Leggett, C; Le Goff, J M; Leiste, R; Lenti, M; Leonardi, E; Levchenko, P M; Li Chuan; Lieb, E H; Lin, W T; Linde, Frank L; Lista, L; Liu, Z A; Lohmann, W; Longo, E; Lu, W; Lü, Y S; Lübelsmeyer, K; Luci, C; Luckey, D; Ludovici, L; Luminari, L; Lustermann, W; Ma Wen Gan; Macchiolo, A; Maity, M; Majumder, G; Malgeri, L; Malinin, A; Maña, C; Mangla, S; Marchesini, P A; Marin, A; Martin, J P; Marzano, F; Massaro, G G G; Mazumdar, K; McNally, D; Mele, S; Merola, L; Meschini, M; Metzger, W J; Von der Mey, M; Mi, Y; Mihul, A; Van Mil, A J W; Mirabelli, G; Mnich, J; Monteleoni, B; Moore, R; Morganti, S; Mount, R; Müller, S; Muheim, F; Nagy, E; Nahn, S; Napolitano, M; Nessi-Tedaldi, F; Newman, H; Nippe, A; Nowak, H; Organtini, G; Ostonen, R; Pandoulas, D; Paoletti, S; Paolucci, P; Park, H K; Pascale, G; Passaleva, G; Patricelli, S; Paul, T; Pauluzzi, M; Paus, C; Pauss, Felicitas; Peach, D; Pei, Y J; Pensotti, S; Perret-Gallix, D; Petrak, S; Pevsner, A; Piccolo, D; Pieri, M; Pinto, J C; Piroué, P A; Pistolesi, E; Plyaskin, V; Pohl, M; Pozhidaev, V; Postema, H; Produit, N; Prokofev, D; Prokofiev, D O; Raghavan, R; Rahal-Callot, G; Rancoita, P G; Rattaggi, M; Raven, G; Razis, P A; Read, K; Ren, D; Rescigno, M; Reucroft, S; Van Rhee, T; Riemann, S; Riemers, B C; Riles, K; Rind, O; Ro, S; Robohm, A; Rodin, J; Rodríguez-Calonge, F J; Roe, B P; Röhner, S; Romero, L; Rosier-Lees, S; Rosselet, P; Van Rossum, W; Roth, S; Rubio, Juan Antonio; Rykaczewski, H; Salicio, J; Sánchez, E; Santocchia, A; Sarakinos, M E; Sarkar, S; Sassowsky, M; Sauvage, G; Schäfer, C; Shchegelskii, V; Schmidt-Kärst, S; Schmitz, D; Schmitz, P; Schneegans, M; Schöneich, B; Scholz, N; Schopper, Herwig Franz; Schotanus, D J; Schwenke, J; Schwering, G; Sciacca, C; Sciarrino, D; Sens, Johannes C; Servoli, L; Shevchenko, S; Shivarov, N; Shoutko, V; Shukla, J; Shumilov, E; Shvorob, A V; Siedenburg, T; Son, D; Sopczak, André; Soulimov, V; Smith, B; Spillantini, P; Steuer, M; Stickland, D P; Sticozzi, F; Stone, H; Stoyanov, B; Strässner, A; Strauch, K; Sudhakar, K; Sultanov, G G; Sun, L Z; Susinno, G F; Suter, H; Swain, J D; Tang, X W; Tauscher, Ludwig; Taylor, L; Ting, Samuel C C; Ting, S M; Tonisch, F; Tonutti, M; Tonwar, S C; Tóth, J; Tully, C; Tuchscherer, H; Tung, K L; Ulbricht, J; Uwer, U; Valente, E; Van de Walle, R T; Vesztergombi, G; Vetlitskii, I; Viertel, Gert M; Vivargent, M; Völkert, R; Vogel, H; Vogt, H; Vorobev, I; Vorobyov, A A; Vorvolakos, A; Wadhwa, M; Wallraff, W; Wang, J C; Wang, X L; Wang, Y F; Wang, Z M; Weber, A; Wittgenstein, F; Wu, S X; Wynhoff, S; Xu, J; Xu, Z Z; Yang, B Z; Yang, C G; Yao, X Y; Ye, J B; Yeh, S C; You, J M; Zalite, A; Zalite, Yu; Zemp, P; Zeng, Y; Zhang, Z; Zhang, Z P; Zhou, B; Zhou, Y; Zhu, G Y; Zhu, R Y; Zichichi, Antonino

    1996-01-01

    Time-dependent \\Bd-\\Bbd\\ mixing is studied using 1.5 million hadronic Z decays collected by L3. Semileptonic B decays are selected by requiring at least one reconstructed lepton in both thrust hemispheres. Charge correlations between the tagged leptons are studied as a function of proper time. The proper time of the b-hadron decay is measured by reconstructing the production and decay vertices using a silicon microvertex detector. The measured \\Bd\\ meson oscillation frequency corresponds to a mass difference \\Dmd\\ between the two \\Bd\\ mass eigenstates of \\begin{displaymath} \\Dmd = \\left( 0.496 ^{+ 0.055}_{- 0.051}\\ \\mathrm{(stat)} \\pm{ 0.043}\\ \\mathrm{(syst)} \\right)\\ \\mathrm{ps}^{-1}. \\end{displaymath}

  15. Cytochrome bd from Escherichia coli catalyzes peroxynitrite decomposition.

    Science.gov (United States)

    Borisov, Vitaliy B; Forte, Elena; Siletsky, Sergey A; Sarti, Paolo; Giuffrè, Alessandro

    2015-02-01

    Cytochrome bd is a prokaryotic respiratory quinol oxidase phylogenetically unrelated to heme-copper oxidases, that was found to promote virulence in some bacterial pathogens. Cytochrome bd from Escherichia coli was previously reported to contribute not only to proton motive force generation, but also to bacterial resistance to nitric oxide (NO) and hydrogen peroxide (H2O2). Here, we investigated the interaction of the purified enzyme with peroxynitrite (ONOO(-)), another harmful reactive species produced by the host to kill invading microorganisms. We found that addition of ONOO(-) to cytochrome bd in turnover with ascorbate and N,N,N',N'-tetramethyl-p-phenylenediamine (TMPD) causes the irreversible inhibition of a small (≤15%) protein fraction, due to the NO generated from ONOO(-) and not to ONOO(-) itself. Consistently, addition of ONOO(-) to cells of the E. coli strain GO105/pTK1, expressing cytochrome bd as the only terminal oxidase, caused only a minor (≤5%) irreversible inhibition of O2 consumption, without measurable release of NO. Furthermore, by directly monitoring the kinetics of ONOO(-) decomposition by stopped-flow absorption spectroscopy, it was found that the purified E. coli cytochrome bd in turnover with O2 is able to metabolize ONOO(-) with an apparent turnover rate as high as ~10 mol ONOO(-) (mol enzyme)(-1) s(-1) at 25°C. To the best of our knowledge, this is the first time that the kinetics of ONOO(-) decomposition by a terminal oxidase has been investigated. These results strongly suggest a protective role of cytochrome bd against ONOO(-) damage. Copyright © 2014 Elsevier B.V. All rights reserved.

  16. Cytochrome bd and Gaseous Ligands in Bacterial Physiology.

    Science.gov (United States)

    Forte, Elena; Borisov, Vitaliy B; Vicente, João B; Giuffrè, Alessandro

    2017-01-01

    Cytochrome bd is a unique prokaryotic respiratory terminal oxidase that does not belong to the extensively investigated family of haem-copper oxidases (HCOs). The enzyme catalyses the four-electron reduction of O 2 to 2H 2 O, using quinols as physiological reducing substrates. The reaction is electrogenic and cytochrome bd therefore sustains bacterial energy metabolism by contributing to maintain the transmembrane proton motive force required for ATP synthesis. As compared to HCOs, cytochrome bd displays several distinctive features in terms of (i) metal composition (it lacks Cu and harbours a d-type haem in addition to two haems b), (ii) overall three-dimensional structure, that only recently has been solved, and arrangement of the redox cofactors, (iii) lesser energetic efficiency (it is not a proton pump), (iv) higher O 2 affinity, (v) higher resistance to inhibitors such as cyanide, nitric oxide (NO) and hydrogen sulphide (H 2 S) and (vi) ability to efficiently metabolize potentially toxic reactive oxygen and nitrogen species like hydrogen peroxide (H 2 O 2 ) and peroxynitrite (ONOO - ). Compelling evidence suggests that, beyond its bioenergetic role, cytochrome bd plays multiple functions in bacterial physiology and affords protection against oxidative and nitrosative stress. Relevant to human pathophysiology, thanks to its peculiar properties, the enzyme has been shown to promote virulence in several bacterial pathogens, being currently recognized as a target for the development of new antibiotics. This review aims to give an update on our current understanding of bd-type oxidases with a focus on their reactivity with gaseous ligands and its potential impact on bacterial physiology and human pathophysiology. © 2017 Elsevier Ltd. All rights reserved.

  17. Microvolume turbidimetry for rapid and sensitive determination of the acid labile sulfide fraction in waters after headspace single-drop microextraction with in situ generation of volatile hydrogen sulfide.

    Science.gov (United States)

    Lavilla, I; Pena-Pereira, F; Gil, S; Costas, M; Bendicho, C

    2009-08-04

    In this work, we demonstrate the feasibility of applying headspace single-drop microextraction with in-drop precipitation for the quantitative determination of the acid labile sulfide fraction (H2S, HS-, and S2- (free sulfide), amorphous FeS and some metal sulfide complexes-clusters as ZnS) in aqueous samples by microvolume turbidimetry. The methodology lies in the in situ hydrogen sulfide generation and subsequent sequestration into an alkaline microdrop containing ZnO(2)(2-) and exposed to the headspace above the stirred aqueous sample. The ZnS formed in the drop was then determined by microvolume turbidimetry. The optimum experimental conditions of the proposed method were: 2 microL of a microdrop containing 750 mg L(-1) Zn(II) in 1 mol L(-1) NaOH exposed to the headspace of a 20-mL aqueous sample stirred at 1600 rpm during 80 s after derivatization with 1 mL of 6 mol L(-1) HCl. An enrichment factor of 1710 was achieved in only 80 s. The calibration graph was linear in the range of 5-100 microg L(-1) with a detection limit of 0.5 microg L(-1). The repeatability, expressed as relative standard deviation, was 5.8% (N = 9). Finally, the proposed methodology was successfully applied to the determination of the acid labile sulfide fraction in different natural water samples.

  18. Construction of Eukaryotic Expression Vector with mBD1-mBD3 Fusion Genes and Exploring Its Activity against Influenza A Virus

    Directory of Open Access Journals (Sweden)

    Wanyi Li

    2014-03-01

    Full Text Available Influenza (flu pandemics have exhibited a great threat to human health throughout history. With the emergence of drug-resistant strains of influenza A virus (IAV, it is necessary to look for new agents for treatment and transmission prevention of the flu. Defensins are small (2–6 kDa cationic peptides known for their broad-spectrum antimicrobial activity. Beta-defensins (β-defensins are mainly produced by barrier epithelial cells and play an important role in attacking microbe invasion by epithelium. In this study, we focused on the anti-influenza A virus activity of mouse β-defensin 1 (mBD1 and β defensin-3 (mBD3 by synthesizing their fusion peptide with standard recombinant methods. The eukaryotic expression vectors pcDNA3.1(+/mBD1-mBD3 were constructed successfully by overlap-PCR and transfected into Madin-Darby canine kidney (MDCK cells. The MDCK cells transfected by pcDNA3.1(+/mBD1-mBD3 were obtained by G418 screening, and the mBD1-mBD3 stable expression pattern was confirmed in MDCK cells by RT-PCR and immunofluorescence assay. The acquired stable transfected MDCK cells were infected with IAV (A/PR/8/34, H1N1, 0.1 MOI subsequently and the virus titers in cell culture supernatants were analyzed by TCID50 72 h later. The TCID50 titer of the experimental group was clearly lower than that of the control group (p < 0.001. Furthermore, BALB/C mice were injected with liposome-encapsulated pcDNA3.1(+/mBD1-mBD3 through muscle and then challenged with the A/PR/8/34 virus. Results showed the survival rate of 100% and lung index inhibitory rate of 32.6% in pcDNA3.1(+/mBD1-mBD3group; the TCID50 titer of lung homogenates was clearly lower than that of the control group (p < 0.001. This study demonstrates that mBD1-mBD3 expressed by the recombinant plasmid pcDNA3.1(+/mBD1-mBD3 could inhibit influenza A virus replication both in vitro and in vivo. These observations suggested that the recombinant mBD1-mBD3 might be developed into an agent for

  19. SOA-BD: Service Oriented Architecture for Biomedical Devices

    Directory of Open Access Journals (Sweden)

    João Marcos Teixeira Lacerda

    2017-05-01

    Full Text Available Introduction: The communication of information systems with biomedical devices has become complex not only due to the existence of several private communication protocols, but also to the immutable way that software is embedded into these devices. In this sense, this paper proposes a service-oriented architecture to access biomedical devices as a way to abstract the mechanisms of writing and reading data from these devices, thus contributing to enable the focus of the development team of biomedical software to be intended for its functional requirements, i.e. business rules relevant to the problem domain. Methods The SOA-BD architecture consists of five main components: A Web Service for transport and conversion of the device data, Communication Protocols to access the devices, Data Parsers to preprocess data, a Device Repository to store data and transmitted information and Error handling, for error handling of these information. For the development of SOA-BD, technologies such as the XML language and the Java programming language were used. Besides, Software Engineering concepts such as Design Patterns were also used. For the validation of this work, data has been collected from vital sign monitors in an Intensive Care Unit using HL7 standards. Results The tests obtained a difference of about only 1 second in terms of response time with the use of SOA-BD. Conclusion SOA-BD achieves important results such as the reduction on the access protocol complexity, the opportunity for treating patients over long distances, allowing easier development of monitoring applications and interoperability with biomedical devices from diverse manufacturers.

  20. Trajectory and physical properties of near-Earth asteroid 2009 BD

    NARCIS (Netherlands)

    Chesley, Steven R.; Mommert, Michael; Hora, Joseph L.; Farnocchia, Davide; Trilling, David E.; Vokrouhlický, David; Mueller, Michael; Harris, Alan W; Smith, Howard Alan; Fazio, Giovanni G.

    2014-01-01

    We analyze the trajectory of near-Earth asteroid 2009 BD, which is a candidate target of the NASA Asteroid Robotic Retrieval Mission (ARRM). The small size of 2009 BD and its Earth-like orbit pose challenges to understanding the dynamical properties of 2009 BD. In particular, nongravitational

  1. Trajectory and physical properties of near-Earth asteroid 2009 BD

    NARCIS (Netherlands)

    Farnocchia, D.; Mommert, M.; Hora, J. L.; Chesley, S. R.; Vokrouhlický, D.; Trilling, D. E.; Mueller, M.; Harris, A. W.; Smith, H. A.; Fazio, G. G.; Knežević, Zoran; Lemaitre, Anne

    2014-01-01

    We analyze the trajectory of near-Earth asteroid 2009~BD, which is a candidate target of the NASA Asteroid Redirect Mission. The small size of 2009 BD and its Earth-like orbit pose challenges to understanding the dynamical properties of 2009 BD. In particular, nongravitational perturbations, such as

  2. 78 FR 75511 - Special Conditions: Bombardier Inc., Models BD-500-1A10 and BD-500-1A11 Series Airplanes...

    Science.gov (United States)

    2013-12-12

    ... issue a finding of regulatory adequacy under section 611 of Public Law 92-574, the ``Noise Control Act... Inc., Models BD-500-1A10 and BD- 500-1A11 Series Airplanes; Electronic Flight Control System: Control... design feature associated with control surface awareness and mode annunciation of the electronic flight...

  3. High Production of 2,3-Butanediol (2,3-BD by Raoultella ornithinolytica B6 via Optimizing Fermentation Conditions and Overexpressing 2,3-BD Synthesis Genes.

    Directory of Open Access Journals (Sweden)

    Taeyeon Kim

    Full Text Available Biological production of 2,3-butandiol (2,3-BD has received great attention as an alternative to the petroleum-based 2,3-BD production. In this study, a high production of 2,3-BD in fed-batch fermentation was investigated with a newly isolated bacterium designated as Raoultella ornithinolytica B6. The isolate produced 2,3-BD as the main product using hexoses (glucose, galactose, and fructose, pentose (xylose and disaccharide (sucrose. The effects of temperature, pH-control schemes, and agitation speeds on 2,3-BD production were explored to optimize the fermentation conditions. Notably, cell growth and 2,3-BD production by R. ornithinolytica B6 were higher at 25°C than at 30°C. When three pH control schemes (no pH control, pH control at 7, and pH control at 5.5 after the pH was decreased to 5.5 during fermentation were tested, the best 2,3-BD titer and productivity along with reduced by-product formation were achieved with pH control at 5.5. Among different agitation speeds (300, 400, and 500 rpm, the optimum agitation speed was 400 rpm with 2,3-BD titer of 68.27 g/L, but acetic acid was accumulated up to 23.32 g/L. Further enhancement of the 2,3-BD titer (112.19 g/L, yield (0.38 g/g, and productivity (1.35 g/L/h as well as a significant reduction of acetic acid accumulation (9.71 g/L was achieved by the overexpression of homologous budABC genes, the 2,3-BD-synthesis genes involved in the conversion of pyruvate to 2,3-BD. This is the first report presenting a high 2,3-BD production by R.ornithinolytica which has attracted little attention with respect to 2,3-BD production, extending the microbial spectrum of 2,3-BD producers.

  4. An investigation of Bd0 and Bs0 oscillation

    Science.gov (United States)

    Buskulic, D.; de Bonis, I.; Decamp, D.; Ghez, P.; Goy, C.; Lees, J.-P.; Minard, M.-N.; Odier, P.; Pietrzyk, B.; Ariztizabal, F.; Comas, P.; Crespo, J. M.; Efthymiopoulos, I.; Fernandez, E.; Fernandez-Bosman, M.; Gaitan, V.; Garrido, Ll.; Martinez, M.; Mattison, T.; Orteu, S.; Pacheco, A.; Padilla, C.; Pascual, A.; Creanza, D.; de Palma, M.; Farilla, A.; Iaselli, G.; Maggi, G.; Marinelli, N.; Natali, S.; Nuzzo, S.; Ranieri, A.; Raso, G.; Romano, F.; Ruggieri, F.; Selvaggi, G.; Silvestris, L.; Tempesta, P.; Zito, G.; Chai, Y.; Hu, H.; Huang, D.; Huang, X.; Lin, J.; Wang, T.; Xie, Y.; Xu, D.; Xu, R.; Zhang, J.; Zhang, L.; Zhao, W.; Bonvicini, G.; Boudreau, J.; Casper, D.; Drevermann, H.; Forty, R. W.; Ganis, G.; Gay, C.; Girone, M.; Hagelberg, R.; Harvey, J.; Hilgart, J.; Jacobsen, R.; Jost, B.; Knobloch, J.; Lehraus, I.; Maggi, M.; Markou, C.; Mato, P.; Meinhard, H.; Minten, A.; Miquel, R.; Moser, H.-G.; Palazzi, P.; Pater, J. R.; Perlas, J. A.; Perrodo, P.; Pusztaszeri, J.-F.; Ranjard, F.; Rolandi, L.; Rothberg, J.; Ruan, T.; Saich, M.; Schlatter, D.; Schmelling, M.; Sefkow, F.; Tejessy, W.; Tomalin, I. R.; Veenhof, R.; Wachsmuth, H.; Wasserbaech, S.; Wiedenmann, W.; Wildish, T.; Witzeling, W.; Wotschack, J.; Ajaltouni, Z.; Bardadin-Otwinowska, M.; Barres, A.; Boyer, C.; Falvard, A.; Gay, P.; Guicheney, C.; Henrard, P.; Jousset, J.; Michael, B.; Montret, J.-C.; Pallin, D.; Perret, P.; Podlyski, F.; Proriol, J.; Saadi, F.; Fearnley, T.; Hansen, J. B.; Hansen, J. D.; Hansen, J. R.; Hansen, P. H.; Johnson, S. D.; Møllerud, R.; Nilsson, B. S.; Kyriakis, A.; Simopoulou, E.; Siotis, I.; Vayaki, A.; Zachariadou, K.; Badier, J.; Blondel, A.; Bonneaud, G.; Brient, J. C.; Bourdon, P.; Fouque, G.; Passalacqua, L.; Rougé, A.; Rumpf, M.; Tanaka, R.; Verderi, M.; Videau, H.; Candlin, D. J.; Parsons, M. I.; Veitch, E.; Focardi, E.; Moneta, L.; Parrini, G.; Corden, M.; Delfino, M.; Georgipoulos, C.; Jaffe, D. E.; Levinthal, D.; Antonelli, A.; Bencivenni, G.; Bologna, G.; Bossi, F.; Campana, P.; Capon, G.; Cerutti, F.; Chiarella, V.; Felici, G.; Laurelli, P.; Mannocchi, G.; Murtas, F.; Murtas, G. P.; Pepe-Altarelli, M.; Salomone, S.; Colrain, P.; Ten Have, I.; Knowles, I. G.; Lynch, J. G.; Maitland, W.; Morton, W. T.; Raine, C.; Reeves, P.; Scarr, J. M.; Smith, K.; Smith, M. G.; Thompson, A. S.; Thorn, S.; Turnbull, R. M.; Brandl, B.; Braun, O.; Geweniger, C.; Hanke, P.; Hepp, V.; Kluge, E. E.; Maumary, Y.; Putzer, A.; Rensch, B.; Stahl, A.; Tittel, K.; Wunsch, M.; Beuselinck, R.; Binnie, D. M.; Cameron, W.; Cattaneo, M.; Colling, D. J.; Dornan, P. J.; Hassard, J. F.; Lieske, N. M.; Moutoussi, A.; Nash, J.; Patton, S.; Payne, D. G.; Phillips, M. J.; San Martin, G.; Sedgbeer, J. K.; Wright, A. G.; Girtler, P.; Kuhn, D.; Rudolph, G.; Vogl, R.; Bowdery, C. K.; Brodbeck, T. J.; Finch, A. J.; Foster, F.; Hughes, G.; Jackson, D.; Keemer, N. R.; Nuttall, M.; Patel, A.; Sloan, T.; Snow, S. W.; Whelan, E. P.; Galla, A.; Greene, A. M.; Kleinknecht, K.; Raab, J.; Renk, B.; Sander, H.-G.; Schmidt, H.; Walther, S. M.; Wanke, R.; Wolf, B.; Bencheikh, A. M.; Benchouk, C.; Bonissent, A.; Calvet, D.; Carr, J.; Coyle, P.; Diaconu, C.; Drinkard, J.; Etienne, F.; Nicod, D.; Payre, P.; Roos, L.; Rousseau, D.; Schwemling, P.; Talby, M.; Adlung, S.; Assmann, R.; Bauer, C.; Blum, W.; Brown, D.; Cattaneo, P.; Dehning, B.; Dietl, H.; Dydak, F.; Frank, M.; Halley, A. W.; Jakobs, K.; Lauber, J.; Lütjens, G.; Lutz, G.; Männer, W.; Richter, R.; Schröder, J.; Schwarz, A. S.; Settles, R.; Seywerd, H.; Stierlin, U.; Stiegle, U.; St. Denis, R.; Wolf, G.; Alemany, R.; Boucrot, J.; Callot, O.; Cordier, A.; Davier, M.; Duflot, L.; Grivaz, J.-F.; Heusse, Ph.; Janot, P.; Kim, D. W.; Le Diberder, F.; Lefrançois, J.; Lutz, A.-M.; Musolino, G.; Schune, M.-H.; Veillet, J.-J.; Videau, I.; Abbaneo, D.; Bagliesi, G.; Batignani, G.; Bottigli, U.; Bozzi, C.; Calderini, G.; Carpinelli, M.; Ciocci, M. A.; Ciulli, V.; Dell'Orso, R.; Ferrante, I.; Fidecaro, F.; Foà, L.; Forti, F.; Giassi, A.; Giorgi, M. A.; Gregorio, A.; Ligabue, F.; Lusiani, A.; Mannelli, E. B.; Marrocchesi, P. S.; Messineo, A.; Palla, F.; Rizzo, G.; Sanguinetti, G.; Spagnolo, P.; Steinberger, J.; Tenchini, R.; Tonelli, G.; Triggiani, G.; Valassi, A.; Vannini, C.; Venturi, A.; Verdini, P. G.; Walsh, J.; Betteridge, A. P.; Gao, Y.; Green, M. G.; Johnson, D. L.; March, P. V.; Medcalf, T.; Mir, Ll. M.; Quazi, I. S.; Strong, J. A.; Bertin, V.; Botterill, D. R.; Clifft, R. W.; Edgecock, T. R.; Haywood, S.; Edward, M.; Norton, P. R.; Thompson, J. C.; Bloch-Devaux, B.; Colas, P.; Duarte, H.; Emery, S.; Kozanecki, W.; Lançon, E.; Lemaire, M. C.; Locci, E.; Marx, B.; Perez, P.; Rander, J.; Renardy, J.-F.; Rosowsky, A.; Roussarie, A.; Schuller, J.-P.; Schwindling, J.; Si Mohand, D.; Vallage, B.; Johnson, R. P.; Litke, A. M.; Taylor, G.; Wear, J.; Babbage, W.; Booth, C. N.; Buttar, C.; Cartwright, S.; Combley, F.; Dawson, I.; Thompson, L. F.; Barberio, E.; Böhrer, A.; Brandt, S.; Cowan, G.; Grupen, C.; Lutters, G.; Rivera, F.; Schäfer, U.; Smolik, L.; Bosisio, L.; Della Marina, R.; Giannini, G.; Gobbo, B.; Pitis, L.; Ragusa, F.; Bellantoni, L.; Chen, W.; Chen, W.; Conway, J. S.; Feng, Z.; Ferguson, D. P. S.; Gao, Y. S.; Grahl, J.; Harton, J. L.; Hayes, O. J.; Nachtman, J. M.; Pan, Y. B.; Saadi, Y.; Schmitt, M.; Scott, I.; Sharma, V.; Shi, Z. H.; Turk, J. D.; Walsh, A. M.; Weber, F. V.; Sau Lan Wu; Wu, X.; Zheng, M.; Zobernig, G.; Aleph Collaboration

    1994-02-01

    B 0overlineB0 oscillation is studied using almost a million hadronic Z decays collected by the ALEPH experiment at LEP. Events are selected with two leptons present, on opposite sides of the event and with high transverse momentum. The leptons are expected to be dominantly from b decays; a topological vertexing technique is applied to measure the decay length of the b hadrons, and their momentum is determined using an energy-flow method. The fraction of events in which the leptons have the same charge is studied as a function of the measured decay time, and clear evidence is seen for the time-dependent nature of B d0overlineBd0 mixing. The frequency measured for the oscillation corresponds to a mass difference for the Bd0 mass eigenstates Δmd = (3.3 -0.4+0.5 ± 0.7) × 10 -4 eV/ c2. Allowing a second frequency component for the Bs0 a high value for Δms is favoured, leading to the limit Δms > 12 × 10 -4 eV/ c2 (95% CL), from which ( Δm/ Γ) s > 2.0 is derived.

  5. Activity of Bdellovibrio hit locus proteins, Bd0108 and Bd0109, links Type IVa pilus extrusion/retraction status to prey-independent growth signalling.

    Directory of Open Access Journals (Sweden)

    Michael J Capeness

    Full Text Available Bdellovibrio bacteriovorus are facultatively predatory bacteria that grow within gram-negative prey, using pili to invade their periplasmic niche. They also grow prey-independently on organic nutrients after undergoing a reversible switch. The nature of the growth switching mechanism has been elusive, but several independent reports suggested mutations in the hit (host-interaction locus on the Bdellovibrio genome were associated with the transition to prey-independent growth. Pili are essential for prey entry by Bdellovibrio and sequence analysis of the hit locus predicted that it was part of a cluster of Type IVb pilus-associated genes, containing bd0108 and bd0109. In this study we have deleted the whole bd0108 gene, which is unique to Bdellovibrio, and compared its phenotype to strains containing spontaneous mutations in bd0108 and the common natural 42 bp deletion variant of bd0108. We find that deletion of the whole bd0108 gene greatly reduced the extrusion of pili, whereas the 42 bp deletion caused greater pilus extrusion than wild-type. The pili isolated from these strains were comprised of the Type IVa pilin protein; PilA. Attempts to similarly delete gene bd0109, which like bd0108 encodes a periplasmic/secreted protein, were not successful, suggesting that it is likely to be essential for Bdellovibrio viability in any growth mode. Bd0109 has a sugar binding YD- repeat motif and an N-terminus with a putative pilin-like fold and was found to interact directly with Bd0108. These results lead us to propose that the Bd0109/Bd0108 interaction regulates pilus production in Bdellovibrio (possibly by interaction with the pilus fibre at the cell wall, and that the presence (and possibly retraction state of the pilus feeds back to alter the growth state of the Bdellovibrio cell. We further identify a novel small RNA encoded by the hit locus, the transcription of which is altered in different bd0108 mutation backgrounds.

  6. The lifestyle switch protein Bd0108 of Bdellovibrio bacteriovorus is an intrinsically disordered protein.

    Directory of Open Access Journals (Sweden)

    Gerd Prehna

    Full Text Available Bdellovibrio bacteriovorus is a δ-proteobacterium that preys upon Salmonella spp., E. coli, and other Gram-negative bacteria. Bdellovibrio can grow axenically (host-independent, HI, rare and mutation-driven or subsist via a predatory lifecycle (host-dependent, HD, the usual case. Upon contact with prey, B. bacteriovorus enters the host periplasm from where it slowly drains the host cytosol of nutrients for its own replication. At the core of this mechanism is a retractile pilus, whose architecture is regulated by the protein Bd0108 and its interaction with the neighboring gene product Bd0109. Deletion of bd0108 results in negligible pilus formation, whereas an internal deletion (the one that instigates host-independence causes mis-regulation of pilus length. These mutations, along with a suite of naturally occurring bd0108 mutant strains, act to control the entry to HI growth. To further study the molecular mechanism of predatory regulation, we focused on the apparent lifecycle switch protein Bd0108. Here we characterize the solution structure and dynamics of Bd0108 using nuclear magnetic resonance (NMR spectroscopy complemented with additional biophysical methods. We then explore the interaction between Bd0108 and Bd0109 in detail utilizing isothermal titration calorimetry (ITC and NMR spectroscopy. Together our results demonstrate that Bd0108 is an intrinsically disordered protein (IDP and that the interaction with Bd0109 is of low affinity. Furthermore, we observe that Bd0108 retains an IDP nature while binding Bd0109. From our data we conclude that Bdellovibrio bacteriovorus utilizes an intrinsically disordered protein to regulate its pilus and control predation signaling.

  7. Charm-beauty meson bound states from B (B*)D (D*) and B (B*)D \\xAF(D\\xAF*) interaction

    Science.gov (United States)

    Sakai, S.; Roca, L.; Oset, E.

    2017-09-01

    We evaluate the s -wave interaction of pseudoscalar and vector mesons with both charm and beauty to investigate the possible existence of molecular B D , B*D , B D*, B*D*, B D ¯, B*D ¯, B D¯*, or B*D¯* meson states. The scattering amplitude is obtained implementing unitarity starting from a tree level potential accounting for the dominant vector meson exchange. The diagrams are evaluated using suitable extensions to the heavy flavor sector of the hidden gauge symmetry Lagrangians involving vector and pseudoscalar mesons, respecting heavy quark spin symmetry. We obtain bound states at energies above 7 GeV for B D (JP=0+), B*D (1+), B D* (1+), and B*D* (0+, 1+, 2+), all in isospin 0. For B D ¯ (0+), B*D ¯ (1+), B D¯* (1+), and B*D¯* (0+, 1+, 2+) we also find similar bound states in I =0 , but much less bound, which would correspond to exotic meson states with b ¯ and c ¯ quarks, and for the I =1 we find a repulsive interaction. We also evaluate the scattering lengths in all cases, which can be tested in current investigations of lattice QCD.

  8. RVX-297- a novel BD2 selective inhibitor of BET bromodomains

    Energy Technology Data Exchange (ETDEWEB)

    Kharenko, Olesya A., E-mail: olesya@zenithepigenetics.com [Zenith Epigenetics, Suite 300, 4820 Richard Road SW, Calgary, Alberta, T3E 6L1 (Canada); Gesner, Emily M.; Patel, Reena G.; Norek, Karen [Zenith Epigenetics, Suite 300, 4820 Richard Road SW, Calgary, Alberta, T3E 6L1 (Canada); White, Andre; Fontano, Eric; Suto, Robert K. [Xtal BioStructures, Inc., 12 Michigan Dr., Natick, MA 01760 (United States); Young, Peter R.; McLure, Kevin G.; Hansen, Henrik C. [Zenith Epigenetics, Suite 300, 4820 Richard Road SW, Calgary, Alberta, T3E 6L1 (Canada)

    2016-08-12

    Bromodomains are epigenetic readers that specifically bind to the acetyl lysine residues of histones and transcription factors. Small molecule BET bromodomain inhibitors can disrupt this interaction which leads to potential modulation of several disease states. Here we describe the binding properties of a novel BET inhibitor RVX-297 that is structurally related to the clinical compound RVX-208, currently undergoing phase III clinical trials for the treatment of cardiovascular diseases, but is distinctly different in its biological and pharmacokinetic profiles. We report that RVX-297 preferentially binds to the BD2 domains of the BET bromodomain and Extra Terminal (BET) family of protein. We demonstrate the differential binding modes of RVX-297 in BD1 and BD2 domains of BRD4 and BRD2 using X-ray crystallography, and describe the structural differences driving the BD2 selective binding of RVX-297. The isothermal titration calorimetry (ITC) data illustrate the related differential thermodynamics of binding of RVX-297 to single as well as dual BET bromodomains. - Highlights: • A novel inhibitor of BET bromodomains, RVX-297 is described. • The differential binding modes of RVX-297 in BD1 and BD2 domains of BRD4 and BRD2 using X-ray crystallography are described. • RVX-297 preferentially binds to the BD2 domains of the BET bromodomains. • The structural and thermodynamic properties of the BD2 selective binding of RVX-297 are characterized.

  9. Label-free biochips for rapid detection of soybean allergen Glym Bd ...

    African Journals Online (AJOL)

    Label-free biochips for rapid detection of soybean allergen GlymBd 30K (P34) in foods. Wei Wang, Xudong Zhu, Shuang Teng, Qiaojun Fan, Hang Qian. Abstract. Purpose: To develop an innovative method for detection of soybean allergen, Gly mBd 30K (P34) in foods using a biosensor based on high spatial imaging ...

  10. Increased expression and levels of human β defensins (hBD2 and hBD4 in adults with dental caries

    Directory of Open Access Journals (Sweden)

    Girolamo Jose Barrera

    2013-09-01

    Full Text Available Introduction: Defensins are small anti-microbial peptides produced by epithelial cells. These peptides have a broad range of actions against microorganisms, including Gram-positive and Gram-negative bacteria.Human defensins are classifi ed into two subfamilies, the α-, and β- defensins, which differ in their distribution of disulphide bonds between the six conserved cysteine residues. Defensins are found in salivaand others compartments of the body. Human β defensins 2 (hBD2, beta defensins 4 (hBD4 and alpha defensins 4 (hNP4 in saliva may contributes to vulnerability or resistance to caries. This study aimed to determine a possible correlation between caries and levels of defensins measuring the expression in gingival tissue and concentrations in saliva samples.Methods: Oral examinations were performed on 100 adults of both genders (18-30 years old, and unstimulated whole saliva was collected for immunoassays of the three peptides and for the salivary pH, buffercapacity, protein, and peroxidase activity. mRNA levels of defensins in gingival sample were assessed by semi-quantitative RT-PCR technique.Results: The median salivary levels of hBD2 and hBD4 were 1.88 μg/ml and 0.86 μg/ml respectively for the caries-free group (n=44 and 7.26 μ/ml (hBD2 and 4.25 μg/ml (hBD4 for all subjects with evidenceof caries (n=56. There was no difference in the levels of hNP4, salivary pH, and proteins between groups, however the peroxidase activity and buffer capacity (interval 6.0-5.0 were reduced in caries group. Transcriptional levels of hBD2 and hBD4 did correlate with caries experience, the mRNA expression of hBD2 and hBD4 were signifi cantly higher in patients with caries than in patients with no-caries (p < 0.01.Conclusion: We conclude that high salivary levels and expression of beta defensins, low peroxidase activity and buffer capacity may represent a biological response of oral tissue to caries. Our observation couldlead to new ways to prevent

  11. Increased expression and levels of human β defensins (hBD2 and hBD4 in adults with dental caries

    Directory of Open Access Journals (Sweden)

    Girolamo Jose Barrera

    2013-09-01

    Full Text Available Introduction: Defensins are small anti-microbial peptides produced by epithelial cells. These peptides have a broad range of actions against microorganisms, including Gram-positive and Gram-negative bacteria.Human defensins are classifi ed into two subfamilies, the α-, and β- defensins, which differ in their distribution of disulphide bonds between the six conserved cysteine residues. Defensins are found in salivaand others compartments of the body. Human β defensins 2 (hBD2, beta defensins 4 (hBD4 and alpha defensins 4 (hNP4 in saliva may contributes to vulnerability or resistance to caries. This study aimed to determine a possible correlation between caries and levels of defensins measuring the expression in gingival tissue and concentrations in saliva samples.Methods: Oral examinations were performed on 100 adults of both genders (18-30 years old, and unstimulated whole saliva was collected for immunoassays of the three peptides and for the salivary pH, buffercapacity, protein, and peroxidase activity. mRNA levels of defensins in gingival sample were assessed by semi-quantitative RT-PCR technique.Results: The median salivary levels of hBD2 and hBD4 were 1.88 μg/ml and 0.86 μg/ml respectively for the caries-free group (n=44 and 7.26 μ/ml (hBD2 and 4.25 μg/ml (hBD4 for all subjects with evidenceof caries (n=56. There was no difference in the levels of hNP4, salivary pH, and proteins between groups, however the peroxidase activity and buffer capacity (interval 6.0-5.0 were reduced in caries group. Transcriptional levels of hBD2 and hBD4 did correlate with caries experience, the mRNA expression of hBD2 and hBD4 were signifi cantly higher in patients with caries than in patients with no-caries (p Conclusion: We conclude that high salivary levels and expression of beta defensins, low peroxidase activity and buffer capacity may represent a biological response of oral tissue to caries. Our observation couldlead to new ways to prevent caries

  12. Design and development of the BD Odon DeviceTM: a human factors evaluation process.

    Science.gov (United States)

    O'Brien, S M; Mouser, A; Odon, J E; Winter, C; Draycott, T J; Sumitro, T; Alisantoso, D; Lim, W L; Merialdi, M; Stankovic, A K; Crofts, J F

    2017-09-01

    To (1) determine how intended users interact with and use the BD Odon Device in simulation, (2) use these findings to alter progressively the design of the BD Odon Device and (3) validate that these changes have improved the ability of practitioners to use the BD Odon Device. Human factors evaluation study. Simulation suite designed to mimic delivery room. Three hundred and ninety simulated operative births, performed by 100 practising clinicians. Simulated operative vaginal births performed using the BD Odon Device and the device Instructions for use were subjected to three formative human factors evaluations and one human factors validation test. Following each evaluation, findings were reviewed and the design of the BD Odon Device and Instructions for use were modified. Successful performance of an operative vaginal birth using the BD Odon Device in accordance with provided training and Instructions for use. Using version two of the BD Odon Device, and following exposure to face-to-face training and written instructions, 25% of accouchers were able successfully to perform a simulated operative vaginal birth. In the final evaluation, following device design and training material alterations, all accouchers were able successfully to perform a simulated operative vaginal birth using version four of the BD Odon Device. Human factors evaluations have enabled a multi-professional device and training materials design team to alter the design of the BD Odon Device and the Instructions for use in an evidence-based fashion. This process has resulted in a device which has a predictable and likely safe pattern of use. Human Factors evaluations help make the BD Odon Device safe and usable for clinical practice. © 2017 Royal College of Obstetricians and Gynaecologists.

  13. The Escherichia coli CydX protein is a member of the CydAB cytochrome bd oxidase complex and is required for cytochrome bd oxidase activity.

    Science.gov (United States)

    VanOrsdel, Caitlin E; Bhatt, Shantanu; Allen, Rondine J; Brenner, Evan P; Hobson, Jessica J; Jamil, Aqsa; Haynes, Brittany M; Genson, Allyson M; Hemm, Matthew R

    2013-08-01

    Cytochrome bd oxidase operons from more than 50 species of bacteria contain a short gene encoding a small protein that ranges from ∼30 to 50 amino acids and is predicted to localize to the cell membrane. Although cytochrome bd oxidases have been studied for more than 70 years, little is known about the role of this small protein, denoted CydX, in oxidase activity. Here we report that Escherichia coli mutants lacking CydX exhibit phenotypes associated with reduced oxidase activity. In addition, cell membrane extracts from ΔcydX mutant strains have reduced oxidase activity in vitro. Consistent with data showing that CydX is required for cytochrome bd oxidase activity, copurification experiments indicate that CydX interacts with the CydAB cytochrome bd oxidase complex. Together, these data support the hypothesis that CydX is a subunit of the CydAB cytochrome bd oxidase complex that is required for complex activity. The results of mutation analysis of CydX suggest that few individual amino acids in the small protein are essential for function, at least in the context of protein overexpression. In addition, the results of analysis of the paralogous small transmembrane protein AppX show that the two proteins could have some overlapping functionality in the cell and that both have the potential to interact with the CydAB complex.

  14. The Cytochrome bd Oxidase of Porphyromonas gingivalis Contributes to Oxidative Stress Resistance and Dioxygen Tolerance.

    Directory of Open Access Journals (Sweden)

    Julia Leclerc

    Full Text Available Porphyromonas gingivalis is an etiologic agent of periodontal disease in humans. The disease is associated with the formation of a mixed oral biofilm which is exposed to oxygen and environmental stress, such as oxidative stress. To investigate possible roles for cytochrome bd oxidase in the growth and persistence of this anaerobic bacterium inside the oral biofilm, mutant strains deficient in cytochrome bd oxidase activity were characterized. This study demonstrated that the cytochrome bd oxidase of Porphyromonas gingivalis, encoded by cydAB, was able to catalyse O2 consumption and was involved in peroxide and superoxide resistance, and dioxygen tolerance.

  15. [Protokolle der Estländischen Ritterschaft 1914-1920. Bd 1-2] / Mati Laur

    Index Scriptorium Estoniae

    Laur, Mati, 1955-

    2012-01-01

    Arvustus: Protokolle der Estländischen Ritterschaft 1914-1920. Bd. 1-2 (Ex fontibus archivi Estoniae, 3). Hrsg. von Thomas Freiherr von Dellingshausen und Henning von Wistingshausen. (Tartu: Eesti Ajalooarhiiv, 2011)

  16. Reconstitution of emulsifying activity of Acinetobacter calcoaceticus BD4 emulsan by using pure polysaccharide and protein.

    OpenAIRE

    Kaplan, N; Zosim, Z; Rosenberg, E

    1987-01-01

    Acinetobacter calcoaceticus BD4 and BD413 produce extracellular emulsifying agents when grown on 2% ethanol medium. For emulsifying activity, both polysaccharide and protein fractions were required, as demonstrated by selective digestion of the polysaccharide with a specific bacteriophage-borne polysaccharide depolymerase, deproteinization of the extracellular emulsifying complex with hot phenol, and reconstitution of emulsifier activity with pure polysaccharide and a polysaccharide-free prot...

  17. Nuclear hBD-1 accumulation in malignant salivary gland tumours

    International Nuclear Information System (INIS)

    Wenghoefer, M; Merkelbach-Bruse, S; Fischer, HP; Novak, N; Winter, J; Pantelis, A; Dommisch, H; Götz, W; Reich, R; Bergé, S; Martini, M; Allam, JP; Jepsen, S

    2008-01-01

    Whereas the antimicrobial peptides hBD-2 and -3 are related to inflammation, the constitutively expressed hBD-1 might function as 8p tumour suppressor gene and thus play a key role in control of transcription and induction of apoptosis in malignant epithelial tumours. Therefore this study was conducted to characterise proteins involved in cell cycle control and host defence in different benign and malignant salivary gland tumours in comparison with healthy salivary gland tissue. 21 paraffin-embedded tissue samples of benign (n = 7), and malignant (n = 7) salivary gland tumours as well as healthy (n = 7) salivary glands were examined immunohistochemically for the expression of p53, bcl-2, and hBD-1, -2, -3. HBD-1 was distributed in the cytoplasm of healthy salivary glands and benign salivary gland tumours but seems to migrate into the nucleus of malignant salivary gland tumours. Pleomorphic adenomas showed cytoplasmic as well as weak nuclear hBD-1 staining. HBD-1, 2 and 3 are traceable in healthy salivary gland tissue as well as in benign and malignant salivary gland tumours. As hBD-1 is shifted from the cytoplasm to the nucleus in malignant salivary gland tumours, we hypothesize that it might play a role in the oncogenesis of these tumours. In pleomorphic adenomas hBD-1 might be connected to their biologic behaviour of recurrence and malignant transformation

  18. Nuclear hBD-1 accumulation in malignant salivary gland tumours

    Directory of Open Access Journals (Sweden)

    Merkelbach-Bruse S

    2008-10-01

    Full Text Available Abstract Background Whereas the antimicrobial peptides hBD-2 and -3 are related to inflammation, the constitutively expressed hBD-1 might function as 8p tumour suppressor gene and thus play a key role in control of transcription and induction of apoptosis in malignant epithelial tumours. Therefore this study was conducted to characterise proteins involved in cell cycle control and host defence in different benign and malignant salivary gland tumours in comparison with healthy salivary gland tissue. Methods 21 paraffin-embedded tissue samples of benign (n = 7, and malignant (n = 7 salivary gland tumours as well as healthy (n = 7 salivary glands were examined immunohistochemically for the expression of p53, bcl-2, and hBD-1, -2, -3. Results HBD-1 was distributed in the cytoplasm of healthy salivary glands and benign salivary gland tumours but seems to migrate into the nucleus of malignant salivary gland tumours. Pleomorphic adenomas showed cytoplasmic as well as weak nuclear hBD-1 staining. Conclusion HBD-1, 2 and 3 are traceable in healthy salivary gland tissue as well as in benign and malignant salivary gland tumours. As hBD-1 is shifted from the cytoplasm to the nucleus in malignant salivary gland tumours, we hypothesize that it might play a role in the oncogenesis of these tumours. In pleomorphic adenomas hBD-1 might be connected to their biologic behaviour of recurrence and malignant transformation.

  19. Characterization of Phosphate Transporters BdPT4 and BdPT8 in Mycorrhizal and Non-Mychorrhizal Brachypodium distachyon

    DEFF Research Database (Denmark)

    Clausen, Signe Sandbech

    was generated by Agrobacterium tumefaciens-mediated transformation. The transgenic lines were characterized for effects on growth and plant P uptake, and their subcellular localization was moreover determined by confocal microscopy. Quantitative expression analysis of 11 BdPTs in AM and non-mycorrhizal (NM...

  20. Guillem Fabre, “Pus dels majors” (BdT 216.2; Id., “Hon mais vey, pus truep sordeyor” (BdT 216.1

    Directory of Open Access Journals (Sweden)

    Linda Paterson

    2013-03-01

    Full Text Available The historical circumstances of Guillem Fabre’s two surviving sirventes has given rise to widely divergent views. This essay builds on Parducci’s contextualisation of BdT 216.2 during the War of the Sicilian Vespers and the so-called Aragonese crusade by the French against Pere III of Aragon in 1284-1285. It argues that Guillem is likely to be referring to events say entre nos because Narbonne was the focal point of the gathering French army and preaching of the crusade. All other textual details are compatible with this period and best explained by this context. But while Parducci places the sirventes in May 1285, it must in fact have preceded the death of Martin IV on 29 March, since his speedily-appointed successor Honorius IV could not be blamed for not having preached a crusade against the heathen before the conflict degenerated into further atrocities. Furthermore a slightly earlier timing better explains the allusion to “the best-known man in the world”, the obvious candidate at this time being Charles of Anjou. Guillem probably composed BdT 216.2 during the build-up to war in 1284, before the death of Charles in January 1285, during the period of war preparations and propaganda speeches. It is also argued here that, pace Parducci, BdT 216.1 did not necessarily precede BdT 216.2.

  1. A MULTI-WAVELENGTH 3D MODEL OF BD+30°3639

    Energy Technology Data Exchange (ETDEWEB)

    Freeman, M. J.; Kastner, Joel H. [Chester F. Carlson Center for Imaging Science, School of Physics and Astronomy, and Laboratory for Multiwavelength Astrophysics, Rochester Institute of Technology, 54 Lomb Memorial Drive, Rochester NY 14623 (United States)

    2016-10-01

    We present a 3D multi-wavelength reconstruction of BD+30°3639, one of the best-studied planetary nebulae in the solar neighborhood. BD+30°3639, which hosts a [WR]-type central star, has been imaged at wavelength regimes that span the electromagnetic spectrum, from radio to X-rays. We have used the astrophysical modeling software SHAPE to construct a 3D morpho-kinematic model of BD+30°3639. This reconstruction represents the most complete 3D model of a PN to date from the standpoint of the incorporation of multi-wavelength data. Based on previously published kinematic data in optical emission lines and in lines of CO (radio) and H{sub 2} (near-IR), we were able to reconstruct BD+30's basic velocity components assuming a set of homologous velocity expansion laws combined with collimated flows along the major axis of the nebula. We confirm that the CO “bullets” in the PN lie along an axis that is slightly misaligned with respect to the major axis of the optical nebula, and that these bullets are likely responsible for the disrupted structures of the ionized and H{sub 2}-emitting shells within BD+30. Given the relative geometries and thus dynamical ages of BD+30's main structural components, it is furthermore possible that the same jets that ejected the CO bullets are responsible for the generation of the X-ray-emitting hot bubble within the PN. Comparison of alternative viewing geometries for our 3D reconstruction of BD+30°3639 with imagery of NGC 40 and NGC 6720 suggests a common evolutionary path for these nebulae.

  2. Clinical management and burden of bipolar disorder: a multinational longitudinal study (WAVE-bd Study

    Directory of Open Access Journals (Sweden)

    Moreno-Manzanaro Miriam

    2011-04-01

    Full Text Available Abstract Background Studies in bipolar disorder (BD to date are limited in their ability to provide a whole-disease perspective - their scope has generally been confined to a single disease phase and/or a specific treatment. Moreover, most clinical trials have focused on the manic phase of disease, and not on depression, which is associated with the greatest disease burden. There are few longitudinal studies covering both types of patients with BD (I and II and the whole course of the disease, regardless of patients' symptomatology. Therefore, the Wide AmbispectiVE study of the clinical management and burden of Bipolar Disorder (WAVE-bd (NCT01062607 aims to provide reliable information on the management of patients with BD in daily clinical practice. It also seeks to determine factors influencing clinical outcomes and resource use in relation to the management of BD. Methods WAVE-bd is a multinational, multicentre, non-interventional, longitudinal study. Approximately 3000 patients diagnosed with BD type I or II with at least one mood event in the preceding 12 months were recruited at centres in Austria, Belgium, Brazil, France, Germany, Portugal, Romania, Turkey, Ukraine and Venezuela. Site selection methodology aimed to provide a balanced cross-section of patients cared for by different types of providers of medical aid (e.g. academic hospitals, private practices in each country. Target recruitment percentages were derived either from scientific publications or from expert panels in each participating country. The minimum follow-up period will be 12 months, with a maximum of 27 months, taking into account the retrospective and the prospective parts of the study. Data on demographics, diagnosis, medical history, clinical management, clinical and functional outcomes (CGI-BP and FAST scales, adherence to treatment (DAI-10 scale and Medication Possession Ratio, quality of life (EQ-5D scale, healthcare resources, and caregiver burden (BAS scale

  3. High Milk-Clotting Activity Expressed by the Newly Isolated Paenibacillus spp. Strain BD3526

    Directory of Open Access Journals (Sweden)

    Feng Hang

    2016-01-01

    Full Text Available Paenibacillus spp. BD3526, a bacterium exhibiting a protein hydrolysis circle surrounded with an obvious precipitation zone on skim milk agar, was isolated from raw yak (Bos grunniens milk collected in Tibet, China. Phylogenetic analysis based on 16S rRNA and whole genome sequence comparison indicated the isolate belong to the genus Paenibacillus. The strain BD3526 demonstrated strong ability to produce protease with milk clotting activity (MCA in wheat bran broth. The protease with MCA was predominantly accumulated during the late-exponential phase of growth. The proteolytic activity (PA of the BD3526 protease was 1.33-fold higher than that of the commercial R. miehei coagulant. A maximum MCA (6470 ± 281 SU mL−1 of the strain BD3526 was reached under optimal cultivation conditions. The protease with MCA was precipitated from the cultivated supernatant of wheat bran broth with ammonium sulfate and purified by anion-exchange chromatography. The molecular weight of the protease with MCA was determined as 35 kDa by sodium dodecyl sulfate-polyacrylamide gels electrophoresis (SDS-PAGE and gelatin zymography. The cleavage site of the BD3526 protease with MCA in κ-casein was located at the Met106–Ala107 bond, as determined by mass spectrometry analysis.

  4. Adiponectin Suppresses UVB-Induced Premature Senescence and hBD2 Overexpression in Human Keratinocytes.

    Directory of Open Access Journals (Sweden)

    MinJeong Kim

    Full Text Available Recent studies have revealed that adiponectin can suppress cellular inflammatory signaling pathways. This study aimed to elucidate the effect of adiponectin on the unregulated production of hBD2 in UVB-induced premature senescent keratinocytes. We constructed an in vitro model of premature senescent keratinocytes through repeated exposure to low energy UVB. After repeated low energy UVB exposure, there was significant generation of reactive oxygen species (ROS and induction of senescence-associated markers, including senescence associated beta-galactosidase activity and expression of p16INK4a and histone H2AX. In addition, the present clinical study showed higher expression of hBD2 in sun-exposed skin of elderly group, and the overexpression of hBD2 was observed by c-Fos activation in vitro. Adiponectin has the ability to scavenge ROS and consequently inhibit MAPKs and SA-markers in UVB-exposed keratinocytes. An inhibitor study demonstrated that adiponectin downregulated hBD2 mRNA expression through suppression of the AP-1 transcription factor components c-Fos via inactivation of p38 MAPK. Collectively, the dysregulated production of hBD2 by the induction of oxidative stress was attenuated by adiponectin through the suppression of p38 and JNK/SAPK MAPK signaling in UVB-mediated premature senescent inducible conditions. These results suggest the feasibility of adiponectin as an anti-photoaging and anti-inflammatory agent in the skin.

  5. Three new barium dwarfs with white dwarf companions: BD+68°1027, RE J0702+129 and BD+80°670

    Science.gov (United States)

    Kong, X. M.; Bharat Kumar, Y.; Zhao, G.; Zhao, J. K.; Fang, X. S.; Shi, J. R.; Wang, L.; Zhang, J. B.; Yan, H. L.

    2018-02-01

    We report three new barium (Ba) dwarfs lying in Sirius-like systems. They provide direct evidence that Ba dwarfs are companions to white dwarfs (WDs). Atmospheric parameters, stellar masses and the chemical abundances of 25 elements, including light, α, Fe-peak and s-process elements, are derived from high-resolution and high S/N spectra. The enhancement of s-process elements with [s/Fe] ratios between 0.4 and 0.6 confirm them as mild barium stars. The estimated metallicities (-0.31, -0.06 and 0.13) of BD+68°1027, RE J0702+129 and BD+80°670 are in the range of known Ba dwarfs and giants. As expected, the observed indices [hs/ls], [s/Fe] and [C/Fe] show an anti-correlation with metallicity. Asymptotic giant branch (AGB) progenitor masses are estimated for the WD companions of RE J0702+129 (1.47 M⊙) and BD+80°670 (3.59 M⊙). These confirm the predicted range of progenitor AGB masses (1.5-4 M⊙) for unseen WDs around Ba dwarfs. The surface abundances of s-process elements in RE J0702+129 and BD+80°670 are compared with AGB models and they are in close agreement, within the predicted accretion efficiencies and pollution factors for Ba stars. These results support that the origin of s-process overabundances in Ba dwarfs is similar to those of Ba giants via the McClure hypothesis in which Ba stars accumulate s-process elements through mass transfer from their host companions during the AGB phase.

  6. Isolation and identification of berberine and berberrubine metabolites by berberine-utilizing bacterium Rhodococcus sp. strain BD7100.

    Science.gov (United States)

    Ishikawa, Kazuki; Takeda, Hisashi; Wakana, Daigo; Sato, Fumihiko; Hosoe, Tomoo

    2016-05-01

    Based on the finding of a novel berberine (BBR)-utilizing bacterium, Rhodococcus sp. strain BD7100, we investigated the degradation of BBR and its analog berberrubine (BRU). Resting cells of BD7100 demethylenated BBR and BRU, yielding benzeneacetic acid analogs. Isolation of benzeneacetic acid analogs suggested that BD7100 degraded the isoquinoline ring of the protoberberine skeleton. This work represents the first report of cleavage of protoberberine skeleton by a microorganism.

  7. Managing the computational chemistry big data problem: the ioChem-BD platform.

    Science.gov (United States)

    Álvarez-Moreno, M; de Graaf, C; López, N; Maseras, F; Poblet, J M; Bo, C

    2015-01-26

    We present the ioChem-BD platform ( www.iochem-bd.org ) as a multiheaded tool aimed to manage large volumes of quantum chemistry results from a diverse group of already common simulation packages. The platform has an extensible structure. The key modules managing the main tasks are to (i) upload of output files from common computational chemistry packages, (ii) extract meaningful data from the results, and (iii) generate output summaries in user-friendly formats. A heavy use of the Chemical Mark-up Language (CML) is made in the intermediate files used by ioChem-BD. From them and using XSL techniques, we manipulate and transform such chemical data sets to fulfill researchers' needs in the form of HTML5 reports, supporting information, and other research media.

  8. Solid-state synthesis of LiBD(4) observed by in situ neutron diffraction.

    Science.gov (United States)

    Remhof, A; Friedrichs, O; Buchter, F; Mauron, Ph; Züttel, A; Wallacher, D

    2008-10-14

    The synthesis of Li[(11)BD(4)] from LiB and D(2) (p = 180 bar) is investigated by in situ neutron diffraction. The onset of the Li[(11)BD(4)] formation is observed far below the temperatures reported so far for the reaction from the pure elements, indicative of a lower activation barrier. We attribute the improved formation behavior to the breaking of the rigid boron lattice and intermixing of the elements on an atomic level when forming the binary compound LiB. The reaction starts with the decomposition of the initial LiB compound and the formation of LiD. At 623 K LiBD(4) starts to form. However, under the given experimental conditions (maximal temperature = 773 K) a complete reaction was not achieved; there is still residual LiD present.

  9. Clinical Evaluation of the BD FACSPresto™ Near-Patient CD4 Counter in Kenya.

    Directory of Open Access Journals (Sweden)

    Francis Angira

    Full Text Available The BD FACSPresto™ Near-Patient CD4 Counter was developed to expand HIV/AIDS management in resource-limited settings. It measures absolute CD4 counts (AbsCD4, percent CD4 (%CD4, and hemoglobin (Hb from a single drop of capillary or venous blood in approximately 23 minutes, with throughput of 10 samples per hour. We assessed the performance of the BD FACSPresto system, evaluating accuracy, stability, linearity, precision, and reference intervals using capillary and venous blood at KEMRI/CDC HIV-research laboratory, Kisumu, Kenya, and precision and linearity at BD Biosciences, California, USA.For accuracy, venous samples were tested using the BD FACSCalibur™ instrument with BD Tritest™ CD3/CD4/CD45 reagent, BD Trucount™ tubes, and BD Multiset™ software for AbsCD4 and %CD4, and the Sysmex™ KX-21N for Hb. Stability studies evaluated duration of staining (18-120-minute incubation, and effects of venous blood storage <6-24 hours post-draw. A normal cohort was tested for reference intervals. Precision covered multiple days, operators, and instruments. Linearity required mixing two pools of samples, to obtain evenly spaced concentrations for AbsCD4, total lymphocytes, and Hb.AbsCD4 and %CD4 venous/capillary (N = 189/ N = 162 accuracy results gave Deming regression slopes within 0.97-1.03 and R2 ≥0.96. For Hb, Deming regression results were R2 ≥0.94 and slope ≥0.94 for both venous and capillary samples. Stability varied within 10% 2 hours after staining and for venous blood stored less than 24 hours. Reference intervals results showed that gender-but not age-differences were statistically significant (p<0.05. Precision results had <3.5% coefficient of variation for AbsCD4, %CD4, and Hb, except for low AbsCD4 samples (<6.8%. Linearity was 42-4,897 cells/μL for AbsCD4, 182-11,704 cells/μL for total lymphocytes, and 2-24 g/dL for Hb.The BD FACSPresto system provides accurate, precise clinical results for capillary or venous blood samples

  10. Anonimi, “Ges al meu grat non sui joglar” (BdT 461.126, “Per zo no·m voil desconortar” (BdT 461.193, “Va, cobla: al Juge de Galur” (BdT 461.246, “Seigner Juge, ben aug dir a la gen” (BdT 461.217, “Ges per li diz non er bons prez sabuz” (BdT 461.133

    Directory of Open Access Journals (Sweden)

    Giuseppe Noto

    2012-09-01

    Full Text Available My paper provides a new critical edition, with critical apparatus, comment and translation of a set of anonymous ‘coblas’, copied as a sequence in the anthology present at ff. 55-66 in chansonnier P: BdT 461.126; BdT 461.193; BdT 461.246; BdT 461.217; BdT 461.133 (all of which are unica. I will examine in particular the attributions suggested so far for one or more of these ‘coblas’ (a name that has frequently been put forward is that of Paolo Lanfranchi da Pistoia, author of the sonnet in ‘cobla’ form copied in P immediately preceding the poems discussed here and address the hypothesis put forward by several scholars (and upheld with convincing evidence by Stefano Asperti that the sequence under consideration points to the strong presence of a Tuscan tradition in chansonnier P, clearly contributing, among other things, to outline a “fundamental coherence” (Asperti between some aspects of Dante’s literary culture and this particular songbook.

  11. The Unusual Resistance of Avian Defensin AvBD7 to Proteolytic Enzymes Preserves Its Antibacterial Activity.

    Science.gov (United States)

    Bailleul, Geoffrey; Kravtzoff, Amanda; Joulin-Giet, Alix; Lecaille, Fabien; Labas, Valérie; Meudal, Hervé; Loth, Karine; Teixeira-Gomes, Ana-Paula; Gilbert, Florence B; Coquet, Laurent; Jouenne, Thierry; Brömme, Dieter; Schouler, Catherine; Landon, Céline; Lalmanach, Gilles; Lalmanach, Anne-Christine

    2016-01-01

    Defensins are frontline peptides of mucosal immunity in the animal kingdom, including birds. Their resistance to proteolysis and their ensuing ability to maintain antimicrobial potential remains questionable and was therefore investigated. We have shown by bottom-up mass spectrometry analysis of protein extracts that both avian beta-defensins AvBD2 and AvBD7 were ubiquitously distributed along the chicken gut. Cathepsin B was found by immunoblotting in jejunum, ileum, caecum, and caecal tonsils, while cathepsins K, L, and S were merely identified in caecal tonsils. Hydrolysis product of AvBD2 and AvBD7 incubated with a panel of proteases was analysed by RP-HPLC, mass spectrometry and antimicrobial assays. AvBD2 and AvBD7 were resistant to serine proteases and to cathepsins D and H. Conversely cysteine cathepsins B, K, L, and S degraded AvBD2 and abolished its antibacterial activity. Only cathepsin K cleaved AvBD7 and released Ile4-AvBD7, a N-terminal truncated natural peptidoform of AvBD7 that displayed antibacterial activity. Besides the 3-stranded antiparallel beta-sheet typical of beta-defensins, structural analysis of AvBD7 by two-dimensional NMR spectroscopy highlighted the restricted accessibility of the C-terminus embedded by the N-terminal region and gave a formal evidence of a salt bridge (Asp9-Arg12) that could account for proteolysis resistance. The differential susceptibility of avian defensins to proteolysis opens intriguing questions about a distinctive role in the mucosal immunity against pathogen invasion.

  12. Lightcurve Analysis for Near-Earth Asteroid (143404) 2003 BD44

    Science.gov (United States)

    Polakis, Tom; Warner, Brian D.; Skiff, Brian A.

    2018-01-01

    The synodic rotation period has been determined for the near-Earth asteroid (NEA) (143404) 2003 BD44. The asteroid was observed during three intervals with a rotation period on the order of 79 h determined in each case. The lightcurve exhibited rapidly changing morphology as the asteroid approached. Data have submitted to the ALCDEF database.

  13. Label-free biochips for rapid detection of soybean allergen GlymBd ...

    African Journals Online (AJOL)

    detection. Keywords: Soybean Allergen, Gly mBd 30K, Biochip, Detection, Foods ... methods of choice by food industries and food .... shrimp, fish, peanut, wheat, and graham bread served as negative controls. Manufactured foods such as cream cake, cereal bar, chocolate biscuits, and pineapple cake were screened for.

  14. checkCIF/PLATON report Datablock: monika-bd1re3

    Indian Academy of Sciences (India)

    IF USED AS PART OF A REVIEW PROCEDURE. FOR PUBLICATION, IT SHOULD NOT REPLACE THE EXPERTISE OF AN EXPERIENCED. CRYSTALLOGRAPHIC REFEREE. No syntax errors found. CIF dictionary Interpreting this report. Datablock: monika-bd1re3. Bond precision: C-C = 0.0046 A. Wavelength=0.71073.

  15. The B.D.-240 and the Future of the Peralta Community College District.

    Science.gov (United States)

    Selo, Peter A.

    This document examines the position of the Peralta Community College District as defined by the Budget Division-240 (B.D.-240), a statistical projection prepared annually by the California Department of Finance which measures the current and future student load on California community college districts. This load is used as an index of the demand…

  16. Vitamin B@d12@@ concentrations in Mandovi and Zuari estuaries

    Digital Repository Service at National Institute of Oceanography (India)

    DeSilva, C.; Rajendran, A.

    and between 0.12 and 0.49 ng/l in bottom samples. Near the head of the estuary, the variation in B@d12@@ concentration was from nil to 2.47 ng/l. Relatively lower concentration was observed (0.20 to 1.06 ng/l) at the head of this estuary. Various probable...

  17. AutoBD: Automated Bi-Level Description for Scalable Fine-Grained Visual Categorization.

    Science.gov (United States)

    Yao, Hantao; Zhang, Shiliang; Yan, Chenggang; Zhang, Yongdong; Li, Jintao; Tian, Qi

    Compared with traditional image classification, fine-grained visual categorization is a more challenging task, because it targets to classify objects belonging to the same species, e.g. , classify hundreds of birds or cars. In the past several years, researchers have made many achievements on this topic. However, most of them are heavily dependent on the artificial annotations, e.g., bounding boxes, part annotations, and so on . The requirement of artificial annotations largely hinders the scalability and application. Motivated to release such dependence, this paper proposes a robust and discriminative visual description named Automated Bi-level Description (AutoBD). "Bi-level" denotes two complementary part-level and object-level visual descriptions, respectively. AutoBD is "automated," because it only requires the image-level labels of training images and does not need any annotations for testing images. Compared with the part annotations labeled by the human, the image-level labels can be easily acquired, which thus makes AutoBD suitable for large-scale visual categorization. Specifically, the part-level description is extracted by identifying the local region saliently representing the visual distinctiveness. The object-level description is extracted from object bounding boxes generated with a co-localization algorithm. Although only using the image-level labels, AutoBD outperforms the recent studies on two public benchmark, i.e. , classification accuracy achieves 81.6% on CUB-200-2011 and 88.9% on Car-196, respectively. On the large-scale Birdsnap data set, AutoBD achieves the accuracy of 68%, which is currently the best performance to the best of our knowledge.Compared with traditional image classification, fine-grained visual categorization is a more challenging task, because it targets to classify objects belonging to the same species, e.g. , classify hundreds of birds or cars. In the past several years, researchers have made many achievements on this topic

  18. 13 CFR 124.101 - What are the basic requirements a concern must meet for the 8(a) BD program?

    Science.gov (United States)

    2010-01-01

    ... concern meets the basic requirements for admission to the 8(a) BD program if it is a small business which... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false What are the basic requirements a concern must meet for the 8(a) BD program? 124.101 Section 124.101 Business Credit and Assistance SMALL...

  19. Dynamical properties and temperature induced molecular disordering of LiBH4 and LiBD4

    NARCIS (Netherlands)

    Buchter, F.; Lodziana, Z.; Mauron, P.; Remhof, A.; Friedrichs, O.; Borgschulte, A.; Zuttel, A.; Sheptyakov, D.; Strassle, T.; Ramirez-Cuesta, A. J.

    2008-01-01

    We report on neutron powder-diffraction experiments, inelastic incoherent neutron-scattering experiments, and density-functional calculations on dynamics, order and disorder properties of LiBH4 and LiBD4. From refinement of LiBD4 structure at 10 and 302 K, we found an almost ideal tetrahedral

  20. Molecular characterization and functional analysis of BdFoxO gene in the oriental fruit fly, Bactrocera dorsalis (Diptera: Tephritidae).

    Science.gov (United States)

    Wu, Yi-Bei; Yang, Wen-Jia; Xie, Yi-Fei; Xu, Kang-Kang; Tian, Yi; Yuan, Guo-Rui; Wang, Jin-Jun

    2016-03-10

    The forkhead box O transcription factor (FoxO) is an important downstream transcription factor in the well-conserved insulin signaling pathway, which regulates the body size and development of insects. In this study, the FoxO gene (BdFoxO) was identified from the oriental fruit fly, Bactrocera dorsalis (Hendel). The open reading frame of BdFoxO (2732 bp) encoded a 910 amino acid protein, and the sequence was well conserved with other insect species. The BdFoxO was highly expressed in larvae and pupae among different development stages, and the highest tissue-specific expression level was found in the fat bodies compared to the testis, ovary, head, thorax, midgut, and Malpighian tubules of adults. Interestingly, we found BdFoxO expression was also up-regulated by starvation, but down-regulated when re-fed. Moreover, the injection of BdFoxO double-stranded RNAs into third-instar larvae significantly reduced BdFoxO transcript levels, which in turn down-regulated the expression of other four genes in the insulin signaling pathway. The silencing of BdFoxO resulted in delayed pupation, and the insect body weight increased significantly compared with that of the control. These results suggested that BdFoxO plays an important role in body size and development in B. dorsalis. Copyright © 2015 Elsevier B.V. All rights reserved.

  1. Cytochrome bd Protects Bacteria against Oxidative and Nitrosative Stress: A Potential Target for Next-Generation Antimicrobial Agents.

    Science.gov (United States)

    Borisov, V B; Forte, E; Siletsky, S A; Arese, M; Davletshin, A I; Sarti, P; Giuffrè, A

    2015-05-01

    Cytochrome bd is a terminal quinol oxidase of the bacterial respiratory chain. This tri-heme integral membrane protein generates a proton motive force at lower efficiency than heme-copper oxidases. This notwithstanding, under unfavorable growth conditions bacteria often use cytochrome bd in place of heme-copper enzymes as the main terminal oxidase. This is the case for several pathogenic and opportunistic bacteria during host colonization. This review summarizes recent data on the contribution of cytochrome bd to bacterial resistance to hydrogen peroxide, nitric oxide, and peroxynitrite, harmful species produced by the host as part of the immune response to microbial infections. Growing evidence supports the hypothesis that bd-type oxidases contribute to bacterial virulence by promoting microbial survival under oxidative and nitrosative stress conditions. For these reasons, cytochrome bd represents a protein target for the development of next-generation antimicrobials.

  2. BD LSRFortessa for Tulane DoD ID and Cancer Projects

    Science.gov (United States)

    2015-01-21

    QUOTATION NUMBER: August 11, 2011 September 15, 2011 420062564(Revised 2) ~BD SOLD-TO NO: 2000039181 I SOLO -TO ADDRESS TULANE UN IV MEDICAL CENTER...for labor, travel expenses and parts (excluding consumable items) for the following: Two (2) Preventive Maintenance Inspections to be performed...be issued (see back: Para. I. C.) Under this Agreement, CUSTOMER will be billed at the prevailing hourly rate for labor and travel for service

  3. The performance of BD FACSPresto™ for CD4 T-cell count, CD4% and hemoglobin concentration test in Ethiopia.

    Directory of Open Access Journals (Sweden)

    Gebremedhin Gebremicael

    Full Text Available In Ethiopia, CD4+ T-cell counting is still required for all patients at baseline before antiretroviral therapy (ART and to determine eligibility and follow-up of opportunistic infection prophylaxis. However, access to CD4+ T cell count in rural health facilities remains a major challenge in Ethiopia like other resource-limited settings.Both capillary and venous blood was drawn from each of 325 study participant recruited in Addis Ababa and surroundings. The CD4+ T-cell count, CD4%, and hemoglobin (Hgb were tested at one of the four study health facilities using capillary blood and BD FACSPresto™ device. These tests were also done at the national HIV reference laboratory, using venous blood with BD FACSCalibur™, Sysmex XT-1800i™, and BD FACSPresto™.BD FACSPresto™ had an absolute mean bias of -13.3 cells/ul (-2.99% and 28.3 cells/μl (6.4% using venous and capillary blood, respectively, compared with BD FACSCalibur™. The absolute CD4 assay on the BD FACSPresto™ had a regression coefficient (R2 of 0.87 and 0.92 using capillary blood and venous blood samples, respectively, compared with BD FACSCalibur™. The percentage similarity of the BD FACSPresto™ using capillary and venous blood was 105.2% and 99.3%, respectively. The sensitivity of the FACSPresto™ using threshold of 500 cells/μl for ART eligibility using capillary and venous blood was 87.9 and 94.3%, while the specificity was 91.4 and 83.8%, respectively. Furthermore, the BD FACSPresto™ had an absolute mean bias of -0.2 dl/μl (0.0% (95% LOA: -1.7, 1.3 and -0.59 dl/μl (0.1% (95% LOA: -1.49, 0.31 for Hgb using capillary and venous blood compared with the Sysmex XT-1800i™, respectively.Our results showed acceptable agreement between the BD FACSPresto™ and BD FACSCalibur™ for CD4+ T-cell counting and CD4%; and between the BD FACSPresto™ and Sysmex XT-1800i™for measuring Hgb concentration.

  4. The cytochrome bd oxidase of Escherichia coli prevents respiratory inhibition by endogenous and exogenous hydrogen sulfide.

    Science.gov (United States)

    Korshunov, Sergey; Imlay, Karin R C; Imlay, James A

    2016-07-01

    When sulfur compounds are scarce or difficult to process, Escherichia coli adapts by inducing the high-level expression of sulfur-compound importers. If cystine then becomes available, the cystine is rapidly overimported and reduced, leading to a burgeoning pool of intracellular cysteine. Most of the excess cysteine is exported, but some is adventitiously degraded, with the consequent release of sulfide. Sulfide is a potent ligand of copper and heme moieties, raising the prospect that it interferes with enzymes. We observed that when cystine was provided and sulfide levels rose, E. coli became strictly dependent upon cytochrome bd oxidase for continued respiration. Inspection revealed that low-micromolar levels of sulfide inhibited the proton-pumping cytochrome bo oxidase that is regarded as the primary respiratory oxidase. In the absence of the back-up cytochrome bd oxidase, growth failed. Exogenous sulfide elicited the same effect. The potency of sulfide was enhanced when oxygen concentrations were low. Natural oxic-anoxic interfaces are often sulfidic, including the intestinal environment where E. coli dwells. We propose that the sulfide resistance of the cytochrome bd oxidase is a key trait that permits respiration in such habitats. © 2016 John Wiley & Sons Ltd.

  5. Low-Cost BD/MEMS Tightly-Coupled Pedestrian Navigation Algorithm

    Directory of Open Access Journals (Sweden)

    Tianyu Lin

    2016-05-01

    Full Text Available Pedestrian Dead Reckoning (PDR by combining the Inertial Measurement Unit (IMU and magnetometer is an independent navigation approach based on multiple sensors. Since the inertial component error is significantly determined by the parameters of navigation equations, the navigation precision may deteriorate with time, which is inappropriate for long-time navigation. Although the BeiDou (BD navigation system can provide high navigation precision in most scenarios, the signal from satellites is easily degraded because of buildings or thick foliage. To solve this problem, a tightly-coupled BD/MEMS (Micro-Electro-Mechanical Systems integration algorithm is proposed in this paper, and a prototype was built for implementing the integrated system. The extensive experiments prove that the BD/MEMS system performs well in different environments, such as an open sky environment and a playground surrounded by trees and thick foliage. The proposed algorithm is able to provide continuous and reliable positioning service for pedestrian outdoors and thereby has wide practical application.

  6. Application of recombinant Pediococcus acidilactici BD16 (fcs⁺/ech⁺) in malolactic fermentation.

    Science.gov (United States)

    Kaur, Baljinder; Kumar, Balvir; Kaur, Gaganjot; Chakraborty, Debkumar; Kaur, Kiranjeet

    2015-04-01

    This study was conducted to enhance flavor characteristics of wine by malolactic fermentation using recombinant Pediococcus acidilactici BD16 (fcs (+)/ech (+)) encoding synthetic genes of feruloyl-CoA synthetase and enoyl-CoA hydratase. After malolactic fermentation, wine phenolics were characterized using LCMS-ESI technique and a significant improvement in the antioxidant activity and flavor characteristics of wine was observed due to increased concentration of cinnamic acid derivatives. This proof of concept study highlights the role of recombinant P. acidilactici BD16 (fcs (+)/ech (+)) in improving flavor as well as aroma of wine due to production of several phenolic derivatives during secondary fermentation. A novel metabolic pathway was predicted from mass spectral analysis data that indicates biotransformation of cinnamic acid and derivatives into apigenin, catechin, coniferyl aldehyde, cyanidin, hydroxybenzoic acids, laricitrin, luteolin, malvidin 3-glucoside, myricetin, naringenin, pelargonin, piceatannol, querecitin, and vanillin that not only increased the overall consumer appreciation but also improved nutritional and probably the therapeutic properties of wines. This is a first evidence-based study where role of recombinant P. acidilactici BD16 (fcs (+)/ech (+)) in the wine secondary fermentation has been elucidated.

  7. Identification and characterization of the RouenBd1987 Babesia divergens Rhopty-Associated Protein 1.

    Directory of Open Access Journals (Sweden)

    Marilis Rodriguez

    Full Text Available Human babesiosis is caused by one of several babesial species transmitted by ixodid ticks that have distinct geographical distributions based on the presence of competent animal hosts. The pathology of babesiosis, like malaria, is a consequence of the parasitaemia which develops through the cyclical replication of Babesia parasites in a patient's red blood cells, though symptoms typically are nonspecific. We have identified the gene encoding Rhoptry-Associated Protein -1 (RAP-1 from a human isolate of B. divergens, Rouen1987 and characterized its protein product at the molecular and cellular level. Consistent with other Babesia RAP-1 homologues, BdRAP-1 is expressed as a 46 kDa protein in the parasite rhoptries, suggesting a possible role in red cell invasion. Native BdRAP-1 binds to an unidentified red cell receptor(s that appears to be non-sialylated and non-proteinacious in nature, but we do not find significant reduction in growth with anti-rRAP1 antibodies in vitro, highlighting the possibility the B. divergens is able to use alternative pathways for invasion, or there is an alternative, complementary, role for BdRAP-1 during the invasion process. As it is the parasite's ability to recognize and then invade host cells which is central to clinical disease, characterising and understanding the role of Babesia-derived proteins involved in these steps are of great interest for the development of an effective prophylaxis.

  8. Fixed Combination Aerosol Foam Calcipotriene 0.005% (Cal) Plus Betamethasone Dipropionate 0.064% (BD) is More Efficacious than Cal or BD Aerosol Foam Alone for Psoriasis Vulgaris

    Science.gov (United States)

    Tyring, Stephen; Bukhalo, Michael; Alonso-Llamazares, Javier; Olesen, Martin; Lowson, David; Yamauchi, Paul

    2016-01-01

    Objective: To evaluate the efficacy of fixed combination aerosol foam calcipotriene 0.005% (Cal) plus betamethasone dipropionate 0.064% (BD). Design: Patients were randomized (100:101:101) to receive Cal/BD foam, Cal foam, or BD foam once daily for four weeks. Setting: Twenty-eight United States centers. Participants: 302 patients (≥18 years) with Psoriasis vulgaris (plaque Psoriasis; ≥mild disease severity by physicians global assessment). Measurements: Treatment success of the body (“clear”/”almost clear” from baseline moderate/severe disease; “clear” from baseline mild disease). Involved scalp treatment success was an additional endpoint. Results: Most patients (76%) had moderate Psoriasis of the body (66% for scalp). At Week 4, 45 percent of Cal/BD foam patients achieved treatment success, significantly more than Cal foam (14.9%; OR 4.34 [95%CI 2.16,8.72] Pfoam (30.7%; 1.81 [1.00,3.26] P=0.047). Fifty-three percent of Cal/BD foam patients achieved treatment success of the scalp, significantly greater than Cal foam (35.6%; 1.91 [1.09,3.35] P=0.021), but not BD foam (47.5%; 1.24 [0.71,2.16] P=0.45). Mean modified Psoriasis area and severity index (population baseline 7.6) improved in all groups, with statistically significant differences in Week 4 Cal/BD foam score (2.37) versus Cal foam (4.39; mean difference -2.03 [-2.63][-1.43] Pfoam (3.37; -1.19 [-1.80][-0.59] Pfoam was significantly more effective than Cal foam and BD foam in providing treatment success at Week 4 and effective on involved scalp. Trial registration: NCT01536938. PMID:27313822

  9. Validity and reliability of the Brief version of Quality of Life in Bipolar Disorder" (Bref QoL.BD) among Chinese bipolar patients.

    Science.gov (United States)

    Xiao, Lin; Gao, Yulin; Zhang, Lili; Chen, Peiyun; Sun, Xiaojia; Tang, Siyuan

    2016-03-15

    Previous literatures on quality of life (QoL) in bipolar disorder (BD) strongly suggested that a disease-specific QoL measure for patients with BD should be developed to evaluate QoL more specifically and reliably. To our knowledge, "Quality of Life in Bipolar Disorder" (QoL.BD) is the first and only questionnaire produced to specifically measure QoL in people with BD. In China, there is no disease-targeted measure available to specifically measure QoL in Chinese patients with BD. The aim of the study is to revise and validate the brief version of the QoL.BD (Bref QoL.BD ) into Chinese version. All the items of the Bref QoL.BD was translated into Chinese language, using the Brislin translation mode. The questionnaire was administered to a total sample of 231 subjects, including 101 BD patients and 130 healthy controls, to test the psychometric properties of Bref QoL.BD (e.g. internal consistency, retest reliability, content validity, item analysis, confirmatory factor analysis, criterion validity, convergent validity, discriminative validity and feasibility). The Chinese version of the Bref QoL.BD had very high internal consistency (Cronbach's alpha=0.815) and retest reliability (intraclass correlation coefficient (ICC )=0.808). Confirmatory factor analysis (CFA) validated the original one-factor structure. The direction and magnitude of correlations with 36-item Short-Form Health Survey (SF-36; rs= 0.313, Psize from only one tertiary care center. And BD patients enrolled were euthymic, excluding the acute BD patients. The Chinese version of the Bref QoL.BD is a feasible, reliable and valid tool for the assessment of QoL for Chinese BD patients. Copyright © 2015 Elsevier B.V. All rights reserved.

  10. Detection of Trichomonas vaginalis DNA by Use of Self-Obtained Vaginal Swabs with the BD ProbeTec Qx Assay on the BD Viper System

    Science.gov (United States)

    Williams, James A.; Taylor, Stephanie N.; Cammarata, Catherine L.; Rivers, Charles A.; Body, Barbara A.; Nye, Melinda; Fuller, Deanna; Schwebke, Jane R.; Barnes, Mathilda; Gaydos, Charlotte A.

    2014-01-01

    Trichomonas vaginalis is the most prevalent nonviral sexually transmitted infection worldwide, and improved diagnostic methods are critical for controlling this pathogen. Diagnostic assays that can be used in conjunction with routine chlamydia/gonorrhea nucleic acid-based screening are likely to have the most impact on disease control. Here we describe the performance of the new BD T. vaginalis Qx (TVQ) amplified DNA assay, which can be performed on the automated BD Viper system. We focus on data from vaginal swab samples, since this is the specimen type routinely used for traditional trichomonas testing and the recommended specimen type for chlamydia/gonorrhea screening. Vaginal swabs were obtained from women attending sexually transmitted disease or family planning clinics at 7 sites. Patient-collected vaginal swabs were tested by the TVQ assay, and the Aptima T. vaginalis (ATV) assay was performed using clinician-collected vaginal swabs. Additional clinician-collected vaginal swabs were used for the wet mount and culture methods. Analyses included comparisons versus the patient infection status (PIS) defined by positive results with the wet mount method or culture, direct comparisons assessed with κ scores, and latent class analysis (LCA) as an unbiased estimator of test accuracy. Data from 838 women, 116 of whom were infected with T. vaginalis, were analyzed. The TVQ assay sensitivity and specificity estimates based on the PIS were 98.3% and 99.0%, respectively. The TVQ assay was similar to the ATV assay (κ = 0.938) in direct analysis. LCA estimated the TVQ sensitivity and specificity as 98.3 and 99.6%, respectively. The TVQ assay performed well using self-collected vaginal swabs, the optimal sample type, as recommended by the CDC for chlamydia/gonorrhea screening among women. PMID:24391200

  11. Structural and functional characterization of hBD-1(Ser35), a peptide deduced from a DEFB1 polymorphism.

    Science.gov (United States)

    Circo, Raffaella; Skerlavaj, Barbara; Gennaro, Renato; Amoroso, Antonio; Zanetti, Margherita

    2002-04-26

    beta-Defensins are mammalian antimicrobial peptides that share a unique disulfide-bonding motif of six conserved cysteines. An intragenic polymorphism of the DEFB1 gene that changes a highly conserved Cys to Ser in the peptide coding region has recently been described. The deduced peptide cannot form three disulfide bonds, as one of the cysteines is unpaired. We have determined the cysteine connectivities of a corresponding synthetic hBD-1(Ser35) peptide, investigated the structure by circular dichroism spectroscopy, and assayed the in vitro antimicrobial activity. Despite a different arrangement of the disulfides, hBD-1(Ser35) proved as active as hBD-1 against the microorganisms tested. This activity likely depends on the ability of hBD-1(Ser35) to adopt an amphipathic conformation in hydrophobic environment, similar to the wild type peptide, as suggested by CD spectroscopy.

  12. Effect of chloride substitution on the order–disorder transition in NaBH4 and Na11BD4

    International Nuclear Information System (INIS)

    Olsen, Jørn Eirik; Karen, Pavel; Sørby, Magnus H.; Hauback, Bjørn C.

    2014-01-01

    Graphical abstract: Interactions that order the BD 4 - tetrahedra below the order–disorder transition became increasingly frustrated by the solute in the Na( 11 BD 4 ) 1−x Cl x solid solutions, and the order disappears at x = 0.158. Highlights: • The order–disorder transition temperature for Na(BH 4 ) 1−x Cl x and Na( 11 BD 4 ) 1−x Cl x is highly dependent on the Cl-content, x. • The transition is characterized by DSC for Na( 11 BD 4 ) 1−x Cl x for x = 0, 0.10 and 0.15. • No transition is observed for x ⩾ 0.20 on cooling to 8 K. • The crystal structures are reported for Na 11 BD 4 at room temperature and 8 K and Na( 11 BD 4 ) 1−x Cl x (x = 0.10, 0.15, 0.20 and 0.25) at 8 K from powder neutron diffraction. -- Abstract: Phase transition associated with anion disordering over two orientations in Na 11 BD 4 (NaBH 4 ) and its solid solutions with NaCl, Na( 11 BD 4 ) 1−x Cl x , is investigated with powder diffraction (neutron and synchrotron radiation), differential scanning calorimetry and Raman spectroscopy. Upon heating, the transition temperature extrapolated to zero rate of heating is 192.2 K for Na 11 BD 4 , ΔS = 4.41 J/mol K, hysteresis 1.7 K and the volume increase 0.43%. Thermal parameters of the transition in Na( 11 BD 4 ) 1−x Cl x follow a colligative-property model of an ideal solution, with x = 0.158(1) as the critical concentration at which the ordering interactions and the transition itself are eliminated. On approaching this limit, the tetragonal distortion of the ordered structure decreases somewhat towards the cubic average, and this is associated with a partial disorder of the tetrahedral anions seen by diffraction methods. In fact, a 3% disorder is already present in the pure solvent of the solid solution (Na 11 BD 4 ) at 8 K

  13. Use of the BD-100R as a neutron spectrometer through applied pressure variation.

    Science.gov (United States)

    White, B; Ebert, D; Munno, F

    1991-05-01

    A study was undertaken to demonstrate the feasibility of using the well-characterized BD-100R neutron bubble dosimeter as a neutron spectrometer in low-level radiation fields. The BD-100R dosimeters used in this work consisted of a test tube containing an elastic polymer with interspersed droplets of two types of Freon: Freon-12 and Freon-114. Each superheated liquid droplet is a potential nucleation site, with the minimum energy needed to form a bubble at the nucleation site being inversely proportional to the square of the difference between the applied and the vapor pressure (i.e., Emin alpha(delta P)-2. For a given dose, the number of bubbles formed continually decreases with increasing applied pressure, until a pressure is reached where no bubbles are formed, since the energy transferred can no longer vaporize the Freon. This investigation is intended to demonstrate the feasibility of measuring an unknown spectrum utilizing the dosimeter response (number of bubbles formed) as a function of the neutron energy (applied pressure). A set of 12 dosimeters was exposed under various applied pressures in a well-characterized neutron energy spectrum at the East Beam Port (EBP) of the Maryland University Training Reactor (MUTR). The dosimeters were placed inside a pressure chamber that could accommodate up to 18 dosimeters. Energy response coefficients (cross-sections) were obtained by spectral unfolding techniques on the known spectrum. The same set of dosimeters were then irradiated using a paraffin-moderated Pu/Be source. Measured spectral estimates obtained using the response coefficients were compared with numerical computations generated using the ANISN computer code. The results indicate that further research using the BD-100R as a neutron spectrometer in low radiation fields is warranted.

  14. B_d and B_s mixing: mass and width differences and CP violation

    OpenAIRE

    Nierste, Ulrich

    2006-01-01

    B-B-bar mixing involves three physical parameters: the magnitudes of the off-diagonal elements of the mass and decay matrices and their relative phase. They are related to the mass and width differences between the mass eigenstates and to the CP asymmetry in flavour-specific decays, a_fs. Introducing a new operator basis I present new, more precise theory predictions for the width differences in the B_s and B_d systems: in the Standard Model one finds Delta Gamma_s = 0.088 +/- 0.017 ps^{-1} a...

  15. BD-22deg3467, a DAO-type Star Exciting the Nebula Abell 35

    Science.gov (United States)

    Ziegler, M.; Rauch, T.; Werner, K.; Koppen, J.; Kruk, J. W.

    2013-01-01

    Spectral analyses of hot, compact stars with non-local thermodynamical equilibrium (NLTE) model-atmosphere techniques allow the precise determination of photospheric parameters such as the effective temperature (T(sub eff)), the surface gravity (log g), and the chemical composition. The derived photospheric metal abundances are crucial constraints for stellar evolutionary theory. Aims. Previous spectral analyses of the exciting star of the nebula A35, BD-22deg3467, were based on He+C+N+O+Si+Fe models only. For our analysis, we use state-of-the-art fully metal-line blanketed NLTE model atmospheres that consider opacities of 23 elements from hydrogen to nickel. We aim to identify all observed lines in the ultraviolet (UV) spectrum of BD-22deg3467 and to determine the abundances of the respective species precisely. Methods. For the analysis of high-resolution and high signal-to-noise ratio (S/N) far-ultraviolet (FUSE) and UV (HST/STIS) observations, we combined stellar-atmosphere models and interstellar line-absorption models to fully reproduce the entire observed UV spectrum. Results. The best agreement with the UV observation of BD-22deg3467 is achieved at T(sub eff) = 80 +/- 10 kK and log g = 7.2 +/- 0.3. While T(sub eff) of previous analyses is verified, log g is significantly lower. We re-analyzed lines of silicon and iron (1/100 and about solar abundances, respectively) and for the first time in this star identified argon, chromium, manganese, cobalt, and nickel and determined abundances of 12, 70, 35, 150, and 5 times solar, respectively. Our results partially agree with predictions of diffusion models for DA-type white dwarfs. A combination of photospheric and interstellar line-absorption models reproduces more than 90% of the observed absorption features. The stellar mass is M approx. 0.48 Solar Mass. Conclusions. BD.22.3467 may not have been massive enough to ascend the asymptotic giant branch and may have evolved directly from the extended horizontal branch

  16. Jofre de Foixa, “Subrafusa ab cabirol” (BdT 304.4

    Directory of Open Access Journals (Sweden)

    Wendy Pfeffer

    2011-11-01

    Full Text Available Jofre de Foixa’s verses “Subrafusa ab cabirol” (BdT 304.4 merit attention for the light the two ‘coblas’ shed on Jofre’s familiarity with his Occitan predecessors, for the information the text provides regarding food practices in his time, and for the use of a food term rare in the Iberian peninsula, “unyo”. The resources of culinary history, specifically fourteenth- and fifteenth-century Languedocian and Catalan cookbooks, allow us better to understand the meaning of Jofre’s lyric.

  17. BD-22°3467, a DAO-type star exciting the nebula Abell 35

    Science.gov (United States)

    Ziegler, M.; Rauch, T.; Werner, K.; Köppen, J.; Kruk, J. W.

    2012-12-01

    Context. Spectral analyses of hot, compact stars with non-local thermodynamical equilibrium (NLTE) model-atmosphere techniques allow the precise determination of photospheric parameters such as the effective temperature (Teff), the surface gravity (log g), and the chemical composition. The derived photospheric metal abundances are crucial constraints for stellar evolutionary theory. Aims: Previous spectral analyses of the exciting star of the nebula A 35, BD-22°3467, were based on He+C+N+O+Si+Fe models only. For our analysis, we use state-of-the-art fully metal-line blanketed NLTE model atmospheres that consider opacities of 23 elements from hydrogen to nickel. We aim to identify all observed lines in the ultraviolet (UV) spectrum of BD-22°3467 and to determine the abundances of the respective species precisely. Methods: For the analysis of high-resolution and high signal-to-noise ratio (S/N) far-ultraviolet (FUSE) and UV (HST/STIS) observations, we combined stellar-atmosphere models and interstellar line-absorption models to fully reproduce the entire observed UV spectrum. Results: The best agreement with the UV observation of BD-22°3467 is achieved at Teff = 80 ± 10 kK and log g = 7.2 ± 0.3. While Teff of previous analyses is verified, log g is significantly lower. We re-analyzed lines of silicon and iron (1/100 and about solar abundances, respectively) and for the first time in this star identified argon, chromium, manganese, cobalt, and nickel and determined abundances of 12, 70, 35, 150, and 5 times solar, respectively. Our results partially agree with predictions of diffusion models for DA-type white dwarfs. A combination of photospheric and interstellar line-absorption models reproduces more than 90% of the observed absorption features. The stellar mass is M ≈ 0.48 M⊙. Conclusions.BD-22°3467 may not have been massive enough to ascend the asymptotic giant branch and may have evolved directly from the extended horizontal branch to the white dwarf

  18. Effect of hBD2 genetically modified dermal multipotent stem cells on repair of infected irradiated wounds

    International Nuclear Information System (INIS)

    Zong Zhaowen; Li Nan; Xiao Taoyuan

    2010-01-01

    Deficiencies in repair cells and infection are two of the main factors that can hinder the process of wound healing. In the present study, we investigated the ability of human beta-defensin-2 (hBD2) genetically modified dermal multipotent stem cells (dMSCs) to accelerate the healing irradiated wounds complicated by infections. An hBD2 adenovirus expression vector (Adv-hBD2) was firstly constructed and used to infect dMSCs. The antibacterial activity of the supernatant was determined by Kirby-Bauer method and macrodilution broth assay. Time to complete wound healing, residual percentage of wound area, and the number of bacteria under the scar were measured to assess the effects of Adv-hBD2-infected dMSC transplantation on the healing of irradiated wounds complicated by Pseudomonas aeruginosa infection. Results showed that the supernatant from Adv-hBD2-infected dMSCs had obvious antibacterial effects. Transplantation of Adv-hBD2-infected dMSCs killed bacteria in the wound. The complete wound healing time was 19.8±0.45 days, which was significantly shorter than in the control groups (P<0.05). From 14 days after transplantation, the residual wound area was smaller in the experimental group than in the control groups (P<0.05). In conculsion, we found that transplantation of hBD2 genetically modified dMSCs accelerated the healing of wounds complicated by P. aeruginosa infection in whole body irradiated rats. (author)

  19. Structure and Biological Function of the RNA Pyrophosphohydrolase BdRppH from Bdellovibrio bacteriovorus

    Energy Technology Data Exchange (ETDEWEB)

    Messing, S.; Gabelli, S; Liu, Q; Celesnik, H; Belasco, J; Pineiro, S; Amzel, L

    2009-01-01

    Until recently, the mechanism of mRNA decay in bacteria was thought to be different from that of eukaryotes. This paradigm changed with the discovery that RppH (ORF176/NudH/YgdP), an Escherichia coli enzyme that belongs to the Nudix superfamily, is an RNA pyrophosphohydrolase that initiates mRNA decay by cleaving pyrophosphate from the 5?-triphosphate. Here we report the 1.9 A resolution structure of the Nudix hydrolase BdRppH from Bdellovibrio bacteriovorus, a bacterium that feeds on other Gram-negative bacteria. Based on the structure of the enzyme alone and in complex with GTP-Mg2+, we propose a mode of RNA binding similar to that of the nuclear decapping enzyme from Xenopus laevis, X29. In additional experiments, we show that BdRppH can indeed function in vitro and in vivo as an RNA pyrophosphohydrolase. These findings set the basis for the identification of possible decapping enzymes in other bacteria.

  20. Cyanide-insensitive quinol oxidase (CIO) from Gluconobacter oxydans is a unique terminal oxidase subfamily of cytochrome bd.

    Science.gov (United States)

    Miura, Hiroshi; Mogi, Tatsushi; Ano, Yoshitaka; Migita, Catharina T; Matsutani, Minenosuke; Yakushi, Toshiharu; Kita, Kiyoshi; Matsushita, Kazunobu

    2013-06-01

    Cyanide-insensitive terminal quinol oxidase (CIO) is a subfamily of cytochrome bd present in bacterial respiratory chain. We purified CIO from the Gluconobacter oxydans membranes and characterized its properties. The air-oxidized CIO showed some or weak peaks of reduced haemes b and of oxygenated and ferric haeme d, differing from cytochrome bd. CO- and NO-binding difference spectra suggested that haeme d serves as the ligand-binding site of CIO. Notably, the purified CIO showed an extraordinary high ubiquinol-1 oxidase activity with the pH optimum of pH 5-6. The apparent Vmax value of CIO was 17-fold higher than that of G. oxydans cytochrome bo3. In addition, compared with Escherichia coli cytochrome bd, the quinol oxidase activity of CIO was much more resistant to cyanide, but sensitive to azide. The Km value for O2 of CIO was 7- to 10-fold larger than that of G. oxydans cytochrome bo3 or E. coli cytochrome bd. Our results suggest that CIO has unique features attributable to the structure and properties of the O2-binding site, and thus forms a new sub-group distinct from cytochrome bd. Furthermore, CIO of acetic acid bacteria may play some specific role for rapid oxidation of substrates under acidic growth conditions.

  1. Increased illness burden in women with comorbid bipolar and premenstrual dysphoric disorder: data from 1 099 women from STEP-BD study.

    Science.gov (United States)

    Slyepchenko, A; Frey, B N; Lafer, B; Nierenberg, A A; Sachs, G S; Dias, R S

    2017-11-01

    The impact of comorbid premenstrual dysphoric disorder (PMDD) in women with bipolar disorder (BD) is largely unknown. We compared illness characteristics and female-specific mental health problems between women with BD with and without PMDD. A total of 1 099 women with BD who participated in the Systematic Treatment Enhancement Program for Bipolar Disorder (STEP-BD) were studied. Psychiatric diagnoses and illness characteristics were assessed using the Mini International Neuropsychiatric Interview. Female-specific mental health was assessed using a self-report questionnaire developed for STEP-BD. PMDD diagnosis was based on DSM-5 criteria. Women with comorbid BD and PMDD had an earlier onset of bipolar illness (P associated with higher proportion of panic disorder, post-traumatic stress disorder, generalized anxiety disorder, bulimia nervosa, substance abuse, and adult attention deficit disorder (all P associated with worse clinical outcomes and increased illness burden. © 2017 John Wiley & Sons A/S. Published by John Wiley & Sons Ltd.

  2. Cytochrome bd-I in Escherichia coli is less sensitive than cytochromes bd-II or bo'' to inhibition by the carbon monoxide-releasing molecule, CORM-3: N-acetylcysteine reduces CO-RM uptake and inhibition of respiration.

    Science.gov (United States)

    Jesse, Helen E; Nye, Tacita L; McLean, Samantha; Green, Jeffrey; Mann, Brian E; Poole, Robert K

    2013-09-01

    CO-releasing molecules (CO-RMs) are potential therapeutic agents, able to deliver CO - a critical gasotransmitter - in biological environments. CO-RMs are also effective antimicrobial agents; although the mechanisms of action are poorly defined, haem-containing terminal oxidases are primary targets. Nevertheless, it is clear from several studies that the effects of CO-RMs on biological systems are frequently not adequately explained by the release of CO: CO-RMs are generally more potent inhibitors than is CO gas and other effects of the molecules are evident. Because sensitivity to CO-RMs cannot be predicted by sensitivity to CO gas, we assess the differential susceptibilities of strains, each expressing only one of the three terminal oxidases of E. coli - cytochrome bd-I, cytochrome bd-II and cytochrome bo', to inhibition by CORM-3. We present the first sensitive measurement of the oxygen affinity of cytochrome bd-II (Km 0.24μM) employing globin deoxygenation. Finally, we investigate the way(s) in which thiol compounds abolish the inhibitory effects of CORM-2 and CORM-3 on respiration, growth and viability, a phenomenon that is well documented, but poorly understood. We show that a strain expressing cytochrome bd-I as the sole oxidase is least susceptible to inhibition by CORM-3 in its growth and respiration of both intact cells and membranes. Growth studies show that cytochrome bd-II has similar CORM-3 sensitivity to cytochrome bo'. Cytochromes bo' and bd-II also have considerably lower affinities for oxygen than bd-I. We show that the ability of N-acetylcysteine to abrogate the toxic effects of CO-RMs is not attributable to its antioxidant effects, or prevention of CO targeting to the oxidases, but may be largely due to the inhibition of CO-RM uptake by bacterial cells. A strain expressing cytochrome bd-I as the sole terminal oxidase is least susceptible to inhibition by CORM-3. N-acetylcysteine is a potent inhibitor of CO-RM uptake by E. coli. Rational design

  3. Cytochrome bd-I in Escherichia coli is less sensitive than cytochromes bd-II or bo′' to inhibition by the carbon monoxide-releasing molecule, CORM-3☆☆☆

    Science.gov (United States)

    Jesse, Helen E.; Nye, Tacita L.; McLean, Samantha; Green, Jeffrey; Mann, Brian E.; Poole, Robert K.

    2013-01-01

    Background: CO-releasing molecules (CO-RMs) are potential therapeutic agents, able to deliver CO – a critical gasotransmitter – in biological environments. CO-RMs are also effective antimicrobial agents; although the mechanisms of action are poorly defined, haem-containing terminal oxidases are primary targets. Nevertheless, it is clear from several studies that the effects of CO-RMs on biological systems are frequently not adequately explained by the release of CO: CO-RMs are generally more potent inhibitors than is CO gas and other effects of the molecules are evident. Methods: Because sensitivity to CO-RMs cannot be predicted by sensitivity to CO gas, we assess the differential susceptibilities of strains, each expressing only one of the three terminal oxidases of E. coli — cytochrome bd-I, cytochrome bd-II and cytochrome bo′, to inhibition by CORM-3. We present the first sensitive measurement of the oxygen affinity of cytochrome bd-II (Km 0.24 μM) employing globin deoxygenation. Finally, we investigate the way(s) in which thiol compounds abolish the inhibitory effects of CORM-2 and CORM-3 on respiration, growth and viability, a phenomenon that is well documented, but poorly understood. Results: We show that a strain expressing cytochrome bd-I as the sole oxidase is least susceptible to inhibition by CORM-3 in its growth and respiration of both intact cells and membranes. Growth studies show that cytochrome bd-II has similar CORM-3 sensitivity to cytochrome bo′. Cytochromes bo′ and bd-II also have considerably lower affinities for oxygen than bd-I. We show that the ability of N-acetylcysteine to abrogate the toxic effects of CO-RMs is not attributable to its antioxidant effects, or prevention of CO targeting to the oxidases, but may be largely due to the inhibition of CO-RM uptake by bacterial cells. Conclusions: A strain expressing cytochrome bd-I as the sole terminal oxidase is least susceptible to inhibition by CORM-3. N-acetylcysteine is a

  4. BdCIPK31, a Calcineurin B-Like Protein-Interacting Protein Kinase, Regulates Plant Response to Drought and Salt Stress

    Directory of Open Access Journals (Sweden)

    Qingchen Luo

    2017-07-01

    Full Text Available Calcineurin B-like protein interacting protein kinases (CIPKs are vital elements in plant abiotic stress signaling pathways. However, the functional mechanism of CIPKs has not been understood clearly, especially in Brachypodium distachyon, a new monocot model plant. In this study, BdCIPK31, a CIPK gene from B. distachyon was characterized. BdCIPK31 was downregulated by polyethylene glycol, NaCl, H2O2, and abscisic acid (ABA treatments. Transgenic tobacco plants overexpressing BdCIPK31 presented improved drought and salt tolerance, and displayed hypersensitive response to exogenous ABA. Further investigations revealed that BdCIPK31 functioned positively in ABA-mediated stomatal closure, and transgenic tobacco exhibited reduced water loss under dehydration conditions compared with the controls. BdCIPK31 also affected Na+/K+ homeostasis and root K+ loss, which contributed to maintain intracellular ion homeostasis under salt conditions. Moreover, the reactive oxygen species scavenging system and osmolyte accumulation were enhanced by BdCIPK31 overexpression, which were conducive for alleviating oxidative and osmotic damages. Additionally, overexpression of BdCIPK31 could elevate several stress-associated gene expressions under stress conditions. In conclusion, BdCIPK31 functions positively to drought and salt stress through ABA signaling pathway. Overexpressing BdCIPK31 functions in stomatal closure, ion homeostasis, ROS scavenging, osmolyte biosynthesis, and transcriptional regulation of stress-related genes.

  5. Photometric anomalies in the metal-deficient red giants, BD -18 deg 5550 and CD -38 deg 245

    Energy Technology Data Exchange (ETDEWEB)

    Twarog, B.A.; Anthony-Twarog, B.J. (Kansas Univ., Lawrence (USA) Obsevatorio Interamericano de Cerro Tololo, La Serena (Chile))

    1991-01-01

    Three distinct anomalies affecting the red giants CD -38 deg 245 and BD -18 deg 5550 are examined with reference to new uvby photometry data for metal-deficient red giants. In particular, it is demonstrated that shortward of 4200 A, CD -38 deg 245 exhibits an ultraviolet deficiency for a star of its temperature when compared with stars of higher metallicity. In contrast, BD -18 deg 5550 may contain an ultraviolet excess. Another problem is that CD -38 deg 245 is a variable star in the ultraviolet. Possible explanations for these anomalies are considered. 62 refs.

  6. [Therapeutic management of bipolar disorder in France and Europe: a multinational longitudinal study (WAVE-bd)].

    Science.gov (United States)

    Bellivier, F; Delavest, M; Coulomb, S; Figueira, M L; Langosch, J M; Souery, D; Vieta, E

    2014-10-01

    Bipolar disorder is a complex disease which requires multiple healthcare resources and complex medical care programs including pharmacological and non pharmacological treatment. If mood stabilizers remain the corner stone for bipolar disorder treatment, the development of atypical antipsychotics and their use as mood stabilizers has significantly modified therapeutic care. At the present time, psychiatrists have a large variety of psychotropic drugs for bipolar disorder: mood stabilizers, atypical antipsychotics, antidepressants, anxiolytics… However, despite the publication of guidelines on pharmacological treatment, with a high degree of consensus, everyday clinical practices remain heterogeneous. Moreover, there are few longitudinal studies to describe therapeutic management of bipolar disorder, whatever the phase of the disease is. Indeed, most of the studies are carried out on a specific phase of the disease or treatment. And there is no study comparing French and European practices. In this paper, we aim to present the comparison of the management of pharmacological treatments of bipolar disorder between France and Europe, using the data of the observational Wide AmbispectiVE study of the clinical management and burden of bipolar disorder (WAVE-bd study). The WAVE-bd study is a multinational, multicentre and non-interventional cohort study of patients diagnosed with BD type I or type II, according to DSM IV-TR criteria, in any phase of the disorder, who have experienced at least one mood event during the 12 months before enrolment. In total, 2507 patients have been included across 8 countries of Europe (480 in France). Data collection was retrospective (from 3 to 12 months), but also prospective (from 9 to 15 months) for a total study length of 12 to 27 months. Main outcome measures were the healthcare resource use and pharmacological treatments. Our results show differences in the therapeutic management of bipolar disorder between France and other European

  7. Near-Earth Asteroids 2006 RH120 AND 2009 BD: Proxies for Maximally Accessible Objects?

    Science.gov (United States)

    Barbee, Brent W.; Chodas, Paul W.

    2015-01-01

    NASA's Near-Earth Object Human Space Flight Accessible Targets Study (NHATS) has identified over 1,400 of the approximately 12,800 currently known near-Earth asteroids (NEAs) as more astrodynamically accessible, round-trip, than Mars. Hundreds of those approximately 1,400 NEAs can be visited round-trip for less change-in-velocity than the lunar surface, and dozens can be visited round-trip for less change-in-velocity than low lunar orbit. How accessible might the millions of undiscovered NEAs be? We probe that question by investigating the hypothesis that NEAs 2006 RH120 and 2009 BD are proxies for the most accessible NEAs we would expect to find, and describing possible future NEA population model studies.

  8. Study of drying process of paint by dynamic speckle with B/D pixel counting technique

    Science.gov (United States)

    Balamurugan, R.; Rajarajan, G.

    2017-11-01

    The aim of the work is the assessment of drying process of latex paint by dynamic Laser speckle method. The basic concept of dynamic speckle technique is described. Laser light scattering by water borne sample is a time dependent surface activity. The variation of laser speckle intensity is due to the change of refractive index and the particle movements of the latex paint. A novel method, B/D counting technique to measure the dynamic activity of drying paint using co-occurrence matrix of Time History of Speckle Pattern (THSP) is presented. The result of drying process of latex paint by dynamic laser speckle method is compared with the gravimetric method and agreed well.

  9. Multicenter Evaluation of the BD Phoenix Automated Microbiology System for Antimicrobial Susceptibility Testing of Streptococcus Species▿

    Science.gov (United States)

    Richter, Sandra S.; Howard, Wanita J.; Weinstein, Melvin P.; Bruckner, David A.; Hindler, Janet F.; Saubolle, Michael; Doern, Gary V.

    2007-01-01

    This multicenter study evaluated the BD Phoenix Automated Microbiology System STREP panel (BD Diagnostic Systems). Antimicrobial susceptibility testing (AST) with 13 agents was performed on 2,013 streptococci (938 Streptococcus pneumoniae isolates; 396 group B streptococci [GBS]; 369 viridans group streptococci [VGS]; 290 beta-hemolytic streptococcus groups A, C, and G; and 20 other streptococci) with the Phoenix system and a broth microdilution reference method. Clinical and challenge isolates were tested against cefepime, cefotaxime (CTX), ceftriaxone (CTR), clindamycin (CLI), erythromycin (ERY), gatifloxacin, levofloxacin, linezolid, meropenem, penicillin (PEN), tetracycline (TET), trimethoprim-sulfamethoxazole, and vancomycin. Clinical isolates with major errors or very major errors (VMEs) were retested in duplicate by both methods. The final results for clinical isolates showed the following trends. For all of the organism-antimicrobial agent combinations tested, categorical agreement (CA) was 92 to 100%, with one exception—VGS-PEN (87% CA; all errors were minor). For S. pneumoniae, there was one major error with CLI (0.1%) and one or two VMEs with CTX (4%), CTR (4.5%), ERY (0.9%), and TET (0.7%). For groups A, C, and G, the CA was 97 to 100% and the only VMEs were resolved by additional reference laboratory testing. For GBS, there was only one VME (TET, 0.3%) and D-zone testing of 23 isolates with CLI major errors (one isolate unavailable) revealed inducible CLI resistance. For VGS, the major error rates were 0 to 3% and VMEs occurred with seven agents (3.5 to 7.1%). The mean times required for organism groups to generate results ranged from 8.4 to 9.4 h. The Phoenix system provided reliable and rapid AST results for most of the organism-antimicrobial agent combinations tested. PMID:17652483

  10. 13 CFR 124.203 - What must a concern submit to apply to the 8(a) BD program?

    Science.gov (United States)

    2010-01-01

    ... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false What must a concern submit to apply to the 8(a) BD program? 124.203 Section 124.203 Business Credit and Assistance SMALL BUSINESS... to, financial statements, Federal personal and business tax returns, and personal history statements...

  11. Omeprazole (20 mg o.m.) versus ranitidine (150 mg b.d.) in duodenal ulcer healing and pain relief

    NARCIS (Netherlands)

    Mulder, C. J.; Tijtgat, G. N.; Cluysenaer, O. J.; Nicolai, J. J.; Meyer, W. W.; Hazenberg, B. P.; Vogten, A. J.; Gerrits, C.; Stuifbergen, W. H.

    1989-01-01

    The object of this double-blind, multicentre study was to compare duodenal ulcer healing rates after 2 to 4 weeks of treatment with either 20 mg omeprazole o.m. or 150 mg ranitidine b.d. One hundred and eighty-one patients were randomized: 91 received omeprazole and 90 received ranitidine. In a per

  12. 13 CFR 124.305 - What is suspension and how is a Participant suspended from the 8(a) BD program?

    Science.gov (United States)

    2010-01-01

    ... concern from receiving all Federal Government contracts, including 8(a) contracts. Business Development ... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false What is suspension and how is a Participant suspended from the 8(a) BD program? 124.305 Section 124.305 Business Credit and Assistance SMALL...

  13. Brachypodium distachyon line Bd3-1 resistance is elicited by the barley stripe mosaic virus triple gene block 1 movement protein

    NARCIS (Netherlands)

    Lee, M.Y.; Yan, L.J.; Gorter, F.A.; Kim, B.Y.T.; Cui, Y.; Hu, Y.; Yuan, C.; Grindheim, J.; Ganesan, U.; Liu, Z.Y.; Han, C.G.; Yu, J.L.; Li, D.W.; Jackson, A.O.

    2012-01-01

    Barley stripe mosaic virus North Dakota 18 (ND18), Beijing (BJ), Xinjiang (Xi), Type (TY) and CV21 strains are unable to infect the Brachypodium distachyon Bd3-1 inbred line, which harbours a resistance gene designated Bsr1, but the Norwich (NW) strain is virulent on Bd3-1. Analysis of ND18 and NW

  14. White matter abnormalities in the fornix are linked to cognitive performance in SZ but not in BD disorder: An exploratory analysis with DTI deterministic tractography.

    Science.gov (United States)

    Knöchel, Christian; Schmied, Claudia; Linden, David E J; Stäblein, Michael; Prvulovic, David; de A de Carvalho, Luiza; Harrison, Octavia; Barros, Paulo O; Carvalho, André F; Reif, Andreas; Alves, Gilberto S; Oertel-Knöchel, Viola

    2016-09-01

    In psychosis, white matter (WM) microstructural changes have been detected previously; however, direct comparisons of findings between bipolar (BD) and schizophrenia (SZ) patients are scarce. In this study, we employed deterministic tractography to reconstruct WM tracts in BD and SZ patients. Diffusion tensor imaging (DTI) data was carried out with n=32 euthymic BD type I patients, n=26 SZ patients and 30 matched healthy controls. Deterministic tractography using multiple indices of diffusion (fractional anisotropy (FA), tract volume (Vol), tract length (Le) and number of tracts (NofT)) were obtained from the fornix, the cingulum, the anterior thalamic radiation, and the corpus callosum bilaterally. We showed widespread WM microstructural changes in SZ, and changes in the corpus callosum, the left cingulum and the fornix in BD. Fornix fiber tracking scores were associated with cognitive performance in SZ, and with age and age at disease onset in the BD patient group. Although the influence of psychopharmacological drugs as biasing variables on morphological alterations has been discussed for SZ and BD, we did not observe a clear influence of drug exposure on our findings. These results confirm the assumption that SZ patients have more severe WM changes than BD patients. The findings also suggest a major role of WM changes in the fornix as important fronto-limbic connections in the etiology of cognitive symptoms in SZ, but not in BD. Copyright © 2016 Elsevier B.V. All rights reserved.

  15. Evidence for Fast Electron Transfer between the High-Spin Haems in Cytochrome bd-I from Escherichia coli.

    Science.gov (United States)

    Siletsky, Sergey A; Rappaport, Fabrice; Poole, Robert K; Borisov, Vitaliy B

    2016-01-01

    Cytochrome bd-I is one of the three proton motive force-generating quinol oxidases in the O2-dependent respiratory chain of Escherichia coli. It contains one low-spin haem (b558) and the two high-spin haems (b595 and d) as the redox-active cofactors. In order to examine the flash-induced intraprotein reverse electron transfer (the so-called ''electron backflow''), CO was photolyzed from the ferrous haem d in one-electron reduced (b5583+b5953+d2+-CO) cytochrome bd-I, and the fully reduced (b5582+b5952+d2+-CO) oxidase as a control. In contrast to the fully reduced cytochrome bd-I, the transient spectrum of one-electron reduced oxidase at a delay time of 1.5 μs is clearly different from that at a delay time of 200 ns. The difference between the two spectra can be modeled as the electron transfer from haem d to haem b595 in 3-4% of the cytochrome bd-I population. Thus, the interhaem electron backflow reaction induced by photodissociation of CO from haem d in one-electron reduced cytochrome bd-I comprises two kinetically different phases: the previously unnoticed fast electron transfer from haem d to haem b595 within 0.2-1.5 μs and the slower well-defined electron equilibration with τ ~16 μs. The major new finding of this work is the lack of electron transfer at 200 ns.

  16. Clinical and analytical performance of the BD Onclarity™ HPV assay for detection of CIN2+ lesions on SurePath samples

    DEFF Research Database (Denmark)

    Ejegod, Ditte Møller; Junge, Jette; Franzmann, Maria

    2016-01-01

    BACKGROUND: The novel BD Onclarity(TM) HPV assay (Onclarity) on the BD Viper™ LT system (BD Diagnostics, Sparks, MD), detects E6/E7 DNA from 13 high-risk HPV genotypes and HPV66. We compared the analytical and clinical performance of the Onclarity Assay to that of Hybrid Capture 2 and LINEAR ARRAY...... using adjudicated histological outcomes from Danish women referred for colposcopy. METHODS: 276 women from Copenhagen, Denmark were referred for colposcopy with abnormal cytology and/or a positive HPV test. Two samples for HPV analysis were taken in BD SurePath™ and in the BD cervical brush diluent (CBD......%, 17%, and 22%, for HC2, Onclarity and LA, respectively. CONCLUSION: Overall, the Onclarity HPV assay performed well on SurePath LBC and CBD media, with clinical sensitivity and specificity matching those of HC2 and LA....

  17. Agrowaste to vanillin conversion by a natural Pediococcus acidilactici strain BD16.

    Science.gov (United States)

    Chakraborty, Debkumar; Kaur, Baljinder; Obulisamy, Karthikeyan; Selvam, Ammaiyappan; Wong, Jonathan W C

    2017-07-01

    Owing to its flavoring, antimicrobial, antioxidant and anticarcinogenic nature, vanillin is widely used in foods, beverages, perfumes and pharmaceutical products. Ferulic acid (FA) is an important precursor of vanillin which is abundant in cereals like maize, rice and wheat and sugar beet. A major drawback of microbial vanillin production from FA is the degradation and biotransformation of toxic vanillin to other phenolic derivatives. The present study is undertaken to explore microbial vanillin production from FA precursor rice bran by employing vanillin-resistant Pediococcus acidilactici BD16, a natural lactic acid bacteria isolate. Extracellular, intracellular and cellular vanillin dehydrogenase activity was found least, which was minimized vanillin degradation, and the strain resists more than 5 g L -1 vanillin in the medium. A metabolomics approach was followed for the detection of FA, vanillin and other metabolites generated during fermentation of rice bran medium. A metabolic pathway was also predicted for vanillin biosynthesis. Approximately 1.06 g L -1 of crude vanillin was recovered from rice-bran-containing medium and this further offers scope for the industrial utilization of the organism and its genetic manipulation to enhance production of biovanillin.

  18. Application of recombinant Pediococcus acidilactici BD16 (fcs +/ech +) for bioconversion of agrowaste to vanillin.

    Science.gov (United States)

    Chakraborty, Debkumar; Selvam, Ammaiyappan; Kaur, Baljinder; Wong, Jonathan Woon Chung; Karthikeyan, Obulisamy Parthiba

    2017-07-01

    Biotechnological production of vanillin is gaining momentum as the natural synthesis of vanillin that is very expensive. Ferulic acid (FA), a costly compound, is used as the substrate to produce vanillin biotechnologically and the making process is still expensive. Therefore, this study investigated the practical use of an agrobiomass waste, rice bran, and provides the first evidence of a cost-effective production of vanillin within 24 h of incubation using recombinant Pediococcus acidilactici BD16 (fcs + /ech + ). Introduction of two genes encoding feruloyl CoA synthetase and enoyl CoA hydratase into the native strain increased vanillin yield to 4.01 g L -1 . Bioconversion was monitored through the transformation of phenolic compounds. A hypothetical metabolic pathway of rice bran during the vanillin bioconversion was proposed with the inserted pathway from ferulic acid to vanillin and compared with that of other metabolic engineered strains. These results could be a gateway of using recombinant lactic acid bacteria for industrial production of vanillin from agricultural waste.

  19. Research of smoothing pseudo-range algorithm by Doppler based on GPS/BD

    Science.gov (United States)

    Kang, Chuanli; Zhou, Yanliu

    2015-12-01

    GNSS (Global Navigation Satellite System) technology not only in the general field of surveying and mapping, geology, mining, water and electricity, and in particular in the field of public security, fire protection, tourism, search and rescue, adventure have been more widely used. These special areas require real-time and high positioning accuracy. Currently, GNSS precision positioning technology has become a hot research direction. This paper introduced an algorithm of smoothing pseudo range by Doppler based GPS/BD to improve GNSS positioning precision. This algorithm decoded the pseudo range data and ephemeris data, and then designed algorithm of smoothing pseudo range by Doppler according principle of Doppler smoothing pseudo range. This algorithm was realized by C++ and proved its efficiency. At last, this algorithm has proved its correctness through calculating and analyzing practical Doppler and pseudo range data, and then a conclusion has been obtained: the Doppler value precision is sub-meter, far better than the pseudo-range accuracy, so that if the two data are combined to calculate position that can help to improve the positioning accuracy.

  20. Acute risk factors for suicide attempts and death: prospective findings from the STEP-BD study

    Science.gov (United States)

    Ballard, Elizabeth D; Vande Voort, Jennifer L; Luckenbaugh, David A; Machado-Vieira, Rodrigo; Tohen, Mauricio; Zarate, Carlos A

    2016-01-01

    Objectives Suicide is unfortunately common in psychiatric practice, but difficult to predict. This study sought to assess which clinical symptoms increase in the months before suicidal behavior in a sample of psychiatric outpatients with bipolar disorder. Methods Data from the Systematic Treatment Enhancement Program for Bipolar Disorder (STEP-BD) trial were used. A total pf 103 participants who attempted suicide or died by suicide during the trial were included; a 15% random sample of the remaining participants (n = 427) was used as a comparison sample. Linear mixed models in the six months before suicidal behavior were conducted for each of five proposed acute risk factors for suicidal behavior. Participants were assessed using the Clinical Monitoring Form (CMF) at each visit for the following potential acute risk factors for suicidal behavior: suicidal ideation, loss of interest, anxiety, psychomotor agitation, and high-risk behavior. Results Each of the five symptoms was elevated overall in individuals who engaged in suicidal behavior (p suicidal ideation and loss of interest significantly increased in the months before suicidal behavior (p suicidal behavior. Conclusions Suicidal ideation, loss of interest and, to a lesser extent, anxiety may represent acute suicide risk factors up to four months before suicidal behavior in outpatients with bipolar disorder. Further investigation of these potential acute risk factors in prospective analyses is warranted. PMID:27233466

  1. Albertet, “En amor trob tantz de mals seignoratges” (BdT 16.13

    Directory of Open Access Journals (Sweden)

    Francesca Sanguineti

    2008-12-01

    Full Text Available The article provides a commentary and a new critical edition of Albertet’s poem “En amor trob tantz de mals seignoratges”, in which the troubadour praises some of the most courtly ladies of his time. The poem can be linked to the genre of the collective eulogy, where the enumerated ladies are praised essentially for political reasons, since the commendation is clearly addressed to the men hidden behind them: famous specimena of this genre are the ‘tournoiements des dames’ by Huon d’Oisy and Richard de Semilli and Raimbaut de Vaqueiras’ “Carros” (BdT 392.32. Albertet’s song starts with a misogynic tone, since the poet declares that celebrating or loving ladies is worthless, given their immoral behaviour, and with a polemic against the strict rules of courtly love. This misogyny, as is further discovered, is a rhetorical device to praise women as well as a tool to renew the genre of the love song from a thematic point of view.

  2. BD+15 2940 AND HD 233604: TWO GIANTS WITH PLANETS CLOSE TO THE ENGULFMENT ZONE

    Energy Technology Data Exchange (ETDEWEB)

    Nowak, G.; Niedzielski, A.; Adamow, M.; Maciejewski, G. [Torun Center for Astronomy, Faculty of Physics, Astronomy, and Informatics, Nicolaus Copernicus University, Grudziadzka 5, 87-100 Torun (Poland); Wolszczan, A., E-mail: grzegorz.nowak@astri.umk.pl, E-mail: andrzej.niedzielski@astri.umk.pl, E-mail: monika.adamow@astri.umk.pl, E-mail: gracjan.maciejewski@astri.umk.pl, E-mail: alex@astro.psu.edu [Department of Astronomy and Astrophysics, The Pennsylvania State University, 525 Davey Laboratory, University Park, PA 16802 (United States)

    2013-06-10

    We report the discovery of planetary-mass companions to two red giants by the ongoing Penn State-Torun Planet Search (PTPS) conducted with the 9.2 m Hobby-Eberly Telescope. The 1.1 M{sub Sun} K0-giant, BD+15 2940, has a 1.1 M{sub J} minimum mass companion orbiting the star at a 137.5 day period in a 0.54 AU orbit what makes it the closest-in planet around a giant and possible subject of engulfment as the consequence of stellar evolution. HD 233604, a 1.5 M{sub Sun} K5-giant, is orbited by a 6.6 M{sub J} minimum mass planet which has a period of 192 days and a semi-major axis of only 0.75 AU making it one of the least distant planets to a giant star. The chemical composition analysis of HD 233604 reveals a relatively high {sup 7}Li abundance which may be a sign of its early evolutionary stage or recent engulfment of another planet in the system. We also present independent detections of planetary-mass companions to HD 209458 and HD 88133, and stellar activity-induced radial velocity variations in HD 166435, as part of the discussion of the observing and data analysis methods used in the PTPS project.

  3. Detection of Mycobacterium chelonae, Mycobacterium abscessus Group, and Mycobacterium fortuitum Complex by a Multiplex Real-Time PCR Directly from Clinical Samples Using the BD MAX System.

    Science.gov (United States)

    Rocchetti, Talita T; Silbert, Suzane; Gostnell, Alicia; Kubasek, Carly; Campos Pignatari, Antonio C; Widen, Raymond

    2017-03-01

    A new multiplex PCR test was designed to detect Mycobacterium chelonae, Mycobacterium abscessus group, and Mycobacterium fortuitum complex on the BD MAX System. A total of 197 clinical samples previously submitted for mycobacterial culture were tested using the new protocol. Samples were first treated with proteinase K, and then each sample was inoculated into the BD MAX Sample Buffer Tube. Extraction and multiplex PCR were performed by the BD MAX System, using the BD MAX ExK TNA-3 extraction kit and BD TNA Master Mix, along with specific in-house designed primers and probes for each target. The limit of detection of each target, as well as specificity, was evaluated. Of 197 clinical samples included in this study, 133 were positive and 60 were negative for mycobacteria by culture, and another 4 negative samples were spiked with M. chelonae ATCC 35752. The new multiplex PCR on the BD MAX had 97% concordant results with culture for M. abscessus group detection, 99% for M. chelonae, and 100% for M. fortuitum complex. The new multiplex PCR test performed on the BD MAX System proved to be a sensitive and specific test to detect M. chelonae, M. abscessus group, and M. fortuitum complex by real-time PCR on an automated sample-in results-out platform. Copyright © 2017 American Society for Investigative Pathology and the Association for Molecular Pathology. Published by Elsevier Inc. All rights reserved.

  4. The National Institutes of Health's Big Data to Knowledge (BD2K) initiative: capitalizing on biomedical big data.

    Science.gov (United States)

    Margolis, Ronald; Derr, Leslie; Dunn, Michelle; Huerta, Michael; Larkin, Jennie; Sheehan, Jerry; Guyer, Mark; Green, Eric D

    2014-01-01

    Biomedical research has and will continue to generate large amounts of data (termed 'big data') in many formats and at all levels. Consequently, there is an increasing need to better understand and mine the data to further knowledge and foster new discovery. The National Institutes of Health (NIH) has initiated a Big Data to Knowledge (BD2K) initiative to maximize the use of biomedical big data. BD2K seeks to better define how to extract value from the data, both for the individual investigator and the overall research community, create the analytic tools needed to enhance utility of the data, provide the next generation of trained personnel, and develop data science concepts and tools that can be made available to all stakeholders. Published by the BMJ Publishing Group Limited. For permission to use (where not already granted under a licence) please go to http://group.bmj.com/group/rights-licensing/permissions.

  5. Recovery of radiated energy in the $B_d \\to J/\\psi(e^+e^-)K_S$ decay channel

    CERN Document Server

    Aguiló, E; Garrido, L

    2006-01-01

    B_d->J/\\psi K_S is the golden channel to measure the unitary triangle angle beta. In the current LHCb off-line selection of the decay channel B_d -> J/\\psi(e^+e^-)K_S, the reconstructed J/\\psi mass peak and the B_d mass peak (to a lesser extent) are shifted to lower values due to the loss of energy by electrons and positrons, that cannot be reconstructed. This energy comes from non-reconstructed Bremsstrahlung and low energy radiated photons that have been emited before the electron or positron arrives to the magnet, where the track momentum is measured. In this note a method is presented to recover this energy after studying its probability distribution function.

  6. Re-examining sin⁡2β and Δmd from evolution of Bd0 mesons with decoherence

    Directory of Open Access Journals (Sweden)

    Ashutosh Kumar Alok

    2015-10-01

    Full Text Available In the time evolution of neutral meson systems, a perfect quantum coherence is usually assumed. The important quantities of the Bd0 system, such as sin⁡2β and Δmd, are determined under this assumption. However, the meson system interacts with its environment. This interaction can lead to decoherence in the mesons even before they decay. In our formalism this decoherence is modelled by a single parameter λ. It is desirable to re-examine the procedures of determination of sin⁡2β and Δmd in meson systems with decoherence. We find that the present values of these two quantities are modulated by λ. Re-analysis of Bd0 data from B-factories and LHCb can lead to a clean determination of λ, sin⁡2β and Δmd.

  7. Efficacy of rhBMP-2 Loaded PCL/β-TCP/bdECM Scaffold Fabricated by 3D Printing Technology on Bone Regeneration

    Directory of Open Access Journals (Sweden)

    Eun-Bin Bae

    2018-01-01

    Full Text Available This study was undertaken to evaluate the effect of 3D printed polycaprolactone (PCL/β-tricalcium phosphate (β-TCP scaffold containing bone demineralized and decellularized extracellular matrix (bdECM and human recombinant bone morphogenetic protein-2 (rhBMP-2 on bone regeneration. Scaffolds were divided into PCL/β-TCP, PCL/β-TCP/bdECM, and PCL/β-TCP/bdECM/BMP groups. In vitro release kinetics of rhBMP-2 were determined with respect to cell proliferation and osteogenic differentiation. These three reconstructive materials were implanted into 8 mm diameter calvarial bone defect in male Sprague-Dawley rats. Animals were sacrificed four weeks after implantation for micro-CT, histologic, and histomorphometric analyses. The findings obtained were used to calculate new bone volumes (mm3 and new bone areas (%. Excellent cell bioactivity was observed in the PCL/β-TCP/bdECM and PCL/β-TCP/bdECM/BMP groups, and new bone volume and area were significantly higher in the PCL/β-TCP/bdECM/BMP group than in the other groups (p<.05. Within the limitations of this study, bdECM printed PCL/β-TCP scaffolds can reproduce microenvironment for cells and promote adhering and proliferating the cells onto scaffolds. Furthermore, in the rat calvarial defect model, the scaffold which printed rhBMP-2 loaded bdECM stably carries rhBMP-2 and enhances bone regeneration confirming the possibility of bdECM as rhBMP-2 carrier.

  8. Intrinsic distortion of a fully differential BD-modulated\\ud Class-D amplifier with analog feedback

    OpenAIRE

    Cox, Stephen M.; Yu, J.; Goh, W.L.; Tan, M.T.

    2013-01-01

    This paper presents a mathematical analysis of a fully differential BD-modulated Class-D amplifier with analog feedback, i.e., one having a bridge-tied-load output configuration with negative feedback and ternary PWM signal. Notwithstanding the highly nonlinear nature of\\ud the amplifier's operation, an extremely accurate closed-form expression for the audible output signal is derived and verified based on computer simulations. This expression demonstrates that there exist larger \\ud high-ord...

  9. Dynamical properties and temperature induced molecular disordering of LiBH4 and LiBD4

    International Nuclear Information System (INIS)

    Buchter, F.; Lodziana, Z.; Mauron, Ph.; Remhof, A.; Friedrichs, O.; Borgschulte, A.; Zuettel, A.; Sheptyakov, D.; Straessle, Th.; Ramirez-Cuesta, A. J.

    2008-01-01

    We report on neutron powder-diffraction experiments, inelastic incoherent neutron-scattering experiments, and density-functional calculations on dynamics, order and disorder properties of LiBH 4 and LiBD 4 . From refinement of LiBD 4 structure at 10 and 302 K, we found an almost ideal tetrahedral geometry of BD 4 ions (difference between shortest and longest interatomic distances is less than 4% for B-D bond, and less than 3% for D-D bond), close to the calculated geometry. A quantitative agreement was found between experimental and calculated anisotropic temperature factors of individual atoms. For phonon energies 4 in the low-temperature phase depends quadratically on the phonon energy while for the high-temperature phase a linear dependence is observed, revealing a high lattice anharmonicity in the high-temperature phase. Moreover, an increased phonon density of states at low energies in the high-temperature phase compared to the low-temperature phase give a direct evidence for disorder in the high-temperature phase of LiBH 4 of the hydrogen sublattice which can originate from orientational disorder of BH 4 units. Potential energy landscape for rotation of BH 4 indicates that fairly localized minima and barriers higher than 0.6 eV exist in the low-temperature phase, i.e., ordered BH 4 ions. The high-temperature structure shows shallow barriers of ∼0.2 eV without distinct energy minima, i.e., orientation of a single BH 4 unit cannot be precisely defined. This corroborates the large thermal displacements observed in diffraction studies and high disorder of BH 4 ions deduced from experimental partial phonon density of states in the high-temperature phase

  10. Multimedia Archiving: Videotape, Compact Disc (CD), Digital Versatile Disc (DVD), and Blu-Ray Disc (BD) Media

    Science.gov (United States)

    2010-02-01

    reflective surface used will also influence the color shades . Phthalocyanine is almost clear with a very light yellow or green tint . Some observations...BD) MEDIA WHITE SANDS MISSILE RANGE REAGAN TEST SITE YUMA PROVING GROUND DUGWAY PROVING GROUND ABERDEEN TEST CENTER ELECTRONIC PROVING...Avenue, White Sands Missile Range,NM,88002 8. PERFORMING ORGANIZATION REPORT NUMBER 462-10 9. SPONSORING/MONITORING AGENCY NAME(S) AND ADDRESS(ES) 10

  11. Breast density (BD) assessment with digital breast tomosynthesis (DBT): Agreement between Quantra™ and 5th edition BI-RADS®.

    Science.gov (United States)

    Ekpo, Ernest U; Mello-Thoms, Claudia; Rickard, Mary; Brennan, Patrick C; McEntee, Mark F

    2016-12-01

    To assess the agreement between digital breast tomosynthesis (DBT) breast density (BD) assessment made using Quantra™ and fifth edition BI-RADS ® . This board approved study involved BD assessment of 234 women undergoing DBT investigation. BD estimation was performed from the raw DBT images using Quantra™ 3 (v.2.1.1, Hologic, Bedford MA). BI-RADS ® assessment was performed using prior digital mammograms displayed simultaneously with 2D images synthesized from DBT by three radiologists using the fifth edition BI-RADS ® (A, B, C, D). Kappa (к) was used to assess inter-reader agreement, agreement between Quantra™ and each reader, as well as the majority report of all readers. Receiver Operating Characteristic (ROC) analysis was used to assess the performance of Quantra™ in reproducing the majority BI-RADS ® assessment. Data was then grouped into a two-category scale [almost entirely fatty and scattered fibroglandular tissue (A-B) versus heterogeneously dense and extremely dense (C-D)], and a further analysis performed. Inter-reader agreement varied from fair [0.38 (95%CI: 0.30-0.46)] to substantial [0.68 (95%CI: 0.61-0.75)] on a four-category scale and substantial [0.70 (95%CI: 0.61-0.78)] to almost perfect [0.85 (95%CI: 0.78-0.92)] on a two-category scale. Using the majority report, the agreement between BI-RADS ® and Quantra™ was 0.68 (95%CI: 0.59-0.75) on a four-category scale and 0.86 (95%CI: 0.79-0.93) on a two-category scale. Quantra™ distinguished BI-RADS ® A-B from C-D with 97.1% sensitivity and 83.1% specificity. Data demonstrate moderate to substantial agreement in BD assessment between fifth edition BI-RADS ® and Quantra™. Copyright © 2016 Elsevier Ltd. All rights reserved.

  12. Effect of chloride substitution on the order–disorder transition in NaBH{sub 4} and Na{sup 11}BD{sub 4}

    Energy Technology Data Exchange (ETDEWEB)

    Olsen, Jørn Eirik [Institute for Energy Technology, Physics Department, P.O. Box 40, NO-2027 Kjeller (Norway); Karen, Pavel [University of Oslo, Department of Chemistry, P.O. Box 1033 Blindern, NO-0315 Oslo (Norway); Sørby, Magnus H. [Institute for Energy Technology, Physics Department, P.O. Box 40, NO-2027 Kjeller (Norway); Hauback, Bjørn C., E-mail: bjorn.hauback@ife.no [Institute for Energy Technology, Physics Department, P.O. Box 40, NO-2027 Kjeller (Norway)

    2014-02-25

    Graphical abstract: Interactions that order the BD{sub 4}{sup -} tetrahedra below the order–disorder transition became increasingly frustrated by the solute in the Na({sup 11}BD{sub 4}){sub 1−x}Cl{sub x} solid solutions, and the order disappears at x = 0.158. Highlights: • The order–disorder transition temperature for Na(BH{sub 4}){sub 1−x}Cl{sub x} and Na({sup 11}BD{sub 4}){sub 1−x}Cl{sub x} is highly dependent on the Cl-content, x. • The transition is characterized by DSC for Na({sup 11}BD{sub 4}){sub 1−x}Cl{sub x} for x = 0, 0.10 and 0.15. • No transition is observed for x ⩾ 0.20 on cooling to 8 K. • The crystal structures are reported for Na{sup 11}BD{sub 4} at room temperature and 8 K and Na({sup 11}BD{sub 4}){sub 1−x}Cl{sub x} (x = 0.10, 0.15, 0.20 and 0.25) at 8 K from powder neutron diffraction. -- Abstract: Phase transition associated with anion disordering over two orientations in Na{sup 11}BD{sub 4} (NaBH{sub 4}) and its solid solutions with NaCl, Na({sup 11}BD{sub 4}){sub 1−x}Cl{sub x}, is investigated with powder diffraction (neutron and synchrotron radiation), differential scanning calorimetry and Raman spectroscopy. Upon heating, the transition temperature extrapolated to zero rate of heating is 192.2 K for Na{sup 11}BD{sub 4}, ΔS = 4.41 J/mol K, hysteresis 1.7 K and the volume increase 0.43%. Thermal parameters of the transition in Na({sup 11}BD{sub 4}){sub 1−x}Cl{sub x} follow a colligative-property model of an ideal solution, with x = 0.158(1) as the critical concentration at which the ordering interactions and the transition itself are eliminated. On approaching this limit, the tetragonal distortion of the ordered structure decreases somewhat towards the cubic average, and this is associated with a partial disorder of the tetrahedral anions seen by diffraction methods. In fact, a 3% disorder is already present in the pure solvent of the solid solution (Na{sup 11}BD{sub 4}) at 8 K.

  13. Expression of human beta-defensins-1-4 in thyroid cancer cells and new insight on biologic activity of hBD-2 in vitro.

    Science.gov (United States)

    Zhuravel, O V; Gerashchenko, O L; Khetsuriani, M R; Soldatkina, M A; Pogrebnoy, P V

    2014-09-01

    The study was aimed on analysis of human beta-defensin-1-4 (hBDs) mRNA expression in cultured thyroid cancer cells and evaluation of effects of recombinant hBD-2 (rec-hBD-2) on growth patterns, migration properties and expression of E-cadherin and vimentin in these cells. The study was performed on cultured follicular thyroid cancer WRO cells, papillary thyroid cancer TPC1 cells, and anaplastic thyroid cancer KTC-2 cells. For analysis of hBD-1-4 mRNA expression in thyroid cancer cells, semiquantitative RT-PCR was used. Effects of rec-hBD-2 on cell proliferation, viability, and migration were analyzed using direct cell counting, MTT test, and scratch assay respectively. Expression of vimentin and E-cadherin was evaluated by quantitative PCR (qPCR). By the data of RT-PCR, all three studied thyroid cancer cell lines express hBD-1 and -4 mRNA, but not hBD-2 mRNA, while hBD-3 expression was detected in WRO and KTC-2 cells. The treatment of TPC-1, WRO, and KTC-2 cells with 100-1000 nM rec-hBD-2 resulted in significant concentration-dependent suppression of cell proliferation, viability, and migratory property. By the data of qPCR, significant up-regulation of vimentin expression was registered in KTC-2 and WRO cells treated with 500 nM rec-hBD-2. Significant down-regulation of E-cadherin expression (p cells treated with the defensin. Also, it has been shown that TPC-1 cells treated with 500 nM rec-hBD-2 acquired more elongated morphology. The data demonstrate that hBD-2 in concentrations higher than 100 nM exerts significant concentration-dependent suppression of thyroid cancer cell growth and migration, and affects vimentin and E-cadherin expression dependent on histologic type of thyroid cancer cells.

  14. Development and validation of the BD SX: a brief measure of mood and symptom variability for use with adults with bipolar disorder.

    Science.gov (United States)

    O'Rourke, Norm; Sixsmith, Andrew; King, David B; Yaghoubi-Shahir, Hamed; Canham, Sarah L

    2016-12-01

    Ecological momentary sampling in BD research requires brief symptom measures with low cognitive demands to maximize data collection across the range of BD symptomatology. We developed the BD Sx cognizant of the challenges inherent in scale development with low prevalence populations and the limitations of existing measures (e.g., over-reliance on patients in acute states recruited from psychiatric settings). In order to be generalizable across the full spectrum of the illness, we also included those currently euthymic and those who avoid clinical contact. We recruited a global sample of 1010 adults with BD over 19 days using socio-demographically targeted, social media advertising and online data collection. At follow-up, 428 participants provided responses 67 days later on average. This enabled us to develop the BD Sx and replicate initial findings across multiple samples over time. Both exploratory and confirmatory factor analyses support a 4-factor BD Sx model. Goodness of fit indices indicate good model fit across samples and over time. We labeled these factors: elation/loss of insight, affrontive symptoms of mania, cognitive/depressive, and somatic/depressive symptoms. Affrontive symptoms correlate positively with cognitive and somatic depression factors, which may suggest mixed-state symptom clusters in accord with DSM 5. Responses to the BD Sx reliably measure both depressive and hypo/manic symptoms. Temporal invariance analyses indicate that the 4-factor structure is consistent over time. Future research  should compare BD Sx responses to clinical diagnoses of hypo/mania and major depressive episodes.

  15. Rapid Detection of Staphylococcus aureus and Methicillin-Resistant S. aureus in Atopic Dermatitis by Using the BD Max StaphSR Assay.

    Science.gov (United States)

    Lee, Mi Kyung; Park, Kui Young; Jin, Taewon; Kim, Ju Hee; Seo, Seong Jun

    2017-07-01

    Eczematous lesions of atopic dermatitis (AD) patients are known to be a source of Staphylococcus aureus (SA) transmission and might be a reservoir for community-associated methicillin-resistant SA (MRSA). The BD Max StaphSR (BD-SR) is a fully automated, multiplex real-time PCR assay for the direct detection and differentiation of SA and MRSA from nasal swab samples. We evaluated the detection rates of SA and MRSA from skin lesions of outpatients with AD using the BD-SR assay, and determined the usefulness of the BD-SR assay. A total of 244 skin swab samples (skin lesions of 213 outpatients with AD and normal skin of 31 healthy controls) were tested directly by using the BD-SR assay. Of the 213 samples from patients with AD, 69 (32.4%) were positive for SA, 6 (8.7%) of which were positive for MRSA. Only 1 (3.2%) of 31 samples from healthy controls was positive for SA. The BD-SR assay is effective for the rapid detection of SA and MRSA from skin swab samples, which can provide important information for managing patients with AD and preventing the spread of MRSA. © The Korean Society for Laboratory Medicine.

  16. Microsecond Time-Resolved Absorption Spectroscopy Used to Study CO Compounds of Cytochrome bd from Escherichia coli

    Science.gov (United States)

    Siletsky, Sergey A.; Zaspa, Andrey A.; Poole, Robert K.; Borisov, Vitaliy B.

    2014-01-01

    Cytochrome bd is a tri-heme (b558, b595, d) respiratory oxygen reductase that is found in many bacteria including pathogenic species. It couples the electron transfer from quinol to O2 with generation of an electrochemical proton gradient. We examined photolysis and subsequent recombination of CO with isolated cytochrome bd from Escherichia coli in one-electron reduced (MV) and fully reduced (R) states by microsecond time-resolved absorption spectroscopy at 532-nm excitation. Both Soret and visible band regions were examined. CO photodissociation from MV enzyme possibly causes fast (τcytochrome bd in the R state, in MV enzyme the apparent contribution of absorbance changes associated with CO dissociation from heme d is small, if any. Photodissociation of CO from heme d in MV enzyme is suggested to be accompanied by the binding of an internal ligand (L) at the opposite side of the heme. CO recombines with heme d (τ∼16 µs) yielding a transient hexacoordinate state (CO-Fe2+-L). Then the ligand slowly (τ∼30 ms) dissociates from heme d. Recombination of CO with a reduced heme b in a fraction of the MV sample may also contribute to the 30-ms phase. In R enzyme, CO recombines to heme d (τ∼20 µs), some heme b558 (τ∼0.2–3 ms), and finally migrates from heme d to heme b595 (τ∼24 ms) in ∼5% of the enzyme population. Data are consistent with the recent nanosecond study of Rappaport et al. conducted on the membranes at 640-nm excitation but limited to the Soret band. The additional phases were revealed due to differences in excitation and other experimental conditions. PMID:24755641

  17. Hubble space telescope near-ultraviolet spectroscopy of the bright cemp-no star BD+44°493

    Energy Technology Data Exchange (ETDEWEB)

    Placco, Vinicius M. [Gemini Observatory, Hilo, HI 96720 (United States); Beers, Timothy C.; Smith, Verne V. [National Optical Astronomy Observatory, Tucson, AZ 85719 (United States); Roederer, Ian U. [Department of Astronomy, University of Michigan, Ann Arbor, MI 48109 (United States); Cowan, John J. [Homer L. Dodge Department of Physics and Astronomy, University of Oklahoma, Norman, OK 73019 (United States); Frebel, Anna [Kavli Institute for Astrophysics and Space Research and Department of Physics, Massachusetts Institute of Technology, Cambridge, MA 02139 (United States); Filler, Dan; Ivans, Inese I. [Department of Physics and Astronomy, The University of Utah, Salt Lake City, UT 84112 (United States); Lawler, James E. [Department of Physics, University of Wisconsin, Madison, WI 53706 (United States); Schatz, Hendrik [JINA—Joint Institute for Nuclear Astrophysics, Department of Physics, University of Notre Dame, Notre Dame, IN 46556-5670 (United States); Sneden, Christopher [Department of Astronomy and McDonald Observatory, University of Texas, Austin, TX 78712 (United States); Sobeck, Jennifer S. [Department of Astronomy, University of Virginia, Charlottesville, VA 22904 (United States); Aoki, Wako, E-mail: vplacco@gemini.edu [National Astronomical Observatory of Japan, 2-21-1 Osawa, Mitaka, Tokyo 181-8588 (Japan)

    2014-07-20

    We present an elemental-abundance analysis, in the near-ultraviolet (NUV) spectral range, for the extremely metal-poor star BD+44°493 a ninth magnitude subgiant with [Fe/H] =–3.8 and enhanced carbon, based on data acquired with the Space Telescope Imaging Spectrograph on the Hubble Space Telescope. This star is the brightest example of a class of objects that, unlike the great majority of carbon-enhanced metal-poor (CEMP) stars, does not exhibit over-abundances of heavy neutron-capture elements (CEMP-no). In this paper, we validate the abundance determinations for a number of species that were previously studied in the optical region, and obtain strong upper limits for beryllium and boron, as well as for neutron-capture elements from zirconium to platinum, many of which are not accessible from ground-based spectra. The boron upper limit we obtain for BD+44°493, log ε (B) <–0.70, the first such measurement for a CEMP star, is the lowest yet found for very and extremely metal-poor stars. In addition, we obtain even lower upper limits on the abundances of beryllium, log ε (Be) <–2.3, and lead, log ε (Pb) <–0.23 ([Pb/Fe] <+1.90), than those reported by previous analyses in the optical range. Taken together with the previously measured low abundance of lithium, the very low upper limits on Be and B suggest that BD+44°493 was formed at a very early time, and that it could well be a bona-fide second-generation star. Finally, the Pb upper limit strengthens the argument for non-s-process production of the heavy-element abundance patterns in CEMP-no stars.

  18. Jet creation in post-AGB binaries: the circum-companion accretion disk around BD+46°442

    Science.gov (United States)

    Bollen, Dylan; Van Winckel, Hans; Kamath, Devika

    2017-11-01

    Aims: We aim at describing and understanding binary interaction processes in systems with very evolved companions. Here, we focus on understanding the origin and determining the properties of the high-velocity outflow observed in one such system. Methods: We present a quantitative analysis of BD+46°442, a post-AGB binary that shows active mass transfer that leads to the creation of a disk-driven outflow or jet. We obtained high-resolution optical spectra from the HERMES spectrograph, mounted on the 1.2 m Flemish Mercator Telescope. By performing a time-series analysis of the Hα profile, we identified the different components of the system. We deduced the jet geometry by comparing the orbital phased data with our jet model. In order to image the accretion disk around the companion of BD+46°442, we applied the technique of Doppler tomography. Results: The orbital phase-dependent variations in the Hα profile can be related to an accretion disk around the companion, from which a high-velocity outflow or jet is launched. Our model shows that there is a clear correlation between the inclination angle and the jet opening angle. The latitudinally dependent velocity structure of our jet model shows a good correspondence to the data, with outflow velocities higher than at least 400 km s-1. The intensity peak in the Doppler map might be partly caused by a hot spot in the disk, or by a larger asymmetrical structure in the disk. Conclusions: We show that BD+46°442 is a result of a binary interaction channel. The origin of the fast outflow in this system might be to a gaseous disk around the secondary component, which is most likely a main-sequence star. Our analysis suggests that the outflow has a rather wide opening angle and is not strongly collimated. Our time-resolved spectral monitoring reveals the launching site of the jet in the binary BD+46°442. Similar orbital phase-dependent Hα profiles are commonly observed in post-AGB binaries. Post-AGB binaries provide ideal

  19. Characterization of the NTPR and BD1 interacting domains of the human PICH-BEND3 complex

    DEFF Research Database (Denmark)

    Pitchai, Ganesha P; Hickson, Ian D; Streicher, Werner

    2016-01-01

    Chromosome integrity depends on DNA structure-specific processing complexes that resolve DNA entanglement between sister chromatids. If left unresolved, these entanglements can generate either chromatin bridging or ultrafine DNA bridging in the anaphase of mitosis. These bridge structures...... are defined by the presence of the PICH protein, which interacts with the BEND3 protein in mitosis. To obtain structural insights into PICH-BEND3 complex formation at the atomic level, their respective NTPR and BD1 domains were cloned, overexpressed and crystallized using 1.56 M ammonium sulfate...

  20. Form factors of the semileptonic decays B(D) → π + lν near zero recoil

    International Nuclear Information System (INIS)

    Jin Hongying.

    1995-12-01

    We discuss the possible corrections of some recent calculations on the form factors which parametrize the matrix element of the decays B(D) → πlν. These calculations are based on the assumption that the B * (D * ) pole contribution is fully dominant near the zero recoil. By using the Bethe-Salpeter approach. We have calculated some low-lying states pole terms predicted by the quark model. The numerical results are obtained to the next-leading order of the 1/M expansion. (author). 12 refs, 1 tab

  1. Experimental investigations concerning the three particle reaction 19B(d,3α) at 360 keV

    International Nuclear Information System (INIS)

    Nocken, U.

    1976-01-01

    In this paper a complete energy angular correlation measurement of the three-particle reaction 10 B(d,3α) with an incident energy of Esub(d) = 360 keV is reported. By the measurement of coincidence events in two detectors complanar to the incident beam under 24 different angles, the 'Dalitz-plane' is covered in a wide region. An exact theory of three-particle reactions with compound nuclei in the final state does not exist, therefore three wellknown model theories are used for comparison. (orig./WL) [de

  2. Improved management of SG BD demineralizer for reduced generation of low-level radioactive spent resin in Korean nuclear power plants

    International Nuclear Information System (INIS)

    Rhee, I.; Cho, D.; Yeon, J.

    2003-01-01

    Most nuclear power plants in Korea have adopted Ethanolamine(ETA) as a secondary pH control agent to increase the pH at the liquid phase, which may reduce the corrosion in steam generator tubes and moisture separator/reheat system. Along with its beneficial effect of SG protection from corrosion and degradation, the replacement of ammonia with ETA causes the increased generation of spent resin and the reduced run time of demineralizer in steam generator blowdown(SG BD) system. The composition ratio of cation- to anion- exchange resin in SG BD mixed bed should be increased in the ETA chemistry environment to meet the ratio of cation to anion in the aqueous solution, which results in the simultaneous exhaustion of cation and anion exchange resins. The utilization rate of mixed bed is greatest at the cation-to-anion ratio of 95:1 on the theoretical equivalent basis in the solution, but practically highest at that of 22:1 due to the possible inhomogeneous distribution of cation and anion exchange resins in SG BD bed. The run time of the bed could be extended by 30% such that, at that much, the purchase cost of new resin is saved and the production rate of spent resin is reduced. The guideline on the replacement of resin in SG BD bed is not necessary to secure the removal of radioactive particles without the leakage of the primary coolant into the secondary side since all the radioactive ions can be eliminated by SG BD bed with the sufficient time. They are retained during more than one month after their ingress into the SG BD bed without leakage. With the reduced replacement, thus, the SG BD spent resin that comprises 65% of low-level radioactive solid waste can be much cut down

  3. High-resolution 8-13 micron imaging of the planetary nebulae BD + 30 deg 3639 and NGC 6572

    International Nuclear Information System (INIS)

    Hora, J.L.; Hoffmann, W.F.; Deutsch, L.K.; Fazio, G.G.

    1990-01-01

    High-resolution midinfrared images of the planetary nebulae BD + 30 deg 3639 and NGC 6572 are presented at 8.3, 8.7, 9.8, 11.2, and 12.4 microns. Analysis of the maps of BD + 30 deg 3639 supports a model in which the infrared emission originates from two spatially distinct components, one which is responsible for the continuum radiation at 8-12 microns and the other which produces the emission-line features. The NGC 6572 images provides evidence for a previously undetected 11.2 micron UIR emission feature. Comparison with radio continuum maps indicates that the distribution of dust is similar to the distribution of ionized gas in each nebula. Various models of source morphology are also investigated. The planetary nebulae DB + 30 deg 3639 and NGC 6572 can be modeled by an optically thin cylinder or a prolate ellipsoid with enhanced equatorial emission. These models reproduce well the general features of the nebula, such as the bipolar lobes of emission and the ring structure. 67 refs

  4. Substorm Injected Energetic Electrons and Ions Deeply into the Inner Magnetosphere Observed by BD-IES and Van Allan Probes

    Science.gov (United States)

    Zong, Qiugang

    2017-04-01

    When substorm injections are observed simultaneously with multiple spacecraft, they help elucidate potential mechanisms for particle transport and energization, a topic of great importance for understanding and modeling the magnetosphere. In the present paper, by using the data return from the BeiDa- IES (BD-IES) instrument onboard an inclined (55◦) geosynchronous orbit (IGSO) satellite together with geo-transfer orbit (GTO) Van Allen Probe A&B satellite, we analysis a substorm injection event occurred on Oct 16, 2015. During the substorm injection, the IES onboard IGSO is outbound while both Van Allen Probe A&B satellites are inbound. This configuration of multiple satellite trajectories provides a unique opportunity to investigate the inward and outward radial propagation of the substorm injection simultaneously. This substorm as indicated by AE/AL indices is closely related an IMF/solar wind discontinuity with a sharp change in the IMF Bz direction (northward turning). The innermost signature of this substorm injection has been detected by the Van Allen Probes A & B at L 3.7. The outermost signature, observed by the BD-IES, is found to be at L 10. This indicated that this substorm have a rather global effect rather than just a local effect. Further, we suggest that the electric fields carried by fast-mode compressional waves around the substorm injection are the most likely mechanism candidate for the injection signatures of electrons observed in the innermost and outermost inner magnetosphere.

  5. Radial Propagation of Magnetospheric Substorm Injected Energetic Electrons Observed by BD-IES and Van Allan Probes

    Science.gov (United States)

    Zong, Q.

    2016-12-01

    When substorm injections are observed simultaneously with multiple spacecraft, they help elucidate potential mechanisms for particle transport and energization, a topic of great importance for understanding and modeling the magnetosphere. In the present paper, by using the data return from the BeiDa- IES (BD-IES) instrument onboard an inclined (55°) geosynchronous orbit (IGSO) satellite together with geo-transfer orbit (GTO) Van Allen Probe A&B satellite, we analysis a substorm injection event occurred on Oct 16, 2015. During the substorm injection, the IES onboard IGSO is outbound while both Van Allen Probe A&B satellites are inbound. This configuration of multiple satellite trajectories provides a unique opportunity to investigate the inward and outward radial propagation of the substorm injection simultaneously. This substorm as indicated by AE/AL indices is closely related an IMF/solar wind discontinuity with a sharp change in the IMF Bz direction (northward turning). The innermost signature of this substorm injection has been detected by the Van Allen Probes A & B at L 3.7. The outermost signature, observed by the BD-IES, is found to be at L 10. This indicated that this substorm have a rather global effect rather than just a local effect. Further, we suggest that the electric fields carried by fast-mode compressional waves around the substorm injection are the most likely mechanism candidate for the injection signatures of electrons observed in the innermost and outermost inner magnetosphere.

  6. Physical parameters of close binaries QX Andromedae, RW Comae Berenices, MR Delphini, and BD +079° 3142

    Science.gov (United States)

    Djurašević, G.; Yılmaz, M.; Baştürk, Ö.; Kılıçoğlu, T.; Latković, O.; Çalışkan, Ş.

    2011-01-01

    Aims: We analyze new multicolor light curves and recently published radial velocity curves for close binaries QX And, RW Com, MR Del, and BD +07°3142 to determine the physical parameters of the components. Methods: The light curves are analyzed using a binary star model based on Roche geometry to fit the photometric observations. Spectroscopic parameters, such as the mass ratios and spectral types, were taken from recent spectroscopic studies of the systems in question. Results: Our findings provide consistent and reliable sets of stellar parameters for the four studied binary systems. Of particular interest is the BD +07°3142 system, since this is the first analysis of its light curves. We find that it is an overcontact binary of W UMa type and W subtype, and that each component has a large cool spot in the polar region. QX And is an A subtype, and RW Com a W subtype W UMa binary, and in both systems we find a bright spot in the neck region between the components. MR Del is a detached binary with a complex light curve that we could model with two cool spots on the hotter component. The light curve data are only available in electronic form at the CDS via anonymous ftp to cdsarc.u-strasbg.fr (130.79.128.5) or via http://cdsarc.u-strasbg.fr/viz-bin/qcat?J/A+A/525/A66

  7. Hubble Space Telescope Near-ultraviolet Spectroscopy of the Bright CEMP-no Star BD+44°493

    Science.gov (United States)

    Placco, Vinicius M.; Beers, Timothy C.; Roederer, Ian U.; Cowan, John J.; Frebel, Anna; Filler, Dan; Ivans, Inese I.; Lawler, James E.; Schatz, Hendrik; Sneden, Christopher; Sobeck, Jennifer S.; Aoki, Wako; Smith, Verne V.

    2014-07-01

    We present an elemental-abundance analysis, in the near-ultraviolet (NUV) spectral range, for the extremely metal-poor star BD+44°493 a ninth magnitude subgiant with [Fe/H] =-3.8 and enhanced carbon, based on data acquired with the Space Telescope Imaging Spectrograph on the Hubble Space Telescope. This star is the brightest example of a class of objects that, unlike the great majority of carbon-enhanced metal-poor (CEMP) stars, does not exhibit over-abundances of heavy neutron-capture elements (CEMP-no). In this paper, we validate the abundance determinations for a number of species that were previously studied in the optical region, and obtain strong upper limits for beryllium and boron, as well as for neutron-capture elements from zirconium to platinum, many of which are not accessible from ground-based spectra. The boron upper limit we obtain for BD+44°493, log epsilon (B) formed at a very early time, and that it could well be a bona-fide second-generation star. Finally, the Pb upper limit strengthens the argument for non-s-process production of the heavy-element abundance patterns in CEMP-no stars. Based on observations made with the NASA/ESA Hubble Space Telescope, obtained at the Space Telescope Science Institute, which is operated by the Association of Universities for Research in Astronomy, Inc., under NASA contract NAS 5-26555. These observations are associated with program GO-12554, and we also make use of data taken in program GO-12268.

  8. Comparative Evaluation of Inoculation of Urine Samples with the Copan WASP and BD Kiestra InoqulA Instruments.

    Science.gov (United States)

    Iversen, Jesper; Stendal, Gitta; Gerdes, Cecilie M; Meyer, Christian H; Andersen, Christian Østergaard; Frimodt-Møller, Niels

    2016-02-01

    This study evaluated the quantitative results from and quality of the inoculation patterns of urine specimens produced by two automated instruments, the Copan WASP and the BD InoqulA. Five hundred twenty-six urine samples submitted in 10-ml canisters containing boric acid were processed within 30 min on an InoqulA instrument plating 10 μl of specimen, and on two WASP instruments, one plating 1 μl of specimen (WASP-1), and the second plating 10 μl of WASP (WASP-10). All samples were incubated, analyzed, and digitally imaged using the BD Kiestra total lab automation system. The results were evaluated using a quantitative protocol and assessed for the presence or absence of ≥5 distinct colonies. Separate studies were conducted using quality control (QC) organisms to determine the relative accuracy of WASP-1, WASP-10, and InoqulA instruments compared to the results obtained with a calibrated pipette. The results with QC organisms were calculated as the ratios of the counts of the automated instruments divided by the counts for the calibrated pipette (the gold standard method). The ratios for the InoqulA instrument were closest to 1.0, with the smallest standard deviations indicating that compared to a calibrated pipette, the InoqulA results were more accurate than those with the WASP instrument. For clinical samples, the WASP instruments produced higher colony counts and more commensals than the InoqulA instrument, with differences most notable for WASP-1. The InoqulA instrument was significantly better at dispersing organisms with counts of ≥10(5) bacteria/ml of urine than were the WASP-1 and WASP-10 instruments (P instrument was significantly greater than that produced by the WASP instrument. Copyright © 2016 Iversen et al.

  9. Expression of hBD-2 induced by 23-valent pneumococcal polysaccharide vaccine, Haemophilus influenzae type b vaccine and split influenza virus vaccine.

    Science.gov (United States)

    Shen, Zhenwei; Lei, Han

    2012-10-01

    Human β-defensin-2 (hBD-2) is an antimicrobial peptide with high activity and broad spectrum activity. hBD-2 expression may be highly elevated by microorganisms and inflammation. We reported that the majority of common vaccines used, including 23-valent pneumococcal polysaccharide vaccine, Haemophilus influenzae type b vaccine and split influenza virus vaccine, could induce the expression of hBD-2 in epithelial cells. Among them, the 23-valent pneumococcal polysaccharide vaccine was effective at a lower concentration (0.5 µg/ml), while Haemophilus influenzae type b vaccine and split influenza virus vaccine were effective at the concentration of 1 µg/ml. However, bacteriostatic experiments revealed that the split influenza virus vaccine was capable of inducing the highest antimicrobial activity. The medium of the 23-valent pneumococcal polysaccharide vaccine treatment group had a higher antimicrobial activity than the medium of the Haemophilus influenzae type b vaccine treatment group. The transcriptional regulator of hBD-2, that is, the NF-κB subunit, had a high level of activity, while the normal epithelial cells showed barely detectable activity, indicating that these vaccines have potential for clinical application.

  10. Comparison of chromogenic media to BD GeneOhm methicillin-resistant Staphylococcus aureus (MRSA) PCR for detection of MRSA in nasal swabs.

    Science.gov (United States)

    Bischof, Larry J; Lapsley, Linda; Fontecchio, Karen; Jacosalem, Dollie; Young, Carol; Hankerd, Rosemary; Newton, Duane W

    2009-07-01

    To select a method for detecting methicillin-resistant Staphylococcus aureus (MRSA) in nasal swabs, we compared BD GeneOhm MRSA PCR and various culture media (mannitol salt agar with cefoxitin, MRSASelect, CHROMagar MRSA, and Spectra MRSA). While PCR detection of MRSA was more rapid, MRSASelect and Spectra MRSA demonstrated performance equivalent to that of PCR with maximal detection at 24 h.

  11. Glycoprotein from street rabies virus BD06 induces early and robust immune responses when expressed from a non-replicative adenovirus recombinant.

    Science.gov (United States)

    Wang, Shuchao; Sun, Chenglong; Zhang, Shoufeng; Zhang, Xiaozhuo; Liu, Ye; Wang, Ying; Zhang, Fei; Wu, Xianfu; Hu, Rongliang

    2015-09-01

    The rabies virus (RABV) glycoprotein (G) is responsible for inducing neutralizing antibodies against rabies virus. Development of recombinant vaccines using the G genes from attenuated strains rather than street viruses is a regular practice. In contrast to this scenario, we generated three human adenovirus type 5 recombinants using the G genes from the vaccine strains SRV9 and Flury-LEP, and the street RABV strain BD06 (nrAd5-SRV9-G, nrAd5-Flury-LEP-G, and nrAd5-BD06-G). These recombinants were non-replicative, but could grow up to ~10(8) TCID50/ml in helper HEK293AD cells. Expression of the G protein was verified by immunostaining, quantitative PCR and cytometry. Animal experiments revealed that immunization with nrAd5-BD06-G can induce a higher seroconversion rate, a higher neutralizing antibody level, and a longer survival time after rabies virus challenge in mice when compared with the other two recombinants. Moreover, the expression of granulocyte-macrophage colony-stimulating factor (GM-CSF) was significantly higher in mice immunized with nrAd5-BD06-G, which might also contribute to the increased protection. These results show that the use of street RABV G for non-replicative systems may be an alternative for developing effective recombinant rabies vaccines.

  12. Comparison of the identification results of Candida species obtained by BD Phoenix™ and Maldi-TOF (Bruker Microflex LT Biotyper 3.1).

    Science.gov (United States)

    Marucco, Andrea P; Minervini, Patricia; Snitman, Gabriela V; Sorge, Adriana; Guelfand, Liliana I; Moral, Laura López

    2018-02-05

    In patients with invasive fungal infections, the accurate and rapid identification of the genus Candida is of utmost importance since antimycotic sensitivity is closely related to the species. The aim of the present study was to compare the identification results of species of the genus Candida obtained by BD Phoenix™ (Becton Dickinson [BD]) and Maldi-TOF MS (Bruker Microflex LT Biotyper 3.1). A total of 192 isolates from the strain collection belonging to the Mycology Network of the Autonomous City of Buenos Aires, Argentina, were analyzed. The observed concordance was 95%. Only 10 strains (5%) were not correctly identified by the BD Phoenix™ system. The average identification time with the Yeast ID panels was 8h 22min. The BD Phoenix™ system proved to be a simple, reliable and effective method for identifying the main species of the genus Candida. Copyright © 2017 Asociación Argentina de Microbiología. Publicado por Elsevier España, S.L.U. All rights reserved.

  13. Isolation and characterization of two new lipopeptide biosurfactants produced by Pseudomonas fluorescens BD5 isolated from water from the Arctic Archipelago of Svalbard

    Czech Academy of Sciences Publication Activity Database

    Janek, T.; Lukaszewicz, M.; Řezanka, Tomáš; Krasowska, A.

    2010-01-01

    Roč. 101, č. 15 (2010), s. 6118-6123 ISSN 0960-8524 Institutional research plan: CEZ:AV0Z50200510 Keywords : Pseudomonas fluorescens BD5 * Lipopeptide * Pseudofactins Subject RIV: EE - Microbiology, Virology Impact factor: 4.365, year: 2010

  14. 13 CFR 124.110 - Do Native Hawaiian Organizations have any special rules for applying to the 8(a) BD program?

    Science.gov (United States)

    2010-01-01

    ... have obtained, or are likely to obtain, a substantial unfair competitive advantage within an industry... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false Do Native Hawaiian Organizations have any special rules for applying to the 8(a) BD program? 124.110 Section 124.110 Business Credit and...

  15. Growth-phase-dependent expression of the lipolytic system of Acinetobacter calcoaceticus BD413: cloning of a gene encoding one of the esterases

    NARCIS (Netherlands)

    KOK, R. G.; Christoffels, V. M.; VOSMAN, B.; Hellingwerf, K. J.

    1993-01-01

    Acinetobacter calcoaceticus BD413, when grown in batch culture in nutrient broth, produces both extracellular lipase activity and cell-bound esterase activity during and after the transition between exponential growth and the stationary phase. From a library of A. calcoaceticus DNA in Escherichia

  16. The Drosophila Gr28bD product is a non-specific cation channel that can be used as a novel thermogenetic tool.

    Science.gov (United States)

    Mishra, Aditi; Salari, Autoosa; Berigan, Benton R; Miguel, Kayla C; Amirshenava, Marzie; Robinson, Abbey; Zars, Benjamin C; Lin, Jenna L; Milescu, Lorin S; Milescu, Mirela; Zars, Troy

    2018-01-17

    Extrinsic control of single neurons and neuronal populations is a powerful approach for understanding how neural circuits function. Adding new thermogenetic tools to existing optogenetic and other forms of intervention will increase the complexity of questions that can be addressed. A good candidate for developing new thermogenetic tools is the Drosophila gustatory receptor family, which has been implicated in high-temperature avoidance behavior. We examined the five members of the Gr28b gene cluster for temperature-dependent properties via three approaches: biophysical characterization in Xenopus oocytes, functional calcium imaging in Drosophila motor neurons, and behavioral assays in adult Drosophila. Our results show that Gr28bD expression in Xenopus oocytes produces a non-specific cationic current that is activated by elevated temperatures. This current is non-inactivating and non-voltage dependent. When expressed in Drosophila motor neurons, Gr28bD can be used to change the firing pattern of individual cells in a temperature-dependent fashion. Finally, we show that pan-neuronal or motor neuron expression of Gr28bD can be used to alter fruit fly behavior with elevated temperatures. Together, these results validate the potential of the Gr28bD gene as a founding member of a new class of thermogenetic tools.

  17. A dual mechanism involved in membrane and nucleic acid disruption of AvBD103b, a new avian defensin from the king penguin, against Salmonella enteritidis CVCC3377.

    Science.gov (United States)

    Teng, Da; Wang, Xiumin; Xi, Di; Mao, Ruoyu; Zhang, Yong; Guan, Qingfeng; Zhang, Jun; Wang, Jianhua

    2014-10-01

    The food-borne bacterial gastrointestinal infection is a serious public health threat. Defensins are evolutionarily conserved innate immune components with broad-spectrum antibacterial activity that do not easily induce resistance. AvBD103b, an avian defensin with potent activity against Salmonella enteritidis, was isolated from the stomach contents of the king penguin (Aptenodytes patagonicus). To elucidate further the antibacterial mechanism of AvBD103b, its effect on the S. enteritidis CVCC3377 cell membrane and intracellular DNA was researched. The cell surface hydrophobicity and a N-phenyl-1-naphthylamine uptake assay demonstrated that AvBD103b treatment increased the cell surface hydrophobicity and outer membrane permeability. Atomic absorption spectrometry, ultraviolet spectrophotometry, flow cytometry, and transmission electron microscopy (TEM) indicated that AvBD103b treatment can lead to the release of the cellular contents and cell death through damage of the membrane. DNA gel retardation and circular dichroism analysis demonstrated that AvBD103b interacted with DNA and intercalated into the DNA base pairs. A cell cycle assay demonstrated that AvBD103b affected cellular functions, such as DNA synthesis. Our results confirmed that AvBD103b exerts its antibacterial activity by damaging the cell membrane and interfering with intracellular DNA, ultimately causing cell death, and suggested that AvBD103b may be a promising candidate as an alternative to antibiotics against S. enteritidis.

  18. Repair of Staphylococcus aureus-infected wound with gene-modified C3H10T1/2 cells expressing BPI-BD3 fusion antibiotic peptide

    Directory of Open Access Journals (Sweden)

    Xin-ran ZHANG

    2015-10-01

    Full Text Available Objective To study the antibacterial and tissue reparative effect of BPI-BD3 gene-modified mesenchymal stem cells in a mouse model of wound infection. Methods C3H10T1/2 cells were transfected with recombinant adenovirus vector pAdxsi-BPI-BD3, the expression of BPI-BD3 fusion protein was verified by RT-PCR and Western blotting. Excision wound with a diameter of 1cm was inoculated with Staphylococcus aureuswas made on the back of 30 mice. The mice were randomly divided into 3 groups (10 each. Mice in group T were injected with BPI-BD3 gene-modified C3H10T1/2 cells through caudal vein, those in group C were injected with unmodified C3H10T1/2 cells, and in group N were injected with PBS as control. The wound repair result was evaluated by estimation of the percentage of remaining wound area and the amount of wound bacteria under the scar, followed by observation of pathological changes. Inflammatory reactions of the wounds were assessed accordingly. Results The amount of bacteria under the scar was less in group T than in the other two groups (P<0.05. It was also found that the wound healing process was faster in group T than in group C and group N. Pathological observation showed that the inflammatory reaction in group T was also significantly milder than in the other two groups. Conclusion BPI-BD3 gene-modified mesenchymal stem cells may enhance wound repair by controlling infection and promoting tissue regeneration, thus it may be promising in clinical application. DOI: 10.11855/j.issn.0577-7402.2015.09.07

  19. Evaluation of the BD MAX Enteric Parasite Panel for the detection of Cryptosporidium parvum/hominis, Giardia duodenalis and Entamoeba histolytica.

    Science.gov (United States)

    Perry, Michael D; Corden, Sally A; Lewis White, P

    2017-08-01

    Conventional laboratory detection methods for gastrointestinal parasites are time consuming, require considerable technical expertise and may suffer from poor analytical sensitivity. This study sought to evaluate the automated BD MAX Enteric Parasite Panel (EPP) for the detection of Cryptosporidium parvum/hominis, Entamoeba histolytica and Giardia duodenalis.Methodolgy. A total of 104 known positive samples (43 Cryptosporidium parvum/hominis and 61 G. duodenalis), 15 simulated samples (E. histolytica and other Entamoeba species) and 745 patient stool samples, submitted for enteric pathogen culture and microscopy, were inoculated into BD MAX EPP sample buffer tubes (SBTs). All specimens were blinded and tested within 7 days of SBT inoculation using the BD MAX EPP assay with results compared to those generated by microscopy.Results/Key findings. Combining the results from the known positive samples and anonymously tested patient samples, the sensitivity of the BD MAX EPP assay was 100 % for both Cryptosporidium spp. and G. duodenalis. Specificities of 99.7 and 98.9 % were calculated for the detection of Cryptosporidium spp. and G. duodenalis respectively. Insufficient clinical specimen data was available to determine the performance of the assay for E. histolytica detection. The findings of this study indicate that the BD MAX EPP is suitable for the detection of Cryptosporidium parvum/hominis and G. duodenalis from clinical specimens with reduced hands-on time and complexity compared to microscopy. Results for the detection of E. histolytica were promising although further work is required to evaluate the assay for the detection of this pathogen.

  20. The kinetics, current efficiency, and power consumption of electrochemical dye decolorization by BD-NCD film electrode

    Science.gov (United States)

    Nurhayati, Ervin; Juang, Yaju; Huang, Chihpin

    2017-06-01

    Diamond film electrode has been known as a material with very wide potential window for water electrolysis which leads to its applicability in numerous electrochemical processes. Its capability to produce hydroxyl radicals, a very strong oxidants, prompts its popular application in wastewater treatment. Batch and batch recirculation reactor were applied to perform bulk electrolysis experiments to investigate the kinetics of dye decolorization under different operation conditions, such as pH, active species, and current density. Furthermore, COD degradation data from batch recirculation reactor operation was used as the basis for the calculation of current efficiency and power consumption in the decolorization process. The kinetics of decolorization process using boron-doped nanocrystalline diamond (BD-NCD) film electrode revealed that acidic condition is favored for the dye degradation, and the presence of chloride ion in the solution was found to be more advantageous than sulfate active species, as evidenced by the higher reaction rate constants. Applying different current density of 10, 20 and 30 mA cm-2, it was found that the higher the current density the faster the decolorization rate. General current efficiency achieved after nearly total decolorization and 80% COD removal in batch recirculation reactor was around 74%, with specific power consumption of 4.4 kWh m-3 (in terms of volume of solution treated) or 145 kWh kg-1(in terms of kg COD treated).

  1. Rcupcake: an R package for querying and analyzing biomedical data through the BD2K PIC-SURE RESTful API.

    Science.gov (United States)

    Gutiérrez-Sacristán, Alba; Guedj, Romain; Korodi, Gabor; Stedman, Jason; Furlong, Laura I; Patel, Chirag J; Kohane, Isaac S; Avillach, Paul

    2018-04-15

    In the era of big data and precision medicine, the number of databases containing clinical, environmental, self-reported and biochemical variables is increasing exponentially. Enabling the experts to focus on their research questions rather than on computational data management, access and analysis is one of the most significant challenges nowadays. We present Rcupcake, an R package that contains a variety of functions for leveraging different databases through the BD2K PIC-SURE RESTful API and facilitating its query, analysis and interpretation. The package offers a variety of analysis and visualization tools, including the study of the phenotype co-occurrence and prevalence, according to multiple layers of data, such as phenome, exposome or genome. The package is implemented in R and is available under Mozilla v2 license from GitHub (https://github.com/hms-dbmi/Rcupcake). Two reproducible case studies are also available (https://github.com/hms-dbmi/Rcupcake-case-studies/blob/master/SSCcaseStudy_v01.ipynb, https://github.com/hms-dbmi/Rcupcake-case-studies/blob/master/NHANEScaseStudy_v01.ipynb). paul_avillach@hms.harvard.edu. Supplementary data are available at Bioinformatics online.

  2. Studies of RICH detectors and the $B_d \\rightarrow K^{*}\\mu^{+}\\mu^{-}$ decay at the LHCb experiment

    CERN Document Server

    Skottowe, Hugh Philip

    2010-01-01

    LHCb is an experiment designed for precise studies of the large number of b-hadrons expected at the Large Hadron Collider. This thesis first introduces the Standard Model of Particle Physics and motivates the LHCb experiment. The design of the LHCb forward spectrometer is then described, including performance of the detector with recent LHC collisions. The ring imaging Cherenkov (RICH) sub-detector is described in particular detail. This uses three radiators to identify particles over the momentum range 1-100 GeV/c. Tests performed of an LHCb RICH prototype with a charged pion beam are described in detail. Excellent performance is found in agreement with that expected from studies of simulated data. The decay $B_d \\rightarrow K^{*}\\mu^{+}\\mu^{-}$ is a powerful indirect probe of new physics. In particular, the forward-backward asymmetry of the muon pair is precisely predicted in the Standard Model and many new physics models, and measurements of this asymmetry will discriminate between the widely varying expec...

  3. TRUMP-BD: A computer code for the analysis of nuclear fuel assemblies under severe accident conditions

    International Nuclear Information System (INIS)

    Lombardo, N.J.; Marseille, T.J.; White, M.D.; Lowery, P.S.

    1990-06-01

    TRUMP-BD (Boil Down) is an extension of the TRUMP (Edwards 1972) computer program for the analysis of nuclear fuel assemblies under severe accident conditions. This extension allows prediction of the heat transfer rates, metal-water oxidation rates, fission product release rates, steam generation and consumption rates, and temperature distributions for nuclear fuel assemblies under core uncovery conditions. The heat transfer processes include conduction in solid structures, convection across fluid-solid boundaries, and radiation between interacting surfaces. Metal-water reaction kinetics are modeled with empirical relationships to predict the oxidation rates of steam-exposed Zircaloy and uranium metal. The metal-water oxidation models are parabolic in form with an Arrhenius temperature dependence. Uranium oxidation begins when fuel cladding failure occurs; Zircaloy oxidation occurs continuously at temperatures above 13000 degree F when metal and steam are available. From the metal-water reactions, the hydrogen generation rate, total hydrogen release, and temporal and spatial distribution of oxide formations are computed. Consumption of steam from the oxidation reactions and the effect of hydrogen on the coolant properties is modeled for independent coolant flow channels. Fission product release from exposed uranium metal Zircaloy-clad fuel is modeled using empirical time and temperature relationships that consider the release to be subject to oxidation and volitization/diffusion (''bake-out'') release mechanisms. Release of the volatile species of iodine (I), tellurium (Te), cesium (Ce), ruthenium (Ru), strontium (Sr), zirconium (Zr), cerium (Cr), and barium (Ba) from uranium metal fuel may be modeled

  4. TRUMP-BD: A computer code for the analysis of nuclear fuel assemblies under severe accident conditions

    Energy Technology Data Exchange (ETDEWEB)

    Lombardo, N.J.; Marseille, T.J.; White, M.D.; Lowery, P.S.

    1990-06-01

    TRUMP-BD (Boil Down) is an extension of the TRUMP (Edwards 1972) computer program for the analysis of nuclear fuel assemblies under severe accident conditions. This extension allows prediction of the heat transfer rates, metal-water oxidation rates, fission product release rates, steam generation and consumption rates, and temperature distributions for nuclear fuel assemblies under core uncovery conditions. The heat transfer processes include conduction in solid structures, convection across fluid-solid boundaries, and radiation between interacting surfaces. Metal-water reaction kinetics are modeled with empirical relationships to predict the oxidation rates of steam-exposed Zircaloy and uranium metal. The metal-water oxidation models are parabolic in form with an Arrhenius temperature dependence. Uranium oxidation begins when fuel cladding failure occurs; Zircaloy oxidation occurs continuously at temperatures above 13000{degree}F when metal and steam are available. From the metal-water reactions, the hydrogen generation rate, total hydrogen release, and temporal and spatial distribution of oxide formations are computed. Consumption of steam from the oxidation reactions and the effect of hydrogen on the coolant properties is modeled for independent coolant flow channels. Fission product release from exposed uranium metal Zircaloy-clad fuel is modeled using empirical time and temperature relationships that consider the release to be subject to oxidation and volitization/diffusion ( bake-out'') release mechanisms. Release of the volatile species of iodine (I), tellurium (Te), cesium (Ce), ruthenium (Ru), strontium (Sr), zirconium (Zr), cerium (Cr), and barium (Ba) from uranium metal fuel may be modeled.

  5. Subunit CydX of Escherichia coli cytochrome bd ubiquinol oxidase is essential for assembly and stability of the di-heme active site.

    Science.gov (United States)

    Hoeser, Jo; Hong, Sangjin; Gehmann, Gerfried; Gennis, Robert B; Friedrich, Thorsten

    2014-05-02

    Cytochrome bd ubiquinol oxidase uses the electron transport from ubiquinol to oxygen to establish a proton gradient across the membrane. The enzyme complex consists of subunits CydA and B and contains two b- and one d-type hemes as cofactors. Recently, it was proposed that a third subunit named CydX is essential for the function of the complex. Here, we show that CydX is indeed a subunit of purified Escherichia coli cytochrome bd oxidase and that the small protein is needed either for the assembly or the stability of the active site di-heme center and, thus, is essential for oxidase activity. Copyright © 2014 Federation of European Biochemical Societies. All rights reserved.

  6. Natural genetic transformation in Acinetobacter sp. BD413 Biofilms: introducing natural genetic transformation as a tool for bioenhancement of biofilm reactors

    Energy Technology Data Exchange (ETDEWEB)

    Hendrickx, L.

    2002-07-01

    This study focussed on the localization and quantification of natural genetic transformation using neutral and disadvantageous genes in monoculture biofilms to investigate gene transfer and expression of the transferred genes in the absence of a selective advantage. Data obtained by this investigation were regarded as initial steps for evaluating the applicability of adding catabolic traits into the indigenous bacterial community of biofilm reactors by in situ natural genetic transformation. Because Acinetobacter spp. strains are readily found in waste water treatment plants and because Acinetobacter sp. BD413 possesses a high effective level of competence, natural genetic transformation was investigated in monoculture Acinetobacter sp. BD413 biofilms. The genes used for transformation encoded for the green fluorescent protein (GFP) and its variants. Monitoring of transformation events were performed with the use of automated confocal laser scanning microscopy (CLSM) and semi automated digital image processing and analysis. (orig.)

  7. Eksperimentasi Model Numbered Heads Together Dengan Make a Match (Nht Mm) Dan Numbered Heads Together Dengan Bamboo Dancing (Nht Bd) Ditinjau Dari Kecerdasan Interpersonal

    OpenAIRE

    Dewi, Arianti Puspita; Kusmayadi, Tri Atmojo; Usodo, Budi

    2014-01-01

    The purposes of this research were to determine: (1) which students mathematics achievement would be better, student given NHT MM, NHT BD, or direct learning model, (2) which students mathematics achievement would be better, student with interpersonal intelligence of high, medium or low, (3) which students mathematics achievement would be better, student with interpersonal intelligence of high, medium, or low on each learning model, (4) which student mathematics achievement would be better, ...

  8. Comparison of Chromogenic Media to BD GeneOhm Methicillin-Resistant Staphylococcus aureus (MRSA) PCR for Detection of MRSA in Nasal Swabs▿

    Science.gov (United States)

    Bischof, Larry J.; Lapsley, Linda; Fontecchio, Karen; Jacosalem, Dollie; Young, Carol; Hankerd, Rosemary; Newton, Duane W.

    2009-01-01

    To select a method for detecting methicillin-resistant Staphylococcus aureus (MRSA) in nasal swabs, we compared BD GeneOhm MRSA PCR and various culture media (mannitol salt agar with cefoxitin, MRSASelect, CHROMagar MRSA, and Spectra MRSA). While PCR detection of MRSA was more rapid, MRSASelect and Spectra MRSA demonstrated performance equivalent to that of PCR with maximal detection at 24 h. PMID:19439540

  9. Quantitative spectroscopy of extreme helium stars Model atmospheres and a non-LTE abundance analysis of BD+10°2179

    Science.gov (United States)

    Kupfer, T.; Przybilla, N.; Heber, U.; Jeffery, C. S.; Behara, N. T.; Butler, K.

    2017-10-01

    Extreme helium stars (EHe stars) are hydrogen-deficient supergiants of spectral type A and B. They are believed to result from mergers in double degenerate systems. In this paper, we present a detailed quantitative non-LTE spectral analysis for BD+10°2179, a prototype of this rare class of stars, using UV-Visual Echelle Spectrograph and Fiber-fed Extended Range Optical Spectrograph spectra covering the range from ˜3100 to 10 000 Å. Atmosphere model computations were improved in two ways. First, since the UV metal line blanketing has a strong impact on the temperature-density stratification, we used the atlas12 code. Additionally, We tested atlas12 against the benchmark code sterne3, and found only small differences in the temperature and density stratifications, and good agreement with the spectral energy distributions. Secondly, 12 chemical species were treated in non-LTE. Pronounced non-LTE effects occur in individual spectral lines but, for the majority, the effects are moderate to small. The spectroscopic parameters give Teff =17 300±300 K and log g = 2.80±0.10, and an evolutionary mass of 0.55±0.05 M⊙. The star is thus slightly hotter, more compact and less massive than found in previous studies. The kinematic properties imply a thick-disc membership, which is consistent with the metallicity [Fe/H] ≈ -1 and α-enhancement. The refined light-element abundances are consistent with the white dwarf merger scenario. We further discuss the observed helium spectrum in an appendix, detecting dipole-allowed transitions from about 150 multiplets plus the most comprehensive set of known/predicted isolated forbidden components to date. Moreover, a so far unreported series of pronounced forbidden He I components is detected in the optical-UV.

  10. Comparison of Nucleic Acid Amplification Assays with BD Affirm VPIII for Diagnosis of Vaginitis in Symptomatic Women

    Science.gov (United States)

    Lembke, Bryndon D.; Ramachandran, Kalpana; Body, Barbara A.; Nye, Melinda B.; Rivers, Charles A.; Schwebke, Jane R.

    2013-01-01

    A commercially available, nonamplified, nucleic acid probe-based test system (BD Affirm VPIII) was compared with nucleic acid amplification (NAA)-based assays for determining the etiology of vaginitis in a cohort of 323 symptomatic women. First, a semiquantitative, multiplexed PCR assay (BV-PCR) and the Affirm VPIII Gardnerellavaginalis test were compared with a unified bacterial-vaginosis (BV) reference standard incorporating both Nugent Gram stain scores and Amsel clinical criteria. In the evaluable population of 305 patients, BV-PCR was 96.9% (191/197) sensitive and 92.6% specific (100/108) for BV, while Affirm VPIII was 90.1% sensitive (179/197) and 67.6% specific (73/108). Second, a multiplexed PCR assay detecting Candida albicans and Candida glabrata (CAN-PCR) was compared with the Affirm VPIII Candida test using a reference standard for vulvovaginal candidiasis (VVC) of yeast culture plus exclusion of alternate vaginitis etiologies. In the population evaluated (n = 102), CAN-PCR was 97.7% sensitive (42/43) and 93.2% specific (55/59) and Affirm VP III was 58.1% sensitive (25/43) and 100% specific (59/59) for VVC. Finally, the results of a commercial NAA test (GenProbe Aptima Trichomonas vaginalis assay; ATV) for T. vaginalis were compared with the Affirm VPIII Trichomonas vaginalis test. In the absence of an independent reference standard for trichomonal vaginitis (TV), a positive result in either assay was deemed to represent true infection. In the evaluable cohort of 388 patients, the sensitivity of ATV was 98.1% (53/54) versus 46.3% (25/54) for Affirm VPIII. The diagnostic accuracy of the combined NAA-based test construct was approximately 20 to 25% higher than that of the Affirm VPIII when modeled in populations with various prevalences of infectious vaginitis. PMID:23985917

  11. Factors associated with stigma among caregivers of patients with bipolar disorder in the STEP-BD study.

    Science.gov (United States)

    Gonzalez, Jodi M; Perlick, Deborah A; Miklowitz, David J; Kaczynski, Richard; Hernandez, Melissa; Rosenheck, Robert A; Culver, Jenifer L; Ostacher, Michael J; Bowden, Charles L

    2007-01-01

    Little is known about the factors contributing to mental illness stigma among caregivers of people with bipolar disorder. A total of 500 caregivers of patients participating in the Systematic Treatment Enhancement Program for Bipolar Disorder (STEP-BD) study were interviewed in a cross-sectional design on measures of stigma, mood, burden, and coping. Relatives and friends with bipolar disorder were assessed on measures of diagnosis and clinical status, determined by a days-well measure derived from psychiatrist ratings of DSM-IV episode status. Because patients' clinical status varied widely, separate models were run for patients who were euthymic for at least three-fourths of the past year (well group) and for those who met criteria for an affective episode for at least one-fourth of the previous year (unwell group). Stepwise multiple regression was used to identify patient, illness, and caregiver characteristics associated with caregiver stigma. In the unwell group, greater mental illness stigma was associated with bipolar I (versus II) disorder, less social support for the caregiver, fewer caregiver social interactions, and being a caregiver of Hispanic descent. In the well group, greater stigma was associated with being a caregiver who is the adult child of a parent with bipolar disorder, who has a college education, who has fewer social interactions, and who cares for a female bipolar patient. Mental illness stigma was found to be prevalent among caregivers of persons with bipolar disorder who have active symptoms as well as for caregivers of those who have remitted symptoms. Stigma is typically associated with factors identifying patients as "different" during symptomatic periods. Research is needed to understand how the stigma experienced by caregivers during stable phases of illness differs from the stigma experienced during patients' illness states.

  12. Guillem Peire de Cazals, “Be·m plagr’ueymais qu’ab vos dona·m valgues” (BdT 227.6

    Directory of Open Access Journals (Sweden)

    Alessio Collura

    2011-12-01

    Full Text Available This paper proposes a new edition with commentary of the poem “Be·m plagr’ueymais qu’ab vos, dona, ·m valgues” by Guillem Peire de Cazals and represents a first critical and hermeneutical reassessment of the poetry of the troubadour from Cahors, that has long been neglected. The text presents the classical structure of a love-story (springtime exordium, singing brought on by love, the theme of improvement, courting with no hope of a reward, a request for mercé and invites the fin aman to be patient. The song is examined from the viewpoint of its metrical and stylistic relations to other troubadour poems (Bernart de Ventadorn, “Can par la flors josta·l vert folh” [BdT 70.41] and “La dousa votz ai auzida” [BdT 70.23] and Lanfranc Cigala, “Ioios d’amor farai de ioi senblan” [BdT 282.12], and represents an early example of the mannerisms and experimental tendencies that characterize Guillem Peire’s poems. The article also attempts to date the composition to the twenties or thirties of the 13th century.

  13. In addition to its antiviral and immunomodulatory properties, the zebrafish β-defensin 2 (zfBD2) is a potent viral DNA vaccine molecular adjuvant.

    Science.gov (United States)

    García-Valtanen, P; Martinez-Lopez, A; Ortega-Villaizan, M; Perez, L; Coll, J M; Estepa, A

    2014-01-01

    It is well known that β-defensins are key components of the host innate immune response against pathogens and potentially provide a link between innate and adaptive immunity. In zebrafish (Danio rerio), a vertebrate model species in numerous biomedical fields, three β-defensin isoforms were recently identified. To our knowledge, however, studies describing antimicrobial or immunomodulatory properties of any of the zebrafish β-defensins isoforms are absent today. Since it is indubitable that deepening the study of zebrafish β-defensins would be of interest in this work we investigated whether or not the zebrafish β-defensin 2 (zfBD2) has the antiviral properties described for their vertebrate counterparts. Our in vitro and in vivo studies showed that zfBD2 has antiviral activity, immunomodulatory properties and, most importantly, is a potent viral DNA vaccine molecular adjuvant. In addition, a potential relationship between zfBD2 activity and the NF-κB signaling pathway is suggested. Altogether these results show that the zebrafish could be a suitable in vivo animal model to study the roles played by β-defensin 2 in viral diseases, vaccinology and even in clinical dermatology. To note that psoriasis can be induced in zebrafish and the over-expression of β-defensin 2 is implicated in the inflammatory response associated with this human skin disorder. Copyright © 2013 Elsevier B.V. All rights reserved.

  14. Svingningsteori, Bd. 1

    DEFF Research Database (Denmark)

    Nielsen, Søren R. K.

    Nærværende lærebog er skrevet med henblik på undervisningen i lineær svingingsteori på konstruktionsliniens 8. semester på Aalborg Universitetscenter. Det pågældende kursus danner grundlaget for efterfølgende undervisning i ikke-lineær svingningsteori, hvilket har påvirket fremstillingens form. Det...

  15. Genital and extra-genital screening for gonorrhoea using the BD Probetec ET system with an in-house PCR method targeting the porA pseudogene as confirmatory test

    DEFF Research Database (Denmark)

    Skovgaard, Sissel; Larsen, Helle Kiellberg; Sand, Carsten

    2012-01-01

    for Chlamydia trachomatis testing were also examined for GC on the BD Viper™ platform using the BD Probetec ET system. In order to avoid false-positive results all GC BD reactive samples were re-tested using a PCR method with the porA pseudogene as target. Using this method we screened 170% more samples for GC...... than in the previous year, in the same population, and diagnosed more than twice as many GC-positive episodes. The BD system can be used successfully to screen extra-genital as well as genital specimen types for GC in a low-prevalence area if it is combined with a validated confirmatory PCR test....

  16. [Jörg Zägel (in Zusammenarbeit mit Reiner Steinweg). Vergangenheitsdiskurse in der Ostseeregion. Bd. 1. Auseinandersetzungen in den nordischen Staaten über Krieg. Völkermord, Diktatur, Besatzung und Vertreibung; B. 2 : Die Sicht auf Krieg, Diktat

    Index Scriptorium Estoniae

    Hecker-Stampehl, Jan

    2011-01-01

    Arvustus : Jörg Zägel (in Zusammenarbeit mit Reiner Steinweg). Vergangenheitsdiskurse in der Ostseeregion. Bd. 1. Auseinandersetzungen in den nordischen Staaten über Krieg. Völkermord, Diktatur, Besatzung und Vertreibung. Berlin : LIT Verlag, 2007. (Kieler Schriften zur Friedenswissenschaft. 14); Bd. 2 : Die Sicht auf Krieg, Diktatur, Völkermord, Besatsung und Vertreibung in Russland, Polen und den baltischen Staaten. Berlin: Lit Verlag, 2007. (Kieler Schriften zur Friedenswissenschaft. 15)

  17. Head-to-head comparison of the diagnostic accuracies of BD Veritor™ System RSV and Quidel® Sofia® RSV FIA systems for respiratory syncytial virus (RSV) diagnosis.

    Science.gov (United States)

    Kanwar, Neena; Hassan, Ferdaus; Nguyen, Ashley; Selvarangan, Rangaraj

    2015-04-01

    Respiratory syncytial virus (RSV) is one of the most common causes of severe lower respiratory tract disease among infants and young children. BD Veritor™ System RSV (BD) and Quidel(®) Sofia(®) RSV FIA (QD) are the new generation lateral flow digital immunoassay (DIA) tests with an instrumented read for the qualitative detection of RSV viral antigens. To compare the diagnostic accuracies of BD and QD for RSV detection using fresh nasopharyngeal aspirates and nasopharyngeal swab specimens collected in universal transport media during 2013-2014 respiratory season. The two DIA tests were performed simultaneously on randomly selected specimens on a weekly basis during the RSV season until 200 fresh remnant specimens were enrolled. Real-time RT-PCR assay results were used to compare and evaluate the performance of both RSV DIA assays. Among 200 specimens tested, RSV real-time RT-PCR assay detected RSV in 104 samples, while QD detected 84 samples and BD detected 74 samples as positive. The overall sensitivity for detection of RSV in comparison to PCR was 71.15% (61.3-79.4) for BD and 80.77% (71.6-87.6) for QD system (P=0.36). The specificity was 100% (95.2-100) for both systems. The work flow analysis revealed that the overall specimen processing time was significantly lower for BD as compared with the QD assay. In comparison with the real-time PCR, the QD system showed a higher sensitivity than that of the BD system, but the difference did not reach statistical significance (P=0.36). Both BD and QD systems were found comparable in terms of specificity. Copyright © 2015 Elsevier B.V. All rights reserved.

  18. Development and optimization of a real-time PCR assay for detection of herpes simplex and varicella-zoster viruses in skin and mucosal lesions by use of the BD Max open system.

    Science.gov (United States)

    Cárdenas, Ana María; Edelstein, Paul H; Alby, Kevin

    2014-12-01

    We transitioned laboratory-developed PCR assays for herpes simplex virus 1 (HSV-1), HSV-2, and varicella-zoster virus (VZV) to the BD Max system by using BD Max open system reagents. After optimization, the agreement with the reference PCR assay was 100% (123/123) for HSV-1, 96.7% (119/123) for HSV-2, and 100% (60/60) for VZV using retrospective clinical samples. Copyright © 2014, American Society for Microbiology. All Rights Reserved.

  19. Evaluation of the BD GeneOhm MRSA and VanR Assays as a Rapid Screening Tool for Detection of Methicillin-Resistant Staphylococcus aureus and Vancomycin-Resistant Enterococci in a Tertiary Hospital in Saudi Arabia

    Directory of Open Access Journals (Sweden)

    H. Hassan

    2011-01-01

    Full Text Available Objectives. The aim of this study was to evaluate the diagnostic performance of BD GeneOhm VanR Assay, a rapid PCR test that detects the presence of vanA and/or vanB genes and the performance of BDGeneOhm MRSA Assay which detects the staphylococcal cassette chromosomemec (SCCmec cassette carrying the mecA gene and Staphylococcus aureus specific sequence located within the orfX gene. Methods. 300 duplicate rectal swabs collected consecutively were analyzed for the presence of VRE by culture and BD PCR. 2267 duplicate swabs were collected (728 nasal and 1539 groin swabs and analyzed for the presence of MRSA by culture method and BD PCR. Results. Compared to culture, the BD GeneOhm VanR Assay showed a sensitivity, specificity, positive predictive value (PPV and negative predictive value (NPV of 100%, 91.1%, 23.5%, and 100%, respectively. The BD GeneOhm MRSA Assay revealed sensitivity, specificity, PPV, and NPV of 97.2%, 99.4%, 89.7%, and 99.9%, respectively, for nasal swabs. For groin swabs, it was 100%, 98.7%, 61.5% and 100%, respectively. Conclusion. The BD GeneOhm vanR Assay is a good screening test for rapid exclusion of VRE carriers in hospitals. The BD GeneOhm MRSA Assay represents a reliable screening test. The true strength of the BD GeneOhm Assay for MRSA and VRE is its exceptionally high NPV making the test an ideal tool for rapid exclusion of MRSA and VRE carriers in hospitals. As a consequence, this would dramatically shorten the patient isolation time.

  20. Influence of centrifugation conditions on the results of 77 routine clinical chemistry analytes using standard vacuum blood collection tubes and the new BD-Barricor tubes.

    Science.gov (United States)

    Cadamuro, Janne; Mrazek, Cornelia; Leichtle, Alexander B; Kipman, Ulrike; Felder, Thomas K; Wiedemann, Helmut; Oberkofler, Hannes; Fiedler, Georg M; Haschke-Becher, Elisabeth

    2018-02-15

    Although centrifugation is performed in almost every blood sample, recommendations on duration and g-force are heterogeneous and mostly based on expert opinions. In order to unify this step in a fully automated laboratory, we aimed to evaluate different centrifugation settings and their influence on the results of routine clinical chemistry analytes. We collected blood from 41 healthy volunteers into BD Vacutainer PST II-heparin-gel- (LiHepGel), BD Vacutainer SST II-serum-, and BD Vacutainer Barricor heparin-tubes with a mechanical separator (LiHepBar). Tubes were centrifuged at 2000xg for 10 minutes and 3000xg for 7 and 5 minutes, respectively. Subsequently 60 and 21 clinical chemistry analytes were measured in plasma and serum samples, respectively, using a Roche COBAS instrument. High sensitive Troponin T, pregnancy-associated plasma protein A, ß human chorionic gonadotropin and rheumatoid factor had to be excluded from statistical evaluation as many of the respective results were below the measuring range. Except of free haemoglobin (fHb) measurements, no analyte result was altered by the use of shorter centrifugation times at higher g-forces. Comparing LiHepBar to LiHepGel tubes at different centrifugation setting, we found higher lactate-dehydrogenase (LD) (P = 0.003 to centrifuged at higher speed (3000xg) for a shorter amount of time (5 minutes) without alteration of the analytes tested in this study. When using LiHepBar tubes for blood collection, a separate LD reference value might be needed.

  1. Evaluation of BD MAX Staph SR Assay for Differentiating Between Staphylococcus aureus and Coagulase-Negative Staphylococci and Determining Methicillin Resistance Directly From Positive Blood Cultures.

    Science.gov (United States)

    Lee, Jaewoong; Park, Yeon Joon; Park, Dong Jin; Park, Kang Gyun; Lee, Hae Kyung

    2017-01-01

    We evaluated the performance of the BD MAX StaphSR Assay (SR assay; BD, USA) for direct detection of Staphylococcus aureus and methicillin resistance not only in S. aureus but also in coagulase-negative Staphylococci (CNS) from positive blood cultures. From 228 blood culture bottles, 103 S. aureus [45 methicillin-resistant S. aureus (MRSA), 55 methicillin-susceptible S. aureus (MSSA), 3 mixed infections (1 MRSA+Enterococcus faecalis, 1 MSSA+MRCNS, 1 MSSA+MSCNS)], and 125 CNS (102 MRCNS, 23 MSCNS) were identified by Vitek 2. For further analysis, we obtained the cycle threshold (Ct) values from the BD MAX system software to determine an appropriate cutoff value. For discrepancy analysis, conventional mecA/mecC PCR and oxacillin minimum inhibitory concentrations (MICs) were determined. Compared to Vitek 2, the SR assay identified all 103 S. aureus isolates correctly but failed to detect methicillin resistance in three MRSA isolates. All 55 MSSA isolates were correctly identified by the SR assay. In the concordant cases, the highest Ct values for nuc, mecA, and mec right-extremity junction (MREJ) were 25.6, 22, and 22.2, respectively. Therefore, we selected Ct values from 0-27 as a range of positivity, and applying this cutoff, the sensitivity/specificity of the SR assay were 100%/100% for detecting S. aureus, and 97.9%/98.1% and 99.0%/95.8% for detecting methicillin resistance in S. aureus and CNS, respectively. We propose a Ct cutoff value for nuc/mec assay without considering MREJ because mixed cultures of MSSA and MRCNS were very rare (0.4%) in the positive blood cultures.

  2. Long-term stability of human genomic and human papillomavirus DNA stored in BD SurePath and Hologic PreservCyt liquid-based cytology media.

    Science.gov (United States)

    Agreda, Patricia M; Beitman, Gerard H; Gutierrez, Erin C; Harris, James M; Koch, Kristopher R; LaViers, William D; Leitch, Sharon V; Maus, Courtney E; McMillian, Ray A; Nussbaumer, William A; Palmer, Marcus L R; Porter, Michael J; Richart, Gregory A; Schwab, Ryan J; Vaughan, Laurence M

    2013-08-01

    We evaluated the effect of storage at 2 to 8°C on the stability of human genomic and human papillomavirus (HPV) DNA stored in BD SurePath and Hologic PreservCyt liquid-based cytology media. DNA retained the ability to be extracted and PCR amplified for more than 2.5 years in both medium types. Prior inability to detect DNA in archived specimens may have been due to failure of the extraction method to isolate DNA from fixed cells.

  3. Long-Term Stability of Human Genomic and Human Papillomavirus DNA Stored in BD SurePath and Hologic PreservCyt Liquid-Based Cytology Media

    OpenAIRE

    Agreda, Patricia M.; Beitman, Gerard H.; Gutierrez, Erin C.; Harris, James M.; Koch, Kristopher R.; LaViers, William D.; Leitch, Sharon V.; Maus, Courtney E.; McMillian, Ray A.; Nussbaumer, William A.; Palmer, Marcus L. R.; Porter, Michael J.; Richart, Gregory A.; Schwab, Ryan J.; Vaughan, Laurence M.

    2013-01-01

    We evaluated the effect of storage at 2 to 8°C on the stability of human genomic and human papillomavirus (HPV) DNA stored in BD SurePath and Hologic PreservCyt liquid-based cytology media. DNA retained the ability to be extracted and PCR amplified for more than 2.5 years in both medium types. Prior inability to detect DNA in archived specimens may have been due to failure of the extraction method to isolate DNA from fixed cells.

  4. Evidence of a massive planet candidate orbiting the young active K5V star BD+20 1790

    Science.gov (United States)

    Hernán-Obispo, M.; Gálvez-Ortiz, M. C.; Anglada-Escudé, G.; Kane, S. R.; Barnes, J. R.; de Castro, E.; Cornide, M.

    2010-03-01

    Context. BD+20 1790 is a young active, metal-rich, late-type K5Ve star. We have undertaken a study of stellar activity and kinematics for this star over the past few years. Previous results show a high level of stellar activity, with the presence of prominence-like structures, spots on the surface, and strong flare events, despite the moderate rotational velocity of the star. In addition, radial velocity variations with a semi-amplitude of up to 1 km s-1 were detected. Aims: We investigate the nature of these radial velocity variations, in order to determine whether they are due to stellar activity or the reflex motion of the star induced by a companion. Methods: We have analysed high-resolution echelle spectra by measuring stellar activity indicators and computing radial velocity (RV) and bisector velocity spans. Two-band photometry was also obtained to produce the light curve and determine the photometric period. Results: Based upon the analysis of the bisector velocity span, as well as spectroscopic indices of chromospheric indicators, Ca ii H & K, Hα, and taking the photometric analysis into account, we report that the best explanation for the RV variation is the presence of a substellar companion. The Keplerian fit of the RV data yields a solution for a close-in massive planet with an orbital period of 7.78 days. The presence of the close-in massive planet could also be an interpretation for the high level of stellar activity detected. Since the RV data are not part of a planet search programme, we can consider our results as a serendipitous evidence of a planetary companion. To date, this is the youngest main sequence star for which a planetary candidate has been reported. Based on observations collected at the German-Spanish Astronomical Center, Calar Alto, jointly operated by the Max-Planck-Institut für Astronomie Heidelberg and the Instituto de Astrofísica de Andalucía (CSIC). Based on observations made with the Italian Telescopio Nazionale Galileo

  5. Metabolic engineering of Pediococcus acidilactici BD16 for production of vanillin through ferulic acid catabolic pathway and process optimization using response surface methodology.

    Science.gov (United States)

    Kaur, Baljinder; Chakraborty, Debkumar; Kumar, Balvir

    2014-10-01

    Occurrence of feruloyl-CoA synthetase (fcs) and enoyl-CoA hydratase (ech) genes responsible for the bioconversion of ferulic acid to vanillin have been reported and characterized from Amycolatopsis sp., Streptomyces sp., and Pseudomonas sp. Attempts have been made to express these genes in Escherichia coli DH5α, E. coli JM109, and Pseudomonas fluorescens. However, none of the lactic acid bacteria strain having GRAS status was previously proposed for heterologous expression of fcs and ech genes for production of vanillin through biotechnological process. Present study reports heterologous expression of vanillin synthetic gene cassette bearing fcs and ech genes in a dairy isolate Pediococcus acidilactici BD16. After metabolic engineering, statistical optimization of process parameters that influence ferulic acid to vanillin biotransformation in the recombinant strain was carried out using central composite design of response surface methodology. After scale-up of the process, 3.14 mM vanillin was recovered from 1.08 mM ferulic acid per milligram of recombinant cell biomass within 20 min of biotransformation. From LCMS-ESI spectral analysis, a metabolic pathway of phenolic biotransformations was predicted in the recombinant P. acidilactici BD16 (fcs (+)/ech (+)).

  6. Pigment epithelium-derived factor (PEDF) regulates metabolism and insulin secretion from a clonal rat pancreatic beta cell line BRIN-BD11 and mouse islets.

    Science.gov (United States)

    Chen, Younan; Carlessi, Rodrigo; Walz, Nikita; Cruzat, Vinicius Fernandes; Keane, Kevin; John, Abraham N; Jiang, Fang-Xu; Carnagarin, Revathy; Dass, Crispin R; Newsholme, Philip

    2016-05-05

    Pigment epithelium-derived factor (PEDF) is a multifunctional glycoprotein, associated with lipid catabolism and insulin resistance. In the present study, PEDF increased chronic and acute insulin secretion in a clonal rat β-cell line BRIN-BD11, without alteration of glucose consumption. PEDF also stimulated insulin secretion from primary mouse islets. Seahorse flux analysis demonstrated that PEDF did not change mitochondrial respiration and glycolytic function. The cytosolic presence of the putative PEDF receptor - adipose triglyceride lipase (ATGL) - was identified, and ATGL associated stimulation of glycerol release was robustly enhanced by PEDF, while intracellular ATP levels increased. Addition of palmitate or ex vivo stimulation with inflammatory mediators induced β-cell dysfunction, effects not altered by the addition of PEDF. In conclusion, PEDF increased insulin secretion in BRIN-BD11 and islet cells, but had no impact on glucose metabolism. Thus elevated lipolysis and enhanced fatty acid availability may impact insulin secretion following PEDF receptor (ATGL) stimulation. Copyright © 2016 Elsevier Ireland Ltd. All rights reserved.

  7. Comparison of GeneXpert PCR to BD GeneOhm for detecting C. difficile toxin gene in GDH positive toxin negative samples.

    Science.gov (United States)

    Agaronov, Maksim; Karak, Soma G; Maldonado, Yanice; Tetreault, Janice; Aslanzadeh, Jaber

    2012-01-01

    The need for rapid diagnosis of Clostridium difficile (C. difficile) associated infection in a clinical microbiology laboratory has provided the stimulus for new diagnostic tests and testing protocols. A two-test algorithm has been proposed using assays such as Quik Chek Complete, which detects both C. difficile glutamate dehydrogenase (GDH) and C. difficile toxins A and B, followed by reflex testing of samples having inconclusive results (GDH positive and toxin negative) with PCR for identification of toxin gene specific DNA. The goal of this study was to compare the outcome and efficiency of PCR assays, BD GeneOhm and GeneXpert, for detecting C. difficile toxin B gene in samples that have tested indeterminate for C. difficile by the Quik Chek Complete test. Over a three-month period, a total of 41 cases tested indeterminate by Quik Chek Complete test and were retested by the aforementioned PCR assays. Out of the 41 samples, 36 had matching results in both assays; 19 negative samples and 17 positive samples. In terms of efficiency, GeneXpert was user-friendly and had a turnaround time (TAT) of 45 minutes with two-minute specimen processing compared to BD GeneOhm which had a TAT of 75 to 90 minutes.

  8. A common variant of staphylococcal cassette chromosome mec type IVa in isolates from Copenhagen, Denmark, is not detected by the BD GeneOhm methicillin-resistant Staphylococcus aureus assay

    DEFF Research Database (Denmark)

    Bartels, Mette Damkjaer; Boye, Kit; Rohde, Susanne Mie

    2009-01-01

    Rapid tests for detection of methicillin-resistant Staphylococcus aureus (MRSA) carriage are important to limit the transmission of MRSA in the health care setting. We evaluated the performance of the BD GeneOhm MRSA real-time PCR assay using a diverse collection of MRSA isolates, mainly from......-susceptible Staphylococcus aureus isolates were included as negative controls. Forty-four MRSA isolates were undetectable; of these, 95% harbored SCCmec type IVa, and these included the most-common clone in Copenhagen, spa t024-sequence type 8-IVa. The false-negative MRSA isolates were tested with new primers (analyte...... MRSA isolates being false negative. The BD GeneOhm MRSA assay alone is not adequate for MRSA detection in Copenhagen, Denmark, as more than one-third of our MRSA isolates would not be detected. We recommend that the BD GeneOhm MRSA assay be evaluated against the local MRSA diversity before being...

  9. Substituting environmentally relevant flame retardants: assessment fundamentals. Vol. 1: results and summary overview; Erarbeitung von Bewertungsgrundlagen zur Substitution umweltrelevanter Flammschutzmittel. Bd. 1: Ergebnisse und zusammenfassende Uebersicht

    Energy Technology Data Exchange (ETDEWEB)

    Leisewitz, A.; Kruse, H.; Schramm, E.

    2001-04-01

    /Elektronik, Schienenfahrzeugbereich, Textil-/Polstermoebelindustrie. Parallel dazu werden dreizehn Flammschutzmittel hinsichtlich Mengenstrom, Anwendungen und Toxikologie/Oekotoxikologie charakterisiert. Bd. I: Ergebniszusammenfassung zu Flammschutzmitteleinsatz in Deutschland 1999/2000; Charakterisierung von 13 FSM nach Stoff- und Anwendungseigenschaften, Einsatzspektrum, Mengen; Ableitung von Bewertungsgrundlagen fuer FSM mit Schwergewicht auf Toxikologie/Oekotoxikologie, Kreislauffaehigkeit, Substitutions- und Minderungspotentialen; zusammenfassende Stoffbewertung zu 13 FSM; zusammenfassende Uebersicht zu FSM-Anwendungen. Bd. II: Anwendungsuntersuchungen (Stand der Technik, Trend, Alternativen) zu FSM bei UP-Harzen (Schienenfahrzeuge), bei PU-Daemm- und Montageschaeumen (Baubereich); bei Kunststoffen fuer E+E-Geraete insgesamt, Aussengehaeusen fuer E+E-Geraete und Leiterplatten (Elektro/Elektronikindustrie); bei Polstermoebeln/Matratzen (Textilanwendungen). Bd. III: Toxikologisch/oekotoxikologische Stoffprofile Decabromdiphenylether, Tetrabrombisphenol A; Bis[pentabromphenyl]ethan; Hexabromcyclododecan, Tris[chlorpropyl]phosphat, Resorcinol-bis-diphenyl-phosphat; N-Hydroxymethyl-3-dimethylphosphonpropionamid, roter Phosphor, Ammoniumpolyphosphat, Melamincyanurat, Aluminiumtrihydroxid, Borax, Antimontrioxid. (orig.)

  10. The period analysis of V418 AQL, SU BOO, RV CVn, CR CAS, GV CYG, V432 PER, and BD+42 2782

    International Nuclear Information System (INIS)

    Zasche, P.; Wolf, M.; Kučáková, H.; Uhlař, R.

    2014-01-01

    The minimum timings of eclipsing binaries V418 Aql, SU Boo, RV CVn, CR Cas, GV Cyg, V432 Per, and BD+42 2782 were collected and analyzed. Their long-term behavior was studied via period analysis, revealing a periodic term in eclipse times. We derived 576 new times of minimum. Hence, to describe the periodic variation, a third-body hypothesis was proposed and the resulting orbital periods are as follows: 70, 7.4, 53, 37, 27, 53, and 18 yr, respectively. For the system V432 Per an additional 9.5 yr variation was also found. The predicted minimum masses of these distant bodies were calculated and their detectability discussed. The light curves of SU Boo and RV CVn were analyzed using the PHOEBE program, resulting in physical parameters of the components. New variable stars in the field of V418 Aql were discovered.

  11. Organization and functioning of department of radiodiagnosis and imaging services of Pt. B.D. Sharma, PGIMS Rohtak, with special emphasis on waiting time

    International Nuclear Information System (INIS)

    Agarwal, Shalini; Yadav, R.K.

    2007-01-01

    Pt. B.D. Sharma PGIMS, Rohtak is a premier medical institute of the Govt. of Haryana. It is a well equipped hospital for 1266 beds spread over an area of 350 acres of land. The clinical consultants, each year are becoming more and more dependent on radiological investigations for diagnosis and treatment of patients. Radiodiagnostic capabilities have become the hallmark of a modern hospital and constitute the keynote of the diagnostic facilities of the hospitals. A well designed properly equipped and efficiently managed radiodiagnostic department is essential for the provision of quality medical care in a hospital. In addition because of the harmful effects of radiation the department should also be planned taking into consideration radiation exposure and stress to which personnel are exposed. The present study was conducted to analyse waiting time in the Radiodiagnostic Department and to suggest steps to reduce this waiting time

  12. Multicenter Evaluation of BD Max Enteric Parasite Real-Time PCR Assay for Detection of Giardia duodenalis, Cryptosporidium hominis, Cryptosporidium parvum, and Entamoeba histolytica.

    Science.gov (United States)

    Madison-Antenucci, S; Relich, R F; Doyle, L; Espina, N; Fuller, D; Karchmer, T; Lainesse, A; Mortensen, J E; Pancholi, P; Veros, W; Harrington, S M

    2016-11-01

    Common causes of chronic diarrhea among travelers worldwide include protozoan parasites. The majority of parasitic infections are caused by Giardia duodenalis, Entamoeba histolytica, Cryptosporidium parvum, and Cryptosporidium hominis Similarly, these species cause the majority of parasitic diarrhea acquired in the United States. Detection of parasites by gold standard microscopic methods is time-consuming and requires considerable expertise; enzyme immunoassays and direct fluorescent-antibody (DFA) stains have lowered hands-on time for testing, but improvements in sensitivity and technical time may be possible with a PCR assay. We performed a clinical evaluation of a multiplex PCR panel, the enteric parasite panel (EPP), for the detection of these common parasites using the BD Max instrument, which performs automated extraction and amplification. A total of 2,495 compliant specimens were enrolled, including 2,104 (84%) specimens collected prospectively and 391 (16%) specimens collected retrospectively. Approximately equal numbers were received in 10% formalin (1,273 specimens) and unpreserved (1,222 specimens). The results from the EPP were compared to those from alternate PCR and bidirectional sequencing (APCR), as well as DFA (G. duodenalis and C. parvum or C. hominis) or trichrome stain (E. histolytica). The sensitivity and specificity for prospective and retrospective specimens combined were 98.2% and 99.5% for G. duodenalis, 95.5% and 99.6 for C. parvum or C. hominis, and 100% and 100% for E. histolytica, respectively. The performance of the FDA-approved BD Max EPP compared well to the reference methods and may be an appropriate substitute for microscopic examination or immunoassays. Copyright © 2016 Madison-Antenucci et al.

  13. Clinical sensitivity and specificity of the Check-Points Check-Direct ESBL Screen for BD MAX, a real-time PCR for direct ESBL detection from rectal swabs

    NARCIS (Netherlands)

    Souverein, Dennis; Euser, Sjoerd M.; Reijden, Wil A. van der; Herpers, Bjorn L.; Kluytmans, Jan; Rossen, John W A; Den Boer, Jeroen W.

    Objectives: To determine the diagnostic accuracy of the Check-Direct ESBL Screen for BD MAX (ESBL qPCR) and an ESBL culture method to identify ESBLs directly from rectal swabs. Methods: Rectal swabs were obtained from clinical patients by performing cross-sectional (point) prevalence measurements in

  14. Editorial. Impact of the Binge Drinking (BD) in Adolescence. Are we doing it right? Editorial. Impacto del consumo episódico excesivo de alcohol en la adolescencia. ¿Lo estamos haciendo bien?

    Science.gov (United States)

    Vargas-Martínez, Ana Magdalena; Trapero-Bertran, Marta; Gil-García, Eugenia; Lima-Serrano, Marta

    2018-04-15

    Nowadays, one of the most prevalent patterns of alcohol consumption is called binge drinking (BD). In 2015, the European School Survey Project on Alcohol and Drugs (ESPAD) Group estimated that about 35% of adolescents of 15-16 years old have had at least one BD occasion in the past 30 days while at national level, the series of surveys on the use of drugs in adolescents of secondary education (ESTUDES, 2014-2015) determined that 32.2% of adolescents stated having performed BD in the last month. The aim of this editorial was to update the context of adolescence drinking and analysing the impact of BD by ages, including health and social costs derived. Once the magnitude of the problem was set, some research and action lines have been established in order to guide future work for the prevention of alcohol misuse and for establishing future preventive policies on alcohol. Finally, the need for evaluating these interventions from the efficiency point of view was discussed and assessed.

  15. Spectroscopy of southern active stars. II - HD 32918, HD 82558, BD - 22 deg 3467, AB Doradus (HD 36705) and RST 137 B

    Science.gov (United States)

    Vilhu, O.; Gustafsson, B.; Walter, F. M.

    1991-01-01

    We have observed the southern active cool stars HD 32918 (K1 IIIp), HD 82558 (K2 V), BD-22°3467 (G8 III), AB Doradus (HD 36705, K1 IV) and Rst 137 B (M 3-5), each of which lies close to the chromospheric- coronal saturation limit. The fractional Hα-luminosities LHα/Lbol of the stars were close to 10-4. No significant radial velocity variations were detected in any of the stars. With the variations of the Fe I 6546-line profiles, as a function of the 9.55 d rotation period, the existence of a cool spot-region of HD 32918 was traced. The spectra were analysed by a surface imaging technique by Piskunov et al. (1990). The resulting image showed a large group of cool spots at the equatorial belt at one side of the star, and a smaller and less cool one extending to higher latitudes at the opposite longitude. Old photometry suggests that the equatorial spots might have been permanent during 7 yr at the same (active) longitude. The Hα-emission of HD 32918 was variable and asymmetric, comprising possibly of chromospheric and wind (or expanding chromosphere) components. The He I 5876 (D 3) absorption was remarkably strong in HD 32918, pointing to the existence of an extended and low density chromosphere. BD-22°3467, the cool companion to the hot central star of the planetary nebula Abell 35, experiences a photometric wave with a 0.77 d period (Jasniewicz & Acker, 1988). Our observations, performed around the same time with this photometry, resolved a blue-shifted Hα-emission at the minimum light. This behaviour was opposite to that found in HD 32918. The υ sin i value (90 km s-1) of BD-22°3467 is compatible with the interpretation that the 0.77 d photometric cycle is the star's rotation period. The Hα-emission of HD 82558 was stronger than in the previous observations by Fekel et al. (1986) and variable, but with no obvious rotational modulation. The Hα-emission strengths of the young pre-main-sequence pair AB Dor - Rst 137 B are compatible with those of the

  16. Precision measurements of B(D+ -> mu(+)nu(mu)), the pseudoscalar decay constant fD+, and the quark mixing matrix element vertical bar V-cd vertical bar

    NARCIS (Netherlands)

    Ablikim, M.; Achasov, M. N.; Ai, X. C.; Albayrak, O.; Ambrose, D. J.; An, F. F.; An, Q.; Bai, J. Z.; Ferroli, R. Baldini; Ban, Y.; Bennett, J. V.; Bertani, M.; Bian, J. M.; Boger, E.; Bondarenko, O.; Boyko, I.; Braun, S.; Briere, R. A.; Cai, H.; Cai, X.; Cakir, O.; Calcaterra, A.; Cao, G. F.; Cetin, S. A.; Chang, J. F.; Chelkov, G.; Chen, G.; Chen, H. S.; Chen, J. C.; Chen, M. L.; Chen, S. J.; Chen, X.; Chen, X. R.; Chen, Y. B.; Cheng, H. P.; Chu, X. K.; Chu, Y. P.; Cronin-Hennessy, D.; Dai, H. L.; Dai, J. P.; Dedovich, D.; Deng, Z. Y.; Denig, A.; Denysenko, I.; Destefanis, M.; Ding, W. M.; Ding, Y.; Dong, C.; Dong, J.; Dong, L. Y.; Dong, M. Y.; Du, S. X.; Fan, J. Z.; Fang, J.; Fang, S. S.; Fang, Y.; Fava, L.; Feng, C. Q.; Fu, C. D.; Fu, J. L.; Fuks, O.; Gao, Q.; Gao, Y.; Geng, C.; Goetzen, K.; Gong, W. X.; Gradl, W.; Greco, M.; Gu, M. H.; Gu, Y. T.; Guan, Y. H.; Guo, A. Q.; Guo, L. B.; Guo, T.; Guo, Y. P.; Guo, Y. P.; Han, Y. L.; Harris, F. A.; He, K. L.; He, M.; He, Z. Y.; Held, T.; Heng, Y. K.; Hou, Z. L.; Hu, C.; Hu, H. M.; Hu, J. F.; Hu, T.; Huang, G. M.; Huang, G. S.; Huang, J. S.; Huang, L.; Huang, X. T.; Huang, Y.; Hussain, T.; Ji, C. S.; Ji, Q.; Ji, Q. P.; Ji, X. B.; Ji, X. L.; Jiang, L. L.; Jiang, X. S.; Jiao, J. B.; Jiao, Z.; Jin, D. P.; Jin, S.; Johansson, T.; Kalantar-Nayestanaki, N.; Kang, X. L.; Kang, X. S.; Kavatsyuk, M.; Kloss, B.; Kopf, B.; Kornicer, M.; Kuehn, W.; Kupsc, A.; Lai, W.; Lange, J. S.; Lara, M.; Larin, P.; Leyhe, M.; Li, C. H.; Li, Cheng; Li, Cui; Li, D.; Li, D. M.; Li, F.; Li, G.; Li, H. B.; Li, J. C.; Li, K.; Li, K.; Li, Lei; Li, P. R.; Li, Q. J.; Li, T.; Li, W. D.; Li, W. G.; Li, X. L.; Li, X. N.; Li, X. Q.; Li, X. R.; Li, Z. B.; Liang, H.; Liang, Y. F.; Liang, Y. T.; Lin, D. X.; Liu, B. J.; Liu, C. L.; Liu, C. X.; Liu, F. H.; Liu, Fang; Liu, Feng; Liu, H. B.; Liu, H. H.; Liu, H. M.; Liu, J.; Liu, J. P.; Liu, K.; Liu, K. Y.; Liu, P. L.; Liu, Q.; Liu, S. B.; Liu, X.; Liu, Y. B.; Liu, Z. A.; Liu, Zhiqiang; Liu, Zhiqing; Loehner, H.; Lou, X. C.; Lu, G. R.; Lu, H. J.; Lu, H. L.; Lu, J. G.; Lu, X. R.; Lu, Y.; Lu, Y. P.; Luo, C. L.; Luo, M. X.; Luo, T.; Luo, X. L.; Lv, M.; Ma, F. C.; Ma, H. L.; Ma, Q. M.; Ma, S.; Ma, T.; Ma, X. Y.; Maas, F. E.; Maggiora, M.; Malik, Q. A.; Mao, Y. J.; Mao, Z. P.; Messchendorp, J. G.; Min, J.; Min, T. J.; Mitchell, R. E.; Mo, X. H.; Mo, Y. J.; Moeini, H.; Morales, C. Morales; Moriya, K.; Muchnoi, N. Yu.; Muramatsu, H.; Nefedov, Y.; Nikolaev, I. B.; Ning, Z.; Nisar, S.; Niu, X. Y.; Olsen, S. L.; Ouyang, Q.; Pacetti, S.; Pelizaeus, M.; Peng, H. P.; Peters, K.; Ping, J. L.; Ping, R. G.; Poling, R.; Prencipe, E.; Qi, M.; Qian, S.; Qiao, C. F.; Qin, L. Q.; Qin, X. S.; Qin, Y.; Qin, Z. H.; Qiu, J. F.; Rashid, K. H.; Redmer, C. F.; Ripka, M.; Rong, G.; Ruan, X. D.; Sarantsev, A.; Schoenning, K.; Schumann, S.; Shan, W.; Shao, M.; Shen, C. P.; Shen, X. Y.; Sheng, H. Y.; Shepherd, M. R.; Song, W. M.; Song, X. Y.; Spataro, S.; Spruck, B.; Sun, G. X.; Sun, J. F.; Sun, S. S.; Sun, Y. J.; Sun, Y. Z.; Sun, Z. J.; Sun, Z. T.; Tang, C. J.; Tang, X.; Tapan, I.; Thorndike, E. H.; Toth, D.; Ullrich, M.; Uman, I.; Varner, G. S.; Wang, B.; Wang, D.; Wang, D. Y.; Wang, K.; Wang, L. L.; Wang, L. S.; Wang, M.; Wang, P.; Wang, P. L.; Wang, Q. J.; Wang, S. G.; Wang, W.; Wang, X. F.; Wang, Y. D.; Wang, Y. F.; Wang, Y. Q.; Wang, Z.; Wang, Z. G.; Wang, Z. H.; Wang, Z. Y.; Wei, D. H.; Wei, J. B.; Weidenkaff, P.; Wen, S. P.; Werner, M.; Wiedner, U.; Wolke, M.; Wu, L. H.; Wu, N.; Wu, W.; Wu, Z.; Xia, L. G.; Xia, Y.; Xiao, D.; Xiao, Z. J.; Xie, Y. G.; Xiu, Q. L.; Xu, G. F.; Xu, L.; Xu, Q. J.; Xu, Q. N.; Xu, X. P.; Xue, Z.; Yan, L.; Yan, W. B.; Yan, W. C.; Yan, Y. H.; Yang, H. X.; Yang, Y.; Yang, Y. X.; Ye, H.; Ye, M.; Ye, M. H.; Yu, B. X.; Yu, C. X.; Yu, H. W.; Yu, J. S.; Yu, S. P.; Yuan, C. Z.; Yuan, W. L.; Yuan, Y.; Zafar, A. A.; Zallo, A.; Zang, S. L.; Zeng, Y.; Zhang, B. X.; Zhang, B. Y.; Zhang, C.; Zhang, C. B.; Zhang, C. C.; Zhang, D. H.; Zhang, H. H.; Zhang, H. Y.; Zhang, J. J.; Zhang, J. L.; Zhang, J. Q.; Zhang, J. W.; Zhang, J. Y.; Zhang, J. Z.; Zhang, S. H.; Zhang, X. J.; Zhang, X. Y.; Zhang, Y.; Zhang, Y. H.; Zhang, Z. H.; Zhang, Z. P.; Zhang, Z. Y.; Zhao, G.; Zhao, J. W.; Zhao, Lei; Zhao, Ling; Zhao, M. G.; Zhao, Q.; Zhao, Q. W.; Zhao, S. J.; Zhao, T. C.; Zhao, X. H.; Zhao, Y. B.; Zhao, Z. G.; Zhemchugov, A.; Zheng, B.; Zheng, J. P.; Zheng, Y. H.; Zhong, B.; Zhou, L.; Zhou, Li; Zhou, X.; Zhou, X. K.; Zhou, X. R.; Zhou, X. Y.; Zhu, K.; Zhu, K. J.; Zhu, X. L.; Zhu, Y. C.; Zhu, Y. S.; Zhu, Z. A.; Zhuang, J.; Zou, B. S.; Zou, J. H.

    2014-01-01

    We report a measurement of the branching fraction B(D+ -> mu(+)nu(mu)) = [3.71 +/- 0.19(stat) +/- 0.06(sys)] x 10(-4) based on 2.92 fb(-1) of data accumulated at root s = 3.773 GeV with the BESIII detector at the BEPCII collider. This measurement, in conjunction with the Cabibbo-Kobayashi-Maskawa

  17. Affinity composite cryogel discs functionalized with Reactive Red 120 and Green HE 4BD dye ligands: Application on the separation of human immunoglobulin G subclasses

    Energy Technology Data Exchange (ETDEWEB)

    Huseynli, Sabina; Baydemir, Gözde; Sarı, Esma [Department of Chemistry, Biochemistry Division, Hacettepe University, Ankara (Turkey); Elkak, Assem [Laboraory of “Valorisation des Ressources Naturelles et Produits de Santé (VRNPS)”, Doctoral School of Sciences and Technology, Lebanese University, Rafic Hariri University Campus, Hadath (Lebanon); Denizli, Adil, E-mail: denizli@hacettepe.edu.tr [Department of Chemistry, Biochemistry Division, Hacettepe University, Ankara (Turkey)

    2015-01-01

    Naturally produced by the human immune system, immunoglobulin nowadays is widely used for in vivo and in vitro purposes. The increased needs for pure immunoglobulin have prompted researchers to find new immunoglobulin chromatographic separation processes. Cryogels as chromatographic adsorbents, congregate several mechanical features including good compatibility, large pore structure, flexibility, short diffusion pathway and stability. These different characteristics make them a good alternative to conventional chromatographic methods and allowing their potential use in separation technology. In the present study, two sets of poly(2-hydroxyethyl methacrylate) (PHEMA) based beads were prepared and functionalized with Reactive Red 120 (RR) and Reactive Green HE 4BD (RG) dyes, and then embedded into supermacroporous cryogels. The morphology, physical and chemical features of the prepared bead embedded composite cryogel discs (CCDs) were performed by scanning electron microscopy (SEM), swelling test, elemental analysis and Fourier transform infrared spectroscopy (FTIR). The results showed that the embedded composite cryogel discs have a specific surface area of 192.0 m{sup 2}/g with maximum adsorption capacity of HIgG 239.8 mg/g for the RR functionalized CCD and 170 mg/g for RG functionalized CCD columns, both at pH 6.2. - Highlights: • Dye attached composite cryogel discs were prepared to separate HIgG subclasses. • Composite cryogels characterized by swelling, FTIR, SEM and elemental analysis. • Reactive Green HE 4B and Reactive Red 120 dyes were used as the affinity ligand. • HIgG and subclasses were separate from both aqueous solution and human plasma.

  18. The local clinical validation of a new lithium heparin tube with a barrier: BD Vacutainer® Barricor LH Plasma tube

    Science.gov (United States)

    Arslan, Fatma Demet; Karakoyun, Inanc; Basok, Banu Isbilen; Aksit, Merve Zeytinli; Baysoy, Anil; Ozturk, Yasemin Kilic; Guclu, Yusuf Adnan; Duman, Can

    2017-01-01

    Introduction Although serum-providing blood tubes with a barrier are still widely used due to their significant advantages, the use of blood tubes with a barrier to provide plasma is becoming widespread. We compared 22 analytes in a BD Vacutainer® Barricor LH Plasma tube for local clinical validation of this new lithium heparin tube with a barrier. Materials and methods Samples from 44 volunteers were collected in different tubes (Becton Dickinson and Company): Z tube without additive (reference), clot-activator tube with gel (SST), lithium heparin tube without gel (LiH), and lithium heparin tube with barrier (Barricor). Analyte concentrations in different tubes were compared with the reference tube. All tubes were also evaluated according to additional testing (different centrifugation durations, blood-sampling techniques and individual differences). Results Aspartate aminotransferase (AST), glucose (Glc), potassium (K), lactate dehydrogenase (LD), sodium (Na), and total protein (TP) had a significant bias in Barricor (9.19%, - 3.24%, - 4.88%, 21.60%, - 0.40%, 5.03%, respectively) relative to the reference tube. There was no statistical difference between different centrifugation durations and individual differences for AST, K and LD in LiH and/or Barricor (P > 0.05). There was a significant bias for LD between LiH and Barricor in terms of blood-sampling techniques (21.2% and 12.4%, respectively). Conclusions Recently, the use of plasma has become prominent due to some of its advantages. In this study, plasma AST, K, LD, Glc and TP levels in Barricor were clinically different in comparison to serum. The results of additional tests showed that higher levels of LD in Barricor did not result from haemolysis, and they might be related to other factors including number of platelets, cellular fragility, or functional environment. PMID:28900369

  19. The local clinical validation of a new lithium heparin tube with a barrier: BD Vacutainer® Barricor LH Plasma tube.

    Science.gov (United States)

    Arslan, Fatma Demet; Karakoyun, Inanc; Basok, Banu Isbilen; Aksit, Merve Zeytinli; Baysoy, Anil; Ozturk, Yasemin Kilic; Guclu, Yusuf Adnan; Duman, Can

    2017-10-15

    Although serum-providing blood tubes with a barrier are still widely used due to their significant advantages, the use of blood tubes with a barrier to provide plasma is becoming widespread. We compared 22 analytes in a BD Vacutainer® Barricor LH Plasma tube for local clinical validation of this new lithium heparin tube with a barrier. Samples from 44 volunteers were collected in different tubes (Becton Dickinson and Company): Z tube without additive (reference), clot-activator tube with gel (SST), lithium heparin tube without gel (LiH), and lithium heparin tube with barrier (Barricor). Analyte concentrations in different tubes were compared with the reference tube. All tubes were also evaluated according to additional testing (different centrifugation durations, blood-sampling techniques and individual differences). Aspartate aminotransferase (AST), glucose (Glc), potassium (K), lactate dehydrogenase (LD), sodium (Na), and total protein (TP) had a significant bias in Barricor (9.19%, - 3.24%, - 4.88%, 21.60%, - 0.40%, 5.03%, respectively) relative to the reference tube. There was no statistical difference between different centrifugation durations and individual differences for AST, K and LD in LiH and/or Barricor (P > 0.05). There was a significant bias for LD between LiH and Barricor in terms of blood-sampling techniques (21.2% and 12.4%, respectively). Recently, the use of plasma has become prominent due to some of its advantages. In this study, plasma AST, K, LD, Glc and TP levels in Barricor were clinically different in comparison to serum. The results of additional tests showed that higher levels of LD in Barricor did not result from haemolysis, and they might be related to other factors including number of platelets, cellular fragility, or functional environment.

  20. Comparative quantification of umbilical cord blood CD34+ and CD34+ bright cells using the ProCount™-BD and ISHAGE protocols

    Directory of Open Access Journals (Sweden)

    P. Pranke

    2006-07-01

    Full Text Available The total number of CD34+ cells is the most relevant clinical parameter when selecting human umbilical cord blood (HUCB for transplantation. The objective of the present study was to compare the two most commonly used CD34+ cell quantification methods (ISHAGE protocol and ProCount™ - BD and analyze the CD34+ bright cells whose 7-amino actinomycin D (7AAD analysis suggests are apoptotic or dead cells. Twenty-six HUCB samples obtained at the Placental Blood Program of New York Blood Center were evaluated. The absolute numbers of CD34+ cells evaluated by the ISHAGE (with exclusion of 7AAD+ cells and ProCount™ (with exclusion of CD34+ bright cells were determined. Using the ISHAGE protocol we found 35.6 ± 19.4 CD34+ cells/µL and with the ProCount™ method we found 36.6 ± 23.2 CD34+ cells/µL. With the ProCount™ method, CD34+ bright cell counts were 9.3 ± 8.2 cells/µL. CD34+ bright and regular cells were individually analyzed by the ISHAGE protocol. Only about 1.8% of the bright CD34+ cells are alive, whereas a small part (19.0% is undergoing apoptosis and most of them (79.2% are dead cells. Our study showed that the two methods produced similar results and that 7AAD is important to exclude CD34 bright cells. These results will be of value to assist in the correct counting of CD34+ cells and to choose the best HUCB unit for transplantation, i.e., the unit with the greatest number of potentially viable stem cells for the reconstitution of bone marrow. This increases the likelihood of success of the transplant and, therefore, the survival of the patient.

  1. Gui d’Uisel, “Ja non cujei qe·m desplagues amors” (BdT 194.11

    Directory of Open Access Journals (Sweden)

    Francesca Sanguineti

    2011-10-01

    Full Text Available This paper offers a new critical edition with commentary of Gui d’Uisel’s ‘mala canso’ against Love, Ja non cujei qe·m desplagues amors, a poem that is less well-known and has received less critical attention compared to the other, better known, ‘mala canso’ addressed to the ‘mala dompna’ by the same author, “Si be·m partetz, mala dompna, de vos” (BdT 194.19. The paper will investigate all those aspects of the text – vocabulary, style, themes – that enable it to be classified as a song against love. As far as this is concerned, a number of features would appear to be of particular interest, such as the use of the rhyme-word “fais”; the equivalence of love service and feudal service that justifies abandoning Love, seen as a bad lord; the motif of ladies who have become “chamjaritz”; the theme of the decadence of courtly values; the poet’s need to place limits on his complaint faced with the corruption of ‘fin’amor’. Although the archetypes of many of the poem’s themes and motifs may be found already in the earliest troubadours, Gui d’Uisel’s songs, and this one in particular, stand out because their author is well aware that he is adopting a classic genre while at the same time attempting to renew it from the point of view of content.

  2. Clinical and diagnostic implications of lifetime attention-deficit/hyperactivity disorder comorbidity in adults with bipolar disorder: data from the first 1000 STEP-BD participants.

    Science.gov (United States)

    Nierenberg, Andrew A; Miyahara, Sachiko; Spencer, Tom; Wisniewski, Stephen R; Otto, Michael W; Simon, Naomi; Pollack, Mark H; Ostacher, Michael J; Yan, Leslie; Siegel, Rebecca; Sachs, Gary S

    2005-06-01

    Systematic studies of children and adolescents with a diagnosis of bipolar disorder show that rates of attention-deficit/hyperactivity disorder (ADHD) range from 60% to 90%, but the prevalence and implications of ADHD in adults with bipolar disorder are less clear. The first consecutive 1000 adults with bipolar disorder enrolled in the National Institute of Mental Health's Systematic Treatment Enhancement Program for Bipolar Disorder (STEP-BD) were assessed for lifetime ADHD. The retrospective course of bipolar disorder, current mood state, and prevalence of other comorbid psychiatric diagnoses were compared for the groups with and without lifetime comorbid ADHD. The overall lifetime prevalence of comorbid ADHD in this large cohort of bipolar patients was 9.5% (95% confidence interval 7.6%-11.4%); 14.7% of male patients and 5.8% of female patients with bipolar disorder had lifetime ADHD. Patients with bipolar disorder and ADHD had the onset of their mood disorder approximately 5 years earlier. After adjusting for age of onset, those with ADHD comorbidity had shorter periods of wellness and were more frequently depressed. We found that patients with bipolar disorder comorbid with ADHD had a greater number of other comorbid psychiatric diagnoses compared with those without comorbid ADHD, with substantially higher rates of several anxiety disorders and alcohol and substance abuse and dependence. Lifetime ADHD is a frequent comorbid condition in adults with bipolar disorder, associated with a worse course of bipolar disorder and greater burden of other psychiatric comorbid conditions. Studies are needed that focus on the efficacy and safety of treating ADHD comorbid with bipolar disorder.

  3. Recoding of the stop codon UGA to glycine by a BD1-5/SN-2 bacterium and niche partitioning between Alpha- and Gammaproteobacteria in a tidal sediment microbial community naturally selected in a laboratory chemostat

    Energy Technology Data Exchange (ETDEWEB)

    Hanke, Anna [Max Planck Institute for Marine Microbiology; Hamann, Emmo [Max Planck Institute for Marine Microbiology; Sharma, Ritin [ORNL; Geelhoed, Jeanine [Max Planck Institute for Marine Microbiology; Hargesheimer, Theresa [Max Planck Institute for Marine Microbiology; Kraft, Beate [Max Planck Institute for Marine Microbiology; Meyer, Volker [Max Planck Institute for Marine Microbiology; Lenk, Sabine [Max Planck Institute for Marine Microbiology; Osmers, Harald [Max Planck Institute for Marine Microbiology; Wu, Rong [Delft University of Technology, Delft, Netherlands; Makinwa, Kofi [Delft University of Technology, Delft, Netherlands; Hettich, Robert {Bob} L [ORNL; Banfield, Jillian F. [University of California, Berkeley; Tegetmeyer, Halina [Max Planck Institute for Marine Microbiology; Strouss, Marc [University of Calgary, ALberta, Canada

    2014-01-01

    Sandy coastal sediments are global hot spots for microbial mineralization of organic matter and denitrification. These sediments are characterized by advective pore water flow, tidal cycling and an active and complex microbial community. Metagenomic sequencing of microbial communities sampled from such sediments showed that potential sulfuroxidizing Gammaproteobacteria and members of the enigmaticBD1-5/ SN-2 candidatephylumwereabundantinsitu (>10% and 2% respectively). By mimicking the dynamic oxic/anoxic environmental conditions of the sedimentin a laboratory chemostat, a simplified microbial community was selected from the more complex inoculum. Metagenomics, proteomics and fluorescenceinsituhybridization showed that this simplified community contained both a potential sulfuroxidizing Gamma proteobacteria (at 24 2% abundance) and a member of the BD1-5 / SN-2candidatephylum (at 7 6%abundance). Despite the abundant supply of organic substrates to the chemostat, proteomic analysis suggested that the selected gamma proteobacterium grew partially auto trophically and performed hydrogen/formate oxidation. The enrichment of a member of the BD1-5/SN-2candidatephylum enabled, for the first time, direct microscopic observation by fluorescent insitu hybridization and the experimental validation of the previously predicted translation of the stop codon UGA into glycine.

  4. Recoding of the stop codon UGA to glycine by a BD1-5/SN-2 bacterium and niche partitioning between Alpha- and Gammaproteobacteria in a tidal sediment microbial community naturally selected in a laboratory chemostat

    Directory of Open Access Journals (Sweden)

    Anna eHanke

    2014-05-01

    Full Text Available Sandy coastal sediments are global hotspots for microbial mineralization of organic matter and denitrification. These sediments are characterized by advective porewater flow, tidal cycling and an active and complex microbial community. Metagenomic sequencing of microbial communities sampled from such sediments showed that potential sulfur oxidizing Gammaproteobacteria and members of the enigmatic BD1-5/SN-2 candidate phylum were abundant in situ (>10% and ~2% respectively. By mimicking the dynamic oxic/anoxic environmental conditions of the sediment in a laboratory chemostat, a simplified microbial community was selected from the more complex inoculum. Metagenomics, proteomics and fluorescence in situ hybridization showed that this simplified community contained both a potential sulfur oxidizing Gammaproteobacterium (at 24±2% abundance and a member of the BD1-5/SN-2 candidate phylum (at 7±6% abundance. Despite the abundant supply of organic substrates to the chemostat, proteomic analysis suggested that the selected gammaproteobacterium grew partially autotrophically and performed hydrogen/formate oxidation. The enrichment of a member of the BD1-5/SN-2 candidate phylum enabled, for the first time, direct microscopic observation by fluorescent in situ hybridization and the experimental validation of the previously predicted translation of the stop codon UGA into glycine.

  5. BD Carthage® Guyane

    Directory of Open Access Journals (Sweden)

    Charline Mourguiart

    2014-06-01

    Full Text Available Le contexte Le bassin de la Guyane est décomposé en 5 grandes régions hydrographiques dont deux sont trans-frontalières : celle du fleuve Oyapock, à l’est, avec l’Etat de l’Amapa au Brésil, et celle du Maroni, à l’ouest, avec le Suriname. En 2007, la Direction Régionale de l’Environnement (DIREN a lancé un projet d’envergure : réaliser une cartographie de l’ensemble du bassin guyanais, afin de disposer d’un référentiel commun pour une meilleure gestion de la ressource en eau. L’objectif prin...

  6. Time gated fluorescence lifetime imaging and micro-volume spectroscopy using two-photon excitation

    NARCIS (Netherlands)

    Sytsma, J.; Vroom, J.M.; de Grauw, C.J.; Gerritsen, H.C.

    A scanning microscope utilizing two-photon excitation in combination with fluorescence lifetime contrast is presented. The microscope makes use of a tunable femtosecond titanium:sapphire laser enabling the two-photon excitation of a broad range of fluorescent molecules, including UV probes.

  7. Multicenter evaluation of the BD max enteric bacterial panel PCR assay for rapid detection of Salmonella spp., Shigella spp., Campylobacter spp. (C. jejuni and C. coli), and Shiga toxin 1 and 2 genes.

    Science.gov (United States)

    Harrington, S M; Buchan, B W; Doern, C; Fader, R; Ferraro, M J; Pillai, D R; Rychert, J; Doyle, L; Lainesse, A; Karchmer, T; Mortensen, J E

    2015-05-01

    Diarrhea due to enteric bacterial pathogens causes significant morbidity and mortality in the United States and worldwide. However, bacterial pathogens may be infrequently identified. Currently, culture and enzyme immunoassays (EIAs) are the primary methods used by clinical laboratories to detect enteric bacterial pathogens. We conducted a multicenter evaluation of the BD Max enteric bacterial panel (EBP) PCR assay in comparison to culture for the detection of Salmonella spp., Shigella spp., Campylobacter jejuni, and Campylobacter coli and an EIA for Shiga toxins 1 and 2. A total of 4,242 preserved or unpreserved stool specimens, including 3,457 specimens collected prospectively and 785 frozen, retrospective samples, were evaluated. Compared to culture or EIA, the positive percent agreement (PPA) and negative percent agreement (NPA) values for the BD Max EBP assay for all specimens combined were as follows: 97.1% and 99.2% for Salmonella spp., 99.1% and 99.7% for Shigella spp., 97.2% and 98.4% for C. jejuni and C. coli, and 97.4% and 99.3% for Shiga toxins, respectively. Discrepant results for prospective samples were resolved with alternate PCR assays and bidirectional sequencing of amplicons. Following discrepant analysis, PPA and NPA values were as follows: 97.3% and 99.8% for Salmonella spp., 99.2% and 100% for Shigella spp., 97.5% and 99.0% for C. jejuni and C. coli, and 100% and 99.7% for Shiga toxins, respectively. No differences in detection were observed for samples preserved in Cary-Blair medium and unpreserved samples. In this large, multicenter study, the BD Max EBP assay showed superior sensitivity compared to conventional methods and excellent specificity for the detection of enteric bacterial pathogens in stool specimens. Copyright © 2015, American Society for Microbiology. All Rights Reserved.

  8. Simultaneous determination of gamma-Hydroxybutyrate (GHB) and its analogues (GBL, 1.4-BD, GVL) in whole blood and urine by liquid chromatography coupled to tandem mass spectrometry

    DEFF Research Database (Denmark)

    Johansen, Sys Stybe; Windberg, Charlotte Norup

    2011-01-01

    . The sample preparation of whole blood involved protein precipitation by acidic methanol. Urine samples were diluted and evaluated in relation to a control at the cutoff concentration. Hexadeutero GHB (GHB-d(6)) was used as the internal standard. Separation was achieved by reversed-phase chromatography......A simple liquid chromatography-tandem mass spectrometry (LC-MS-MS) method has been developed and validated for simultaneous identification and quantification of ¿-hydroxybutyrate (GHB), ¿-butyrolactone (GBL), 1.4-butanediol (1.4-BD), and ¿-valerolactone (GVL) in whole blood from forensic cases...

  9. [Detection of Staphylococcus aureus resistant to methicillin (MRSA) by molecular biology (Cepheid GeneXpert IL, GeneOhm BD, Roche LightCycler, Hyplex Evigene I2A) versus screening by culture: Economic and practical strategy for the laboratory].

    Science.gov (United States)

    Laudat, P; Demondion, E; Jouannet, C; Charron, J; Chillou, C; Salaun, V; Mankikian, B

    2012-06-01

    Patients admitted in cardiac surgery and cardiac ICU at the Clinic Saint-Gatien (Tours) are screened for MRSA at the entrance by nasal swab and culture on blood agar and selective chromogenic medium made by addition of cefoxitin: BBL CHROMagar MRSA-II BD (result obtained at Day +1). We wanted to assess the molecular biology techniques available to obtain a result at day 0 for the majority of patients and to define an economic and practical strategy for the laboratory. We studied four molecular biology techniques: Cepheid GeneXpert (Cepheid) GeneOhm (BD), LightCycler (Roche) and Hyplex (I2A). Upon reception, nasal swabs were treated by culture, considered as reference, and one of the techniques of molecular biology, according to the manufacturer's notice. We conducted four studies between April 2008 and February 2009 to obtain a significant sample for each of them. By screening we mean a method that allows us to exclude MRSA carriage for patients waiting for surgery, and not to change patient management: for example, lack of isolation measures specific to entrance, no modification of antibiotic prophylaxis during surgery and no isolation measures in the immediate postoperative period. The criteria we considered for this evaluation were: (1) technician time: time to perform one or a series of sample(s) n=10 or more (about 2h for all techniques except GeneXpert 75min), level of skilled competences (no specific training for GeneXpert); (2) results: turnaround time (all molecular biology techniques), ease of reading and results interpretations (no specialized training required for GeneXpert), failure or not (12% of failure of internal controls for GeneOhm); (3) economic: cost for one or a series of sample(s) (n=10 or more), if we considered X as the reference culture cost (10 X Hyplex and LightCycler, 20 X and 40 X for GeneXpert GeneOhm); (4) NPV: 100% for GeneXpert and LightCycler. At same sensitivity, no technique, including culture, can solve alone our problem, which

  10. Plutarque, Sur l' E de Delphes 390 B 6-8 et l'explication de  la vision en Timée 45 b-d*

    Directory of Open Access Journals (Sweden)

    Alain Lernould

    2005-04-01

    Full Text Available Le traité (ou dialogue « pythique » du platonicien Plutarque de Chéronée (Iier – IIe s. ap. J.-C. intitulé Sur l’E de Delphes est consacré à l’élucidation de la signification de l’E (la cinquième lettre de l’alphabet grec consacré à Apollon Pythien. Une des interprétations (d’inspiration pythagoricienne est que cet E désigne le nombre cinq, le nombre de l’univers. Dans le cadre de l’exposé de cette interprétation est fait état de l’opinion « de certains » selon laquelle il existe une correspondance entre les cinq sens et les cinq éléments. L’A. montre que les deux lignes où il est question de la vue (E 390b6-8 s’inspirent essentiellement de l’explication qu’en Timée 45b-d Platon donne du mécanisme de la vision en termes de mélange du feu pur émis par l’œil avec le feu pur extérieur qui produit la lumière du jour. L’extrême brièveté de ce résumé (empreint d’aristotélisme, l’élément associé à la vue étant ici l’éther considéré comme cinquième corps, d’un passage dans Platon offrant lui-même bon nombre de difficultés, explique que ces deux lignes énigmatiques n’aient jamais été bien comprises. Au passage, l’A. revient sur les notions d’homoiopatheia (d’homogénéité et de summetria (de commensurabilité en Timée 45b-d et 67c-e pour en proposer une interprétation qui souligne et éclaire d’un jour nouveau le caractère dynamique de l’explication platonicienne de la vision. Un Appendice donne un aperçu des différentes lectures d’E 390b6-8 depuis les premières éditions imprimées à la Renaissance jusqu’aux éditions critiques des 19e et 20e siècles.The essay (or dialogue On the E at Delphi of the Platonist Plutarch of Chaeronea (c. 50 – c. 125 A.D. is devoted to the elucidation of the mysterious E – the fifth letter of the Greek alphabet – that is dedicated to Apollo. According to one interpretation the E is, in a Pythagorean

  11. Concordância dos resultados do sistema BD Phoenix com provas bioquímicas manuais na identificação de Enterobactérias em amostras clínicas

    Directory of Open Access Journals (Sweden)

    Natacha Allgayer

    2015-02-01

    Full Text Available Enterobactérias pertencem a um grupo grande e heterogêneo de bacilos Gram-negativos cujo habitat natural é o cólon de humanos e animais, sendo microrganismos amplamente distribuídos na natureza. Devido a essas características são frequentemente responsáveis por infecções hospitalares. O principal objetivo desse estudo foi estabelecer uma concordância entre as provas bioquímicas manuais e a automação BD Phoenix 100 na identificação de enterobactérias, a partir de uma análise de registros de pacientes hospitalizados. No período de Agosto de 2011 a Abril de 2012, foram realizados 303 exames no Laboratório Exame de Análises Clinicas pelo método manual e pela automação. Do total, 27,7% foram positivos para enterobactérias. Os microrganismos mais frequentes isolados, foram a Klebsiella pneumoniae 36,9%, seguido pela Escherichia coli 29,8%. O estudo apresentou uma alta concordância entre os métodos, principalmente na identificação dos gêneros. Na identificação das espécies, as bactérias dos gêneros Klebsiella spp. e Serratia spp. não tiveram suas espécies identificadas pelo método manual em sete dos registros observados, sendo identificadas somente pela automação. Assim como a Escherichia coli que não foi identificada pelo método manual, vista como indeterminada em quatro dos registros analisados. Portanto, verificou-se uma boa concordância entre os métodos na identificação das principais enterobactérias isoladas de amostras clínicas.

  12. Consequences of observed Bd-anti Bd mixing in standard and nonstandard models

    International Nuclear Information System (INIS)

    Datta, A.; Paschos, E.A.; Tuerke, U.

    1987-01-01

    Implications of the B d -anti B d mixing report by the ARGUS group are investigated. We show that in order for the standard model to accomodate the result, the B → anti B hadronic matrix element must satisfy lower bounds as a function of top quark mass. In this case B S -anti B S mixing is necessarily large (r S > or approx. 0.74) irrespective of m t . This conclusion remains valid in several popular extensions of the standard model with three generations. In contrast to these models, four generation models can accomodate simultaneously the observed B d -anti B d mixing and a relatively small B S -anti B S mixing. (orig.)

  13. Measurement of the Semileptonic Decays B->D tau nu and B->D* tau nu

    Energy Technology Data Exchange (ETDEWEB)

    Aubert, : B.

    2009-02-23

    The authors present measurements of the semileptonic decays B{sup -} {yields} D{sup 0} {tau}{sup -} {bar {nu}}{sub {tau}}, B{sup -} {yields} D*{sup 0} {tau}{sup -}{bar {nu}}{sub {tau}}, {bar B}{sup 0} {yields} D{sup +} {tau}{sup -} {bar {nu}}{sub {tau}}, and {bar B}{sup 0} {yields} D*{sup +} {tau}{sup -}{bar {nu}}{sub {tau}}, which are sensitive to non-Standard Model amplitudes in certain scenarios. The data sample consists of 232 x 10{sup 6} {Upsilon}(4S) {yields} B{bar B} decays collected with the BABAR detector at the PEP-II e{sup +}e{sup -} collider. They select events with a D or D* meson and a light lepton ({ell} = e or {mu}) recoiling against a fully reconstructed B meson. They perform a fit to the joint distribution of lepton momentum and missing mass squared to distinguish signal B {yields} D{sup (*)}{tau}{sup -} {bar {nu}}{sub {tau}} ({tau}{sup -} {yields} {ell}{sup -} {bar {nu}}{sub {ell}}{nu}{sub {tau}}) events from the backgrounds, predominantly B {yields} D{sup (*)} {ell}{sup -}{bar {nu}}{sub {ell}}. They measure the branching-fraction ratios R(D) {triple_bond} {Beta}(B {yields} D{tau}{sup -} {bar {nu}}{sub {tau}})/{Beta}(B {yields} D{ell}{sup -} {bar {nu}}{sub {ell}}) and R(D*) {triple_bond} {Beta}(B {yields} D*{tau}{sup -} {bar {nu}}{sub {tau}})/{Beta}(B {yields} D* {ell}{sup -} {bar {nu}}{sub {ell}}) and, from a combined fit to B{sup -} and {bar B}{sup 0} channels, obtain the results R(D) = (41.6 {+-} 11.7 {+-} 5.2)% and R(D*) = (29.7 {+-} 5.6 {+-} 1.8)%, where the uncertainties are statistical and systematic. Normalizing to measured B{sup -} {yields} D{sup (*)0} {ell}{sup -} {bar {nu}}{sub {ell}} branching fractions, they obtain {Beta}(B {yields} D{tau}{sup -} {bar {nu}}{sub {tau}}) = (0.86 {+-} 0.24 {+-} 0.11 {+-} 0.06)% and {Beta}(B {yields} D*{tau}{sup -} {bar {nu}}{sub {tau}}) = (1.62 {+-} 0.31 {+-} 0.10 {+-} 0.05)%, where the additional third uncertainty is from the normalization mode. They also present, for the first time, distributions of the lepton momentum, |P*{sub {ell}}|, and the squared momentum transfer, q{sup 2}.

  14. Prompt detection of influenza A and B viruses using the BD Veritor™ System Flu A+B, Quidel® Sofia® Influenza A+B FIA, and Alere BinaxNOW® Influenza A&B compared to real-time reverse transcription-polymerase chain reaction (RT-PCR).

    Science.gov (United States)

    Dunn, Jim; Obuekwe, Joy; Baun, Traci; Rogers, Justin; Patel, Twinkle; Snow, Linda

    2014-05-01

    The performance characteristics of rapid influenza diagnostic tests vary widely. This study evaluated the BD Veritor™ System Flu A+B (Veritor; BD Diagnostics, Sparks, MD, USA), Quidel® Sofia® Influenza A+B FIA (Sofia; Quidel Corp., San Diego, CA, USA), and Alere BinaxNOW® Influenza A&B (Binax; Alere Scarborough, Inc., Scarborough, ME, USA) compared to reverse transcription-polymerase chain reaction (RT-PCR) for detection of influenza viruses in nasal wash specimens from 240 pediatric patients. Positive percent agreements for influenza A and B virus detection were 93.8% and 94.2%, 95.8% and 98.1%, and 79.2% and 80.8% for Veritor, Sofia, and Binax, respectively. The Veritor and Binax tests demonstrated negative percent agreements >97.9% for detection of both influenza viruses, but the negative percent agreement of the Sofia test was 91.1% for influenza A and 70.7% for influenza B virus. Overall, the Veritor and Sofia tests were nearly as sensitive as RT-PCR and considerably more sensitive than Binax for detection of influenza viruses. However, the accuracy of the Sofia test was significantly lower than either Veritor or Binax. Copyright © 2014 The Authors. Published by Elsevier Inc. All rights reserved.

  15. Comparative evaluation of the CerTest VIASURE flu A, B & RSV real time RT-PCR detection kit on the BD MAX system versus a routine in-house assay for detection of influenza A and B virus during the 2016/17 influenza season

    DEFF Research Database (Denmark)

    Sydenham, Thomas Vognbjerg; Bek-Thomsen, Malene; Andersen, Signe Dalsgaard

    2018-01-01

    laboratory technician "hands on" time but also the laboratory turnaround time is of interest. OBJECTIVES: We evaluated the performance of the VIASURE Flu A, B & RSV Real Time RT-PCR Detection Kit (CerTest Biotec) for detecting Influenza A and B viruses. STUDY DESIGN: During the 2016/17 influenza season 532.......3-100) and a specificity of 99.1% (95% CI: 97.4-99.8) for detection of Influenza A virus. The positive predictive and negative predictive values were 98.5% (95% CI: 95.8-99.7) and 99.7% (95% CI: 98.3-100) respectively. Influenza B virus detection could not be evaluated due to a low positivity rate. The BD MAX platform......BACKGROUND: Diagnosing of influenza rapidly and accurately helps clinicians to initiate appropriate treatment options and isolation protocols. Unnecessary antimicrobial treatment and laboratory testing can also be reduced. Assess commercial alternatives to in-house assays that may not only reduce...

  16. Fast and direct screening of copper in micro-volumes of distilled alcoholic beverages by high-resolution continuum source graphite furnace atomic absorption spectrometry.

    Science.gov (United States)

    Ajtony, Zsolt; Laczai, Nikoletta; Dravecz, Gabriella; Szoboszlai, Norbert; Marosi, Áron; Marlok, Bence; Streli, Christina; Bencs, László

    2016-12-15

    HR-CS-GFAAS methods were developed for the fast determination of Cu in domestic and commercially available Hungarian distilled alcoholic beverages (called pálinka), in order to decide if their Cu content exceeds the permissible limit, as legislated by the WHO. Some microliters of samples were directly dispensed into the atomizer. Graphite furnace heating programs, effects/amounts of the Pd modifier, alternative wavelengths (e.g., Cu I 249.2146nm), external calibration and internal standardization methods were studied. Applying a fast graphite furnace heating program without any chemical modifier, the Cu content of a sample could be quantitated within 1.5min. The detection limit of the method is 0.03mg/L. Calibration curves are linear up to 10-15mg/L Cu. Spike-recoveries ranged from 89% to 119% with an average of 100.9±8.5%. Internal calibration could be applied with the assistance of Cr, Fe, and/or Rh standards. The accuracy of the GFAAS results was verified by TXRF analyses. Copyright © 2016 Elsevier Ltd. All rights reserved.

  17. Preliminary results from a microvolume, dynamically heated analytical column for preconcentration and separation of simple gases prior to stable isotopic analysis

    Science.gov (United States)

    Panetta, Robert James; Seed, Mike

    2016-04-01

    Stable isotope applications that call for preconcentration (i.e., greenhouse gas measurements, small carbonate samples, etc.) universally call for cryogenic fluids such as liquid nitrogen, dry ice slurries, or expensive external recirculation chillers. This adds significant complexity, first and foremost in the requirements to store and handle such dangerous materials. A second layer of complexity is the instrument itself - with mechanisms to physically move either coolant around the trap, or move a trap in or out of the coolant. Not to mention design requirements for hardware that can safely isolate the fluid from other sensitive areas. In an effort to simplify the isotopic analysis of gases requiring preconcentration, we have developed a new separation technology, UltiTrapTM (patent pending), which leverage's the proprietary Advanced Purge & Trap (APT) Technology employed in elemental analysers from Elementar Analysensysteme GmbH products. UltiTrapTM has been specially developed as a micro volume, dynamically heated GC separation column. The introduction of solid-state cooling technology enables sub-zero temperatures without cryogenics or refrigerants, eliminates all moving parts, and increases analytical longevity due to no boiling losses of coolant . This new technology makes it possible for the system to be deployed as both a focussing device and as a gas separation device. Initial data on synthetic gas mixtures (CO2/CH4/N2O in air), and real-world applications including long-term room air and a comparison between carbonated waters of different origins show excellent agreement with previous technologies.

  18. CP violation with self-tagging Bd modes

    International Nuclear Information System (INIS)

    Dunietz, I.

    1991-01-01

    Gronau and Wyler (GW) extract the weak phase γ and remove the dependence on final state phases by measuring six charged B mesons rates, which are grouped into two trinangles. This note applies the GW method to self-tagging B d modes. Self-tagging eliminates the need for time-dependent measurements. Of interest are the six rates, Γ(B d →D 0 K *0 )=Γ(anti B d →anti D 0 anti K *0 ), Γ(B d →anti D 0 K *0 )=Γ(anti B d →D 0 anti K *0 ), Γ(B d →D 0 CP K *0 ) and Γ(anti B d →D 0 CP anti K *0 ), where D 0 CP denotes a CP eigenmode of a D 0 or anti D 0 . Here the K *0 must be seen in its K + π - mode, which tags the beauty flavour. An additional handle exists to resolve an ambiguity in vertical strokesin γvertical stroke, which accomplished by isospin symmetry from B u and B d data. Preliminary results of a feasibility study are given. (orig.)

  19. Color suppressed contributions to the decay modes Bd,s→Ds,dDs,d, Bd,s→Ds,dD*s,d, and Bd,s→D*s,d D*s,d

    International Nuclear Information System (INIS)

    Eeg, J.O.; Fajfer, S.; Prapotnik, A.

    2005-01-01

    The amplitudes for decays of the type B d,s →D s,d D s,d , have no factorizable contributions, while B d,s →D s,d D * s,d , and B d,s →D * s,d D * s,d have relatively small factorizable contributions through the annihilation mechanism. The dominant contributions to the decay amplitudes arise from chiral loop contributions and tree level amplitudes which can be obtained in terms of soft gluon emissions forming a gluon condensate. We predict that the branching ratios for the processes anti B 0 d →D s + D s - , anti B 0 d →D s +* D s - and anti B 0 d →D s + D s -* are all of order (2-3) x 10 -4 , while anti B 0 s →D d + D d - , anti B 0 s →D d +* D d - and anti B 0 s →D d + D d -* are of order (4-7) x 10 -3 . We obtain branching ratios for two D * 's in the final state of order two times bigger. (orig.)

  20. 76 FR 31223 - Special Conditions: Bombardier Model BD-700-1A10 and BD-700-1A11 Airplanes, Head-up Display (HUD...

    Science.gov (United States)

    2011-05-31

    .... Per Type Certificate Data Sheet (TCDS) T00003NY, those aircraft models are known under the marketing...., conformal) to the external scene. In addition, the SVS image and the HUD symbols--when considered singly or... external scene. In such cases, these symbols may be displayed but with an altered appearance that makes the...

  1. 78 FR 65233 - Special Conditions: Bombardier Inc., Models BD-500-1A10 and BD-500-1A11 Series Airplanes...

    Science.gov (United States)

    2013-10-31

    ... vent and exhaust emission requirements of 14 CFR part 34 and the noise certification requirements of 14...-574, the ``Noise Control Act of 1972.'' The FAA issues special conditions, as defined in 14 CFR 11.19... fuselage material. If negligible amounts of combustion products are produced in this test, the material can...

  2. 75 FR 63420 - Airworthiness Directives; Bombardier, Inc. Model BD-700-1A10 and BD-700-1A11 Airplanes

    Science.gov (United States)

    2010-10-15

    ... damage to No. 2 and No. 3 hydraulic system lines in the wing auxiliary spar area on the left side of the... only remaining braking source available was the No. 3 hydraulic system accumulator. The degradation of... energy aspects of this proposed AD. We will consider all comments received by the closing date and may...

  3. Possible implications of small or large CP violation in Bd0 vs (anti B)d0→J/ΨKs decay

    International Nuclear Information System (INIS)

    Xing Zhizhong

    2002-01-01

    The author argue that a small or large CP-violating asymmetry in B d 0 vs (anti B) d 0 →J/ψK s decays, which seems to be favored by the recent BaBar or Belle data, might hint at the existence of new physics in B d 0 -(anti B) d 0 mixing. The authors present a model-independent framework to show how new physics modifies the standard-model CP-violating asymmetry. The particularly emphasize that the consistent of cp-violating asymmetry experimental result with standard model prediction must not imply the absence of new physics in B d 0 -(anti B) d 0 mixing

  4. 78 FR 75285 - Special Conditions: Bombardier Inc., Models BD-500-1A10 and BD-500-1A11 Series Airplanes; Flight...

    Science.gov (United States)

    2013-12-11

    ... issue a finding of regulatory adequacy under Sec. 611 of Public Law 92-574, the ``Noise Control Act of... have a novel or unusual design feature associated with an electronic flight control system that... turbofan engines. Flight controls are fly-by-wire flight with two passive/uncoupled side sticks. Avionics...

  5. 78 FR 75287 - Special Conditions: Bombardier Inc., Models BD-500-1A10 and BD-500-1A11 Series Airplanes; Flight...

    Science.gov (United States)

    2013-12-11

    ... issue a finding of regulatory adequacy under Sec. 611 of Public Law 92-574, the ``Noise Control Act of... flight control system that provides flight envelope protections. The applicable airworthiness regulations... controls are fly-by-wire flight with two passive/uncoupled side sticks. Avionics includes five landscape...

  6. 78 FR 65231 - Special Conditions: Bombardier Inc., Models BD-500-1A10 and BD-500-1A11 series airplanes...

    Science.gov (United States)

    2013-10-31

    ... Law 92-574, the ``Noise Control Act of 1972.'' The FAA issues special conditions, as defined in 14 CFR... engines. Flight controls are fly-by-wire flight with two passive/uncoupled side sticks. Avionics include... series airplanes; Fuselage In-Flight Fire Safety and Flammability Resistance AGENCY: Federal Aviation...

  7. 78 FR 67291 - Special Conditions: Bombardier Inc., Models BD-500-1A10 and BD-500-1A11 Series Airplanes; Design...

    Science.gov (United States)

    2013-11-12

    .... 611 of Public Law 92-574, the ``Noise Control Act of 1972.'' The FAA issues special conditions, as... have a novel or unusual design feature associated with an electronic flight control system that provides roll control of the airplanes through pilot inputs to the flight computers. The applicable...

  8. 78 FR 65156 - Special Conditions: Bombardier Inc., Models BD-500-1A10 and BD-500-1A11 Series Airplanes...

    Science.gov (United States)

    2013-10-31

    ... ultra high-bypass, geared turbofan engines. Flight controls are fly-by-wire systems with two passive... FAA must issue a finding of regulatory adequacy under Sec. 611 of Public Law 92-574, the ``Noise Control Act of 1972.'' The FAA issues special conditions, as defined in 14 CFR 11.19, in accordance with...

  9. 78 FR 75284 - Special Conditions: Bombardier Inc., Models BD-500-1A10 and BD-500-1A11 Series Airplanes; Flight...

    Science.gov (United States)

    2013-12-11

    ... electronic flight control system that contains fly-by-wire control laws, including envelope protections, for... issue a finding of regulatory adequacy under Sec. 611 of Public Law 92-574, the ``Noise Control Act of... electronic flight control system that contains fly-by-wire control laws, including envelope protections, for...

  10. 78 FR 76736 - Special Conditions: Bombardier Inc., Models BD-500-1A10 and BD-500-1A11 Series Airplanes; Side...

    Science.gov (United States)

    2013-12-19

    ... issue a finding of regulatory adequacy under Sec. 611 of Public Law 92-574, the ``Noise Control Act of...- high bypass, geared turbofan engines. Flight controls are fly-by-wire flight with two passive/uncoupled... and column controls. These airplanes also have a fly-by-wire electronic flight control system. This...

  11. Guilhem de Saint Gregori, "Ben grans avolesa intra" (BdT 233.2; Bartolomeo Zorzi, "En tal dezir mos cors intra" (BdT 74.4

    Directory of Open Access Journals (Sweden)

    Alessandro Bampa

    2014-02-01

    Full Text Available This paper provides a commentary and translation of two contrafacta of Arnaut Daniel’s sestina: Guilhem de Saint Gregori’s "Ben gran avolesa intra" and Bartolomeo Zorzi’s "En tal dezir mos cors intra". For the first song, I will highlight the new contexts and meanings given to Arnaut’s images (which are taken from his sestina and other poems within Guilhem’s invective against Aimers II of Poitiers, in order to evaluate its literary qualities and innovations. Through lexical analysis, this paper will reveal the strong connection between Zorzi’s and Guilhem’s songs. In particular, the paper analyses specifically their common theme of Hell, suggesting Bartolomeo’s text is most likely an answer to Arnaut’s sestina, which clearly expresses a desire of sensual pleasure. The study pays particular attention to the relation between sexual love and the matter of eternal damnation: Zorzi attacks Arnaut’s ferm voler, advancing his argument by evoking Chrétien de Troyes’ "Perceval" (references to which are spread throughout the text, and not only in l. 18 and through his constant stress on the duties towards one’s family.

  12. 76 FR 17062 - Special Conditions: Bombardier Model BD-700-1A10 and BD-700-1A11 Airplanes, Head-Up Display (HUD...

    Science.gov (United States)

    2011-03-28

    ... interested people to take part in this rulemaking by sending written comments, data, or views. The most... of your comments on this proposal, include with your comments a self-addressed, stamped postcard on... prescribed under the provisions of Sec. 21.16. Type Certification Basis Under the provisions of 14 CFR 21.101...

  13. Lexicon of optics. Vol.1: A to L. Vol.2: M to Z; Lexikon der Optik. Bd. 1: A bis L. Bd. 2: M-Z

    Energy Technology Data Exchange (ETDEWEB)

    Paul, H. (ed.)

    2003-07-01

    This lexicon contains the actual knowledge for all aspects in optical sciences and technology. More than 4.000 headings are leading through the whole science of optics in two volumes together with more than 800 figures. More than 70 high-ranked authors guarantee the uptodate knowledge.

  14. Robust-BD Estimation and Inference for General Partially Linear Models

    Directory of Open Access Journals (Sweden)

    Chunming Zhang

    2017-11-01

    Full Text Available The classical quadratic loss for the partially linear model (PLM and the likelihood function for the generalized PLM are not resistant to outliers. This inspires us to propose a class of “robust-Bregman divergence (BD” estimators of both the parametric and nonparametric components in the general partially linear model (GPLM, which allows the distribution of the response variable to be partially specified, without being fully known. Using the local-polynomial function estimation method, we propose a computationally-efficient procedure for obtaining “robust-BD” estimators and establish the consistency and asymptotic normality of the “robust-BD” estimator of the parametric component β o . For inference procedures of β o in the GPLM, we show that the Wald-type test statistic W n constructed from the “robust-BD” estimators is asymptotically distribution free under the null, whereas the likelihood ratio-type test statistic Λ n is not. This provides an insight into the distinction from the asymptotic equivalence (Fan and Huang 2005 between W n and Λ n in the PLM constructed from profile least-squares estimators using the non-robust quadratic loss. Numerical examples illustrate the computational effectiveness of the proposed “robust-BD” estimators and robust Wald-type test in the appearance of outlying observations.

  15. New Observables In the Decay Mode \\bar B_d \\-->\\bar K^{0*} \\ell^+ \\ell^-

    Energy Technology Data Exchange (ETDEWEB)

    Egede, U.; /Imperial Coll., London; Hurth, T.; /CERN /SLAC; Matias, J.; Ramon, M.; /Barcelona, IFAE; Reece, W.; /Imperial Coll., London

    2008-08-07

    We discuss the large set of observables available from the angular distributions of the decay {bar B}{sub d} {yields} {bar K}*{sup 0}{ell}{sup +}{ell}{sup -}. We present a NLO analysis of all observables based on the QCD factorization approach in the low-dilepton mass region and an estimate of {Lambda}/m{sub b} corrections. Moreover, we discuss their sensitivity to new physics. We explore the experimental sensitivities at LHCb (10 fb{sup -1}) and SuperLHCb (100 fb{sup -1}) based on a full-angular fit method and explore the sensitivity to right handed currents. We also show that the previously discussed transversity amplitude A{sub T}{sup (1)} cannot be measured at the LHCb experiment or at future B factory experiments as it requires a measurement of the spin of the final state particles.

  16. Dicty_cDB: FC-BD11 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available GDLYRLKSE DAKSRFVSNLVGQMSGVTIQRNSSSCRFKLLKG*qrfkytlckglgidvndvikfaidqt cksiy*rker...EPHPEFAQHKFDVSGFAARQPYNHPNDDFVQPGDLYRLKSE DAKSRFVSNLVGQMSGVTIQRNSSSCRFKLLKG*qrfkytlckglgidvndvikfaidqt cksiy

  17. Cavaire ~ Bonafos, "Bonafos, yeu vos envit" (BdT 111.1= 99.1

    Directory of Open Access Journals (Sweden)

    Rosa María Medina Granda

    2015-09-01

    Full Text Available The aim of this paper is to study the use of the senhal Bonafos, that occurs in l. 27 of the partimen between Cavaire and Bonafos, as a satirical-parodic senhal. We propose to analyse Bonafos in the same way as we previously examined the use of its opposite, Malafos, in contexts containing a discourse that is far from that of the Canso. This would be the case of the pastorela and the partimen. The use of an echoing irony and its interaction with parody and satire would have made possible the conversion of a previous discursive modalizer into a satirical-parodic senhal in this partimen. We also take into account the use that Jews from the south of France made of the anthroponym Bonafos. The conclusions from previous works as well as the data deriving from the Geopatronyme have provided us with this interesting information. However, we do not believe that in this partimen Bonafos is the real name of the jongleur. On the contrary, we argue that Bonafos, even if an anthroponym, might have continued to ‘encapsulate’ the echo of its hypothetical origin: the discursive modalizer (anc bona fos.

  18. Experimental radiotherapy and clinical radiobiology. Vol. 16; Experimentelle Strahlentherapie und Klinische Strahlenbiologie. Bd. 16. Proceedings

    Energy Technology Data Exchange (ETDEWEB)

    Baumann, M.; Dahm-Daphi, J.; Dikomey, E.; Petersen, C.; Rodemann, H.P.; Zips, D. (eds.)

    2007-07-01

    The following topics were dealt with: DNA repair as therapeutical target in radiation therapy, biological imaging and tumor microenvironment, molecular factors of radiation therapy, molecular factors and modulation of the radiation reaction of normal tissues, experimental tumor therapy, EGFR inhibition, the endothel cell as primary target of radiation therapy, molecular and cellular foundations of the radiation biology of protons and ions. (HSI)

  19. Emotional or Behavioral Disorders: Background and Current Status of the E/BD Terminology and Definition.

    Science.gov (United States)

    Forness, Steven R.; Kavale, Kenneth A.

    2000-01-01

    This article reviews the development and current status of alternatives to the federal definition of emotional disturbance or behavior disorders. It notes that several states are now revising their own terminologies or definitions in response to the 1997 reauthorization of the Individuals with Disabilities Education Act that dropped the term…

  20. The Teacher's Role in the Selection of Social Skills with BD Secondary School Students.

    Science.gov (United States)

    Royer, Egide

    A study of 15 eighth graders with behavioral disorders in Quebec evaluated the effectiveness of a social and school-related skills training program in which goals were decided by the students, their teachers, and their parents. A first year pilot study assessed the effect of parent and teacher participation in the selection of skills to be learned…

  1. Peire Vidal, “Bon’aventura don Dieus als Pizas” (BdT 364.14

    Directory of Open Access Journals (Sweden)

    Marco Grimaldi

    2013-05-01

    Full Text Available The poem examined here, probably composed in Italy, is mainly known for its historical interest and as a satire of the Germans. In “Bon’aventura”, in fact, Peire Vidal seems to be siding openly with the Marquis Boniface I of Monferrato and the Lombard communes, that were at war with the Emperor Henry IV, who had invaded Italy at the end of 1194. This paper, which reproduces Avalle’s edition and basically confirms the usual date between autumn 1194 and April 1195, will discuss the precise relationship between poetry and politics in Peire Vidal’s work through an analysis of the song’s value as a document in relation to contemporary sources. Thus it will examine the troubadour’s attitude to the events of his day and attempt to outline a fluid and ‘regional’ political loyalty which the poet from Toulouse shares with his contemporaries.

  2. Papers of the Braunschweigische Wissenschaftliche Gesellschaft. Vol. LIX; Abhandlungen der Braunschweigischen Wissenschaftlichen Gesellschaft. Bd. LIX

    Energy Technology Data Exchange (ETDEWEB)

    Scheier, Claus-Artur (ed.)

    2008-07-01

    The topic of this symposium is global change and biological invasion. Looking back on earth history to get a rule for the dynamic of changes to be watched today. The science history with contributions on Leibnitz, Euler and Moses Mendelsohn is also presented, and finally presented are contributions on theology and cognition theory. (orig./GL)

  3. Textbook on food chemistry and food technology. Vol. 2. Taschenbuch fuer Lebensmittelchemiker und -technologen. Bd. 2

    Energy Technology Data Exchange (ETDEWEB)

    Osteroth, D. (Karlsruhe Univ. (Germany) Fachhochschule Lippe, Lemgo (Germany)) (ed.)

    1991-01-01

    The textbook presents the basic material and knowledge required in the food industry, relating to food technology and food chemistry, and to the legal aspects of food processing. Apart from information on specific analytical methods, which are discussed in detail, information is given other means and approaches for a comprehensive evaluation of food quality, as e.g. sensory evaluation, statistics, microbiology, dietetics, toxicology. There is one chapter dealing with the available methods of food preservation by physical treatment, as e.g. by food irradiation. (VT) With 159 figs.

  4. DECHEMA annual conference in 1998; DECHEMA-Jahrestagungen `98. Bd. 1. 16. Jahrestagung der Biotechnologen. Kurzfassungen

    Energy Technology Data Exchange (ETDEWEB)

    Hess, C. [comp.

    1998-12-31

    In a versatile, often multidisciplinary programme the DECHEMA annual conferences in 1998 present new results from research, the state of the art, and, not least, the persons, companies, and institutions active in various disciplines. This volume contains shortened versions of the lectures and posters presented at the 16th Annual Conference of Biotechnologists. [Deutsch] Die DECHEMA-Jahrestagungen `98 stellen in einem vielseitigen, oft interdisziplinaeren Programm neue Ergebnisse aus der Forschung, den aktuellen Stand der Technik und nicht zuletzt auch die auf den jeweiligen Gebieten aktiven Personen, Firmen und Institutionen vor. In diesem Band sind die Kurzfassungen der Vortraege und Poster der 16. Jahrestagung der Biotechnologen enthalten. (orig.)

  5. Anonimo, “Totas honors e tuig faig benestan” (BdT 461.234

    Directory of Open Access Journals (Sweden)

    Marco Grimaldi

    2010-08-01

    Full Text Available This paper will examine an anonymous ‘planh’, “Totas honor e tuig faig benestan”, for the death of Manfred of Swabia, illegitimate son of Frederick II, who was killed in the battle of Benevento in 1266. The text is copied in a section of the ‘twin’ chansonniers I and K which contains mainly lyric laments (an exception in the troubadour manuscript tradition and for this reason will serve as a basis for a discussion of the concept of ‘documentary series’. The paper will also consider the author’s origin, probably Italian on the basis of the linguistic and metrical evidence, and attempt to place the planh more precisely within the context of the struggle between Charles of Anjou and Manfred, as well as illustrate the role played by political troubadour poetry at the Italian court of the last Swabians.

  6. 13 CFR 124.3 - What definitions are important in the 8(a) BD program?

    Science.gov (United States)

    2010-01-01

    ... functions of the firm. Immediate family member means father, mother, husband, wife, son, daughter, brother... (other than after death or incapacity). The pledge or encumbrance of stock or other ownership interest as...

  7. Experimental radiotherapy and clinical radiobiology. Vol. 22. Proceedings; Experimentelle Strahlentherapie und Klinische Strahlenbiologie. Bd. 25. Proceedings

    Energy Technology Data Exchange (ETDEWEB)

    Baumann, Michael; Krause, Mechthild [Universitaetsklinikum Technische Univ. Dresden (Germany). Klinik und Poliklinik fuer Strahlentherapie und Radiologie; Cordes, Nils [Universitaetsklinikum Technische Univ. Dresden (Germany). OncoRay - Nationales Zentrum fuer Strahlenforschung in der Radioonkologie; Helmholtz-Zentrum Dresden-Rossendorf e.V., Dresden (Germany); Petersen, Cordula [Universitaetsklinikum Hamburg-Eppendorf, Hamburg (Germany). Klinik und Poliklinik fuer Strahlentherapie und Radioonkologie; Rodemann, H. Peter [Universitaetsklinikum Tuebingen (Germany). Sektion fuer Strahlenbiologie; Rothkamm, Kai [Universitaetsklinikum Hamburg-Eppendorf, Hamburg (Germany). Lab. fuer Strahlentherapie und Experimentelle Radioonkologie; Zips, Daniel (ed.) [Tuebingen Univ. (Germany). Universitaetsklinik fuer Radioonkologie

    2016-05-01

    The proceedings of the 25th symposium on experimental radiotherapy and clinical radiobiology include papers on the following issues: radiotherapy individualization based on imaging; pre-clinic imaging and new experimental methods; methods and models, micromilieu and metabolism, combined therapy; secondary tumors following radiotherapy; radiogenic effects in normal tissue; resistance mechanism of tumors and normal tissue; personalized radio-oncology - which biological data are needed; pre-clinic and personalized radio-oncology; biomarkers - pre-clinic and translational; translational examinations for personalized radio-oncology.

  8. checkCIF/PLATON report Datablock: monika-bd1re3

    Indian Academy of Sciences (India)

    R(reflections)= 0.0624( 3827). wR2(reflections)= 0.1913( 7975). S = 1.000 ... H-X H23B .. H212 .. 1.84 Ang. Alert level C. PLAT026_ALERT_3_C Ratio Observed / Unique Reflections too Low . ... serious problems it may be necessary to carry out additional measurements or structure refinements. However, the purpose of ...

  9. Experimental radiotherapy and clinical radiobiology. Vol. 22. Proceedings; Experimentelle Strahlentherapie und Klinische Strahlenbiologie. Bd. 22. Proceedings

    Energy Technology Data Exchange (ETDEWEB)

    Baumann, Michael; Cordes, Nils; Dikomey, Ekkehard; Krause, Mechthild; Petersen, Cordula; Rodemannn, H. Peter; Zips, Daniel (eds.)

    2013-03-01

    The proceedings of the 22th Symposium on experimental radiotherapy and clinical radiotherapy contain lectures and poster on the following issues: Radiation induced immuno-targeting of tumors; targeting in the radiotherapy; biomarkers; targeting; radio-oncological therapy of rectal carcinoma - contribution of radiobiology for therapy optimization; biomarkers for radiation sensibility; resistance mechanisms of tumors; resistance mechanisms of normal tissue; micro ambience, P13L inhibition in radiotherapy: improvement of the local tumor control by molecular mechanisms or the influence of the tumor micro-ambience? DNA repair; radiation effects and technical development.

  10. Preussag. Research, technology and innovation. Vol. 23; Preussag. Forschung, Technik und Innovation. Bd. 23

    Energy Technology Data Exchange (ETDEWEB)

    Schaper, R.; Haenjes, A. [comps.

    1998-12-31

    The content and the new appearance of Volume 23 of `Research, Technology and Innovation` reflects the current restructuring of the Preussag Group. Although the specific characteristics of the new divisions make it currently impossible to fully echo the new Group structure in the status reports on R and D projects and innovations in this volume, the new focus of the company has already had a considerable impact on its layout and content. The enhanced growth discernible in the Energy, Building Engineering and Logistics Divisions is reflected in expanded R and D activities which make up an impressive proportion of the papers presented in this publication. (orig.) [Deutsch] Der vorliegende Band 23 von `Forschung, Technik und Innovation` weist durch seinen Inhalt und sein neues Aeusseres auf den stattfindenden Umbau des Preussag-Konzerns hin. Zwar ist es wegen der Spezifik der neuen Kerngeschaeftsfelder noch nicht moeglich, im vorliegenden Band ein praezises Spiegelbild der neuen Konzernstruktur auch in den Fortschrittsberichten ueber FuE-Projekte und Innovation zu geben, aber die kuenftigen Schwerpunkte praegen schon deutlich den Aufbau und Inhalt dieses Bandes. Die verstaerkten Wachstumstendenzen in den Geschaeftsfeldern Energie, Gebaeudetechnik und Logistik spiegeln sich auch in steigender FuE-Taetigkeit wider, was zu einem beachtlichen Anteil von Beitraegen in diesem Kompendium gefuehrt hat. (orig.)

  11. Exercises in dental radiology. Vol. 3. Uebungen in zahnaerztlicher Roentgenologie. Bd. 3. Intraorale Roentgendiagnostik

    Energy Technology Data Exchange (ETDEWEB)

    Dixter, C.; Langlais, R.P.; Lichty, G.C.

    1983-01-01

    The book is addressed to paediatric dentists and other dentists who have children among their patients; it presents a survey of normal and pathological development of teeth and surrounding tissues. Imaging errors, eruption problems, anomalies the radiological picture of primary and secondary crowding during eruption, analysis of the deciduous teeth, teleradiography, traumas and temporomandibular diseases are discussed. Each chapter contains questions concerning the interpretation of the radiological findings.

  12. BD-Type Write-Once Disk with Pollutant-Free Material and Starch Substrate

    Science.gov (United States)

    Hosoda, Yasuo; Higuchi, Takanobu; Shida, Noriyoshi; Imai, Tetsuya; Iida, Tetsuya; Kuriyama, Kazumi; Yokogawa, Fumihiko

    2005-05-01

    We realized an inorganic write-once disk for an optical recording system of the Blu-ray disk format. We developed a new Al alloy for the reflective layer and a Nb-compound oxide nitride material for the dielectric layer. By adopting these materials for the reflective layer and the dielectric layer of our write-once disk, we achieved complete exclusion of toxic substances specified in the pollutant release and transfer register (PRTR) law. That is, this disk did not contain any substances specified in the PRTR law. We confirmed this disk to be compatible with 1× to 2× recording at the user capacity of 25.0 GB. The bottom jitter values of both 1× and 2× were less than 6.0%. In addition, we developed another kind of substrate, which was made of a natural polymer derived from corn starch. The bottom jitter value was 6.0% at the user capacity of 25.0 GB with the limit equalizer.

  13. Deuterium measurements toward WD1034+001, BD+393226, and TD1 32709

    Science.gov (United States)

    Oliveira, C. M.; Chayer, P.; Kruk, J.; Moos, H. W.

    2004-12-01

    Observations of the D/H ratio in the interstellar medium provide important constraints on Galactic chemical evolution models as well as on the Big Bang nucleosynthesis theory. The behavior of the D/H ratio in the interstellar medium is far from being well understood. D/H seems to have a single value inside the Local Bubble (logN(DI) Bubble value. In order to increase the number of measurements that will allow us to understand this behavior, we present a preliminary analysis of three sightlines located outside the Local Bubble. All three sightlines have log N(DI) > 15. We use data obtained with FUSE, IUE, and HST/GHRS to determine the column densities of many species, including H I, D I, N I, O I, and H2. We derive D/H, N/H, O/H, and D/O ratios which are then compared to values published in the literature. This work is based on data obtained for the Guaranteed Time Team by the NASA-CNES-CSA FUSE mission operated by The Johns Hopkins University. Financial support to U. S. participants has been provided in part by NASA contract NAS5-32985 to Johns Hopkins University.

  14. Study of Charmless Bd,s0 → h+h'-π0 decays in LHCb

    International Nuclear Information System (INIS)

    Roa Romero, D.A.

    2013-01-01

    This thesis work is about the identification of charmless three-body decays of neutral B mesons with a π 0 in the final state (B d,s 0 → h + h' - π 0 ) through the analysis of a 1.0 fb -1 data sample collected in 2011 by the LHCb experiment at the LHC. Those modes are sensitive to CKM parameters and allow to test Standard Model predictions related to CP violation. Some of them, such as B s 0 → K - π + π 0 and B s 0 → K + K - π 0 , have not been observed previously. This is the first analysis with energetic π 0 in LHCb. To evaluate the detector performance for π 0 , D *+ → D 0 (→ K - π + π 0 )π + decays have been selected. This provides a clean and high statistics sample of neutral pions used to study their energy calibration as well as the effectiveness of the π 0 /γ separation tool of the experiment. Radiative decays are indeed the most dangerous backgrounds for the study of B d,s 0 → h + h' - π 0 modes. To select B d,s 0 → h + h' - π 0 events, a dedicated trigger algorithm has been implemented. It complements the standard online selections and significantly improves the efficiency. Offline, obvious backgrounds, mainly from charm decays, are rejected applying simple criteria. The sample is then further purified using a multivariate classifier. At last, information from the ring imaging Cherenkov detectors allows to separate π + π - π 0 , K ± π ± π 0 and K + K - π 0 final states. A simultaneous fit of the reconstructed B mass spectra in the three sub-samples is used to extract the signal yields. It accounts for the different backgrounds remaining as well as for the signal cross-feeds from one sub-sample to the other. The B 0 → π + π - π 0 , B 0 → K + π - π 0 and B s 0 → K + K - π 0 contributions are clearly established. This is the first observation of the B s 0 → K + K - π 0 decay mode. (author)

  15. Raimbaut de Vaqueiras, “Domna, tant vos ai prejada” (BdT 392.7

    Directory of Open Access Journals (Sweden)

    Gilda Caiti-Russo

    2009-12-01

    Full Text Available This paper will attempt to read Raimbaut de Vaqueiras’ ‘contrasto’ from the viewpoint of its explicit addressees: the late twelfth-century imperial nobility of north-western Italy, as embodied by the Malaspina family. The text’s distinctive bilingualism thus assumes social and political significance since it pits the claims of the feudal aristocracy of the hinterland against the power of the Genoese bankers and merchants. The dialectical relationship of the two sides involved, played out by the voices of the jongleur and the Genoese lady, is nevertheless also literary: Raimbaut appears to match popular poetry, poetry which is «non regulata» as Dante would later call it, against a century of courtly Occitan poetry distinguished by an extremely formal tradition. A carnivalesque dimension is thus present in the reciprocal illumination of the two poetic voices: if popular poetry is unregulated despite its expressive qualities, troubadour poetry is confined, by means of the parody of the genre of the ‘salut’, to topics far-removed from reality. Raimbaut’s aim then is to restructure trobar by going back to the beginning: to the Count of Poitiers and his political and cultural act of inventing a secular poetry of aristocratic inspiration and in the vernacular. A ‘male’ poetry that will be formulated by the surprising gap at the end of the poem.

  16. The NIH BD2K center for big data in translational genomics.

    Science.gov (United States)

    Paten, Benedict; Diekhans, Mark; Druker, Brian J; Friend, Stephen; Guinney, Justin; Gassner, Nadine; Guttman, Mitchell; Kent, W James; Mantey, Patrick; Margolin, Adam A; Massie, Matt; Novak, Adam M; Nothaft, Frank; Pachter, Lior; Patterson, David; Smuga-Otto, Maciej; Stuart, Joshua M; Van't Veer, Laura; Wold, Barbara; Haussler, David

    2015-11-01

    The world's genomics data will never be stored in a single repository - rather, it will be distributed among many sites in many countries. No one site will have enough data to explain genotype to phenotype relationships in rare diseases; therefore, sites must share data. To accomplish this, the genetics community must forge common standards and protocols to make sharing and computing data among many sites a seamless activity. Through the Global Alliance for Genomics and Health, we are pioneering the development of shared application programming interfaces (APIs) to connect the world's genome repositories. In parallel, we are developing an open source software stack (ADAM) that uses these APIs. This combination will create a cohesive genome informatics ecosystem. Using containers, we are facilitating the deployment of this software in a diverse array of environments. Through benchmarking efforts and big data driver projects, we are ensuring ADAM's performance and utility. © The Author 2015. Published by Oxford University Press on behalf of the American Medical Informatics Association. All rights reserved. For Permissions, please email: journals.permissions@oup.com.

  17. Maintenance manual. Vol. 1. Maintenance management; 2. completely rev. ed.; Handbuch Instandhaltung. Bd. 1. Instandhaltungsmanagement

    Energy Technology Data Exchange (ETDEWEB)

    Warnecke, H.J. [ed.] [Fraunhofer-Institut fuer Produktionstechnik und Automatisierung (IPA), Stuttgart (Germany)

    1992-12-31

    This manual is the second, completely revised edition of the standard manual ``Maintenance - Fundamentals``, which was first published in 1981. It presents an outline of all relevant fields of maintenance today and contains practical information on new and established methods of maintenance management and technology. With its comprehensive concept, which addresses any industrial enterprise that wants to remain competitive, the manual is indispensable for maintenance managers in industry, service enterprises and consultancies. Vol.1, ``Maintenance Management``, informs the reader on fundamentals, design with a view to maintenance, organisation of maintenance work, personnel management, industrial safety and economic aspects of maintenance. Current issues such as product liability, electronic data processing, expert systems, environmental protection, controlling based on characteristic data, etc. are gone into. Graphical representations, concrete procedural information and exemplary solutions may be used directly as working tools for the practice of maintenance. (orig.) [Deutsch] Das vorliegende Handbuch ist die zweite, voellig ueberarbeitete und erweiterte Auflage des Standardwerkes ``Instandhaltung - Grundlagen``, das 1981 erstmals erschien. Es gibt einen Ueberblick ueber alle relevanten Gebiete einer modernen Instandhaltung und vermittelt praxisnahes Wissen ueber neue und bewaehrte Methoden und Verfahren des Instandhaltungsmanagements und der Instandhaltungstechnik. Mit dieser umfassenden Konzeption, die auf die Belange des im Wettbewerb stehenden Industriebetriebes ausgerichtet ist, wendet sich das Handbuch an die Fuehrungskraefte der Instandhaltung in der Industrie sowie an Dienstleistungs- und Beratungsunternehmen. Im Band 1 ``Instandhaltungsmanagement`` kann sich der Leser ueber Grundlagen, instandhaltungsgerechtes Konstruieren, Organisation der Instandhaltung, Personalmanagement, Arbeitssicherheit sowie Wirtschaftlichkeit der Instandhaltung informieren. Aktuelle Themen wie Produkthaftung, EDV-Einsatz, Expertensystemen, Umweltschutz, kennzahlengestuetztes Controlling etc. wurden neu aufgenommen. Zahlreiche graphische Darstellungen, konkrete Handlungsanleitungen und Musterloesungen koennen als direkt anwendbare Arbeitshilfen fuer die betriebliche Instandhaltungspraxis eingesetzt werden. (orig.)

  18. Experimental radiotherapy and clinical radiobiology. Vol. 20. Proceedings; Experimentelle Strahlentherapie und Klinische Strahlenbiologie. Bd. 20. Proceedings

    Energy Technology Data Exchange (ETDEWEB)

    Baumann, Michael; Dahm-Daphi, Jochen; Dikomey, Ekkehard; Petersen, Cordula; Rodemannn, Hans-Peter; Zips, Daniel (eds.)

    2011-07-01

    The proceedings include contributions on the following issues: laser driven proton accelerators on the way for radiotherapy, radiobiological evaluation of new radiations; molecular factors of radiation response; biological targeting; EGFR epidermal growth factor receptor/targeting - combined internal and external irradiation, radiobiology of normal tissues; dose-volume histograms for the radiotherapy: curves without radiobiological relevance or important information for the therapy planning; HPV (human papilloma virus) and radiation sensitivity of HNSCC (head and neck squamous cell carcinomas): evidence, radiobiological mechanism, clinical consequences and perspectives; mechanisms of action and intertumoral heterogeneity of response to EGFR inhibition in radiotherapy of solid tumors; evaluation of biomarkers for radiotherapy.

  19. Experimental radiotherapy and clinical radiobiology. Vol. 19. Proceedings; Experimentelle Strahlentherapie und Klinische Strahlenbiologie. Bd. 19. Proceedings

    Energy Technology Data Exchange (ETDEWEB)

    Baumann, Michael; Dahm-Daphi, Jochen; Dikomey, Ekkehard; Petersen, Cordula; Rodemann, H. Peter; Zips, Daniel (eds.)

    2010-12-18

    The proceedings include review contributions on radio-oncology, and new radiation technologies and molecular prediction; and poster sessions on the following topics: hypoxia; molecular mechanisms of radiation resistance; molecular targeting; DNA repair; biological imaging; biology of experimental radiations; normal tissue toxicity; modern radiotherapy; tumor hypoxia and metabolic micro milieu; immune system and radiotherapy.

  20. Experimental radiotherapy and clinical radiobiology. Vol. 18. Proceedings; Experimentelle Strahlentherapie und Klinische Strahlenbiologie. Bd. 18. Proceedings

    Energy Technology Data Exchange (ETDEWEB)

    Baumann, Michael; Dahm-Daphi, Jochen; Dikomey, Ekkehard; Petersen, Cordula; Rodemann, H. Peter; Zips, Daniel (eds.)

    2009-07-15

    The proceedings on experimental radiotherapy and clinical radiobiology contain two review articles (prediction of normal tissue reactions after radiotherapy, ?H2AX foci as a marker for DNA double-strand breaks) and 34 contributions to the following topics: Hypoxia and molecular mechanisms of radiation resistance; biological imaging of the tumor micromilieu; DNA repair, genomic instability and carcerogenesis; molecular factors of radiation resistance; actual controversial discussion on possible irradiation caused metastasis risk enhancement; EGFR inhibition and irradiation; biology of experimental radiation/ normal tissue toxicity.

  1. Bytový dům s provozovnou BD-2

    OpenAIRE

    Slezák, Václav

    2017-01-01

    Předmětem bakalářské práce je návrh a stavební řešení bytového domu s obchodním místem bankovního subjektu v Brně, městské části Komín. Objekt má obdélníkový půdorysný tvar. Bytový dům má jedno podzemní podlaží, tři nadzemní podlaží a je zastřešen sedlovou střechou. Stavba je založena na betonových základových pasech, svislé a vodorovné konstrukce jsou navrženy ze systému Porotherm. K objektu je přivedena pěší komunikace a v blízkosti objektu je navrženo parkoviště. Projekt byl vypracován pom...

  2. [Changes of the immune cells, cytokines and growth hormone in teenager drug addicts].

    Science.gov (United States)

    Kuang, Ying-min; Zhu, Yue-chun; Kuang, Ying; Sun, Yuan; Hua, Chen; He, Wen-yi

    2007-09-01

    To investigate the effect of heroin on the immune function, growth and development in the teenager heroin addicts by measuring their T-lymphocyte subsets, Th1/Th2 cytokines and serum growth hormone. Tlymphocyte subsets of peripheral blood from the teenager heroin addicts were measured by direct microvolume whole blood immunofluorescent staining technique by flow cytometer (FCM). Thl / Th2 cytokines were measured by BD cytometric bead array and serum growth hormone was assayed using the chemiluminescence method in the 20 teenager heroin addicts and 23 healthy teenagers. The levels of CD3(+), CD3(+) + CD4(+), CD3(+) + CD4(+)/CD3(+)+ CD8(+), Th1 cytokines(IL-2, TNF-alpha and IFN-gamma) and Th2 cytokines(IL-4 and IL-10) reduced significantly in the teenager heroin addicts compared with the healthy control group (P teenager heroin addicts was remarkably higher than that in control group (Pteenager heroin addicts. Besides, it can increase the level of serum growth hormone of the teenager heroin addicts.

  3. Measurement of the Ratios of Branching Fractions B(Bs -> Ds pi pi pi) / B(Bd -> Dd pi pi pi) and B(Bs -> Ds pi) / B(Bd -> Dd pi)

    Energy Technology Data Exchange (ETDEWEB)

    Abulencia, A.; /Illinois U., Urbana; Adelman, J.; /Chicago U.; Affolder, T.; /UC, Santa Barbara; Akimoto, T.; /Tsukuba U.; Albrow, M.G.; /Fermilab; Ambrose, D.; /Fermilab; Amerio, S.; /Padua U.; Amidei, D.; /Michigan U.; Anastassov, A.; /Rutgers U., Piscataway; Anikeev, K.; /Fermilab; Annovi, A.; /Frascati /Taiwan, Inst. Phys.

    2006-10-01

    Using 355 pb{sup -1} of data collected by the CDF II detector in p{bar p} collisions at {radical}s = 1.96 TeV at the Fermilab Tevatron, they study the fully reconstructed hadronic decays B{sub (s)}{sup 0} {yields} D{sub (s)}{sup -}{pi}{sup +} and B{sub (s)}{sup 0} {yields} D{sub (s)}{sup -} {pi}{sup +}{pi}{sup +}{pi}{sup -}. They present the first measurement of the ratio of branching fractions {Beta}(B{sub s}{sup 0} {yields} D{sub s}{sup -}{pi}{sup +}{pi}{sup +}{pi}{sup -})/{Beta}(B{sup 0} {yields} D{sup -} {pi}{sup +}{pi}{sup +}{pi}{sup -}) = 1.05 {+-} 0.10(stat.) {+-} 0.22(syst.). They also update their measurement of {Beta}(B{sub s}{sup 0} {yields} D{sub s}{sup -} {pi}{sup +})/{Beta}(B{sup 0} {yields} D{sup -} {pi}{sup +}) to 1.13 {+-} 0.08(stat.) {+-} 0.23(syst.) improving the statistical uncertainty by more than a factor of two. They find {Beta}(B{sub s}{sup 0} {yields} D{sub s}{sup -} {pi}{sup +}) = [3.8 {+-} 0.3(stat.) {+-} 1.3(syst.)] x 10{sup -3} and {Beta}(B{sub s}{sup 0} {yields} D{sub s}{sup -} {pi}{sup +}{pi}{sup +}{pi}{sup -}) = [8.4 {+-} 0.8(stat.) {+-} 3.2(syst.)] x 10{sup -3}.

  4. Assessment of utility of Siriraj Stroke Score (SSS in stroke patients of Pt. BD Sharma PGIMS hospital, Rohtak, India

    Directory of Open Access Journals (Sweden)

    H. Singh

    2001-09-01

    Full Text Available India has predominantly poor rural population where brain CT scan, most often advised investigation in patients of stroke, may not always be available, hence Indian physician in such setting base his diagnosis on bed side sign evaluation for which Siriraj Stroke Score (SSS could be helpful. Objective of study: to assess the utility of SSS in patients of stroke. Methodology: sixty subjects of stroke were evaluated on SSS and 'probable' diagnosis so made was compared with CT scan's (brain 'certain' diagnosis. Main findings: by using SSS, the probable bedside diagnosis was cerebral infarct (score < -1 in 32 subjects and cerebral haemorrhage (score > +1 in 24 subjects while 4 subjects had indeterminant score (-1 to +1. Fifty subjects had their probable diagnosis matched with brain CT scan certain diagnosis. The above findings showed that SSS had 93.7% sensitivity, 76.6% specificity, 81.2% positive predictive value, 92% negative predictive value with an overall accuracy as 93.7% for diagnosis of cerebral infarction. For patients of cerebral haemorrhage the sensitivity was 83.3%, specificity was 92.5%, positive predictive value was 86.9%, negative predictive values was 92.5% with overall accuracy as 83.3%. Principal conclusion: physicians in the rural settings may find SSS to be quite useful in the management of stroke especially where more sophisticated radiological investigations may not be available for confirmation of diagnosis due to high cost or attended due to transportation risk. (Med J Indones 2007; 10: 164-8Keywords: stroke, cerebrovascular accident, infarction, haemorrhage

  5. Achieving a production goal of 1 million B/D of coal liquids by 1990. [Impediments and constraints

    Energy Technology Data Exchange (ETDEWEB)

    Miller, Charles; LaRosa, Dr., P. J.; Coles, E. T.; Fein, H. L.; Petros, J. J.; Iyer, R. S.; Merritt, R. T.

    1980-03-01

    Under this contract, Bechtel analyzed the resource requirements and reviewed major obstacles to the daily production of several million barrels of synthetic coal liquids. Further, the study sought to identify the industry infrastructure needed to support the commercial readiness of the coal liquefaction process. A selected list of critical resource items and their domestic/international availability was developed and examined, and the impact of their supply on the various synthetic coal liquids programs was evaluated. The study approach was to develop representative, or generic, direct and indirect coal liquefaction conceptual designs from available technology and costs data. The generic processes were to employ technology that would be considered commercial by the mid- or late-1980s. The size of the generic construction mobilization was considered reasonable at the outset of the program. The product slate was directed toward unrefined liquid fuels rather than diesel oil or gasoline. The generic processes were to use a wide range of coals to permit siting in most coal-producing regions across the country. Because of the dearth of conceptual design data in the literature, Bechtel developed generic plant designs by using in-house design expertise. Bechtel assumed that because it is first generation technology, the indirect process will be used at the outset of the liquids program, and the direct process will be introduced two to four years later as a second generation technology. The products of either of these processes will be limited to boiler fuels and/or other liquid products which require further upgrading. Cost estimates were developed from equipment lists, as well as material and labor estimates, which enabled the determination of an order-of-magnitude cost estimate and target plant construction schedule for both processes.

  6. Subcloning and Assessment of the Expression of Synthetic Gene of Botulinum Neurotoxin Type A Binding Domain (BD/A

    Directory of Open Access Journals (Sweden)

    Majid Zavvary

    2016-08-01

    Full Text Available Background and Objectives: Botulism syndrome is caused by Clostridium botulinum neurotoxin. This neurotoxin has seven serotypes ranging from A to G. The best way to prevent botulism syndrome caused by Botulinum neurotoxin (BoNT, is using recombinant vaccine made from its binding domain (due to having sufficient epitopes to stimulate immune system. In this study, the binding domain of BoNT serotype A (BoNT/A, was investigated. Methods: Initially, BoNT/A gene with accession number CP000727.1, was obtained from GenBank and was codon optimized according to the codon usage of E. coli. Then, the sequence was synthesized in pET28a plasmid and then subcloned in pGEX-4T-1 expression plasmid. The subcloning was done using PCR with Pfu DNA polymerase and then double digestion with XmaI and XhoI restriction enzymes. E. coli BL21 strain was used as the expression host. The selected marker for pGEX-4T-1 was ampicillin. Results: PCR and restriction digestion with the mentioned enzymes confirmed the subcloning process. The assessment of gene expression was performed by SDS-PAGE and western blotting (using horse anti-BoNT/A (and then glutathione affinity chromatography was performed. Although, the subcloning was performed successfully, no protein expression was observed.  Conclusion: According to the findings of this study, it seems that other hosts, such as eukaryotic hosts should be used for recombinant expression of BoNT/A binding domain.

  7. Handbook on criticality. Vol. 1. Criticality and nuclear safety; Handbuch zur Kritikalitaet. Bd. 1. Kritikalitaet und nukleare Sicherheit

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    2015-04-15

    This handbook was prepared primarily with the aim to provide information to experts in industry, authorities or research facilities engaged in criticality-safety-related problems that will allow an adequate and rapid assessment of criticality safety issues already in the planning and preparation of nuclear facilities. However, it is not the intention of the authors of the handbook to offer ready solutions to complex problems of nuclear safety. Such questions have to remain subject to an in-depth analysis and assessment to be carried out by dedicated criticality safety experts. Compared with the previous edition dated December 1998, this handbook has been further revised and supplemented. The proven basic structure of the handbook remains unchanged. The handbook follows in some ways similar criticality handbooks or instructions published in the USA, UK, France, Japan and the former Soviet Union. The expedient use of the information given in this handbook requires a fundamental understanding of criticality and the terminology of nuclear safety. In Vol. 1, ''Criticality and Nuclear Safety'', therefore, first the most important terms and fundamentals are introduced and explained. Subsequently, experimental techniques and calculation methods for evaluating criticality problems are presented. The following chapters of Vol. 1 deal i. a. with the effect of neutron reflectors and absorbers, neutron interaction, measuring methods for criticality, and organisational safety measures and provide an overview of criticality-relevant operational experience and of criticality accidents and their potential hazardous impact. Vol. 2 parts 1 and 2 finally compile criticality parameters in graphical and tabular form. The individual graph sheets are provided with an initially explained set of identifiers, to allow the quick finding of the information of current interest. Part 1 includes criticality parameters for systems with {sup 235}U as fissile material, while part 2 deals with systems comprising {sup 233}U, plutonium and higher actinides.

  8. Raimbaut de Vaqueiras, “Las frevols venson lo plus fort” (BdT 392.21

    Directory of Open Access Journals (Sweden)

    Paolo Squillacioti

    2008-12-01

    Full Text Available The article provides a commentary of Raimbaut de Vaqueiras Las frevols venson lo plus fort, a poem commonly classified as a devinalh (riddle, an Occitan poetic genre whose real existence is debated among scholars. There are two major interpretations of the poem: one, by Tobler, claims that each stanza contains a riddle whose solution is unrelated to the others; another, by Lawner, explains all the riddles of the poem in sexual terms. The author of the article does not agree with either interpretation: he believes that the central focus of the poem is to be found in the pairs of antithetic elements listed in each stanza (strong vs. weak; nothing vs. universe; sweet vs. bitter; death vs. life; cold vs. hot; rich vs. poor, in their interactions with one another as well as in the paradoxical consequences of this interaction, i.e. that the natural order of things can be subverted and so the impossible can become possible. The whole poem might be affected by biblical influences.

  9. Daude de Pradas (?, “Belha m’es la votz autana” (BdT 124.5

    Directory of Open Access Journals (Sweden)

    Francesco Carapezza

    2012-06-01

    Full Text Available The attribution of this love song to the troubadour from Rouergue, Daude de Pradas, according to the only Occitan testimony, i.e. song-book C, was considered impossible or at least suspicious by many scholars for the mere fact that its first verse is quoted, as a ‘chançon auvrignace’, in the “Roman de la Rose” (or Guillaume de Dole attributed to Jean Renart and initially dated to the earliest years of the XIIIth century. However, in the light of the recent dating of Daude’s poetic activity between 1191 and 1242, the chronological criterion alone cannot resolve the issue of attribution. This paper, where a more conservative edition of the text than that by C. Appel (1890 is proposed, will now present for the first time codicological – i.e. order and sources of Daude’s section in Ms. C – as well as metrical, stylistic and musical data, on the basis of the notation present in Ms. W. The discussion leads to the hypothesis that the song might be the work of an author belonging to the group of Marcabru’s imitators and therefore relatively early (third quarter of the XIIth century, setting aside the isolated attribution to Daude de Pradas.

  10. 75 FR 16646 - Airworthiness Directives; Bombardier, Inc. Model BD-100-1A10 (Challenger 300) Airplanes

    Science.gov (United States)

    2010-04-02

    ... been an incident during a production flight test where the proximity-sensor electronic unit (PSEU... Jersey Avenue, SE., Washington, DC. FOR FURTHER INFORMATION CONTACT: Bruce Valentine, Aerospace Engineer, Avionics and Flight Test Branch, ANE-172, FAA, New York Aircraft Certification Office, 1600 Stewart Avenue...

  11. Regulation of neurotoxin production and sporulation by a Putative agrBD signaling system in proteolytic Clostridium botulinum.

    Science.gov (United States)

    Cooksley, Clare M; Davis, Ian J; Winzer, Klaus; Chan, Weng C; Peck, Michael W; Minton, Nigel P

    2010-07-01

    A significant number of genome sequences of Clostridium botulinum and related species have now been determined. In silico analysis of these data revealed the presence of two distinct agr loci (agr-1 and agr-2) in all group I strains, each encoding putative proteins with similarity to AgrB and AgrD of the well-studied Staphylococcus aureus agr quorum sensing system. In S. aureus, a small diffusible autoinducing peptide is generated from AgrD in a membrane-located processing event that requires AgrB. Here the characterization of both agr loci in the group I strain C. botulinum ATCC 3502 and of their homologues in a close relative, Clostridium sporogenes NCIMB 10696, is reported. In C. sporogenes NCIMB 10696, agr-1 and agr-2 appear to form transcriptional units that consist of agrB, agrD, and flanking genes of unknown function. Several of these flanking genes are conserved in Clostridium perfringens. In agreement with their proposed role in quorum sensing, both loci were maximally expressed during late-exponential-phase growth. Modulation of agrB expression in C. sporogenes was achieved using antisense RNA, whereas in C. botulinum, insertional agrD mutants were generated using ClosTron technology. In comparison to the wild-type strains, these strains exhibited drastically reduced sporulation and, for C. botulinum, also reduced production of neurotoxin, suggesting that both phenotypes are controlled by quorum sensing. Interestingly, while agr-1 appeared to control sporulation, agr-2 appeared to regulate neurotoxin formation.

  12. Subcloning and Assessment of the Expression of Synthetic Botulinum Neurotoxin Type B Binding Domain (BD/B

    Directory of Open Access Journals (Sweden)

    Majid Baradaran

    2016-07-01

    Full Text Available Background and Objectives: Botulism syndrome is caused by Clostridium botulinum neurotoxin. This neurotoxin has 7 serotypes, from A to G. The best way to prevent botulism syndrome caused by BoNT/B is immunization with recombinant binding domains of BoNT/B (due to containing sufficient epitopes to stimulate the immune system. In this study, the expression of the BoNT/B binding domain as a candidate vaccine, was investigated. Methods: At first, the sequence of the BoNT/B binding domain gene was obtained from NCBI website with accession number of EF028399.1. After codon optimization, the gene was synthesized in pUC18 vector. Then, the gene was subcloned in pET32a(+ expression vector that carries an ampicillin selection marker. PCR, enzymatic digestion, and sequencing were used to confirm subcloning accuracy, and E. coli BL21(DE3 was used for the expression analysis. The accuracy of protein expression was evaluated by electrophoresis and western blotting. Results: PCR reaction, enzymatic digestion, and sequencing confirmed that the gene of interest has been subcloned appropriately in the vector. The expression analysis by SDS-PAGE and subsequently western blotting, showed that the protein of interest is not expressed in the mentioned expression strain. Conclusion: Although the gene was successfully subcloned in pET32a(+ vector, no significant expression of the gene was observed.

  13. Inorganic chemistry. Vol. 2. Subgroup elements, lanthanoids, actinoids, transactinoids. 103. ed.; Anorganische Chemie. Bd. 2. Nebengruppenelemente, Lanthanoide, Actinoide, Transactinoide

    Energy Technology Data Exchange (ETDEWEB)

    Holleman, Arnold Frederik; Wiberg, Egon; Wiberg, Nils

    2017-06-01

    For decades, the ''Holleman/Wiberg '' has offered a comprehensive knowledge of inorganic and organometallic chemistry. With the 103rd edition, a new work has been created, which has been designed for the comprehensive preparation of the examination and as a reference book. This second volume comprises the parts C (''subgroups of the periodic system'', the ''d-block elements'') that of the outer transition elements (expansion of the second outermost electron shells) and in the part D (''lanthanides and actinoids''; f-block elements) of the inner transition elements (expansion of the third outermost electron shells). [German] Das ''Holleman/Wiberg'' bietet seit Jahrzehnten ein umfassendes Stoffwissen der anorganischen und metallorganischen Chemie. Mit der 103. Auflage ist nach umfangreicher Umgestaltung der Vorauflage ein neues Werk entstanden, das zur umfassenden Pruefungsvorbereitung und als Nachschlagewerk bestimmt ist. Dieser 2. Band fasst die Teile C (''Nebengruppen des Periodensystems''; ''d-Block-Elemente'') die der aeusseren Uebergangselemente (Ausbau der zweitaeussersten Elektronenschalen) und im Teil D (''Lanthanoide und Actinoide''; ''f-Block-Elemente) die der inneren Uebergangselemente (Ausbau der drittaeussersten Elektronenschalen) zusammen.

  14. Peire Vidal, “Molt m’es bon e bell” (BdT 364.29

    Directory of Open Access Journals (Sweden)

    Adriana Solimena

    2011-01-01

    Full Text Available The poem by Peire Vidal, “Molt m’es bon e bell”, has mainly been examined from the viewpoint of its versification and its belonging more or less justifiably to the ‘formal grammar of trobar’, but it has never been studied as a text. The obsessive repetition of the same rhyme-words has tended to conceal its poetic and narrative discourse. The present analysis will propose an interpretation that takes into account formal as well as textual aspects. Both metrical structure and poetic discourse iconically represent the passing of a measurable length of time: a period that corresponds to the time to be devoted to love’s service, or feudal service, that has never been studied in troubadour poetry. Thus we may speak of a song dedicated to the ‘time for love and for waiting’ as far as both the text and its metrical structure are concerned. It is also quite possible that the metrical structure alludes to the astronomical model of the rotation of the planets, thereby confirming the temporal interpretation of the poem.

  15. BMBF status seminar: Bodies of landfills. Vol. 1. Conference report; BMBF-Statusseminar: Deponiekoerper. Bd. 1. Tagungsband

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1995-12-31

    This conference report contains the lectures presented at the BMBF status seminar on the cooperative project ``Bodies of landfills``, which took place at Wuppertal on 25th and 26th April 1995. The cooperative project was started in autumn 1993 and studies the long-term behaviour of wastes deposited at landfills in general. Inorganic and municipal wastes are studied separately. (orig./SR) [Deutsch] Der vorliegende Tagungsband enthaelt die Vortraege des BMBF-Statusseminars zum Verbundvorhaben `Deponiekoerper` vom 25. und 26. April 1995 in Wuppertal. Das Verbundvorhaben `Deponiekoerper` wurde im Herbst 1993 begonnen und befasst sich ganz generell mit dem langfristigen Deponieverhalten von Abfaellen. Es ist unterteilt in die Untersuchung von anorganischen Abfaellen und von Siedlungsabfaellen. (orig./SR)

  16. Falquet de Romans, “Ma bella dompna, per vos dei esser gais” (BdT 156.8

    Directory of Open Access Journals (Sweden)

    Paolo Di Luca

    2010-08-01

    Full Text Available “Ma bella dompna per vos dei esser gais” by Falquet de Romans has been taken for a courtly song for a long time. However, the poem’s metrical form is derived directly from that of the epic, as illustrated by the use of monorhymed ‘décasyllabes’ with non-systematic epic caesura and the presence of a ‘petit vers’ at the end of each stanza. The poem may thus be defined as stanzaic but not lyric because its versification is that of the chanson de geste and its music must be that of an epic chant. Moreover, its content reflects the rhetorical structure of the ‘salut d’amor’, an epistolary genre in which the lover sends a letter to his lady asking her to respond to his love. Thus, “Ma bella dompna” should be considered a formal hybrid between ‘salut d’amor’ and ‘chanson de geste’; in this sense it is to be compared to those few compositions of an epistolary nature that employ epic form, such as Raimbaut de Vaqueiras’ famous letter to the Marquis Boniface of Monferrato, which is probably the prototype of this poetic experiment, along with two pairs of ‘laisses’ exchanged between Gui de Cavaillon and Bertran Folco d’Avignon.

  17. Arnaut Daniel, “D’autra guiza e d’autra razo” (BdT 29.7

    Directory of Open Access Journals (Sweden)

    Gianluca Valenti

    2012-09-01

    Full Text Available This paper will focus on some specific aspects of Arnaut Daniel’s “D’autra guiza e d’autra razo” which, despite its success in its day and age (some verses were reused by Petrarch in the opening sonnet of the “RVF”, has received little critical attention in modern times. In particular, I will examine the incipit (whose alterity with respect to the rest of the Occitan lyric tradition points to an explicit declaration of intent on the part of the author, the lack of a tornada and, finally, the possibility that Arnaut Daniel was influenced by the section in the “Rhetorica ad Herennium” devoted to mnemonic technique. Moreover, the hypothesis that material concerning the art of memory has been used here helps to explain some particularly problematic textual loci, such as ll. 5-7 and 34.

  18. Wissenschaftlicher Briefwechsel mit Bohr, Einstein, Heisenberg, u.a., Bd.4, Teil 4 A : 1957 ; B : 1958

    CERN Document Server

    Pauli, Wolfgang Ernst Friederich

    2005-01-01

    Mit dem Druck von Wolfgang Paulis Briefwechsel aus seinen letzten beiden Lebensjahren wird eine großangelegte Edition der gesamten wissenschaftlichen Korrespondenz eines der bedeutendsten theoretischen Physiker des 20. Jahrhunderts abgeschlossen, der an der Entwicklung der wichtigsten physikalischen Ideen und Theorien, insbesondere an der Relativitätstheorie und Quantentheorie sowie deren weiteren Ausbau zu einer Feld- und Elementarteilchentheorie, teilgenommen hat. Der vorliegende besonders umfangreiche Band mit 711 Briefen behandelt die durch Wu, Telegdi, Lederman u.a. bei den schwachen Wech

  19. Salt Lake City Area Integrated Projects electric power marketing final environmental impact statement. Volume 4: Appendixes B-D

    International Nuclear Information System (INIS)

    1996-01-01

    The Colorado River Storage Project Customer Office of the Western Area Power Administration (Western) markets electricity produced at hydroelectric facilities operated by the Bureau of Reclamation. The facilities are known collectively as the Salt Lake City Area Integrated Projects (SLCA/IP) and include dams equipped for power generation on the Colorado, Green, Gunnison, and Rio Grande rivers and on Plateau Creek in Arizona, Colorado, Utah, Wyoming, and New Mexico. Of these facilities, only the Glen Canyon Unit, the Flaming Gorge Unit, and the Aspinall Unit (which includes Blue Mesa, Morrow Point, and Crystal dams) are influenced by Western power scheduling and transmission decisions. The environmental impact statement (EIS) alternatives, called commitment-level alternatives, reflect combinations of capacity and energy that would feasibly and reasonably fulfill Western's firm power marketing responsibilities, needs, and statutory obligations. The viability of these alternatives relates directly to the combination of generation capability of the SLCA/IP with energy purchases and interchange. The economic and natural resource assessments in this EIS include an analysis of commitment-level alternatives. Impacts of the no-action alternative are also assessed. Supply options, which include combinations of electrical power purchases and hydropower operational scenarios reflecting different operations of the dams, are also assessed. The EIS evaluates the impacts of these scenarios relative to socioeconomics, air resources, water resources, ecological resources, cultural resources, land use, recreation, and visual resources. Western has identified commitment-level alternative 1, the Post-1989 commitment level, as its preferred alternative. The impact evaluations indicate that this commitment level is also the environmentally preferred alter native

  20. Do Comorbid Anxiety Disorders Moderate the Effects of Psychotherapy for Bipolar Disorder? Results From STEP-BD

    Science.gov (United States)

    Deckersbach, Thilo; Peters, Amy T.; Sylvia, Louisa; Urdahl, Anna; Magalhães, Pedro V.S.; Otto, Michael W.; Frank, Ellen; Miklowitz, David J.; Berk, Michael; Kinrys, Gustavo; Nierenberg, Andrew

    2013-01-01

    Objective At least 50% of individuals with bipolar disorder have a lifetime anxiety disorder. Individuals with both bipolar disorder and a co-occurring anxiety disorder experience longer illness duration, greater illness severity, and poorer treatment response. The study explored whether comorbid lifetime anxiety in bipolar patients moderates psychotherapy treatment outcome. Method In the Systematic Treatment Enhancement Program randomized controlled trial of psychotherapy for bipolar depression, participants received up to 30 sessions of intensive psychotherapy (family-focused therapy, interpersonal and social rhythm therapy, or cognitive-behavioral therapy) or collaborative care, a three-session comparison treatment, plus pharmacotherapy. Using the number needed to treat, we computed effect sizes to analyze the relationship between lifetime anxiety disorders and rates of recovery across treatment groups after 1 year. Results A total of 269 patients (113 women) with a comorbid lifetime anxiety disorder (N=177) or without a comorbid lifetime anxiety disorder (N=92) were included in the analysis. Participants with a lifetime anxiety disorder were more likely to recover with psychotherapy than with collaborative care (66% compared with 49% recovered over 1 year; number needed to treat=5.88, small to medium effect). For patients without a lifetime anxiety disorder, there was no difference between rates of recovery in psychotherapy compared with collaborative care (64% compared with 62% recovered; number needed to treat=50, small effect). Participants with one lifetime anxiety disorder were likely to benefit from intensive psychotherapy compared with collaborative care (84% compared with 53% recovered; number needed to treat=3.22, medium to large effect), whereas patients with multiple anxiety disorders exhibited no difference in response to the two treatments (54% compared with 46% recovered; number needed to treat=12.5, small effect). Conclusions Depressed patients with bipolar disorder and comorbid anxiety may be in particular need of additional psychotherapy for treating acute depression. These results need to be replicated in studies that stratify bipolar patients to treatments based on their anxiety comorbidity status. PMID:24077657

  1. International scientific conference biogas science 2009. Vol. 1. Lectures; Internationale Wissenschaftstagung Biogas Science 2009. Bd. 1. Vortraege

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    2009-12-15

    Within the international conference of the Bavarian State Research Center for Agriculture (Munich, Federal Republic of Germany) at 2nd to 4th December, 2009, in Erding (Federal Republic of Germany), the following lectures were held: (1) Significance of the sector biogas within the scope of renewable energies (P. Schuesseler); (2) Anaerobic digestion, a superior renewable energy degradation method (G. Lettinga); (3) Trends of the biogas technology - Challenges for the practice (J. Pellmeyer); (4) Extensification of cultivation procedures for the production of biogas substrates (K. Deiglmayer et al.); (5) Approaches for the optimization of crop rotations for biogas plants at Bavarian conditions of cultivation (E. Sticksel et al.); (6) Development and comparison of site specific production systems for energy crops (Ch. Strauss et al.); (7) Which type of maize is useful for the production of biogas? (B. Eder et al.); (8) Fermentation of interim fruits, food stocks and residues of harvest: Review on the possibilities of power generation and avoidance of direct and indirect emissions of climatic gases (W. Stinner et al.); (9) Optimization of anaerobic fermentation by means of mineral additives (H. Heuwinkel et al.); (10) The accuracy of the measurement of gas yields of substrates using the batch method (H. Heuwinkel et al.); (11) Combined mechanical-enzymatic pre-treatment of an improved digestion of substrates during the fermentation of renewable raw materials (D. Schiedr et al.); (12) Anaerobic semi-continuous co-digestion of dairy cattle manure and agricultural residues: Effect of operational parameters (E. Alkaya et al.); (13) Do hydrolytic enzymes enhance methane formation of agricultural feedstock? (T. Suarez Quinones et al.); (14) DAUMEN-Energy ''Design fo Separation and Augmented Methanisation of Fibres Substrates - Contribution to sustainable biogas production'' (P. Stopp et al.); (15) Continuous two-phase solid-state anaerobic digestion: Model-based optimisation (J. Mumme et al.); (16) Investigations according to a comparison of material and energy flows of biogas plants for the fermentation of renewable raw materials (V. Aschmann et al.); (17) Problem of emissions and energy efficiency of biogas operated cogeneration plants during the lifetime (T. Lehmann); (18) Biogas plant construction - the digestion is decisive, new results according to bioextrusion (K.D.N. Weerasinghe et al.); (19) Appropriate bio gas generators for resource poor farmers in Sri Lanka to meet home energy and organic fertilizer needs (R. Kissel et al.); (20) Degree of utilization and causes for yield reduction at biogas plants of different design (R. Kissel et al.); (21) Monitoring and assessment of three biogas plants in Italy (S. Piccinini et al.).

  2. Peire Bremon Ricas Novas, “Rics pres, ferms e sobeirans” (BdT 330.15a

    Directory of Open Access Journals (Sweden)

    Paolo Di Luca

    2008-03-01

    Full Text Available This article provides a new critical edition and a commentary of Peire Bremon Ricas Novas’s “Rics pres, ferms e sobeirans”, a courtly love song composed between 1228 and 1257 and dedicated to Audiart del Baux. Built as a eulogy of the lady, the song focuses on the central theme of the moral and material ‘ricor’ (richness of the latter. The complexity of the metrical form, which displays a systematic use of the technique of ‘rim derivatiu’, is paralleled by the semantic obscurity of a number of verses and hapaxes, all discussed in the commentary. Stanzas III and IV show echoes of Jaufre Rudel’s “amor de lonh”, since the lover-poet declares that the distance and the ethnical difference between himself and the lady are abolished by the strength of his feelings. The use of ethnonyms in stanza IV is closely examined: the lover-poet reveals that he loves a Castilian lady who looks like a ‘Serrana’ (the name of an Iberian population, admitting that he would like her even if she were Catalan or Syrian. These references to the lady’s ethnical origins are puzzling: they can be read as a calembour with burlesque overtones, as well as a climax aiming to define the real provenance of the lady or as a rhetorical device to underline that courtly love does not know any kind of boundary.

  3. Search for the rare decays Bs->mu+mu- and Bd->mu+mu- with the LHCb experiment

    CERN Multimedia

    CERN. Geneva

    2011-01-01

    Decays of the B0 and B0s mesons into two muons are extremely rare in the Standard Model as they occur only via helicity suppressed loop diagrams. Their amplitudes can be significantly different in many New Physics models, especially with an extended Higgs sector. Therefore, the search for these decays provides a sensitive probe of physics beyond the Standard Model. A search for the decays B0s ->mu+mu- and B0 ->mu+mu- is performed with about 37 pb-1 of pp collisions at sqrt(s) = 7TeV collected by the LHCb experiment at the Large Hadron Collider at CERN. The analysis relies mostly on control samples with minimal use of the simulation. The observed numbers of events are consistent with the background expectations. The resulting upper limits on the branching ratios are B(B0s->mu+mu-) < 56x10-9 and B(B0->mu+mu-) < 15x10-9 at 95% confidence level. The analysis is presented and prospects are also given for the coming run.

  4. Do comorbid anxiety disorders moderate the effects of psychotherapy for bipolar disorder? Results from STEP-BD.

    Science.gov (United States)

    Deckersbach, Thilo; Peters, Amy T; Sylvia, Louisa; Urdahl, Anna; Magalhães, Pedro V S; Otto, Michael W; Frank, Ellen; Miklowitz, David J; Berk, Michael; Kinrys, Gustavo; Nierenberg, Andrew

    2014-02-01

    At least 50% of individuals with bipolar disorder have a lifetime anxiety disorder. Individuals with both bipolar disorder and a co-occurring anxiety disorder experience longer illness duration, greater illness severity, and poorer treatment response. The study explored whether comorbid lifetime anxiety in bipolar patients moderates psychotherapy treatment outcome. In the Systematic Treatment Enhancement Program randomized controlled trial of psychotherapy for bipolar depression, participants received up to 30 sessions of intensive psychotherapy (family-focused therapy, interpersonal and social rhythm therapy, or cognitive-behavioral therapy) or collaborative care, a three-session comparison treatment, plus pharmacotherapy. Using the number needed to treat, we computed effect sizes to analyze the relationship between lifetime anxiety disorders and rates of recovery across treatment groups after 1 year. A total of 269 patients (113 women) with a comorbid lifetime anxiety disorder (N=177) or without a comorbid lifetime anxiety disorder (N=92) were included in the analysis. Participants with a lifetime anxiety disorder were more likely to recover with psychotherapy than with collaborative care (66% compared with 49% recovered over 1 year; number needed to treat=5.88, small to medium effect). For patients without a lifetime anxiety disorder, there was no difference between rates of recovery in psychotherapy compared with collaborative care (64% compared with 62% recovered; number needed to treat=50, small effect). Participants with one lifetime anxiety disorder were likely to benefit from intensive psychotherapy compared with collaborative care (84% compared with 53% recovered; number needed to treat=3.22, medium to large effect), whereas patients with multiple anxiety disorders exhibited no difference in response to the two treatments (54% compared with 46% recovered; number needed to treat=12.5, small effect). Depressed patients with bipolar disorder and comorbid anxiety may be in particular need of additional psychotherapy for treating acute depression. These results need to be replicated in studies that stratify bipolar patients to treatments based on their anxiety comorbidity status.

  5. Inclusive decays of the B meson and possible life-time difference between Bd0 and B± mesons

    International Nuclear Information System (INIS)

    Tanimoto, Morimitsu

    1992-01-01

    We study branching ratios of the inclusive semileptonic decay and the inclusive anti ccanti s decay of the B meson in the spectator model, focusing on the life-time difference between B d 0 and B + mesons. In the case of τsub(B ± )/τsub(B d 0 )=1, it is impossible to get the branching ratio below 12% for B→eνX without going over 20% for B→anti ccanti s, which is unfavored by the inclusive K - decay of the B meson. It is found that the sizable life-time difference leads to the reasonable inclusive semileptonic decay rate and the inclusive anti ccanti s decay rate. (orig.)

  6. Salt Lake City Area Integrated Projects Electric Power Marketing. Draft environmental impact statement: Volume 4, Appendixes B-D

    Energy Technology Data Exchange (ETDEWEB)

    1994-02-01

    The Salt Lake City Area Office of the Western Area Power Administration (Western) markets electricity produced at hydroelectric facilities operated by the Bureau of Reclamation. The facilities are known collectively as the Salt Lake City Area Integrated Projects (SLCA/IP) and include dams equipped for power generation on the Green, Gunnison, Rio Grande, and Colorado rivers and on Deer and Plateau creeks in the states of Wyoming, Utah, Colorado, Arizona, and New Mexico. Of these facilities, only the Glen Canyon Unit, the Flaming Gorge Unit, and the Aspinall Unit (which includes Blue Mesa, Morrow Point, and Crystal dams;) are influenced by Western power scheduling and transmission decisions. The EIS alternatives, called commitment-level alternatives, reflect combinations of capacity and energy that would feasibly and reasonably fulfill Westerns firm power marketing responsibilities, needs, and statutory obligations. The viability of these alternatives relates directly to the combination of generation capability of the SLCA/IP with energy purchases and interchange. The economic and natural resource assessments in this environmental impact statement (EIS) include an analysis of commitment-level alternatives. Impacts of the no-action alternative are also assessed. Supply options, which include combinations of electrical power purchases and hydropower operational scenarios reflecting different operations of the dams, are also assessed. The EIS evaluates the impacts of these scenarios relative to socioeconomics, air resources, water resources, ecological resources, cultural resources, land use, recreation, and visual resources.

  7. 76 FR 64857 - Airworthiness Directives; Bombardier, Inc. Model BD-100-1A10 (Challenger 300) Airplanes

    Science.gov (United States)

    2011-10-19

    ...., Washington, DC 20590. Hand Delivery: U.S. Department of Transportation, Docket Operations, M-30, West... deformation was attributed to two (2) batches of raw material that did not meet the required tensile strength... . Follow the instructions for submitting comments. Fax: (202) 493-2251. Mail: U.S. Department of...

  8. Cross-sectional environmental study comparing two highly polluted areas in Germany (Bitterfeld and Hettstedt) with a control region; Umweltmedizinische Untersuchungen im Raum Bitterfeld, im Raum Hettstedt und einem Vergleichsgebiet 1992-2000. Bd. 1: Textband. Bd. 2: Publikationen. Bd. 3: Untersuchungsdokumente und Frageboegen. Abschlussbericht

    Energy Technology Data Exchange (ETDEWEB)

    Heinrich, J.; Frye, C.; Hoelscher, B.; Meyer, I.; Pitz, M.; Cyrys, J.; Schneller, H.; Wjst, M.; Wichmann, H.E.

    2001-10-01

    The aim of the environmental epidemiologic study was to determine possible negative effects on the health of children in the very polluted areas of Bitterfeld and Hettstedt in comparison to the less polluted areas of Anhalt-Zerbst (Eastern Germany). The time changes of the health parameters were recorded along with the running redevelopments during the time period of 6 years. The study design consisted of three repeated regional cross sectional studies in 1992/93, 1995/96 and 1998/99. In all, there was information of 7.611 questionnaires to be analysed (participation rate: 89%, 75% and 75%). Children living in the most polluted area of Hettstedt had a noticeable higher risk for non allergic respiratory diseases and symptoms compared to children living in the control area of Anhalt-Zerbst. During the time of the examinations in 1992 till 1999 a clear statistically significant decrease in the prevalences of these restrictions of health could be shown. Children without indoor pollutants in their homes profited most by the improvement of ambient air quality. The better lung function (FVC, FEV{sub 1}) between 1992 and 1999 underlines the improvement of the respiratory health. Children living in both polluted ares have allergies more often (physician's diagnosis, symptoms, allergy specific antibodies). The incidence of asthma, the bronchial hyperreactivity and atopic exzema increased, the prevalence of rhinitis and allergic sensitization did not increase. The body burden with lead and cadmium was higher in children living in polluted areas, but it decreased during the period of observation. In 1997, however, the lead concentration in blood increased a little, parallel to the higher lead concentration in settled dust in Hettstedt at that time. (orig.) [German] Ziel der umweltepidemiologischen Studie war es, moegliche gesundheitliche Beeitraechtigungen von Kindern in den Belastungsgebieten Bitterfeld und Hettstedt i. Vgl. zu dem wenig belasteten Gebiet Anhalt-Zerbst zu ermitteln. Darueber hinaus wurden die zeitlichen Veraenderungen der Gesundheitsparameter begleitend zu den laufenden Sanierungsmassnahmen ueber den Zeitraum von 6 Jahren erfasst. Das Studiendesign bestand aus 3 wiederholten regionalen Querschnittsuntersuchungen in den Jahren 1992/93, 1995/96 und 1998/99. Insgesamt lagen Informationen von 7611 Frageboegen zur Auswertung vor (Beteiligungsrate: 89%, 75% bzw. 75%). Fuer die Belastungsregion Hettstedt waren deutlich hoehere Risiken fuer nicht allergische respiratorische Erkrankungen und Symptome im Vergleich zu Kindern des Kontrollgebietes Anhalt-Zerbst nachweisbar. Waehrend des Untersuchungszeitraumes 1992-1999 zeigte sich eine deutlich statistisch signifikante Abnahme der Praevalenz dieser gesundheitlichen Einschraenkungen, Kinder ohne Exposition mit Innenraumschadstoffen im haeuslichen Bereich profitieren von der Verbesserung der Aussenluftbelastung am meisten. Fuer die Verbesserung der Atemwegsgesundheit sprachen auch bessere Lungenfunktionswerte (FVC, FEV{sub 1}) im Laufe des Beobachtungszeitraumes 1992-1999. Kinder aus den beiden Belastungsregionen hatten haeufiger Allergien (Arztdiagnose, Symptome, allergenspezifischer Antikoerper-Nachweis). Die Haeufigkeit des Asthmas, der bronchialen Hyperreaktivitaet und der Neurodermitis nahm zu; die Praevalenz des Heuschnupfens und der allergischen Sensibilisierung nicht. Die korporale Belastung mit Blei und Cadmium war bei Kindern in den belasteten Regionen erhoeht, nahm aber im Verlauf des Beobachtungszeitraumes ab. Allerdings folgten gestiegenen Bleigehalten im Sedimentationsstaub in Hettstedt im Jahre 1997 leicht gestiegene Blutbleikonzentrationen. (orig.)

  9. Optical spectrometer for an electron-probe microanalyzer

    International Nuclear Information System (INIS)

    Zamoryanskaya, M.V.; Zamoryanskij, A.N.; Vajnshenker, I.A.

    1987-01-01

    Optical spectrometer for the ''Kamebax'' electron-probe microanalyzer permitting to carry out cathodoluminescence analysis together with X-ray diffraction analysis of a sample microvolume, is described. The use of the optical spectrometer in certain cases permits to increase the sensitivity of microanalysis by 2-3 orders, to determine the valency of luminescenting impurities, to study structural defects of microvolumes. The optical spectrometer has the resolution not worse than 0.1 nm over the whole visible region of spectrum (35-750 nm). The spectrometer is used for the study of cathodoluminescence spectra of mineral microvolumes when solving certain problems of technological mineralogy

  10. Utilizando las Matemáticas para resolver problemas de Acústica de Salas

    Directory of Open Access Journals (Sweden)

    Anna Vidal Meló

    2014-03-01

    Full Text Available En este artículo se muestra cómo un alumno puede abordar problemas de acústica de salas ya en primer curso de Grado, con el soporte de las asignaturas de Matemáticas. De este modo, el alumno, encuentra una aplicabilidad directa de los conociminetos adquiridos en asignaturas en asignaturas de Matemáticas en su futuro entorno laboral. Este proyecto se ubica en el Grado de Ingenieria de Sistemas de Telecomunicación, Sonido e Imagn de la Escula Politécnica Superior de Gandia de la Universidad Politécnica de Valéncia.

  11. Sound Database of Marine Animal Vocalizations Structure and Operations.

    Science.gov (United States)

    1992-08-01

    Lacdp~de) 1804 BD8B Peponocephala electra (Gray) 1846 BD10A Sotalia borneensis Lydekker 1901 BD12A Sotalia brasiliensis Van Beneden 1875 BD12C Sotalia ...fluviatilis (Gervais) 1855 BD12B Sotalia quianensis Van Beneden 1864 BD12D Sousa chinensis (Osbeck) 1765 BD13A Sousa plumbea (Cuvier) 1829 BD13 B Sousa...Lissodelphis borealis BD8A South. rt. whale dolphin -- Lissodelphis peronii BD8B -- Peponocephala electra BD1OA Borneo dolphin -- Sotalia borneensis BD12A

  12. 13 CFR 124.112 - What criteria must a business meet to remain eligible to participate in the 8(a) BD program?

    Science.gov (United States)

    2010-01-01

    ... status regarding the transfer of assets for less than fair market value to any immediate family member... the difference between the fair market value of the asset transferred and the value received by the... adversely affect its program eligibility, especially economic disadvantage and ownership and control. Any...

  13. Medizinisches Institut fuer Umwelthygiene. Annual report 1996/97. Vol. 29; Medizinisches Institut fuer Umwelthygiene. Jahresbericht 1996/97. Bd. 29

    Energy Technology Data Exchange (ETDEWEB)

    Beyen, K. [comp.

    1997-12-31

    the annual report 1996/1997 of the Medizinisches Institut fuer Umwelthygiene reports on the institute`s research activities in 1996. Due to raise governmental and federal state funds, the reorganization is still undergoing. The individual task forces report about their progresses in research. A comprehensive report deals with the carcinogenicity of xenoestrogens in the environment. They are mainly ecotoxilogical and hardly toxicological for human beings. The book contains further several abstracts of publications and congress papers. An author index and a subject index are appended.

  14. A roadmap to control penguin effects in B-d(0) -> J/psi K-S(0) and B-s(0) -> J/psi phi

    NARCIS (Netherlands)

    De Bruyn, K.; Fleischer, R.

    2015-01-01

    Abstract: Measurements of CP violation in Bd 0 → J/ψKS 0 and Bs 0 → J/ψϕ decays play key roles in testing the quark-flavour sector of the Standard Model. The theoretical interpretation of the corresponding observables is limited by uncertainties from doubly

  15. Shaft barriers for underground waste repositories in abandoned salt mines. Preparatory project. Vol. 2. Annex; Schachtverschluesse fuer untertaegige Deponien in Salzbergwerken. Vorprojekt. Bd. 2. Anhang

    Energy Technology Data Exchange (ETDEWEB)

    Schmidt, M.W. [GSF - Forschungszentrum fuer Umwelt und Gesundheit, Remlingen (Germany). Forschungsbergwerk Asse; Fruth, R. [GSF - Forschungszentrum fuer Umwelt und Gesundheit, Remlingen (Germany). Forschungsbergwerk Asse; Stockmann, N. [GSF - Forschungszentrum fuer Umwelt und Gesundheit, Remlingen (Germany). Forschungsbergwerk Asse; Birthler, H. [Gesellschaft fuer Anlagen- und Reaktorsicherheit mbH Greece, Braunschweig (Germany). Fachbereich Endlagersicherheitsforschung; Boese, B. [Gesellschaft fuer Anlagen- und Reaktorsicherheit mbH Greece, Braunschweig (Germany). Fachbereich Endlagersicherheitsforschung; Storck, R. [Gesellschaft fuer Anlagen- und Reaktorsicherheit mbH Greece, Braunschweig (Germany). Fachbereich Endlagersicherheitsforschung; Sitz, P. [Technische Univ. Bergakademie Freiberg (Germany). Inst. fuer Bergbau; Krausse, A. [Technische Univ. Bergakademie Freiberg (Germany). Inst. fuer Bergbau; Eulenberger, K.H. [Technische Univ. Bergakademie Freiberg (Germany). Inst. fuer Bergbau; Schleinig, J.P. [Technische Univ. Bergakademie Freiberg (Germany). Inst. fuer Bergbau; Duddeck, H. [Technische Univ. Braunschweig (Germany). Inst. fuer Statik; Ahrens, H. [Technische Univ. Braunschweig (Germany). Inst. fuer Statik; Menzel, W. [IfG Inst. fuer Gebirgsmechanik GmbH, Leipzig (Germany); Salzer, K. [IfG Inst. fuer Gebirgsmechanik GmbH, Leipzig (Germany); Minkley, W. [IfG Inst. fuer Gebirgsmechanik GmbH, Leipzig (Germany); Busche, H. [Kali und Salz AG, Kassel (Germany); Lindloff, U. [Kali und Salz AG, Kassel (Germany); Gierenz, S. [Kali und Salz AG, Kassel (Germany)

    1995-12-31

    This preparatory study, ``Shaft barriers for underground waste repositories in abandoned salt mines``, was to demonstrate the current scientific and technological know-how based on a comprehensive analysis of the barrier design concepts or established structures intended to serve as barriers in abandoned shafts of potash or rock salt mines. Taking as a basis the current regulatory regime and the available know-how on barrier systems in underground waste repositories taken into account so far in plan approval and licensing procedures, as well as the state of the art, concepts are developed as technical guides and models of barrier systems for mine shafts. The required research work for the various components of a shaft barrier is shown, particularly relating to aspects such as materials suitability and technical realisation. Immediate demand for research activities is shown with regard to the available potentials of mathematic and numeric geotechnical and hydrogeologic calculation models required in order to give proof of the long-term workability of shaft barriers. The authors are of the opinion that the following activities are required in order to meet the research demand quantified: (1) Laboratory and bench-scale experiments for determination of the efficiency of various sealing materials and backfilling materials, and (2) an in-situ, large-scale experiment in order to demonstrate the suitability of low-consolidation shotter columns, or constructional technologies. The laboratory work can be done in the facilities of the GSF research mine of Asse, the Freiburg Mining Academy, and the Institut fuer Gebirgsmechanik in Leipzig, and the benchmark experiments also at the Asse site in the research mine. The Kali und Salz Beteiligungs AG is prepared to offer its mine Salzdetfurth II as a site for the large-scale experiment. (orig.) [Deutsch] Im Rahmen der Vorstudie ``Schachtverschluesse fuer Untertagedeponien in Salzbergwerken`` wird ausgehend von einer umfangreichen Analyse der bisher realisierten bzw. konzipierten Verschlussmassnahmen von Schaechten des Kali- und Steinsalzbergbaues der gegenwaertige Stand von Wissenschaft und Technik abgeleitet. Auf der Grundlage der vorhandenen gesetzlichen Regelwerke und des mit zu beruecksichtigenden Kenntnisstandes zu Verschlusssystemen fuer UTD in bisher durchgefuehrten Planfeststellungs- und Genehmigungsverfahren sowie des Standes von Wissenschaft und Technik wurden Konzepte fuer die technischen Loesungen von Verschlusssystemen fuer Schaechte entwickelt. Der sich daraus ableitende Forschungsbedarf zu den einzelnen Elementen eines Schachtverschlusses, insbesondere unter dem Aspekt der Materialauswahl und der technischen Realisierbarkeit, wird ausgewiesen. Im Hinblick auf den Nachweis der langzeitlichen Funktionsfaehigkeit von Schachtverschluessen werden die vorhandenen Moeglichkeiten mathematisch-numerischer geotechnischer und hydrogeologischer Berechnungsmodelle dargestellt. Dabei besteht ein unmittelbarer Forschungsbedarf. Die Verfasser sind der Auffassung, dass zur Abarbeitung des ermittelten Forschungsbedarfes 1. Labor - und Technikumsversuche zur Wirksamkeit verschiedener Dichtmaterialien und Widerlagerbaustoffe sowie 2. ein In-situ-Grossversuch zur Klaerung der Einsatzmoeglichkeiten setzungsarmer Schottersaeulen und Einbautechnologien der Verschlussbauwerke erforderlich sind. Fuer die Laboruntersuchungen stehen die labortechnischen Einrichtungen des GSF-Forschungsbergwerkes Asse, der Bergakademie Freiberg und des Institutes fuer Gebirgsmechanik, Leipzig, sowie fuer die Technikumsversuche das Forschungsbergwerk Asse zur Verfuegung. Als Versuchsort fuer den In-situ-Grossversuch bietet die Kali und Salz Beteiligungs AG den Schacht Salzdetfurth II an. (orig.)

  16. Concepts of ecological construction. Seminar volume of the Central Information Bureau for Environmental Consulting in Bavaria. Vol. 6; Oekologisches Bauen. Seminarband der Zentralen Informationsstelle Umweltberatung Bayern. Bd. 6

    Energy Technology Data Exchange (ETDEWEB)

    Kohmanns, B. [comp.; Koller, U. [comp.; Klemmer, A. [comp.; Haury, H.J. [comp.

    1995-09-01

    On 11 May 1995 the Central Information Bureau for Environmental Consulting in Bavaria held its sixth seminar. The seminar was dedicated to the subject `Concepts of Ecological Construction`. It attracted some 80 representatives of environmental consulting offices and other authorities assigned to environmental consulting tasks. Leading scientists from research institutions and the administration presented the current state of research into the ecological aspects of construction and planning. The lecturers dealt with diverse topics ranging from building site selection over questions on energy to aspects of building materials and illustrated the new possibilities of environmentally adapted construction by reference to practical examples. (orig./HW) [Deutsch] Am 11. Mai 1995 veranstaltete die Zentrale Informationsstelle, Umweltberatung Bayern ihr sechstes Seminar. Thema der Seminarveranstaltung, an der rund 80 Vertreterinnen und Vertreter von Umweltberatungsstellen und anderen mit Umweltberatung beauftragten Behoerden teilnahmen, war `Oekologisches Bauen`. Fuehrende Wissenschaftler und Wissenschaftlerinnen aus Forschung und Behoerden stellten den aktuellen Stand der Forschung oekologischer Aspekte des Bauens und Planens dar. Beginnend mit Kriterien fuer die Standortsuche von Bauvorhaben ueber Energiefragen und Aspekte oekologischer Baustoffe fuehrten die Referentinnen und Referenten schliesslich auch an praktischen Beispielen neue Moeglichkeiten des umweltgerechten Bauens vor. (orig./HW)

  17. Joint-research project. The world of renewable energies: powerado. Final report. Part 2; Verbundforschungsprojekt. Erlebniswelt erneuerbare Energien: powerado. Endbericht. Bd. 2

    Energy Technology Data Exchange (ETDEWEB)

    Scharp, Michael (ed.)

    2009-02-15

    The objective of the research project 'The world of renewable energies: Powerado' was to improve communication aimed at conveying renewable energies to children. In order to achieve his aim, materials for different age groups and multipliers have been developed. These helped determining successful strategies for communicating renewable energies. There were several reasons for the need of such a project. It may be the case that renewable energies have been included into the syllabus of primary schools, but they still have no prominent role at schools. Additionally, the training of multipliers for renewable energies shows severe deficits. The project consisted of ten interconnected modules which explicitly are described. Overall, the powerado project was a huge success. 58,000 estimated multipliers, children, adolescents and persons generally being interested in renewable energies have been reached by the project and its modules. So the powerado project achieved its main objective improving communication of renewable energies.

  18. Sail d’Escola, “Gran esfortz fai qui chanta ni·s deporta” (BdT 430.1

    Directory of Open Access Journals (Sweden)

    Oriana Scarpati

    2009-12-01

    Full Text Available The only extant poem by Sail d’Escola, “Gran esfortz fai qui chanta ni·s deporta”, must have been quite successful with the troubadours since its melody was reused several times. Without a doubt its interest also lies in the fact that it mentions another (or others? poem in which the troubadour has recourse to the ‘mala canso’, believing, quite rightly, that he may offend the lady who proved to be a bad ‘amigua’. The text is ambiguous: it appears to be a love song asking for forgiveness to a lady who had previously been treated badly, but it also contains hidden threats of abuse, should the lady not show herself to be once more well-disposed towards her lover. This paper will propose a new interpretation of the simile in ll. 5-7, as well as some corrections to the previous edition (Chabaneau.

  19. Energy policy and environmental policy of the Czech Republic. Vol. 1: Eastern enlargement of the EU; Energie- und Umweltpolitik der Tschechischen Republik. Bd. 1: Osterweiterung der Europaeischen Union

    Energy Technology Data Exchange (ETDEWEB)

    Brauch, H.G. [Arbeitsgruppe Friedensforschung und Europaeische Sicherheitspolitik (AFES), Mosbach (Germany)

    2002-01-01

    This report has been prepared as part of a bilateral German-Czech project on ''Energy and Environment in the Czech Republic'' that has been financed by the German Federal Ministry of Environment, Nature protection and Nuclear Safety. The project is focused on strengthening the cooperation between Germany and the Czech Republic in the field of energy and environment as well as on assisting the Czech Republic in its EU accession process. The project was launched by the German Federal Environmental Agency (UBA) and is managed by Gertec GmbH, an engineering company in Essen. Additional subcontractors and cooperating organisations included both German and Czech partners: ITUT, e.V., Leipzig, AFES-PRESS, Mosbach, the Czech Energy Agency - CEA Prague, SEVEn, the Energy Efficiency Center, o.p.s., Prague, the German-Czech Chamber of Commerce in Prague, the Euroregion Nisa, Liberec, and KSUE, o.p.s., Litvinov. The goal of this report is to provide brief but focused information for the German and Czech business community, for investors and decision makers both on the current situation and the development in 1990s in the area of energy and environment in the Czech Republic. This report consists of an Executive Summary, a detailed survey in part I with a detailed description of the energy sector and environment and in part II three regional studies focusing on North Bohemia, North Moravia, and Prague. These are supplemented by six appendices. As part of this project two additional studies were prepared by AFES-PRESS that focus - from a social science perspective - on the accession process of the Czech Republic: Enlargement of the European Union - Energy and Environment Policy of the Czech Republic (Volume 1), Liberalisation of the Energy Market for Electricity and Gas in the European Union: a Survey and Implications for the Czech Republic (Volume 3) More information on the whole project, the conducted studies and project partners can be found on internet www.uba-eecr.de or directly by contacting the project leader, the German Federal Environmental Agency, Umweltbundesamt, Dr.-Ing. Wolf-Dieter Glatzel, email: wolfdieter.glatzel rate at uba.de, or Dr. Peter Pichl, email: peter.pichl rate at uba.de. (orig.)

  20. Eco-balances. Seminar report of the Bavarian Central Information Office for Environmental Consulting; Oekobilanzen. Seminarband der Zentralen Informationsstelle Umweltberatung Bayern. Bd. 9

    Energy Technology Data Exchange (ETDEWEB)

    Kohmanns, B. [comp.; Koller, U. [comp.; Klemmer, A. [comp.; Haury, H.J. [comp.

    1997-02-01

    The ninth seminar of the Bavarian Central Information Office for Environmental Consulting was dedicated to the subject of `Life Cycle Assessment`. Leading scientists from research and public authorities discussed methodological approaches to the preparation of life cycle assessments and possibilities for consumers to influence these procedures. They also queried the benefit of life cycle assessments as a valuation instrument of environmental research. The present seminar report contains the lectures in full. (orig./SR) [Deutsch] Fuehrende Wissenschaftler und Wissenschaftlerinnen aus Forschung und Behoerden diskutierten methodische Ansaetze fuer die Erstellung von Oekobilanzen sowie Einflussmoeglichkeiten von Verbrauchern und hinterfragten den Nutzen von Oekobilanzen als Bewertungsinstrument in der Umweltforschung. Beispielhaft wurden einzelne Oekobilanzen vorgestellt und ihre Ergebnisse bewertet. Im vorliegenden Seminarband sind die Vortraege schriftlich wiedergegeben. (orig./SR)

  1. Search for $B_s \\to \\mu^+\\mu^-$ and $B_d \\to \\mu^+\\mu^-$ Decays with CDF II

    Energy Technology Data Exchange (ETDEWEB)

    Aaltonen, T.; /Helsinki Inst. of Phys.; Alvarez Gonzalez, B.; /Oviedo U. /Cantabria Inst. of Phys.; Amerio, S.; /INFN, Padua; Amidei, D.; /Michigan U.; Anastassov, A.; /Northwestern U.; Annovi, A.; /Frascati; Antos, J.; /Comenius U.; Apollinari, G.; /Fermilab; Appel, J.A.; /Fermilab; Apresyan, A.; /Purdue U.; Arisawa, T.; /Waseda U. /Dubna, JINR

    2011-07-01

    A search has been performed for B{sub s}{sup 0} {yields} {mu}{sup +}{mu}{sup -} and B{sup 0} {yields} {mu}{sup +}{mu}{sup -} decays using 7 fb{sup -1} of integrated luminosity collected by the CDF II detector at the Fermilab Tevatron collider. The observed number of B{sup 0} candidates is consistent with background-only expectations and yields an upper limit on the branching fraction of {Beta}(B{sup 0} {yields} {mu}{sup +}{mu}{sup -}) < 6.0 x 10{sup -9} at 95% confidence level. We observe an excess of B{sub s}{sup 0} candidates. The probability that the background processes alone could produce such an excess or larger is 0.27%. The probability that the combination of background and the expected standard model rate of B{sub s}{sup 0} {yields} {mu}{sup +}{mu}{sup -} could produce such an excess or larger is 1.9%. These data are used to determine {Beta}(B{sub s}{sup 0} {yields} {mu}{sup +}{mu}{sup -}) = (1.8{sub -0.9}{sup +1.1}) x 10{sup -8} and provide an upper limit of {Beta}(B{sub s}{sup 0} {yields} {mu}{sup +}{mu}{sup -}) < 4.0 x 10{sup -8} at 95% confidence level.

  2. anti Bd,s → D*d,sV and anti B*d,s → Dd,sV decays in QCD factorization and possible puzzles

    International Nuclear Information System (INIS)

    Chang, Qin; Chen, Ling-Xin; Zhang, Yun-Yun; Sun, Jun-Feng; Yang, Yue-Ling

    2016-01-01

    Motivated by the rapid development of heavy-flavor experiments, phenomenological studies of nonleptonic anti B d,s → D * d,s V and anti B * d,s → D d,s V (V = ρ, K*) decays are performed within the framework of QCD factorization. Relative to the previous work, the QCD corrections to the transverse amplitudes are evaluated at next-to-leading order. The theoretical predictions of the observables are updated. For the measured anti B d,s → D * d,s V decays, the tensions between theoretical results and experimental measurements, i.e. the ''R ds V puzzle'' and ''D*V (or R V/l anti ν l ) puzzle'', are presented after detailed analyses. For the anti B * d,s → D d,s V decays, they have relatively large branching fractions of the order >or similar O(10 -9 ) and are in the scope of Belle-II and LHCb experiments. Moreover, they also provide a way to crosscheck the possible puzzles mentioned above through the similar ratios R ds 'V and R ' V/l anti ν l . More refined experimental measurements and theoretical efforts are required to confirm or refute such two anomalies. (orig.)

  3. Energy saving in houses. Seminar of Zentrale Informationsstelle Umweltberatung Bayern, Vol. 19; Energiesparen rund ums Haus. Seminarband der Zentralen Informationsstelle Umweltberatung Bayern. Bd. 19

    Energy Technology Data Exchange (ETDEWEB)

    Stroh, K.; Behling, G; Koller, U.; Lattner, A. (eds.)

    2002-02-01

    Contents: Information on energy conservation and state funds, Energy management at communal level, eco-balance of power generation; The new Energy Conservation Ordinance; Energy conservation in domestic buildings; Low-consumption power supply systems; Potential savings resulting from consumption patterns; Eco-balances and preventive cost. [German] Referenten aus wissenschaftlichen und behoerdlichen Institutionen informierten ueber aktuelle Erkenntnisse zum Energiesparen in oeffentlichen und privaten Gebaeuden. Dabei wurden folgende Themen behandelt: - Informationen ueber Energiesparen und Foerderprogramme - Energiemanagement fuer Kommunen, Oekobilanz der Stromerzeugung - Die neue Energieeinsparverordnung - Energiesparen in Wohngebaeuden - Sparsame Energieversorgungssysteme - Verhaltensbedingte Einsparpotenziale - Oekobilanzen und Vermeidungskosten. (orig.)

  4. Solving the Big Data (BD) Problem in Advanced Manufacturing (Subcategory for work done at Georgia Tech. Study Process and Design Factors for Additive Manufacturing Improvement)

    Energy Technology Data Exchange (ETDEWEB)

    Clark, Brett W. [Sandia National Lab. (SNL-NM), Albuquerque, NM (United States); Diaz, Kimberly A. [Georgia Inst. of Technology, Atlanta, GA (United States); Ochiobi, Chinaza Darlene [Georgia Inst. of Technology, Atlanta, GA (United States); Paynabar, Kamran [Georgia Inst. of Technology, Atlanta, GA (United States)

    2015-09-01

    3D printing originally known as additive manufacturing is a process of making 3 dimensional solid objects from a CAD file. This ground breaking technology is widely used for industrial and biomedical purposes such as building objects, tools, body parts and cosmetics. An important benefit of 3D printing is the cost reduction and manufacturing flexibility; complex parts are built at the fraction of the price. However, layer by layer printing of complex shapes adds error due to the surface roughness. Any such error results in poor quality products with inaccurate dimensions. The main purpose of this research is to measure the amount of printing errors for parts with different geometric shapes and to analyze them for finding optimal printing settings to minimize the error. We use a Design of Experiments framework, and focus on studying parts with cone and ellipsoid shapes. We found that the orientation and the shape of geometric shapes have significant effect on the printing error. From our analysis, we also determined the optimal orientation that gives the least printing error.

  5. Development of high-speed high-performance engines in Friedrichshafen. Vols. 1 and 2. Die Entwicklung schnellaufender Hochleistungsmotoren in Friedrichshafen. Bd. 1 und 2

    Energy Technology Data Exchange (ETDEWEB)

    Zima, S.

    1984-01-01

    The publication abstracted traces and analyzes the development of high-performance combustion engines in Friedrichshafen over a period of 70 years. By way of introduction the author points out the peculiarity of combustion engines to be consisting in its quasi-negligible development and changes since its early days. Part one describes the chronological development of airplane engines, airship engines, motor vehicle and commercial vehicle engines, diesel engines and high-performance engines. The description is followed by a discussion of the requirements to be met by high-performance engines and a description of their development. The publication points out the design and construction of airplane engines as well as first operational results, increased performance, adaptability to operational conditions and the standardization of types. Moreover the author discusses the development of individual parts and functional components as well as the characteristics and features of the state of development. Part one of the thesis concludes with a discussion of general aspects of engine development. Volume 2 of the thesis presents a comprehensive set of diagrams, tables and graphs illustrating and elucidating the different sections contained in volume 1. The diagrams and tables refer to relevant technical publications dealing with the chronology of engine development, the nomenclature of Maybach-Motorenbau (MM) engines, Maybach-Mercedes-Benz (MMB) engines and Motoren- und Turbinen-Union Friedrichshafen (MTU) engines as well as production and employment data. Descriptions may be found of the major MM, MMB and MTU engines together with detailed sectional drawings, photographs, specifications and operational diagrams. Different sources may be referred to for engine performance data. Comprehensive references (journals, industrial reports) are annexed. (HWJ).

  6. Giraut de Borneil, “Quan lo fregz e·l glatz e la neus” (BdT 242.60

    Directory of Open Access Journals (Sweden)

    Pietro G. Beltrami

    2011-12-01

    Full Text Available This paper provides a critical edition, with a new hypothesis concerning two difficult loci, of “Quan lo fregz e·l glatz e la neus”, one of the most significant love songs by Giraut de Borneil. For l. 48 (according to the order of the stanzas in Kolsen’s edition which is confirmed here, I will argue that “gers”, present in nearly all the manuscripts and editions, but never explained satisfactorily and unique from the lexical viewpoint, is a ghost word. Thus I will suggest accepting the lesson of ms. B as a suitable, ancient conjecture: ‘of those who are inside (the beseiged castle and forced to surrender’ que an grans guerriers, ‘who have great enemies’. For l. 58 none of the solutions put forward so far are convincing, thus I will tentatively propose a new conjecture: the lover fears that his life will become plus breus... “que del quint dels quars”, ‘shorter that the fifth of the quarter (of the day’, that is, it will be cut off. This restores a rhetorical figure of repetition that marks the end of each stanza after the second and which has been lost in nearly all the manuscripts and editions. My reading of the text will underline its distinctive aspects: a large number of quite difficult similes, emphasis on the figure of the lover, a lack of the author intervention and of the sententiae and forms of argument that characterise this poet, a fast pace created by the syntactic and rhetorical structure. I will also examine all that may serve to place the text within a particular historical context, although despite the many hypotheses, the only sure element is that it was written for a courtly occasion in the presence of Richard the Lionheart.

  7. Shedding Light on the "Dark Side" of $B^0_d$--$\\bar{B^{0}_{d}}$ Mixing through $B_{d} \\to \\pi^{+}\\pi^{-}$, $K \\to \\pi\

    CERN Document Server

    Fleischer, Robert; Matias, J; Fleischer, Robert; Isidori, Gino; Matias, Joaquim

    2003-01-01

    In a wide class of NP models, which can be motivated through generic arguments and within SUSY, we obtain large contributions to $B^0_d$--$\\bar B^0_d$ mixing, but not to $\\Delta B=1$ processes. If we assume such a scenario, the solutions $\\phi_d\\sim 47^\\circ\\lor 133^\\circ$ for the $B^0_d$--$\\bar B^0_d$ mixing phase implied by $A_{CP}^{mix}(B_d\\to J/\\psi K_S)$ cannot be converted directly into a constraint in the $\\rho$--$\\eta$ plane. However, we may complement $\\phi_d$ with $|V_{ub}/V_{cb}|$ and the recently measured CP asymmetries in $B_d\\to\\pi^+ \\pi^-$ to determine the unitarity triangle, with its angles $\\alpha$, $\\beta$ and $\\gamma$. To this end, we have also to control penguin effects, which we do by means of the $B_d\\to\\pi^\\mp K^\\pm$ branching ratio. Interestingly, the present data show a perfectly consistent picture not only for the ``standard'' solution of $\\phi_d\\sim 47^\\circ$, but also for $\\phi_d\\sim 133^\\circ$. In the latter case, the preferred region for the apex of the unitarity triangle is in t...

  8. Multibeam collection for BD0601: Multibeam data collected aboard Bowditch from 2006-10-16 to 2006-11-11, Okinawa, Japan to Apra, Guam

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — This data set is part of a larger set of data called the Multibeam Bathymetry Database (MBBDB) where other similar data can be found at...

  9. The orbital elements and physical properties of the eclipsing binary BD+36 degrees 3317, a probable member of delta Lyrae cluster

    Czech Academy of Sciences Publication Activity Database

    Kiran, E.; Harmanec, P.; Degirmenci, O.L.; Wolf, M.; Nemravová, J.; Šlechta, Miroslav; Koubský, Pavel

    2016-01-01

    Roč. 587, March (2016), A127/1-A127/9 ISSN 0004-6361 Grant - others:GA ČR(CZ) GAP209/10/0715; GA(CZ) GA15-02112S Program:GA Institutional support: RVO:67985815 Keywords : binaries * eclipsing * fundamental parameters Subject RIV: BN - Astronomy , Celestial Mechanics, Astrophysics Impact factor: 4.378, year: 2014

  10. Synthesis and radioiodination of 1-(B-D-2-iodo-2-eoxyfuranoarabinosy1)-2-nitroimidazole (N-2-IAZA), a novel radio-tracer for tissue hypoxia imaging

    International Nuclear Information System (INIS)

    Beiki, D.; Weibe, L.I.; Kumar, P.

    2002-01-01

    Viable tumors cells that reside in hypoxic cellular environment are 3 times more resistant to ionizing radiation than oxygenated cells. A non-invasive approach to study the extent of hypoxia involves the use of radio-tracer that selectively accumulates in hypoxic cells and does not damage normal cells. Hypoxia-selective uptake of 5-a- [125 I] iodo azomycin arabinoside (5-a-IAZA) has been demonstrated in a number of patient with varying pathological disorders including cancer, diabetes, arthritis and peripheral vascular disease, making it the most widely studied hypoxia marker in clinical research. The primary alkyl iodide of 5-a-IAZA is much more susceptible to heterodendria than secondary iodides and the compound undergoes d iodination, which necessarily increases the radiation dose to the thyroid gland and also contributes to undesired background radioactivity in later time images 2. It is also known that 5-a- IAZA, is not transported by cellular nucleoside transporters 3, where as, many B-arabinosyl nucleosides are efficiently internalized by these transporters. The present study reports the synthesis of a novel iodo azomycin arabinoside (B-2-IAZA), which designed to be chemically more stable than 5-a-IAZA by reducing extent of deiodination and poli c cleavage of the nucleoside bond by introducing steric bulk near the site of hydrolysis to be a substrate for cellular trans-membrane transport. The previous method for the thesis of B - azomycin arabinoside involves direct coupling of benzylated sugar with thylin moiety. The disadvantages of this method are formation of a - anomers which is 5 times than B-Anomers and the low chemical yield. This investigation also describes the synthesis B- azomycin arabinoside by C-2, inversion of centrifugation of the corresponding B-nucleoside and the resulting change made it possible to obtain only one anomers (B-anomers) reasonable yield. Microwave-assisted radio halogenation of these compounds gave higher of relatively pure products in shorter time compare to the conventional heating method

  11. Radiation, fields and waves. Non-ionizing radiation in everyday life. Vol. 15. Seminar lectures; Strahlen, Felder und Wellen. Nichtionisierende Strahlung im taeglichen Umfeld. Bd. 15. Seminarband

    Energy Technology Data Exchange (ETDEWEB)

    Behling, G.; Koller, U.; Rauh, K.; Haury, H.J. [comps.

    1999-11-01

    Experts from science and administration informed the participants about recent results of scientific research and the applicable laws and regulations. Potential health hazards and recommended protective measures have been discussed. The publication presents the lectures held at the seminar. (orig./CB) [German] Fachleute aus Wissenschaft und von Behoerden informierten ueber aktuelle Erkenntnisse sowie das gesetzliche Regelwerk. Aus unterschiedlichen Blickwinkeln wurden moegliche gesundheitliche Risiken und vorgeschlagene Sicherheitsempfehlungen diskutiert. Der vorliegende Band enthaelt die ausgearbeiteten Vortraege. (orig./MG)

  12. 13 CFR 124.111 - Do Community Development Corporations (CDCs) have any special rules for applying to the 8(a) BD...

    Science.gov (United States)

    2010-01-01

    ... substantial unfair competitive advantage within an industry category. (d) A CDC cannot own 51% or more of... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false Do Community Development... Business Credit and Assistance SMALL BUSINESS ADMINISTRATION 8(a) BUSINESS DEVELOPMENT/SMALL DISADVANTAGED...

  13. Evaluation of direct inoculation of the BD PHOENIX system from positive BACTEC blood cultures for both Gram-positive cocci and Gram-negative rods

    NARCIS (Netherlands)

    J. Beuving (Judith); C.F. van der Donk (Christina); C.F. Linssen (Catharina F.); P. Wolffs (Petra); A. Verbon (Annelies)

    2011-01-01

    textabstractBackground: Rapid identification (ID) and antibiotic susceptibility testing (AST) of the causative micro-organism of bloodstream infections result in earlier targeting of antibiotic therapy. In order to obtain results of ID and AST up to 24 hours earlier, we evaluated the accuracy of

  14. Joan d’Albuzon ~ Nicolet de Turin, “En Nicolet, d’un sognie qu’ieu sognava” (BdT 265.2 = 310.1

    Directory of Open Access Journals (Sweden)

    Linda Paterson

    2008-06-01

    Full Text Available The article provides a commentary and a new critical edition of an Occitan tenso between two Italian troubadours, Joan d’Albuzon and Nicolet de Turin. The tenso presents a dream and its interpretation: Joan claims to have dreamt of a terrifying eagle flying through the air, accompanied by a huge ship of fire sailing across the land from Cologne. Nicolet in turn interprets the dream in terms of an emperor sweeping through Lombardy with a great army of German soldiers at his command, paid from his vast supply of treasure. Joan’s dream concludes with a vision of the eagle blowing out the fire, shining a great light over Montferrat, and settling in a high eyrie from which the whole world, now joyful, can be surveyed. Nicolet expounds this as the emperor’s desire for peace after vengeance, the Marquis of Montferrat’s submission, the emperor’s position of supreme command, and the prospect of appropriate rewards. The emperor is Frederick II Hohenstaufen and the author of the article proposes a new dating of the poem: it was probably composed in 1238 when the emperor, after his victory at the battle of Cortenuova in 1237 and subsequent subjection of several cities of the rebellious Lombard League, was arriving in Turin to receive the homage of Boniface II of Montferrat.

  15. Between legal counseling and administrative functions. Municipal commissioners for pollution abatement, and ecocounseling. Vol. 3; Zwischen Anwaltsfunktion und Verwaltungsaufgaben. Kommunale Umweltbeauftragte und Umweltberatung. Bd. 3

    Energy Technology Data Exchange (ETDEWEB)

    Koller, U. [comp.; Reitemeyer, E. [comp.; Haury, H.J. [comp.

    1994-06-01

    This meeting of February 1994 was dedicated to detailed discussions of the scope of responsibilities of municipal commissioners for pollution abatement and of experiences gained so far from different points of view. Ideas and views were exchanged on the self-image of municipal commissioners for pollution abatement and on the deficiencies, obstacles and resulting future tasks and prospects as combined with different administrative functions. The acquisition of information for commissioners for pollution abatement was another point-of-main effort topic within the framework of the meeting. (orig.) [Deutsch] Ziel der Veranstaltung vom Februar 1994 war es, das Aufgabengebiet von kommunalen Umweltbeauftragten sowie bisher gemachte Erfahrungen aus unterschiedlichen Sichtweisen darzustellen. Im konstruktiven Erfahrungsaustausch diskutierten die Teilnehmer das Selbstverstaendnis der Umweltbeauftragten sowie Defizite, Hemmnisse und daraus abzuleitende Aufgaben und Perspektiven fuer die Zukunft im Zusammenspiel verschiedener Verwaltungsebenen. Einen Schwerpunkt der Tagung bildete der Bereich der Beschaffung von Informationen fuer Umweltbeauftragte. (orig.)

  16. Potentialities of the LHCb experiment for the discovery of the physics beyond the standard model in the Bd0 → φKS0 decay

    International Nuclear Information System (INIS)

    Viaud, B.

    2003-10-01

    The Standard Model predicts the same time-dependant CP asymmetry in both B d 0 -> J/ψK S 0 and B d 0 → φK S 0 decays. This asymmetry is proportional to sin(2*β). Any difference between the CP asymmetries measured in these 2 channels would indicate the presence of new phenomena beyond the Standard Model. We study the sensitivity of the LHCb experiment to this effect. To that end, we estimate the statistical error on the measurement of sin(2*β) in the B d 0 → φK S 0 channel by LHCb. We do that with the LHCb classic detector, and then with the re-optimized detector. The number of simulated background events is too small with respect to the annual statistics to obtain precise evaluations. We developed several methods to improve these evaluations. In the most optimistic case, we predict that sin(2*β) would be measured in the LHCb classic configuration with a statistical error equal to 0.56. With the re-optimized detector, this error is further improved: 0.29. (author)

  17. Serological investigation of the prevalence of Border disease (BD in sheep herds of Tabriz area with a history\tin 2008

    Directory of Open Access Journals (Sweden)

    2010-08-01

    The causal agent of border disease is a pestivirus, which is closely related to a similar virus of cattle called bovine virus diarrhea virus (BVDV. Clinical manifestations of the disease include: infertility, low fertility, mummified fetuses, abortion and still birth, the birth of small weak lambs with tremor and abnormalities of hair coat. This study was conducted in winter of 2008 by referring to sheep farms around Tabriz with a history of abortion especially the Ligwan area as a main sheep rearing area and selection of 4000 sheep as the sample population. Blood samples were drawn from the jugular vein by venoject from 10% of each sheep herd population, the samples were transferred to laboratory in ice and after obtaining serum, the sera were freezed in –20 in order to measure antibody levels with (LSI KIT FRANCE. From a total of 373 sheep including 333 ewes and 40 rams, 282 (75.6% sheep were considered positive and 91 (24.4% were negative for Border antivirus - antibody serum. According to sample separation 252 (75.6% ewes showed positive serum and 81 (24.4% ewes showed negative serum, 30 (75% rams showed positive serum and 10 (25% rams showed negative serum. The results indicate that 75.6% of sheep in Tabriz area are challenged with BDV virus and probably Border virus in one of the main factors in reduction of sheep herds reproduction performance in Tabriz.

  18. Raimon de las Salas (? ~ Bertran Folco d’Avigno (?, “Bertran, si fossetz tant gignos” (BdT 406.16 = 83.1

    Directory of Open Access Journals (Sweden)

    Giuseppe Noto

    2009-12-01

    Full Text Available This paper will offer a new edition, with critical apparatus, commentary and translation, of the ‘tenso’ “Bertran, si fossetz tant gignos”, transmitted by chansonniers ADIK and perhaps ascribable to Raimon de las Salas and Bertran Folco d’Avigno. It is a debate (that takes place within the framework of the Albigensian Crusade and was most likely composed in northern Italy aimed at establishing whether, as far as military prowess, hospitality and courtly values as a whole are concerned, the Lombards (where Lombardy obviously means northern Italy as a whole are better than the Provençals (that is the exponents of the feudal culture of all the courts of southern France put together. Of particular interest is the contrast between Occitania and its typically courtly ethics and the exclusively economic (indeed economicistic outlook of the Lombards.

  19. Granet ~ Bertran d’Alamano, “De vos mi rancur, compaire” (BdT 189.2 = 76.6

    Directory of Open Access Journals (Sweden)

    Giuseppe Noto

    2009-12-01

    Full Text Available This paper will provide a new edition, with critical apparatus, commentary and translation, of the tenso between Granet and Bertran d’Alamano, “De vos mi rancur, compaire”. This text is only transmitted by chansonnier P and it is not only incomplete but also quite incorrect in parts: as far as this latter is concerned I will consider the suggestions by previous editors and, where necessary, put forward new solutions. The ‘tenso’ belongs to a well-attested typology in troubadour lyric: a debate between a jongleur and someone of a different social status (usually his lord and patron, but in this case the type has been altered in some quite interesting ways that hint at judicial contests and end up by overturning the viewpoint to reveal the true nature of the poem. This should not be read realistically, but as a ‘parlour game’, a ‘divertissement’ that is not necessarily linked to the biographies of the participants and whose aim is to amuse the group of ‘companhos’ who accompany Lord Bertran.

  20. Endocrine-disrupting environmental chemicals - hazards to man and animal; Hormonell wirksame Umweltchemikalien - Gefahr fuer Mensch und Tier? Seminarband der Zentralen Informationsstelle Umweltberatung Bayern. Bd. 12

    Energy Technology Data Exchange (ETDEWEB)

    Behling, G.; Koller, U.; Klemmer, A.; Haury, H.J. [comps.

    1998-08-01

    The spectrum of problems relating to endocrine-disrupting environmental chemicals was presented by competent experts from public authorities and scientific institutions. The lecturers described the current stage and future tasks of research. Their lectures focused on effects of hormone-like substances on humans and animals and an assessment of risk factors on the basis of data from scientific tests and current environmental exposure. There was also a contribution presenting the chemical industry`s view of the matter. [Deutsch] Kompetente Sachverstaendige aus Behoerden und wissenschaftlichen Einrichtungen stellten das Themenspektrum vor, fuehrten in den Forschungsstand ein und zeigten den Forschungsbedarf auf. Der Schwerpunkt lag in der Darstellung der der Auswirkungen hormonell wirksamer Substanzen, wie z.B. DDT, Dioxinen und PCBs, auf Mensch und Tier sowie in der Abschaetzung der Risikofaktoren anhand der bekannten Daten aus wissenschaftlichen Tests sowie der aktuellen Exposition in der Umwelt. Mit einem Beitrag der chemischen Industrie wurde auch deren Einschaetzung der Umweltproblematik aufgezeigt. (orig./MG) m9

  1. Increased Intrasubject Variability in Response Time in Youths with Bipolar Disorder and At-Risk Family Members

    Science.gov (United States)

    Brotman, Melissa A.; Rooney, Melissa H.; Skup, Martha; Pine, Daniel S.; Leibenluft, Ellen

    2009-01-01

    Intrasubject variability in response time (ISV-RT) was higher in youths with bipolar disorder (BD) and those with first-degree relatives with BD compared to youths without BD. ISV-RT may be a risk marker for BD.

  2. Emission control measures for precursors of tropospheric ozone. Pt. 1 and 2; Emissionsminderungsmoeglichkeiten bei Vorlaeufersubstanzen von bodennahem Ozon. Bd. 1: Systemanalyse der Ozonminderungsmassnahmen in den USA. Bd. 2: Luftreinhaltemassnahmen in den USA zur Minderung von VOC-Emissionen aus Kleinanlagen und Produkten und Vergleich mit europaeischen Regelungen

    Energy Technology Data Exchange (ETDEWEB)

    Leclaire, T.; Schiefer, C.; Bergmann, S.; Hrabovski, Z. [Institut fuer Umwelttechnologie und Umweltanalytik e.V. (IUTA), Duisburg (Germany)

    1998-08-01

    For more than two decades now experiences of ozone reduction have been made in the USA. In many regions great efforts for VOC control are made to reduce their high ozone concentrations in ambient air that in some cases reach up to more than twice the German peak concentrations. This report places focus on small stationary sources and products, for these sources actually contribute more than half of the VOC emissions in Germany and are still not regulated under the German Immission Control Law. Therefore, main aim of this examination was to determine the major elements of VOC control strategies in the U.S. and to consider, whether strategies and measures are transferable taking into account German circumstances. Volume 1 describes the strategies and measures for ozone control in the U.S. (national) as well as in five regions with high ozone concentrations in ambient air. The authorities and responsbilities at federal, state, regional, and local levels are highlighted, legislation and different types of regulations are explained, priorities concerning VOC versus NO{sub x} related control are mentioned and the control measures on different sources for reducing VOC and NO{sub x} are summarized briefly. Volume 2 contains a detailed description of control measures for reducing VOC emissions from products and stationary sources, namely the proposed national VOC emission standards for coatings and consumer products, the California Consumer Products Regulations, the state-wide requirements for industrial and commercial sources in California and the VOC related rules of the South Coast Air Quality Management District (LA and surrounded Countries). The South Coast Rules were chosen as an example for District Rules for they were generally the most stringent because of the extreme ozone concentration in this area. Moreover, the regulations for VOC emission control in Europe concerning small stationary sources and products are mentioned. The different approaches to control VOC emissions are compared and discussed. Advantages and disadvantages of the described strategies are highlighted. Based on the actual VOC emission inventory of Germany suggestions for future reduction measures are supposed. (orig.) [Deutsch] In den USA liegen Erfahrungen aus der Ozonbekaempfung ueber einen Zeitraum von 20 bis 30 Jahren vor. Aufgrund besonders hoher Ozonbelastungen in vielen Regionen werden grosse Anstrengungen zur VOC-Minderung unternommen. Wesentliches Ziel des Vorhabens war es, die Schwerpunkt im Hinblick auf die Minderung von VOC-Emissionen herauzufinden und zu pruefen, ob und inwieweit eine Uebertragung von Strategien und Massnahmen auf die Verhaeltnisse in Deutschland moeglich ist. Hauptaugenmerk wurde auf kleinere Anlagen und Produkte gelegt, weil in diesen Bereichen in Deutschland momentan vordringlich Handlungsbedarf gesehen wird. Im ersten Band sind die Strategien und Massnahmen zur Ozonminderung in den USA (bundesweit) sowie in fuenf Regionen mit besonders hoher Ozonimmissionsbelastung beschrieben. Hierzu erfolgte eine Darstellung der Zustaendigkeitsbereiche auf nationaler, einzelstaatlicher, regionaler und lokaler Ebene, der Gesetzgebung und Regelwerke, der Schwerpunktsetzung hinsichtlich NO{sub x}- und VOC-Minderung und eine kurze Darstellung der quellenbezogenen Massnahmen auf nationaler Ebene und in den betrachteten Regionen. In Band 2 erfolgt eine ausfuehrliche Beschreibung der Massnahmen zur VOC-Emissionsminderung bei Produkten und im gewerblichen Bereich in den USA anhand der nationalen Regelungen fuer Anstrichstoffe und Konsumgueter, der von der kalifornischen Luftreinhaltebehoerde erlassenen VOC-bezogenen Regelungen fuer Anstrichstoffe, Konsumgueter und Gewerbebetriebe sowie der Regelungen des suedkalifornischen South Coast Air Quality Management Districts (Los Angeles und Umgebung). Zur Darstellung der regionalen Bestimmung wurde diese Region ausgewaehlt, da die Regelungen dort aufgrund der besonders hohen Immissionsbelastung grundsaetzlich am weitesten gehen. Darueber hinaus werden die Regelungen zur VOC-Emissionsminderung fuer den Bereich der Kleinanlagen und Produkte in Europa dargestellt. Die unterschiedlichen Ansaetze zur VOC-Emissionsminderung werden zusammenfassend diskutiert, Vor-und Nachteile herausgearbeitet und unter Beruecksichtigung der derzeitigen VOC-Emissionssituation in Deutschland Ansatzpunkte fuer zukuenftige Massnahmenschwerpunkte aufgezeigt. (orig.)

  3. Investigations of environmental concentrations of alkylphenols, bisphenol A and organic tin compounds in representative samples: methodological developments and actual as well as retrospective monitoring. Final report; Verfolgung von Umweltbelastungen durch Alkylphenole, Bisphenol A und organische Zinnverbindungen repraesentativen Umweltproben: Methodische Entwicklungen und aktuelles sowie retrospektives Monitoring. Bd. 1: Organische Zinnverbindungen. Bd. 2: Alkylphenole, Bisphenol A. Abschlussbericht

    Energy Technology Data Exchange (ETDEWEB)

    Ruedel, H.; Lepper, P.; Sohn, H.; Steinhanses, J.; Boehmer, W.; Bruckert, H.J.; Wenzel, A.

    1999-11-01

    In the context of this research project analytic methods for the quantitative determination of alkylphenols (4-nonylphenol, 4NP; 4-tert.-octylphenol, 4tOP) and alkylphenol ethoxylates (4-nonlyphenol monoethoxylate, 4NP1EO; 4-tert.-octylphenol monoethoxylate, 4tOP1EO), bisphenol A (BPhA) as well as tin-organic compounds (tributyl tin, TBT; dibutyl tin, DBT, monobutyl tin, MBT; triphenyl tin, TPhT) in different biological matrices were adapted and optimised. The methods were documented in form of standard operating procedures (SOP). Following these methods samples from the German federal environmental specimen bank were investigated. Brown algae, (bay) mussels, eel pouts, sea gull eggs from the marine ecological systems of the North Sea and Baltic Sea and zebra mussels and bream muscles from fresh water ecological systems (Elbe, Mulde, Saale, Thine, Saar, Bornhoeveder lake district) of different years were analysed. Alkylphenols: The contents of 4NP and 4NP1EO mostly were in both, the marine and the fresh water, ecological systems above the contents of 4tOP and 4tOP1EO. In the marine samples the mussels were higher loaded than the other matrices. The contents in the samples from fresh water ecological systems were clearly higher than those of the samples from the marine ecological systems. The highest concentration for 4NP1EO with 324 {mu}g/kg fresh weight was measured in bream muscles from the Saar near Guedingen. Bisphenol A: the content of BPhA in the examined samples generally was low. The analyses resulted in concentrations of 1-2.5 {mu}g/ BPhA/kg in zebra mussel; only in zebra mussels from the river Saar near Rehlingen a higher value of approx. 5 {mu}g/kg was detected. The BPhA concentration in bream muscles was always below the limit of determination (LOD). The lowest content of BPhA in marine samples was found for mussels (concentration

  4. Vitrification of isolated mice blastomeres using a closed loading device

    Directory of Open Access Journals (Sweden)

    Sharma Rakesh

    2009-02-01

    Full Text Available Abstract Isolated blastomeres obtained by embryo biopsy serve mainly for preimplantation genetic screening. Blastomeres are undifferentiated embryonic cells that include all the embryo genetic information. A lot of developing technologies may benefit by the efficient cryopreservation of blastomeres for future potential use, especially for stem cell culture and differentiation control. We are hereby reporting for the first time the feasibility of preserving individual isolated blastomeres in microvolumes in a closed vitrification system. Using a cryotip and propagation in microvolumes, isolated mice blastomeres were vitrified and warmed with 100% post-warming survival.

  5. Kinetics and Mechanism of the Oxidation of Coomassie Brilliant Blue ...

    African Journals Online (AJOL)

    NICOLAAS

    The relative importance of the two paths rested on the pH-dependent concentrations of ... mixing micro-volume stopped-flow, Salisbury, UK). The spectrophotometer was interfaced with a computer to .... As pH is an important parameter that controls the characteris-. RESEARCH ARTICLE. S. Nadupalli, V.D.B.C. Dasireddy, ...

  6. Global and local - air pollution abatement in the 21st century. Seminar No. 14 of Zentrale Informationsstelle Umweltberatung Bayern; Global und Lokal - Klimaschutz fuer das 21. Jahrhundert. Seminarband der Zentralen Informationsstelle Umweltberatung Bayern. Bd. 14

    Energy Technology Data Exchange (ETDEWEB)

    Koller, U.; Behling, G.; Rauh, K.; Haury, H.J. (comps.)

    1999-08-01

    Scientists of Germany's major climate research institutes and an expert of the world climate research programme presented current information on climate trends. They informed on the results of international efforts to prevent global warming after the Buenos Aires conference and presented global climate scenarios of the future. Further issues were local air pollution abatement (energy management, thermal insulation), communal air pollution abatement concepts, and state funding in Bavaria and elsewhere. [German] Wissenschaftler aus den bedeutendsten Instituten deutscher Klimaforschung sowie ein Vertreter des Weltklimaforschungsprogramms stellten aktuelle Erkenntnisse zur Entwicklung unseres Klimas vor. Sie informierten ueber Ergebnisse internationaler Klimaschutzpolitik nach der Klimakonferenz in Buenos Aires und praesentierten Szenarien fuer das globale Klima der Zukunft. Sie widmeten sich ausserdem Fragen des lokalen Klimaschutzes unter den Aspekten Energiemanagement, Waermeschutz und diskutierten ueber kommunale Klimaschutzkonzepte sowie Foerdermoeglichkeiten in und ausserhalb Bayerns. (orig.)

  7. Sustainable development - theory and practice of environmental consulting. Proceedings of a seminar of Zentrale Informationsstelle Umweltberatung Bayern. Vol. 11; Nachhaltige Entwicklung - Theorie und Praxis fuer die Umweltberatung. Seminarband der Zentralen Informationsstelle Umweltberatung Bayern. Bd. 11

    Energy Technology Data Exchange (ETDEWEB)

    Koller, U.; Behling, G.; Klemmer, A.; Haury, H.J. [comps.

    1998-12-31

    On 25/26 November, 1997, Zentrale Informationsstelle, Umweltberatung Bayern held its 11th seminar under the title ``Sustainable development - theory and practice of environmental consulting. Subjects related to the Agenda 21 were discussed in lectures and workshops. [Deutsch] Am 25. und 26. November 1997 veranstaltete die Zentrale Informationsstelle, Umweltberatung Bayern ihr elftes Seminar mit dem Thema ``Nachhaltige Entwicklung- Theorie und Praxis fuer die Umweltberatung``. In Fachvortraegen und Workshops wurden Themen zur Agenda 21 behandelt. (ABI)

  8. Determination and calculation of hazardous incident scenarios in accordance with the 3rd hazardous incident administrative instruction. Vol. 1; Ermittlung und Berechnung von Stoerfallablaufszenarien nach Massgabe der 3. Stoerfallverwaltungsvorschrift. Bd. 1: Methodischer Teil zum Erarbeiten von Stoerfallablaufszenarien

    Energy Technology Data Exchange (ETDEWEB)

    Kaiser, W.; Rogazewski, P.; Schindler, M. [TUeV Anlagentechnik GmbH, Berlin-Schoeneberg (Germany). Unternehmensgruppe TUeV Rheinland/Berlin-Brandenburg; Acikalin, A.; Albrecht, M.; Lambert, M.; Steinbach, J. [Technische Univ. Berlin (Germany)

    2000-07-01

    At present there are used various procedures, calculation methods, models and model equations for hazardous incident scenarios. The procedure on principle is varying often. This guideline explains in one main part and six appendixes the methodical procedure to select specifications and assumptions on hazardous incident scenarios and their processing. Hazardous incident scenarios lead to information on emergency preparedness planning. Both general viewpoints and possibilities are shown, how to find necessary basic assumptions on a hazardous incident scenario from information on hazardous substances, on comparable hazardous incidents and on conditions of the site and the plant. Appendixes deal with precise instructions distinguished between substance release, explosion and fire (App. 1: Assessment of source terms, App. 2: Assessment of dispersion, App. 3: Assessment of effects). Appendix 4 gives explanations to appendixes 1, 2 and 3. Appendix 5 contains a collection of 15 examples of hazardous incident scenarios, which illustrate and comment the methodical procedure. Appendix 6 describes and comments software available on German market which assists the calculating of hazardous incidents. Volume 2 determines procedures with regard to methods of calculation, current models and model equations from scientists' point of view. (orig.) [German] Derzeit wird eine Vielzahl von Vorgehensweisen, Berechnungsmethoden, Modellen und Modellgleichungen fuer Stoerfallablaufszenarien verwendet. Das prinzipielle Vorgehen ist haeufig unterschiedlich. Dieser Leitfaden enthaelt in einem Hauptteil und sechs Anhaengen das methodische Vorgehen zur Auswahl von Angaben und Annahmen fuer Stoerfallablaufszenarien sowie deren Bearbeitung. Stoerfallablaufszenarien fuehren zu Angaben fuer die Gefahrenabwehrplanung. Fuer das Ableiten von Stoerfallablaufszenarien sind sowohl allgemeine Gesichtspunkte als auch Moeglichkeiten dargelegt, wie man aus Angaben zu Gefahrstoffen, zu vergleichbaren Stoerfaellen sowie zu Bedingungen des Standortes und der Anlage die erforderlichen Grundannahmen zum Stoerfallablauf gewinnen kann. Unterschieden nach Stofffreisetzungen, Explosionen und Braenden wird jeweils auf die konkreteren Hinweise im Anhang 1 zur Abschaetzung von Quelltermen, im Anhang 2 zur Abschaetzung der Ausbreitung und im Anhang 3 zur Abschaetzung der Auswirkungen verwiesen. Der Anhang 4 enthaelt einige Erlaeuterungen zu den Anhaengen 1 bis 3. Mit einer Sammlung von 15 Beispielen fuer Stoerfallablaufszenarien wird im Anhang 5 das im Leitfaden beschriebene methodische Vorgehen veranschaulicht und erlaeutert. Im Anhang 6 werden die auf dem deutschen Markt erhaeltlichen DV-Programme (Software) zur Berechnung von Stoerfallablaufszenarien beschrieben und kommentiert. Der Band 2 untermauert das Vorgehen im Hinblick auf Berechnungsmethoden, aktuelle Modelle und Modellgleichungen aus wissenschaftlicher Sicht. (orig.)

  9. Mictrostructured sensor systems for chemical gas analysis - 'MISCHGAS'. Vol. 1: Reports 1 - 6. Final report; Mikrostrukturierte Sensorsysteme fuer die chemische Gasanalyse - 'MISCHGAS'. Bd. 1: Teilberichte 1 - 6. Abschlussbericht

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1999-07-01

    The project MISCHGAS was aimed at low-power microstructured multisensor systems for analyses of complex gas mixtures. This comprised 1. the development of the sensor chip (sensor layout, sandwich sensor systems, ultrathin carrier materials, and sol-gel technologies), 2. investigation of atomistic and electrical sensor mechanism, 3. design and construction (glues, materials, noble metal free contact systems), 4. generation and reading of the sensor signal, 5. investigation of the analytical properties of the sensors, 6. user-oriented specialised gas analysis systems. [German] Ziel des Projektes MISCHGAS sind leistungsarme, mikrostrukturierte, multisensor-geeignete Systeme fuer die Analyse sowohl einzelner als auch mehrerer Kompoenten komplexer Gasgemische. Dazu wurden die notwendigen Teilbereiche: technologische Entwicklungen des Sensorchips, Klaerung atomistischer sowie elektrischer Sensormechanismen, Aufbau und Verbindungstechnik, Generierung und Auslesung des Sensorsignals, Ermittlung der analytischen Eigenschaften der Sensoren, anwenderorientierte spezialisierte Gasmesssysteme von den Verbundpartnern bearbeitet. Hauptpunkte neuer technologischer Entwicklungen waren Sensorlayout, Sensorschichtsysteme sowie ultraduenne Traegermaterialien ueber die 'porous silicon sacrificial layer'-Technik sowie Sol-Gel-Technologien. Damit konnten leistungsarme Traeger hergestellt werden. Materialien waren SnO{sub 2} und V{sub 2}O{sub 5}. Der Einfluss von Pt auf die Sensorreaktion konnte beschrieben werden. Das Verstaendnis phaenomenologischer Zusammenhaenge von Sensormechanismen und deren physikalisch-chemisch-analytischer Erfassung sowie der festkoerperphysikalischen Beschreibung wurde deutlich verbessert. Technologie und Prozesstechnik wurden auf Gesichtspunkte wie Qualitaetssicherung, und Transferierbarkeit ausgerichtet. Weitere Arbeitsbereiche sind die Gehaeuseentwicklung und Fixierung im Gehaeuse. In der AVT gab es Fortschritte bei Kleber und Aufbauhilfsstoffen sowie edelmetallfreien Kontaktsystemen. Fuer technische Einsatzbedingungen wurden entsprechende Filter weiterentwickelt. Weitere Fortschritte gab es im Bereich Sensormesstechnik. Alle Verbundpartner wurden mit den jeweils aktuellen technologischen Sensorqualitaeten fuer ihre Qualifizierungsmessungen versorgt. Durch eine Standardisierung des Messprotokolls wurde eine Vergleichbarkeit der Qualifizierungsergebnisse ermoeglicht. Um die Aussagefaehigkeit der Sensoren weiter auszunutzen, wurde der Thermopulsbetrieb als Messmethode ausgebaut. Dies ermoeglicht es u.a., die temperaturabhaengige Empfindlichkeit eines Sensors zu nutzen und kann einen Beitrag zur Verringerung der Leistungsaufnahme des Sensors leisten. Abhaengig vom Anwendungsfall evaluierten Verbundpartner in Pilotsystemen die technologischen Entwicklungen. Dies gilt insbesondere fuer die Bereiche Brandfrueherkennung und Rauchgaserkennung. (orig.)

  10. Scenarios for an integrated sustainability policy - using the example of the ''Sustainable City 2030''. Vol. 1; Szenarien fuer eine integrierte Nachhaltigkeitspolitik - am Beispiel: Die nachhaltige Stadt 2030. Bd. 1. Ueberblick und Fazit

    Energy Technology Data Exchange (ETDEWEB)

    Gassner, Robert [Institut fuer Zukunftsstudien und Technologiebewertung gGmbH (IZT), Berlin (Germany)

    2013-04-15

    On behalf of the German Federal Environment Agency, this project was supposed to enhance the further development of an integrated sustainability policy in Germany. Focus of the project was the design of sustainable urban living environments, as everyday life related views of for example citizens, consumers, employees, traffic participants etc. can serve as a consistency check for an integrated sustainability policy. Political topics and stakeholders within the German environment department and beyond were analyzed in order to enhance an effective integrated sustainability policy and to identify potential synergies. For this as well as for the resolution of possible trade-offs a systematic and empirically based scenario process has been used. In the introductory empirical and planning phase the fundamentals were elaborated: Desk research, interviews and workshops were conducted to identify political topics and strategic fields, which then were checked for trade-offs and potential cooperations. For this first phase of the project stakeholders, as well as their motivations and underlying expectations for the future were identified. In the main phase of the project two complementary topics (''Recycling City'' and ''Sustainable Economy in the City'') were jointly selected and elaborated in two parallel conducted systematic and participatory scenario processes to generate integrated images of the future in 2030. Furthermore, options for action, strategic elements and potentials for networking were derived and concretized with regard to practical cooperation in the German Department of the Environment.

  11. Determination and calculation of hazardous incident scenarios in accordance with the 3rd hazardous incident administrative instruction. Vol. 2; Ermittlung und Berechnung von Stoerfallablaufszenarien nach Massgabe der 3. Stoerfallverwaltungsvorschrift. Bd. 2: Berechnungsmethoden, aktuelle Modelle und Modellgleichungen

    Energy Technology Data Exchange (ETDEWEB)

    Kaiser, W.; Rogazewski, P.; Schindler, M. [TUeV Anlagentechnik GmbH, Berlin-Schoeneberg (Germany). Unternehmensgruppe TUeV Rheinland/Berlin-Brandenburg; Acikalin, A.; Albrecht, M.; Lambert, M.; Steinbach, J. [Technische Univ. Berlin (Germany)

    2000-07-01

    At present there are used various of procedures, calculation methods, models and model equations for hazardous incident scenarios. The procedure on principle is varying often. This guideline explains in one main part and six appendixes the methodical procedure to select specifications and assumptions on hazardous incident scenarios and their processing. Hazardous incident scenarios lead to information on emergency preparedness planning. Both general viewpoints and possibilities are shown, how to find necessary basic assumptions on a hazardous incident scenario from information on hazardous substances, on comparable hazardous incidents and on conditions of the site and the plant. Appendixes deal with precise instructions distinguished between substance release, explosion and fire (app. 1: Assessment of source terms, app. 2: Assessment of dispersion, app. 3: Assessment of effects). Appendix 4 gives explanations to appendixes 1, 2 and 3. Appendix 5 contains a collection of 15 examples of hazardous incident scenarios, which illustrate and comment the methodical procedure. Appendix 6 describes and comments software available on German market which assists the calculating of hazardous incidents. Volume 2 determines procedures with regard to methods of calculation, current models and model equations from scientists point of view. (orig.) [German] Derzeit wird eine Vielzahl von Vorgehensweisen, Berechnungsmethoden, Modellen und Modellgleichungen fuer Stoerfallablaufszenarien verwendet. Das prinzipielle Vorgehen ist haeufig unterschiedlich. Dieser Leitfaden enthaelt in einem Hauptteil und sechs Anhaengen das methodische Vorgehen zur Auswahl von Angaben und Annahmen fuer Stoerfallablaufszenarien sowie deren Bearbeitung. Stoerfallablaufszenarien fuehren zu Angaben fuer die Gefahrenabwehrplanung. Fuer das Ableiten von Stoerfallablaufszenarien sind sowohl allgemeine Gesichtspunkte als auch Moeglichkeiten dargelegt, wie man aus Angaben zu Gefahrstoffen, zu vergleichbaren Stoerfaellen sowie zu Bedingungen des Standortes und der Anlage die erforderlichen Grundannahmen zum Stoerfallablauf gewinnen kann. Unterschieden nach Stofffreisetzungen, Explosionen und Braenden wird jeweils auf die konkreteren Hinweise im Anhang 1 zur Abschaetzung von Quelltermen, im Anhang 2 zur Abschaetzung der Ausbreitung und im Anhang 3 zur Abschaetzung der Auswirkungen verwiesen. Der Anhang 4 enthaelt einige Erlaeuterungen zu den Anhaengen 1 bis 3. Mit einer Sammlung von 15 Beispielen fuer Stoerfallablaufszenarien wird im Anhang 5 das im Leitfaden beschriebene methodische Vorgehen veranschaulicht und erlaeutert. Im Anhang 6 werden die auf dem deutschen Markt erhaeltlichen DV-Programme (Software) zur Berechnung von Stoerfallablaufszenarien beschrieben und kommentiert. Der Band 2 untermauert das Vorgehen im Hinblick auf Berechnungsmethoden, aktuelle Modelle und Modellgleichungen aus wissenschaftlicher Sicht. (orig.)

  12. 27. MPA-Seminar - Safety and reliability in energy technology. Vol. 2: Papers 27-45; 27. MPA-Seminar - Sicherheit und Verfuegbarkeit in der Energietechnik. Bd. 2: Vortraege 27-45

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    2001-07-01

    The proceedings of the 27th MPA Seminar on 'Safety and Reliability in Energy Technology' were issued in two volumes. The main topics of the second volume are: 1. Material behaviour in the creep regime; 2. Fracture machanics; 3. Reliability analysis and 4. Failure analysis.

  13. Caracterización del alergeno principal de soja Gly m Bd 30K como proteína de reactividad cruzada con caseínas bovinas y su potencial aplicación en inmunoterapias

    OpenAIRE

    Candreva, Ángela María

    2013-01-01

    El objetivo general de este trabajo de tesis fue desarrollar diferentes metodologías que permitan explicar las bases moleculares de las alergias alimentarias a proteínas de leche de vaca y a soja e identificar potenciales proteínas de reactividad cruzada entre ambos sistemas, con el fin último de aplicar estos nuevos conocimientos para el desarrollo de técnicas de inmunointervención destinadas a establecer tolerancia oral a leche de vaca. Los objetivos particulares fueron: ...

  14. Climate protection by reducing the emissions of greenhouse gases in households and the tertiary sector through climate-conscious behaviour. Vol. 1; Klimaschutz durch Minderung von Treibhausgasemissionen im Bereich Haushalte und Kleinverbrauch durch klimagerechtes Verhalten. Bd. 1. Private Haushalte

    Energy Technology Data Exchange (ETDEWEB)

    Brohmann, B.; Cames, M.

    2000-06-01

    The aim of the project was to identify areas in households and the tertiary sector in which changes in behaviour could result in energy conservation and thus a reduction of greenhouse gas emissions, and to quantify the potentials for 1995, 2005 and 2020. A second focus was on the analysis and evaluation of programmes and instruments to realise the potentials. With literature evaluation, expert interviews, and a household servey potentials and further technical development have been identified. In sum, behavioural measures can contribute to the CO2 reduction by 64 million tons in 1995 in households and 27 in the commercial sector in which the potential decreases to 18 million tons in 2020 due to the autonomous technical development. Adequate promotion programmes can help to realise 20-30% of the potential by 2020. (orig.) [German] Ziel des Vorhabens war, im Sektor private Haushalte und Kleinverbrauch Bereiche zu identifizieren, in denen Verhaltensaenderungen zur Energieeinsparung fuehren koennen, und diese Potenziale fuer 1995, 2005 und 2020 zu quantifizieren. Darauf aufbauend waren Programme und Instrumente zur Umsetzung aufzuzeigen und zu bewerten. Gestuetzt auf Literaturrecherchen und Expertengespraeche wurden Einzelpotenziale, Rahmenbedingungen, Entwicklungstrends in der Technik und im Ausstattungsgrad ermittelt. Insgesamt koennten Verhaltensmassnahmen im Haushaltssektor die CO2-Emissionen im Basisjahr 1995 um 64 Mio, im Kleinverbrauch um 27 Mio t vermindern. Bis 2020 bleibt dieses Potenzial im Haushaltssektor in etwa gleich. Im Kleinverbrauch sinkt es infolge der autonomen Technikentwicklung auf 18 Mio t ab. Durch geeignete Programme koennen bis 2020 etwa 20-30% des Potenzials erreicht werden. (orig.)

  15. The International College of Neuropsychopharmacology (CINP) Treatment Guidelines for Bipolar Disorder in Adults (CINP-BD-2017), Part 4: Unmet Needs in the Treatment of Bipolar Disorder and Recommendations for Future Research.

    Science.gov (United States)

    Fountoulakis, Konstantinos N; Vieta, Eduard; Young, Allan; Yatham, Lakshmi; Grunze, Heinz; Blier, Pierre; Moeller, Hans Jurgen; Kasper, Siegfried

    2017-02-01

    The current fourth paper on the International College of Neuropsychopharmacology guidelines for the treatment of bipolar disorder reports on the unmet needs that became apparent after an extensive review of the literature and also serves as a conclusion to the project of the International College of Neuropsychopharmacology workgroup. The systematic review of the literature that was performed to develop the International College of Neuropsychopharmacology guidelines for bipolar disorder identified and classified a number of potential shortcomings. Problems identified concerned the reliability and validity of the diagnosis of bipolar disorder and especially of bipolar depression. This, in turn, has profound consequences for early detection and correct treatment of the disorder. Another area that needs improvement is the unsatisfactory efficacy and effectiveness of therapeutic options, especially in special populations such as those with mixed features and rapid cycling course. Gender issues and adherence problems constitute an additional challenge. The literature suggests that while treatment providers are concerned more with treatment-related issues, patients and their caregivers worry more about issues pertaining to the availability of services and care, quality of life, and various types of burden. The workgroup identified additional unmet needs related to the current standard of research in bipolar disorder. These include the fragmentation of bipolar disorder into phases that are handled as being almost absolutely independent from each other, and thus the development of an overall therapeutic strategy on the basis of the existing evidence is very difficult. Trials are not always designed in a way that outcomes cover the most important aspects of bipolar disorder, and often the reporting of the results is biased and unsatisfactory. The data on combination treatments and high dosages are sparse, whereas they are common in real world practice. The workgroup endorses the full release of raw study data to the scientific community, and the development of uniform clinical trial standards (also including more realistic outcomes) and the reporting of results. The 2 large appendices summarize the results of this systematic review with regard to the areas of lack of knowledge where further focused research is necessary. © The Author 2016. Published by Oxford University Press on behalf of CINP.

  16. The International College of Neuro-Psychopharmacology (CINP) Treatment Guidelines for Bipolar Disorder in Adults (CINP-BD-2017), Part 2: Review, Grading of the Evidence, and a Precise Algorithm

    Science.gov (United States)

    Yatham, Lakshmi; Grunze, Heinz; Vieta, Eduard; Young, Allan; Blier, Pierre; Kasper, Siegfried; Moeller, Hans Jurgen

    2017-01-01

    Abstract Background: The current paper includes a systematic search of the literature, a detailed presentation of the results, and a grading of treatment options in terms of efficacy and tolerability/safety. Material and Methods: The PRISMA method was used in the literature search with the combination of the words ‘bipolar,’ ‘manic,’ ‘mania,’ ‘manic depression,’ and ‘manic depressive’ with ‘randomized,’ and ‘algorithms’ with ‘mania,’ ‘manic,’ ‘bipolar,’ ‘manic-depressive,’ or ‘manic depression.’ Relevant web pages and review articles were also reviewed. Results: The current report is based on the analysis of 57 guideline papers and 531 published papers related to RCTs, reviews, posthoc, or meta-analysis papers to March 25, 2016. The specific treatment options for acute mania, mixed episodes, acute bipolar depression, maintenance phase, psychotic and mixed features, anxiety, and rapid cycling were evaluated with regards to efficacy. Existing treatment guidelines were also reviewed. Finally, Tables reflecting efficacy and recommendation levels were created that led to the development of a precise algorithm that still has to prove its feasibility in everyday clinical practice. Conclusions: A systematic literature search was conducted on the pharmacological treatment of bipolar disorder to identify all relevant random controlled trials pertaining to all aspects of bipolar disorder and graded the data according to a predetermined method to develop a precise treatment algorithm for management of various phases of bipolar disorder. It is important to note that the some of the recommendations in the treatment algorithm were based on the secondary outcome data from posthoc analyses. PMID:27816941

  17. A multi-centre prospective evaluation of the Check-Direct ESBL Screen for BD MAX as a rapid molecular screening method for extended-spectrum beta-lactamase-producing Enterobacteriaceae rectal carriage

    NARCIS (Netherlands)

    Engel, T.G.; Slotboom, B.J.; Maarseveen, N. van; Zwet, A.A. van; Nabuurs-Franssen, M.H.; Hagen, F.

    2017-01-01

    OBJECTIVE: A multiplex extended-spectrum beta-lactamase-producing Enterobacteriaceae (ESBL-E) quantitative polymerase chain reaction (qPCR), performed directly on rectal swabs, was compared with a culture-based protocol to study the discrepancies between the two methods, and identify existing

  18. 100eme anniversaire de la théorie de la relativité Une BD romande : Mélanges Einstein (Albert) et l'histoire de la physique

    CERN Multimedia

    Tesnier, Grégory

    2005-01-01

    2005 has been delcared "Year of Physics" by UNESCO and ONU to celebrate the 100th anniversary of the theory of relativity, elaborated by Einstein (who lived in Bern). To hon. Einstein, an historical comic strip has been published (1 page)

  19. The BdV screen of memory and Ciutat d'Asunción boulevard at the Baró de Viver neighborhood (Barcelona: (rethinking citizens' participation in urban design

    Directory of Open Access Journals (Sweden)

    Tomeu Vidal

    2012-03-01

    Full Text Available We present a case of citizen participation to design some public spaces in Baró de Viver, a neighbourhood of the city of Barcelona. Our aim is to reflect on the ways to understand citizen participation in political and academic agenda, the role of different actors (citizens, professionals, politicians... and strategies and methods used in participatory urban planning. The experience showed in this paper is located in a scale of urban design very close and well known to the people. We begin with a brief historical overview of the neighborhood where the project arose. Then we give an account of the stages of the participatory process, showing the main milestones, features and methods. Finally we propose some ideas to rethink the conceptual and methodological aspects of the intervention and urban research in environmental psychology and people-environment studies.

  20. Historical Chronology of the Council for Children with Behavioral Disorders 1964-1999. From the Third CBD Mini-Library Series, What Works for Children and Youth with E/BD: Linking Yesterday and Today with Tomorrow.

    Science.gov (United States)

    Bullock, Lyndal M.; Menendez, Anthony L.

    This monograph presents a history of the Council for Children with Behavioral Disorders (CCBD), a division of the Council for Exceptional Children. Since its founding in 1964, the CCBD has been concerned with children and youth with emotional and behavioral disorders. Following an introductory chapter, Chapter 1 highlights CCBD, including its…

  1. Sewage and sludge treatment process - additive and process-integrated measures. Vol. 1-3. Preprints; Verfahrenstechnik der Abwasser- und Schlammbehandlung - additive und prozessintegrierte Massnahmen. Bd. 1-3. Preprints

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1999-07-01

    This fourth GVC congress again deals with all aspects of industrial and municipal waste water and sludge treatment; the spectrum ranges from unit operations and segmets of the process line over special treatments of problematic constituents, adapted solutions for measuring and control-technical problems to innovative overall concepts and the operating results of executed plants. Novel programme elements are process-integrated measures for water and waste water treatment aiming to minimize the consumption of the water resource and to recycle it. (orig.) [German] Auch dieser 4. GVC-Abwasser-Kongress behandelt die volle Breite der industriellen und kommunalen Abwasser- und Schlammbehandlung; das Spektrum reicht von den unit operations und Prozessstrecken, ueber die spezielle Behandlung von problematischen Inhaltstoffen, ueber adaptierte messtechnische und regelungstechnische Problemloesungen bis hin zu innovativen Gesamtkonzepten und den Betriebsergebnissen von ausgefuehrten Anlagen. Neu im Programm sind die produktionsintegrierten Massnahmen zur Wasser- und Abwasserbehandlung, die darauf abzielen, die Ressource Wasser zu minimieren und zu recyclieren. (orig.)

  2. Dicty_cDB: CHK573 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 251079 |AX251079.1 Sequence 47 from Patent WO0168912. 36 0.14 3 BD452600 |BD452600.1 Diagnosis of Diseases...52161 |AX252161.1 Sequence 422 from Patent WO0168911. 42 0.37 3 BD460625 |BD460625.1 Diagnosis of Diseases A...ssociated with Cell Cycle. 42 0.37 3 BD452547 |BD452547.1 Diagnosis of Diseases Associated with Cell Cycle.

  3. Genetic evidence for a high diversity and wide distribution of endemic strains of the pathogenic chytrid fungus Batrachochytrium dendrobatidis in wild Asian amphibians.

    Science.gov (United States)

    Bataille, Arnaud; Fong, Jonathan J; Cha, Moonsuk; Wogan, Guinevere O U; Baek, Hae Jun; Lee, Hang; Min, Mi-Sook; Waldman, Bruce

    2013-08-01

    Population declines and extinctions of amphibians have been attributed to the chytrid fungus Batrachochytrium dendrobatidis (Bd), especially one globally emerging recombinant lineage ('Bd-GPL'). We used PCR assays that target the ribosomal internal transcribed spacer region (ITS) of Bd to determine the prevalence and genetic diversity of Bd in South Korea, where Bd is widely distributed but is not known to cause morbidity or mortality in wild populations. We isolated Korean Bd strains from native amphibians with low infection loads and compared them to known worldwide Bd strains using 19 polymorphic SNP and microsatellite loci. Bd prevalence ranged between 12.5 and 48.0%, in 11 of 17 native Korean species, and 24.7% in the introduced bullfrog Lithobates catesbeianus. Based on ITS sequence variation, 47 of the 50 identified Korean haplotypes formed a group closely associated with a native Brazilian Bd lineage, separated from the Bd-GPL lineage. However, multilocus genotyping of three Korean Bd isolates revealed strong divergence from both Bd-GPL and the native Brazilian Bd lineages. Thus, the ITS region resolves genotypes that diverge from Bd-GPL but otherwise generates ambiguous phylogenies. Our results point to the presence of highly diversified endemic strains of Bd across Asian amphibian species. The rarity of Bd-GPL-associated haplotypes suggests that either this lineage was introduced into Korea only recently or Bd-GPL has been outcompeted by native Bd strains. Our results highlight the need to consider possible complex interactions among native Bd lineages, Bd-GPL and their associated amphibian hosts when assessing the spread and impact of Bd-GPL on worldwide amphibian populations. © 2013 John Wiley & Sons Ltd.

  4. Prokaryotic expression of antimicrobial ovine β- defensin-1 in ...

    African Journals Online (AJOL)

    AJB_YOMI

    2011-09-05

    Sep 5, 2011 ... conserved cysteine residues forming three disulfide bridges (Figure 1). Construction of expression vectors and prokaryotic expression of psBD-1 and msBD-1 fusion proteins. The psBD-1 and msBD-1 proteins from prokaryotic expression were purified and characterized. The fusion protein yields were not ...

  5. Memory in Early Onset Bipolar Disorder and Attention-Deficit/Hyperactivity Disorder: Similarities and Differences

    Science.gov (United States)

    Udal, Anne H.; Oygarden, Bjorg; Egeland, Jens; Malt, Ulrik F.; Groholt, Berit

    2012-01-01

    Differentiating between early-onset bipolar disorder (BD) and attention-deficit/hyperactivity disorder (ADHD) can be difficult. Memory problems are commonly reported in BD, and forgetfulness is among the diagnostic criteria for ADHD. We compared children and adolescents with BD (n = 23), ADHD combined type (ADHD-C; n = 26), BD + ADHD-C (n = 15),…

  6. Family Functioning, Social Impairment, and Symptoms Among Adolescents with Bipolar Disorder

    Science.gov (United States)

    Keenan-Miller, Danielle; Peris, Tara; Axelson, David; Kowatch, Robert A.; Miklowitz, David J.

    2012-01-01

    Objective: Impaired social functioning is common among youth with bipolar disorder (BD), emerges in multiple settings, and persists over time. However, little is known about factors associated with poor peer and family functioning in the early-onset form of BD. Using a sample of adolescents with BD I or II, we examined which symptoms of BD,…

  7. Dicty_cDB: AFO448 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available of isoprenoid content, compostition and metabolism. 54 0.004 1 BD224357 |BD224357.1 Materials and methods fo...SSA008C03 : 5' end, single read. 50 0.002 2 BD272997 |BD272997.1 Materials and methods for the modification

  8. Dicty_cDB: SSH467 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available =3 Row=J, DNA sequence. 46 0.68 1 BD265981 |BD265981.1 Schizophrenia associated genes, proteins and bialleli...c markers. 40 0.80 2 BD265980 |BD265980.1 Schizophrenia associated genes, proteins and biallelic markers. 40

  9. Application of synchrotron through-the-substrate microdiffraction to crystals in polished thin sections

    Directory of Open Access Journals (Sweden)

    Jordi Rius

    2015-07-01

    Full Text Available The synchrotron through-the-substrate X-ray microdiffraction technique (tts-μXRD is extended to the structural study of microvolumes of crystals embedded in polished thin sections of compact materials [Rius, Labrador, Crespi, Frontera, Vallcorba & Melgarejo (2011. J.Synchrotron Rad. 18, 891–898]. The resulting tts-μXRD procedure includes some basic steps: (i collection of a limited number of consecutive two-dimensional patterns (frames for each randomly oriented crystal microvolume; (ii refinement of the metric from the one-dimensional diffraction pattern which results from circularly averaging the sum of collected frames; (iii determination of the reciprocal lattice orientation of each randomly oriented crystal microvolume which allows assigning the hkl indices to the spots and, consequently, merging the intensities of the different frames into a single-crystal data set (frame merging; and (iv merging of the individual crystal data sets (multicrystal merging to produce an extended data set suitable for structure refinement/solution. Its viability for crystal structure solution by Patterson function direct methods (δ recycling and for accurate single-crystal least-squares refinements is demonstrated with some representative examples from petrology in which different glass substrate thicknesses have been employed. The section of the crystal microvolume must be at least of the same order of magnitude as the focus of the beam (15 × 15 µm in the provided examples. Thanks to its versatility and experimental simplicity, this methodology should be useful for disciplines as disparate as petrology, materials science and cultural heritage.

  10. The use of the Clock Drawing Test in bipolar disorder with or without dementia of Alzheimer’s type

    Directory of Open Access Journals (Sweden)

    Ivan Aprahamian

    2014-12-01

    Full Text Available There is limited data regarding the cognitive profile from screening tests of older adults with bipolar disorder (BD with dementia. Objective To investigate the Clock Drawing Test (CDT among older adults with BD with and without Alzheimer’s disease (AD. Method 209 older adults (79 with BD without dementia and 70 controls; 60 with AD, being 27 with BD were included to evaluate the performance of three CDT scoring scales, beyond the Mini-Mental State Examination (MMSE and verbal fluency (VFT. Results Patients with BD without dementia presented with lower scores in MMSE, VF and one CDT scoring scale than controls. Patients with BD and AD presented with lower scores in VF and CDT scoring scales than patients with only AD. All CDT scales presented similar sensitivity and specificity for BD and non-BD groups. Conclusion Elderly subjects with BD showed greater impairment in CDT in both groups of normal cognition and AD.

  11. Cardiac Computed Tomography and Magnetic Resonance Imaging in the Evaluation of Mitral and Tricuspid Valve Disease: Implications for Transcatheter Interventions.

    Science.gov (United States)

    Naoum, Christopher; Blanke, Philipp; Cavalcante, João L; Leipsic, Jonathon

    2017-03-01

    Transcatheter interventions to treat mitral and tricuspid valve disease are becoming increasingly available because of the growing number of elderly patients with significant comorbidities or high operative risk. Thorough clinical and imaging evaluation in these patients is essential. The latter involves both characterization of the mechanism and severity of valvular disease as well as determining the hemodynamic consequences and extent of ventricular remodeling, which is an important predictor of future outcomes. Moreover, an assessment of the suitability and risk of complications associated with device-specific therapies is also an important component of the preprocedural evaluation in this cohort. Although echocardiography including 2-dimensional and 3-dimensional methods has an important role in the initial assessment and procedural guidance, cross-sectional imaging, including both computed tomographic imagning and cardiac magnetic resonance imaging, is increasingly being integrated into the evaluation of mitral and tricuspid valve disease. In this review, we discuss the role of cross-sectional imaging in mitral and tricuspid valve disease, primarily valvular regurgitation assessment, with an emphasis on the preprocedural evaluation and implications for transcatheter interventions. © 2017 American Heart Association, Inc.

  12. Obesity in bipolar disorder: an overview.

    Science.gov (United States)

    McElroy, Susan L; Keck, Paul E

    2012-12-01

    Bipolar disorder (BD) is associated with obesity, overweight, and abdominal obesity, and BD individuals with obesity have a greater illness burden. Factors related to BD, its treatment, and the individual may all contribute to BD's association with obesity. Management strategies for the obese BD patient include use of medications with better metabolic profiles, lifestyle interventions, and adjunctive pharmacotherapy for weight loss. Obesity-related psychiatric and medical comorbidities should also be assessed and managed. Bariatric surgery may be an option for carefully selected patients. Greater research into the theoretical underpinnings and clinical management of the BD-obesity connection is needed.

  13. Heterogeneous occupancy and density estimates of the pathogenic fungus Batrachochytrium dendrobatidis in waters of North America.

    Directory of Open Access Journals (Sweden)

    Tara Chestnut

    Full Text Available Biodiversity losses are occurring worldwide due to a combination of stressors. For example, by one estimate, 40% of amphibian species are vulnerable to extinction, and disease is one threat to amphibian populations. The emerging infectious disease chytridiomycosis, caused by the aquatic fungus Batrachochytrium dendrobatidis (Bd, is a contributor to amphibian declines worldwide. Bd research has focused on the dynamics of the pathogen in its amphibian hosts, with little emphasis on investigating the dynamics of free-living Bd. Therefore, we investigated patterns of Bd occupancy and density in amphibian habitats using occupancy models, powerful tools for estimating site occupancy and detection probability. Occupancy models have been used to investigate diseases where the focus was on pathogen occurrence in the host. We applied occupancy models to investigate free-living Bd in North American surface waters to determine Bd seasonality, relationships between Bd site occupancy and habitat attributes, and probability of detection from water samples as a function of the number of samples, sample volume, and water quality. We also report on the temporal patterns of Bd density from a 4-year case study of a Bd-positive wetland. We provide evidence that Bd occurs in the environment year-round. Bd exhibited temporal and spatial heterogeneity in density, but did not exhibit seasonality in occupancy. Bd was detected in all months, typically at less than 100 zoospores L(-1. The highest density observed was ∼3 million zoospores L(-1. We detected Bd in 47% of sites sampled, but estimated that Bd occupied 61% of sites, highlighting the importance of accounting for imperfect detection. When Bd was present, there was a 95% chance of detecting it with four samples of 600 ml of water or five samples of 60 mL. Our findings provide important baseline information to advance the study of Bd disease ecology, and advance our understanding of amphibian exposure to free

  14. Two Chitin Biosynthesis Pathway Genes in Bactrocera dorsalis (Diptera: Tephritidae): Molecular Characteristics, Expression Patterns, and Roles in Larval-Pupal Transition.

    Science.gov (United States)

    Yang, Wen-Jia; Wu, Yi-Bei; Chen, Li; Xu, Kang-Kang; Xie, Yi-Fei; Wang, Jin-Jun

    2015-10-01

    Glucose-6-phosphate isomerase (G6PI) and UDP-N-acetylglucosamine pyrophosphorylase (UAP), two key components in the chitin biosynthesis pathway, are critical for insect growth and metamorphosis. In this study, we identified the genes BdG6PI and BdUAP from the oriental fruit fly, Bactrocera dorsalis (Hendel). The open reading frames (ORFs) of BdG6PI (1,491 bp) and BdUAP (1,677 bp) encoded 496 and 558 amino acid residues, respectively. Multiple sequence alignments showed that BdG6PI and BdUAP had high amino acid sequence identity with other insect homologues. Quantitative real-time polymerase chain reaction (qPCR) analysis indicated that BdG6PI was mainly expressed in the early stages of third-instar larvae and adults, while significantly higher expression of BdUAP was observed in adults. Both transcripts were expressed highly in the Malpighian tubules, but only slightly in the tracheae. The expression of both BdG6PI and BdUAP was significantly up-regulated by 20-hydroxyecdysone exposure and down-regulated by starvation. Moreover, injection of double-stranded RNAs of BdG6PI and BdUAP into third-instar larvae significantly reduced the corresponding gene expressions. Additionally, silencing of BdUAP resulted in 65% death and abnormal phenotypes of larvae, while silencing of BdG6PI had a slight effect on insect molting. These findings provide some data on the roles of BdG6PI and BdUAP in B. dorsalis and demonstrate the potential role for BdUAP in larval-pupal transition. © The Authors 2015. Published by Oxford University Press on behalf of Entomological Society of America. All rights reserved. For Permissions, please email: journals.permissions@oup.com.

  15. Biodiesel versus diesel exposure: Enhanced pulmonary inflammation, oxidative stress, and differential morphological changes in the mouse lung

    International Nuclear Information System (INIS)

    Yanamala, Naveena; Hatfield, Meghan K.; Farcas, Mariana T.; Schwegler-Berry, Diane; Hummer, Jon A.; Shurin, Michael R.; Birch, M. Eileen; Gutkin, Dmitriy W.; Kisin, Elena; Kagan, Valerian E.; Bugarski, Aleksandar D.; Shvedova, Anna A.

    2013-01-01

    The use of biodiesel (BD) or its blends with petroleum diesel (D) is considered to be a viable approach to reduce occupational and environmental exposures to particulate matter (PM). Due to its lower particulate mass emissions compared to D, use of BD is thought to alleviate adverse health effects. Considering BD fuel is mainly composed of unsaturated fatty acids, we hypothesize that BD exhaust particles could induce pronounced adverse outcomes, due to their ability to readily oxidize. The main objective of this study was to compare the effects of particles generated by engine fueled with neat BD and neat petroleum-based D. Biomarkers of tissue damage and inflammation were significantly elevated in lungs of mice exposed to BD particulates. Additionally, BD particulates caused a significant accumulation of oxidatively modified proteins and an increase in 4-hydroxynonenal. The up-regulation of inflammatory cytokines/chemokines/growth factors was higher in lungs upon BD particulate exposure. Histological evaluation of lung sections indicated presence of lymphocytic infiltrate and impaired clearance with prolonged retention of BD particulate in pigment laden macrophages. Taken together, these results clearly indicate that BD exhaust particles could exert more toxic effects compared to D. - Highlights: • Exposure of mice to BDPM caused higher pulmonary toxicity compared to DPM. • Oxidative stress and inflammation were higher in BD vs to D exposed mice. • Inflammatory lymphocyte infiltrates were seen only in lungs of mice exposed to BD. • Ineffective clearance, prolonged PM retention was present only after BD exposure

  16. Biodiesel versus diesel exposure: Enhanced pulmonary inflammation, oxidative stress, and differential morphological changes in the mouse lung

    Energy Technology Data Exchange (ETDEWEB)

    Yanamala, Naveena, E-mail: wqu1@cdc.gov [Pathology and Physiology Research Branch/NIOSH/CDC, Morgantown, WV 26505 (United States); Hatfield, Meghan K., E-mail: wla4@cdc.gov [Pathology and Physiology Research Branch/NIOSH/CDC, Morgantown, WV 26505 (United States); Farcas, Mariana T., E-mail: woe7@cdc.gov [Pathology and Physiology Research Branch/NIOSH/CDC, Morgantown, WV 26505 (United States); Schwegler-Berry, Diane [Pathology and Physiology Research Branch/NIOSH/CDC, Morgantown, WV 26505 (United States); Hummer, Jon A., E-mail: qzh3@cdc.gov [Office of Mine Safety and Health Research/NIOSH/CDC, Pittsburgh, PA 15236 (United States); Shurin, Michael R., E-mail: shurinmr@upmc.edu [Department of Pathology, University of Pittsburgh Medical Center, Pittsburgh, PA (United States); Birch, M. Eileen, E-mail: mib2@cdc.gov [NIOSH/CDC, 4676 Columbia Parkway, Cincinnati, OH 45226 (United States); Gutkin, Dmitriy W., E-mail: dwgutkin@hotmail.com [Department of Pathology, University of Pittsburgh Medical Center, Pittsburgh, PA (United States); Kisin, Elena, E-mail: edk8@cdc.gov [Pathology and Physiology Research Branch/NIOSH/CDC, Morgantown, WV 26505 (United States); Kagan, Valerian E., E-mail: kagan@pitt.edu [Department of Environmental and Occupational Health, University of Pittsburgh, PA (United States); Bugarski, Aleksandar D., E-mail: zjl1@cdc.gov [Office of Mine Safety and Health Research/NIOSH/CDC, Pittsburgh, PA 15236 (United States); Shvedova, Anna A., E-mail: ats1@cdc.gov [Pathology and Physiology Research Branch/NIOSH/CDC, Morgantown, WV 26505 (United States); Department Physiology and Pharmacology, WVU, Morgantown, WV 26505 (United States)

    2013-10-15

    The use of biodiesel (BD) or its blends with petroleum diesel (D) is considered to be a viable approach to reduce occupational and environmental exposures to particulate matter (PM). Due to its lower particulate mass emissions compared to D, use of BD is thought to alleviate adverse health effects. Considering BD fuel is mainly composed of unsaturated fatty acids, we hypothesize that BD exhaust particles could induce pronounced adverse outcomes, due to their ability to readily oxidize. The main objective of this study was to compare the effects of particles generated by engine fueled with neat BD and neat petroleum-based D. Biomarkers of tissue damage and inflammation were significantly elevated in lungs of mice exposed to BD particulates. Additionally, BD particulates caused a significant accumulation of oxidatively modified proteins and an increase in 4-hydroxynonenal. The up-regulation of inflammatory cytokines/chemokines/growth factors was higher in lungs upon BD particulate exposure. Histological evaluation of lung sections indicated presence of lymphocytic infiltrate and impaired clearance with prolonged retention of BD particulate in pigment laden macrophages. Taken together, these results clearly indicate that BD exhaust particles could exert more toxic effects compared to D. - Highlights: • Exposure of mice to BDPM caused higher pulmonary toxicity compared to DPM. • Oxidative stress and inflammation were higher in BD vs to D exposed mice. • Inflammatory lymphocyte infiltrates were seen only in lungs of mice exposed to BD. • Ineffective clearance, prolonged PM retention was present only after BD exposure.

  17. The relationship between genetic risk variants with brain structure and function in bipolar disorder

    DEFF Research Database (Denmark)

    Pereira, Licia P; Köhler, Cristiano A; de Sousa, Rafael T

    2017-01-01

    Genetic-neuroimaging paradigms could provide insights regarding the pathophysiology of bipolar disorder (BD). Nevertheless, findings have been inconsistent across studies. A systematic review of gene-imaging studies involving individuals with BD was conducted across electronic major databases from...

  18. Early Maladaptive Schemas in Bipolar Disorder Patients With and Without Suicide Attempts.

    Science.gov (United States)

    Nilsson, Kristine Kahr

    2016-03-01

    Patients with bipolar disorder (BD) are at an increased risk of attempted and completed suicide. To elucidate the beliefs and assumptions associated with suicidality in BD, the present study compared BD patients with and without a history of suicide attempt in terms of early maladaptive schemas (EMSs). The sample consisted of 49 remitted BD patients who completed the Young Schema Questionnaire-Short Version. Information on suicide attempts was obtained through interviews combined with medical records. Compared with BD patients without suicide attempts, the BD patients with suicide attempts scored significantly higher on 3 EMSs: social isolation, practical incompetence, and entitlement. The findings suggest that specific EMSs may be implicated in suicidal behaviors in BD. These results have implications for the assessment and treatment of suicidality in BD.

  19. The first ICRANet catalog of binary-driven hypernovae

    Directory of Open Access Journals (Sweden)

    Pisani G. B.

    2018-01-01

    Thanks to this novel theoretical and observational understanding, it was possible for ICRANet scientists to build the firstst BdHNe catalog, composed by the 345 BdHNe identified up to the end of 2016.

  20. Dicty_cDB: SFC621 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ypeptides and polynucleotides derived from coagulase-negative staphylococci. 48 6e-04 2 AF245043 |AF245043.1... 12 BD245130 |BD245130.1 Polypeptides and polynucleotides derived from coagulase-negative staphylococci. 42

  1. Huge femoral artery pseudoaneurysm in a patient with Behçet’s disease

    Directory of Open Access Journals (Sweden)

    Tarlaan Hasanaghaei

    2017-10-01

    Conclusion: Arterial pseudoaneurysm is life-threatening in BD and should be kept in mind to prevent major complications. Vascular involvement in BD patients is probably associated with hyperhomocysteinemia.

  2. Analysis of Th Cell-related Cytokine Production in Behçet Disease Patients with Uveitis Before and After Infliximab Treatment.

    Science.gov (United States)

    Takeuchi, Masaru; Karasawa, Yoko; Harimoto, Kohzou; Tanaka, Atsushi; Shibata, Masaki; Sato, Tomohito; Caspi, Rachel R; Ito, Masataka

    2017-02-01

    To examine antigen-stimulated cytokine production by Behçet disease patients (BD) before and after infliximab infusion. PBMCs were obtained before and after infliximab infusion in BD patients with or without recurrent uveitis during at least 1 year of infliximab therapy, and from healthy subjects. PBMCs were cultured with IRBP, and Th-related cytokines in cultures were measured. Levels of IL-4, IL-6, IL-10 IL-17A, IL-17F, IL-31, IFN-γ, and TNFα were higher in BD before infliximab infusion than in healthy subjects, and these levels were the highest in BD with recurrent uveitis. After infliximab infusion, these cytokine levels were reduced to a greater extent in BD without recurrent uveitis than in BD with recurrence. Th-related cytokines produced by IRBP-stimulated PBMCs were elevated in BD, and infliximab infusion suppressed these cytokines to a greater extent in BD without recurrent uveitis than in those with recurrence.

  3. Bipolar disorder and comorbid attention deficit hyperactivity disorder. A distinct clinical phenotype? Clinical characteristics and temperamental traits.

    Science.gov (United States)

    Bernardi, Silvia; Cortese, Samuele; Solanto, Mary; Hollander, Eric; Pallanti, Stefano

    2010-06-01

    It has been suggested that bipolar disorder (BD) with comorbid ADHD represents a distinct clinical phenotype of BD. There are no data regarding potential heterogeneity between BD subjects with a diagnosis of ADHD in childhood whose ADHD remitted in adulthood (cADHD-BD) vs. BD patients with persistent ADHD diagnosis in adulthood (aADHD-BD). This heterogeneity may constitute a confounder in investigations of the nature of the co-occurrence between BD and ADHD. The aim of this paper is to compare BD patients without ADHD, to those with aADHD-BD, and those with cADHD-BD on clinical and temperamental characteristics, hypothesizing that maladaptive temperament will be increased in BD subjects with a stable diagnosis of ADHD in adulthood compared to those whose ADHD remitted. We further hypothesize that maladaptive temperament will be associated with the severity of both illnesses. A total of 100 outpatients (aged 18-30 years) with BD in remission were included. The assessment of ADHD was made according to a procedure aimed to reduce potential recall biases. Subjects had to have a parent available and had never been treated with stimulants. Temperamental traits were assessed with the California Child Q-sort (CCQ) and the Early Adolescent Temperament Questionnaire (EATQ). Rate of co-occurrence of ADHD-BD was 18% lifetime and 10% current diagnosis. Patients with ADHD-BD (aADHD-BD+cADHD-BD) reported a significantly earlier onset of mood disorder, higher number of previous mood episodes, and significantly higher impulsivity than BD patients without ADHD. aADHD-BD showed a significantly earlier BD onset, higher number of previous mood episodes, higher impulsivity, decreased Reactive Control and higher Negative Emotionality temperamental scores than cADHD patients. Findings suggest that patients with aADHD-BD present a clinical phenotype distinct from that of patients with BD without ADHD or with a childhood ADHD diagnosis that remitted with the age. This appealing hypothesis

  4. Does perfectionism in bipolar disorder pedigrees mediate associations between anxiety/stress and mood symptoms?

    OpenAIRE

    Corry, Justine; Green, Melissa; Roberts, Gloria; Fullerton, Janice M.; Schofield, Peter R.; Mitchell, Philip B.

    2017-01-01

    Background Bipolar disorder (BD) and the anxiety disorders are highly comorbid. The present study sought to examine perfectionism and goal attainment values as potential mechanisms of known associations between anxiety, stress and BD symptomatology. Measures of perfectionism and goal attainment values were administered to 269 members of BD pedigrees, alongside measures of anxiety and stress, and BD mood symptoms. Regression analyses were used to determine whether perfectionism and goal attain...

  5. Isolation of human β-defensin-4 in lung tissue and its increase in lower respiratory tract infection

    Directory of Open Access Journals (Sweden)

    Mukae Hiroshi

    2005-11-01

    Full Text Available Abstract Background Human β-defensin-4 (hBD-4, a new member of the β-defensin family, was discovered by an analysis of the genomic sequence. The objective of this study was to clarify hBD-4 expression in human lung tissue, along with the inducible expression in response to infectious stimuli, localization, and antimicrobial activities of hBD-4 peptides. We also investigated the participation of hBD-4 in chronic lower respiratory tract infections (LRTI by measuring the concentrations of hBD-4 peptides in human bronchial epithelial lining fluid (ELF. Methods The antimicrobial activity of synthetic hBD-4 peptides against E. coli and P. aeruginosa was measured by radial diffusion and colony count assays. We identified hBD-4 in homogenated human lung tissue by reverse-phase high-performance liquid chromatography coupled with a radioimmunoassay (RIA. Localization of hBD-4 was studied through immunohistochemical analysis (IHC. We investigated the effects of lipopolysaccharide (LPS on hBD-4 expression and its release from small airway epithelial cells (SAEC. We collected ELF from patients with chronic LRTI using bronchoscopic microsampling to measure hBD-4 concentrations by RIA. Results hBD-4 exhibited salt-sensitive antimicrobial activity against P. aeruginosa. We detected the presence of hBD-4 peptides in human lung tissue. IHC demonstrated the localization of hBD-4-producing cells in bronchial and bronchiolar epithelium. The levels of hBD-4 peptides released from LPS-treated SAECs were higher than those of untreated control cells. ELF hBD-4 was detectable in 4 of 6 patients with chronic LRTI, while the amounts in controls were all below the detectable level. Conclusion This study suggested that hBD-4 plays a significant role in the innate immunity of the lower respiratory tract.

  6. Spatiotemporal pattern of bacillary dysentery in China from 1990 to 2009: what is the driver behind?

    Directory of Open Access Journals (Sweden)

    Zhiwei Xu

    Full Text Available Little is known about the spatiotemporal pattern of bacillary dysentery (BD in China. This study assessed the geographic distribution and seasonality of BD in China over the past two decades.Data on monthly BD cases in 31 provinces of China from January 1990 to December 2009 obtained from Chinese Center for Disease Control and Prevention, and data on demographic and geographic factors, as well as climatic factors, were compiled. The spatial distributions of BD in the four periods across different provinces were mapped, and heat maps were created to present the seasonality of BD by geography. A cosinor function combined with Poisson regression was used to quantify the seasonal parameters of BD, and a regression analysis was conducted to identify the potential drivers of morbidity and seasonality of BD.Although most regions of China have experienced considerable declines in BD morbidity over the past two decades, Beijing and Ningxia still had high BD morbidity in 2009. BD morbidity decreased more slowly in North-west China than other regions. BD in China mainly peaked from July to September, with heterogeneity in peak time between regions. Relative humidity was associated with BD morbidity and peak time, and latitude was the major predictor of BD amplitude.The transmission of BD was heterogeneous in China. Improved sanitation and hygiene in North-west China, and better access to clean water and food in the big floating population in some metropolises could be the focus of future preventive interventions against BD. BD control efforts should put more emphasis on those dry areas in summer.

  7. The nailfold videocapillaroscopy findings of Behçet's syndrome

    Directory of Open Access Journals (Sweden)

    Sevil Alan

    2016-06-01

    Conclusion: In this study, the BD group had significantly more capillaroscopic pathological findings than did the healthy control group. However, the detected capillaroscopic pathology rate in BD patients was significantly lower than that of three previously published studies. Further studies are needed to clarify the diagnostic and prognostic value of capillaroscopy in BD.

  8. Bipolar Disorder and Immune Dysfunction: Epidemiological Findings, Proposed Pathophysiology and Clinical Implications

    OpenAIRE

    Rosenblat, Joshua D.; McIntyre, Roger S.

    2017-01-01

    Bipolar disorder (BD) is strongly associated with immune dysfunction. Replicated epidemiological studies have demonstrated that BD has high rates of inflammatory medical comorbidities, including autoimmune disorders, chronic infections, cardiovascular disease and metabolic disorders. Cytokine studies have demonstrated that BD is associated with chronic low-grade inflammation with further increases in pro-inflammatory cytokine levels during mood episodes. Several mechanisms have been identifie...

  9. Effect of several plant products on prevention of E. coli adhesion in the gastrointestinal tract of weaned pigs

    NARCIS (Netherlands)

    Jongbloed, A.W.; Maiorano, R.; Wagenaars, C.

    2007-01-01

    A challenge experiment was carried out which comprised six treatment groups each consisting of 12 individually housed piglets. Each group received one of the following pelleted diets: 1) Basal Diet (BD; Negative control); 2) BD + Yeast product (Positive control, 2.5 g/kg diet); 3) BD + Product SW 7

  10. Distinct and Shared Endophenotypes of Neural Substrates in Bipolar and Major Depressive Disorders.

    Directory of Open Access Journals (Sweden)

    Toshio Matsubara

    Full Text Available Little is known about disorder-specific biomarkers of bipolar disorder (BD and major depressive disorder (MDD. Our aim was to determine a neural substrate that could be used to distinguish BD from MDD. Our study included a BD group (10 patients with BD, 10 first-degree relatives (FDRs of individuals with BD, MDD group (17 patients with MDD, 17 FDRs of individuals with MDD, and 27 healthy individuals. Structural and functional brain abnormalities were evaluated by voxel-based morphometry and a trail making test (TMT, respectively. The BD group showed a significant main effect of diagnosis in the gray matter (GM volume of the anterior cingulate cortex (ACC; p = 0.01 and left insula (p < 0.01. FDRs of individuals with BD showed significantly smaller left ACC GM volume than healthy subjects (p < 0.01, and patients with BD showed significantly smaller ACC (p < 0.01 and left insular GM volume (p < 0.01 than healthy subjects. The MDD group showed a tendency toward a main effect of diagnosis in the right and left insular GM volume. The BD group showed a significantly inverse correlation between the left insular GM volume and TMT-A scores (p < 0.05. Our results suggest that the ACC volume could be a distinct endophenotype of BD, while the insular volume could be a shared BD and MDD endophenotype. Moreover, the insula could be associated with cognitive decline and poor outcome in BD.

  11. Amygdala Hyperactivation During Face Emotion Processing in Unaffected Youth at Risk for Bipolar Disorder

    Science.gov (United States)

    Olsavsky, Aviva K.; Brotman, Melissa A.; Rutenberg, Julia G.; Muhrer, Eli J.; Deveney, Christen M.; Fromm, Stephen J.; Towbin, Kenneth; Pine, Daniel S.; Leibenluft, Ellen

    2012-01-01

    Objective: Youth at familial risk for bipolar disorder (BD) show deficits in face emotion processing, but the neural correlates of these deficits have not been examined. This preliminary study tests the hypothesis that, relative to healthy comparison (HC) subjects, both BD subjects and youth at risk for BD (i.e., those with a first-degree BD…

  12. Association analysis of ANK3 gene variants in nordic bipolar disorder and schizophrenia case-control samples

    DEFF Research Database (Denmark)

    Tesli, Martin; Koefoed, Pernille; Athanasiu, Lavinia

    2011-01-01

    Genetic variants in ankyrin 3 (ANK3) have recently been shown to be associated with bipolar disorder (BD). We genotyped three ANK3 SNPs previously found to be associated with BD (rs10994336, rs1938526, and rs9804190) in a Scandinavian BD case–control sample (N¿=¿854/2,614). Due to evidence...

  13. Increased Clinical and Neurocognitive Impairment in Children with Autism Spectrum Disorders and Comorbid Bipolar Disorder

    Science.gov (United States)

    Weissman, Adam S.; Bates, Marsha E.

    2010-01-01

    Bipolar (BD) symptomatology is prevalent in children with autism spectrum disorders (ASD) and may lead to increased impairment. The current study compared clinical and neurocognitive impairment in children (7-13 years) diagnosed with ASD (n=55), BD (n=34), ASD + BD (n=23), and a non-clinical control group (n=27). Relative to the ASD group, the ASD…

  14. Binge drinking trajectory and neuropsychological functioning among university students: a longitudinal study.

    Science.gov (United States)

    Mota, Nayara; Parada, María; Crego, Alberto; Doallo, Sonia; Caamaño-Isorna, Francisco; Rodríguez Holguín, Socorro; Cadaveira, Fernando; Corral, Montserrat

    2013-11-01

    Adolescence is a time of considerable neurodevelopment. Binge drinking (BD) during this period increases the vulnerability to its neurotoxic effects. This longitudinal study aimed to investigate the relationship between BD trajectory over university years and neuropsychological functioning. Cohort-study. Two-year follow-up. A total of 89 university students were assessed: 40 Non-BD (at Initial and Follow-up), 16 Ex-BD (BD at Initial but not at Follow-up) and 33 BD (at both times). Neuropsychological assessment of working memory, episodic memory and executive abilities was carried out during their first (Initial) and third (Follow-up) academic year at the University of Santiago de Compostela. BD subjects performed less well on the Wechsler Memory Scale-III (WMS-III) Logical Memory Subtest (immediate theme recall, P=.034; delayed theme recall, P=.037; and percent retention, P=.035) and committed more perseverative errors on the Self-Ordered Pointing Task (SOPT) (P=.021) than Non-BD. There were no differences between Ex-BD and Non-BD. Binge drinking trajectory during adolescence is associated with neuropsychological performance. Persistent BD, but not Ex-BD, is associated with verbal memory and monitoring difficulties. This is compatible with the hypothesis that heavy alcohol use during adolescence may affect cognitive functions that rely on the temporomesial and dorsolateral prefrontal cortex. Copyright © 2013 Elsevier Ireland Ltd. All rights reserved.

  15. What is bizarre in bizarre delusions? A critical review

    DEFF Research Database (Denmark)

    Cermolacce, Michel René Joseph; Jensen, Lars Meldgaard Sass; Parnas, J

    2010-01-01

    or incomprehensible. Then, we provide a critical review of contemporary studies on the reliability of BD and their methodological and conceptual limitations. Current approaches have focused intensely on BD's reliability and have defined BD strictly in terms of delusional content--mainly in terms of the physical...

  16. Generation of Soluble Receptor Activator of NF-KappaB Ligand Is Critical for Osteolytic Bone Metastasis

    Science.gov (United States)

    2010-10-01

    mature, TRAP-positive multinucleated cells were counted as osteoclasts. BD BioCoat Osteologic Coverslips (BD Biosciences) were placed in 24-well plates...by counting the number of calcium phosphate matrix resorption pits formed per BD BioCoat Osteologic Coverslip. Commercially available sRANKL (positive

  17. Cross-Sectional and Longitudinal Abnormalities in Brain Structure in Children with Severe Mood Dysregulation or Bipolar Disorder

    Science.gov (United States)

    Adleman, Nancy E.; Fromm, Stephen J.; Razdan, Varun; Kayser, Reilly; Dickstein, Daniel P.; Brotman, Melissa A.; Pine, Daniel S.; Leibenluft, Ellen

    2012-01-01

    Background: There is debate as to whether chronic irritability (operationalized as severe mood dysregulation, SMD) is a developmental form of bipolar disorder (BD). Although structural brain abnormalities in BD have been demonstrated, no study compares neuroanatomy among SMD, BD, and healthy volunteers (HV) either cross-sectionally or over time.…

  18. BehÇet's disease in Libya | Basma | African Journal of Rheumatology

    African Journals Online (AJOL)

    Introduction: Behcet's Disease (BD) is a chronic, relapsing, inflammatory disease characterized by recurrent oral aphthous ulcers and numerous potential systemic manifestations. In Libya, no previous studies were done on BD. Objective: To study the different clinical manifestations of BD in Libyan patients and compare ...

  19. Depression and Mania in Bipolar Disorder.

    Science.gov (United States)

    Tondo, Leonardo; Vázquez, Gustavo H; Baldessarini, Ross J

    2017-04-01

    Episode duration, recurrence rates, and time spent in manic and depressive phases of bipolar disorder (BD) is not well defined for subtypes of the disorder. We reviewed the course, timing, and duration of episodes of mania and depression among 1130 clinically treated DSM-IV-TR BD patients of various types, and compared duration and rates as well as total proportion of time in depressive versus manic episodes during 16.7 average years at risk. As expected, episodes of depressions were much longer than manias, but episode-duration did not differ among BD diagnostic types: I, II, with mainly mixed-episodes (BD-Mx), or with psychotic features (BD-P). Recurrence rates (episodes/year) and proportion of time in depression and their ratios to mania were highest in BD-II and BD-Mx subjects, with more manias/year in psychotic and BD-I subjects. In most BD-subtypes, except with psychotic features, there was more time in depressive than manic morbidity, owing mainly to longer depressive than manic episodes. The proportion of time in depression was highest among those who followed a predominant DMI course, whereas total time in mania was greatest in BD with psychotic features and BD-I. and with an MDI course. Subtypes of BD patients differed little in episode-duration, which was consistently much longer for depression. The findings underscore the limited control of bipolar depression with available treatments.

  20. Maldi-Tof /Tof-MS Reveals Elevated Serum Haptoglobin and Amyloid A in Behcet's Disease

    NARCIS (Netherlands)

    Mao, L.; Dong, H.; Yang, P.; Zhou, H.; Huang, X.; Lin, X.; Kijlstra, A.

    2008-01-01

    Behcet¿s disease (BD) is a multisystemic autoimmune disease with unclear etiology and pathogenesis. To screen aberrant serum proteins in BD, serum samples were obtained from eight male BD patients with active uveitis and eight male healthy volunteers with informed consent. The serum samples from

  1. Antiviral agents for preven- tion and/or treatment of influenza virus ...

    African Journals Online (AJOL)

    Repro

    insomnia, difficulty in concentrat- ing and light-headedness. It is rec- ommended that patients with ... adult > 65 yrs. 50 mg bd or lower child 1 - 9 yrs ( 40 kg). 100 mg bd. Zanamivir adult. 10 mg (2 inhalations) bd. (once daily for prophylaxis).

  2. A rare case of juvenile-onset Behçet's disease: Fournier's gangrene ...

    African Journals Online (AJOL)

    Behçet's disease (BD) is a multisystemic, inflammatory disease with still unknown etiology and rarely seen in childhood. BD has worse prognosis in young, male patients. BD exacerbations may be triggered by viral, bacterial, and other undefined antigenic stimuli in genetically predisposed individuals. Fournier's gangrene ...

  3. Site profiles of low-volatile chlorinated hydrocarbons - cause-oriented monitoring in aquatic media. Vol.2. Low-volatile chlorinated hydrocarbons in surface water, sediments, suspended matter and fish of the Elbe river and its tributaries; Standortprofile schwerfluechtiger chlorierter Kohlenwasserstoffe (SCKW) - ursachenorientiertes Monitoring in aquatischen Medien. Bd. 2. SCKW in Oberflaechenwasser, Sediment, Schwebstoffen und Fischen aus der Elbe und Nebenfluessen

    Energy Technology Data Exchange (ETDEWEB)

    Heinisch, E.; Kettrup, A.; Gebefuegi, I.; Martens, D.; Bergheim, W.; Wenzel, S.

    2001-07-01

    Evaluating the primary data from ARGE ELBE, LAU Halle/Saale and the Environmental Specimen Banking (Umweltprobenbank) as well from publications from the Czech Republic (CHMU) the concentrations of the following low volatile chlorinated hydrocarbons were established for surface water, sediment, breams and eels from the rivers Elbe, Schwarze Elster, Mulde and Saale partly from 1989 till 1999: DDT and its metabolites DDE and DDD, partly as 2,4'- and 4,4' isomers; HCH ({alpha}-, {beta}-, {gamma}- and {delta} isomers); chlorinated benzenes with 1-6 Cl atoms and octachlorostyrene. The data evaluated were drawn up into tables - comprehensive in a separate supplement, in short versions within the text - and consolidated into graphs. Aim of the paper was a cause-oriented monitoring. The by far most important emission sources, found from the distance and time profiles as well as from special assessments of the substance patterns, were chemical plants. (orig.) [German] Durch Auswertung von Primaerdaten der ARGE ELBE, des LAU Halle/Saale und der Umweltprobenbank sowie von Publikationen aus Tschechien (CHMU) wurden fuer Oberflaechenwasser, Sediment, Brassen/Bleien und Aale aus der Elbe, Schwarzen Elster, Mulde und Saale fuer die Jahre von z.T. 1989 bis 1999 die Konzentrationen der folgenden schwerfluechtigen Kohlenwasserstoffe (SCKW) ermittelt: DDT und seine Metabolite DDE und DDD, z.T. als 2,4'- und 4,4'-Isomere; HCH ({alpha}-, {beta}-, {gamma}- und {delta}-Isomere); chlorierte Benzole mit 1-6 Cl-Atomen und Octachlorstyrol. Die ausgewerteten Daten wurden zu Tabellen - ausfuehrlich in einem gesonderten Tabellenanhang und verkuerzt im Textteil - zusammengestellt sowie zu Grafiken verdichtet. Ziel der Arbeit war ein ursachenorientiertes Monitoring. Als mit Abstand wesentlichste Emissionsquellen konnten anhand von Streckenprofilen und Zeitrastern sowie durch spezielle Auswertungen der Stoffmusterverteilungen Chemibetriebe ermittelt werden. (orig.)

  4. 24. MPA-seminar: safety and reliability of plant technology with special emphasis on integrity and life management. Vol. 1. Papers 1-27; 24. MPA-Seminar: Sicherheit und Verfuegbarkeit in der Anlagentechnik mit dem Schwerpunkt Integritaet und Lebensdauermanagement. Bd. 1. Vortraege 1-27

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1999-08-01

    The first volume is dedicated to the safety and reliability of plant technology with special emphasis on the integrity and life management. The main topic in the volume is the contribution of nondestructive testing to the reactor safety from an international point of view. All 20 papers are separately analyzed for this database. (orig.)

  5. Vol. 4 in the series: Site profiles of persistent chlorinated hydrocarbons - cause-oriented monitoring in aquatic media; Pestizide aus der Reihe der persistenten chlorierten Kohlenwasserstoffe in Gewaessern der Rhein-Region - Ergebnisse nachhaltiger Steuerungen von Wirtschaft und Politik. Bd. 4 der Reihe: Standortprofile persistenter chlorierter Kohlenwasserstoffe - ursachenorientiertes Monitoring in aquatischen Medien

    Energy Technology Data Exchange (ETDEWEB)

    Heinisch, E.; Kettrup, A.; Bergheim, W.; Wenzel, S.

    2003-07-01

    Evaluating the analytical data of DDT and its metabolites, the isomers of HCH as well as (sometimes) of aldrin and dieldrin in surface water, suspended matter, eels, breams and roaches from the rivers Rhine, Neckar, Kocher, Enz, Main (upto km 360), Weschnitz, Modau, Schwarzbach, Hengstbach, Grundbach, Nidda, Rodau, Kinzig, Werra, Diemel, Lahn, Nahe, Mosel, Sauer, Saar, Ahr, Kyll, Sieg and Laacher See distance profiles (partly from Konstanz till Markermeer) and time series (partly from 1984-2001) were elaborated. The primary data come from about 15 mainly regional investigation departments, the IKSR and the Environmental Specimen Bank. The chemical enterprises in Rheinfelden, Grenzach, Ludwigshafen, Lampertheim, Gernsheim, Darmstadt, Hoechst, Kelsterbach, Offenbach, Ingelheim, Loelsdorf, Leverkusen, Elberfeld, Krefeld-Uerdingen and Huels could partly be made transparent by the course of the sDDT and sHCH values and the profiles of the constituents and isomers, resp., in the distance profiles (especially from the river Rhine) mainly from 1990/92. The corresponding graph for the year 2000 shows that there is no longer a human and ecotoxicological relevance of the compounds to be expected. (orig.)

  6. Scenarios for an integrated sustainability policy - using the example of the ''Sustainable City 2030''; Szenarien fuer eine integrierte Nachhaltigkeitspolitik - am Beispiel: Die nachhaltige Stadt 2030. Bd. 3. Teilbericht ''Nachhaltiges Wirtschaften in der Stadt 2030''

    Energy Technology Data Exchange (ETDEWEB)

    Grabow, Busso; Hollbach-Groemig, Beate; Groepler, Nicolai; Rechenberg, Christoph [Deutsches Inst. fuer Urbanistik (DiFu), Berlin (Germany); Gassner, Robert [Institut fuer Zukunftsstudien und Technologiebewertung gGmbH (IZT), Berlin (Germany)

    2013-04-15

    The partial report,Sustainability economic activity in the City 2030' was performed as a part of a project of the Federal Environment Agency (Dessau-Rosslau, Federal Republic of Germany) entitled 'Scenarios for an integrated sustainability policy - exemplified by using,Sustainable City 2030''. The objectives of this partial report are: (a) Presentation of the topic and its importance in the current debate on sustainability; (b) Answering the questions: What are the interfaces to the municipal level? What is about the capability of acting at the municipal level? Which framework conditions are necessary on the part of the Federal Government and the State Governments?; (c) Rough outline of the current situation; (d) Outlining the opportunities and perspectives up to the implementation of the sustainable economic activity.

  7. History of nuclear power in the GDR. Nuclear science and engineering in the shadow of socialism. Vol 3: History of nuclear power in the FRG.; Geschichte der Kernenergie in der DDR. Kernforschung und Kerntechnik im Schatten des Sozialismus. Bd. 3: Geschichte der Kernenergie in der Bundesrepublik Deutschland

    Energy Technology Data Exchange (ETDEWEB)

    Mueller, W.D.

    2001-07-01

    The author presents a well-versed survey of the history of nuclear science and engineering in the former GDR, with an emphasis on the aspects of nuclear safety. It was not only the desperate energy situation that urged the governments in power to place their expectations in and heavily support nuclear research and the development of the country's nuclear industry. Competition with the Federal Republic of Germany in the fields of nuclear science and technology was strongly driven by political intentions, the aim being to demonstrate the superiority of the socialist system established after WW II in the eastern part of Germany. The author examines and explains the reasons why the reality never came up to expectations. (orig./CB) [German] Der Autor behandelt ausfuehrlich und kenntnisreich die Entwicklung von Kernforschung und Kerntechnik in der DDR, insbesondere auch die Probleme der nuklearen Sicherheit. Von der Nutzung der Kernenergie und der Uranvorkommen auf ihrem Boden erwartete die DDR die Loesung ihrer draengenden Energieprobleme. Auch sollten im Wettstreit mit der Bundesrepublik Erfolge in der neuen Wissenschaft und Technik die Ueberlegenheit des Sozialismus ueber den Kapitalismus beweisen. Die Erwartungen erfuellten sich jedoch nicht. Der Autor untersucht die Ursachen: die besondere Abhaengigkeit von der Sowjetunion, die starre Planwirtschaft, die extreme Geheimhaltung auf dem Atomgebiet sowie die Folgen des Mangels an Materialien, Ausruestungen und auch Arbeitskraeften. (orig.)

  8. Development and evaluation of a meteorological model system for assessing the effect of environmental measures on climate and air quality. Vol. 2: Appendices 6 through 10; Entwicklung und Evaluierung eines meteorologischen Modellsystems zur Folgenabschaetzung von Umwelteingriffen auf Klima und Luftqualitaet. Bd. 2: Anhaenge 6-10

    Energy Technology Data Exchange (ETDEWEB)

    Bigalke, K. [Hamburg Univ. (Germany). Meteorologisches Inst.; Schluenzen, K.H. [METCON Umweltmeteorologische Beratung, Pinneberg (Germany)

    2001-09-01

    The project focused on the development of a low-cost planning tool for authorities and consulting engineers which meets the envisaged national quality standards (VDI standards). The program system METRAS{sup +} consists of four components for preparation, implementation and quality assurance of mesoscale model calculations, all under Windows. The program system will not be commercialized; instead, it will be made available to interested users at a small fee by the Meteorological Institute of Hamburg University. [German] Ziel war die Bereitstellung eines kostenguenstigen Planungsinstrumentes fuer Behoerden und Beratungsunternehmen, das geplante nationale Qualitaetsnormen (VDI-Richtlinie) erfuellt. Vergleichbare Modelle existieren bislang nur im wissenschaftlichen Bereich, sind kaum qualitaetsgesichert und werden u.a. aus wirtschaftlichen Erwaegungen nur in Ausnahmefaellen eingesetzt. Das Programmsystem METRAS{sup +} setzt sich aus vier Programmkomponenten zusammen, die der Vorbereitung, Durchfuehrung und Qualitaetssicherung mesoskaliger Modellrechnungen dienen. Alle Programmkomponenten laufen unter einer gemeinsamen, anwenderfreundlichen Windowsoberflaeche. Um die breite Anwendung qualifizierter Untersuchungsmethoden im Umweltconsulting zu foerdern, ist geplant, METRAS{sup +} nicht kommerziell zu vertreiben und das Programmsystem interessierten Anwendern gegen einen geringen Kostenbeitrag zur Verfuegung zu stellen. Vertrieb und Oeffentlichkeitsarbeit sollen vom Meteorologischen Institut der Universitaet Hamburg geleistet werden. (orig.)

  9. Sustainability and social benefits of the planning of green areas and landscape planning versus their curteilment. Lifestyles as a challenge to, and an opportunity for, economy; Wirtschaft, Wissenschaft und Umwelt. Bd. 7. Nachhaltigkeit und gesellschaftlicher Nutzen von Gruenordnungsplanung und Landschaftsplanung kontra Reduktion. - Lebensstile als Herausforderung und Chance fuer die Wirtschaft

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1998-11-01

    The book contains the lecture series given within the framework of the 7th Economy Forum ``Economy, science and environment``, organized jointly by the Zentralstelle fuer Forschungs- und Entwicklungstransfer und Wissenschaftliche Weiterbildung (FET and WW) of Essen University and the chamber of industry and trade for Essen, Muelheim/Ruhr and Oberhausen in Essen. The lectures were delivered at the following events at the Essen University: `Sustainability and social benefits of the planning of green areas and landscapes versus their curtailment` (5 June 1997); and `Lifestyles as a challenge to and an opportunity for economy` (13 November 1997). (orig.) [Deutsch] Der Bericht gibt die Vortraege der Veranstaltungsreihe Wirtschaftsforum VII `Wirtschaft, Wissenschaft und Umwelt` wieder, veranstaltet von der FET and WW Zentralstelle fuer Forschungs- und Entwicklungstransfer und Wissenschaftliche Weiterbildung der Universitaet-GH Essen in Zusammenarbeit mit der Industrie- und Handelskammer fuer Essen, Muelheim an der Ruhr, Oberhausen zu Essen. Die Vortraege sind auf folgenden Veranstaltungen an der Universitaet-GH Essen gehalten worden:`Nachhaltigkeit und gesellschaftlicher Nutzen von Gruenordnungsplanung und Landschaftsplanung kontra Reduktion` am 5. Juni 1997 und `Lebensstile als Herausforderung und Chance fuer die Wirtschaft` am 13. November 1997. (orig.)

  10. Strategies for product-based environmental protection - integrated product policy and integrated product management. Proceedings of a seminar of Zentrale Informationsstelle Umweltberatung Bayern; Wege zu einem produktbezogenen Umweltschutz - integrierte Produktpolitik und integriertes Produktmanagement. Seminarband der Zentralen Informationsstelle Umweltberatung Bayern. Bd. 18

    Energy Technology Data Exchange (ETDEWEB)

    Stroh, K.; Behling, G.; Koller, U.; Lattner, A. (comps.)

    2001-09-01

    Apart from waste, exhaust and waste heat, also products should be regarded as 'emissions' of the production process, as the environment is burdened both by their use and disposal. An integrated product policy involves optimization of products through their whole product life and the cooperation of all parties involved (politics, industry, trade, consumers, waste managers). Competent experts from all groups discussed this problem in scientific and practical lectures, which are contained in this proceedings volume. [German] Heute geraten neben den Abfaellen, Abgasen oder Abwaessern auch die Produkte als groesste ''Emission'' aus dem Produktionsprozess ins Blickfeld der Umweltpolitik. Besonders in der Phase der Produktnutzung und -entsorgung entstehen bedeutende Umweltbelastungen. Daher ist es das Ziel einer integrierten Produktpolitik, die Produkte bereits bei der Neuentwicklung fuer ihren gesamten Lebenzyklus, also ''von der Wiege bis zur Bahre'', in ihren Umweltauswirkungen zu optimieren. In diesen Prozess sollen alle Beteiligten (Politik, Wirtschaft, Handel, Verbraucher, Entsorger) eingebunden werden. Ueber dieses breite Thema informierten kompetente Referenten aus den relevanten Akteursgruppen. Neben wissenschaftlichen Vortraegen wurden vor allem anhand zahlreicher Beispiele aus der Praxis der Schwierigkeiten und Chancen von umweltfreundlichen Produktneuentwicklungen diskutiert. Im vorliegenden Seminarband sind die Vortraege schriftlich wiedergegeben. (orig.)

  11. 30. MPA-Seminar 'Safety and reliability in energy technology' in conjunction with the 9th German-Japanese seminar. Vol. 1 (Papers 1-26); 30. MPA-Seminar 'Sicherheit und Verfuegbarkeit in der Energietechnik' in Verbindung mit dem 9. Deutsch-Japanischen Seminar. Bd. 1 (Vortraege 1-26)

    Energy Technology Data Exchange (ETDEWEB)

    Roos, E. (comp.)

    2004-07-01

    The 30th MPA-seminar on ''Safety and Availability in Energy Engineering'' was held in conjuction with the 9th German-Japanese Seminar. The 52 contributions were published in two volumes. Volume 1 contains the contributions to the following sessions: fracture mechanics, fatigue, welding, environmental impact and European research projects. Volume 2 contains contributions of sessions 6-9: high-temperature application, modelling-simulation, ageing management and non-destructive testing. (uke)

  12. Climate protection by reducing the emissions of greenhouse gases in households and the tertiary sector through climate-conscious behaviour. Vol. 2; Klimaschutz durch Minderung von Treibhausgasemissionen im Bereich Haushalte und Kleinverbrauch durch klimagerechtes Verhalten. Bd. 2. Gewerbe, Handel und Dienstleistung

    Energy Technology Data Exchange (ETDEWEB)

    Boede, U.; Gruber, E. [Fraunhofer-Institut fuer Systemtechnik und Innovationsforschung (ISI), Karlsruhe (Germany); Deutscher, P.; Elsberger, M.; Rouvel, L. [Technische Univ., Muenchen (Germany). Lehrstuhl fuer Energiewirtschaft und Innovationsforschung; Brakhage, A.; Jaekel, M. [Abacus, Trier (Germany); Renner, G. [Innovative Energieberatung, Koeln (Germany); Brohmann, B.; Cames, M.; Herold, A.

    2000-08-01

    The aim of the project was to identify areas in households and the tertiary sector in which changes in behaviour could result in energy conservation and thus a reduction of greenhouse gas emissions, and to quantify the potentials for 1995, 2005 and 2020. A second focus was on the analysis and evaluation of programmes and instruments to realise the potentials. With literature evaluation, expert interviews, and a household servey potentials and further technical development have been identified. In sum, behavioural measures can contribute to the CO2 reduction by 64 million tons in 1995 in households and 27 in the commercial sector in which the potential decreases to 18 million tons in 2020 due to the autonomous technical development. Adequate promotion programmes can help to realise 20-30% of the potential by 2020. (orig.) [German] Ziel des Vorhabens war, im Sektor private Haushalte und Kleinverbrauch Bereiche zu identifizieren, in denen Verhaltensaenderungen zur Energieeinsparung fuehren koennen, und diese Potenziale fuer 1995, 2005 und 2020 zu quantifizieren. Darauf aufbauend waren Programme und Instrumente zur Umsetzung aufzuzeigen und zu bewerten. Gestuetzt auf Literaturrecherchen und Expertengespraeche wurden Einzelpotenziale, Rahmenbedingungen, Entwicklungstrends in der Technik und im Ausstattungsgrad ermittelt. Insgesamt koennten Verhaltensmassnahmen im Haushaltssektor die CO2-Emissionen im Basisjahr 1995 um 64 Mio, im Kleinverbrauch um 27 Mio t vermindern. Bis 2020 bleibt dieses Potenzial im Haushaltssektor in etwa gleich. Im Kleinverbrauch sinkt es infolge der autonomen Technikentwicklung auf 18 Mio t ab. Durch geeignete Programme koennen bis 2020 etwa 20-30% des Potenzials erreicht werden. (orig.)

  13. 30. MPA-Seminar 'Safety and reliability in energy technology' in conjunction with the 9th German-Japanese seminar. Vol. 2 (Papers 27-53); 30. MPA-Seminar 'Sicherheit und Verfuegbarkeit in der Energietechnik' in Verbindung mit dem 9. Deutsch-Japanischen Seminar. Bd. 2 (Vortraege 27-53)

    Energy Technology Data Exchange (ETDEWEB)

    Roos, E. (comp.)

    2004-07-01

    he 30th MPA-seminar on ''Safety and Availability in Energy Engineering'' was held in conjuction with the 9th German-Japanese Seminar. The 52 contributions were published in two volumes. Volume 1 contains the contributions to the following sessions: fracture mechanics, fatigue, welding, environmental impact and European research projects. Volume 2 contains contributions of sessions 6-9: high-temperature application, modelling-simulation, ageing management and non-destructive testing. (uke)

  14. Emission control at stationary sources in the Federal Republic of Germany. Vol 1. Sulphur oxide and nitrogen oxide emission control; Massnahmen zur Emissionsminderung bei stationaeren Quellen in der Bundesrepublik Deutschland. Bd. 1. Minderung der SO{sub 2}- und NO{sub x}-Emissionen

    Energy Technology Data Exchange (ETDEWEB)

    Rentz, O.; Schleef, H.J.; Dorn, R.; Sasse, H.; Karl, U.

    1997-05-01

    The first volume of the report covers the state of implementation of primary and secondary measures for SO{sub 2}- and NO{sub x} control applied in the most important industrial sectors in Germany. Integrated pollution abatement techniques, called primary measures in this report, such as process integrated measures and low emission processes, have gained increased importance in recent years. The end-of-pipe processes, described here as secondary measures, are generally highly effective. They represent mature technologies, which are capable of achieving significant reductions in SO{sub 2}- and NO{sub x} emissions, and which have been used in particular for retrofitting existing plants. At first, an overview is given regarding the development of SO{sub 2}- and NO{sub x} emissions in selected European countries during the last 20 years and in Europe. Current national and European emission limits and emission guidelines on SO{sub 2}- and NO{sub x} emissions from stationary sources are discussed as well. The state of implementation of measures for the reduction of SO{sub 2}- and NO{sub x} emissions is analysed for each relevant industrial sector and primary emission reduction options are described. Special units designede for direct contact of flame and process materials are dealt with in the different sector descriptions, while external combustion processes providing process heat and power are dealt with in a separate chapter. In the final section an overview of secondary emission reduction measures covering SO{sub 2}- and NO{sub x} control technology is given. For the various sectors, examples of investments and costs for installed emission reduction measures are given, which have to be considered as highly case specific. In addition, the suppliers of the various control technologies have given specific aspects related to specific process layout of their systems as well as references. (orig.) [Deutsch] Der erste Band des Berichts beschreibt den Anwendungsstand von Primaer- und Sekundaermassnahmen in den emissionsrelevanten Industriesektoren fuer SO{sub 2}- und NO{sub x} in Deutschland. Der Bericht gibt einen Ueberblick ueber die Entwicklung der SO{sub 2}- und NO{sub x}-Emissionen in ausgewaehlten europaeischen Laendern waehrend der letzten 20 Jahre und in Europa. Daran schliessen sich aktuelle nationale und europaeische Grenzwerte und Richtlinien zu der SO{sub 2}- und NO{sub x} Emissionen aus stationaeren Quellen an. Der Anwendungsstand von Massnahmen zur Minderung der SO{sub 2}- und NO{sub x}-Emissionen wird fuer jeden relevanten Industriesektor untersucht und primaere Minderungsoptionen beschrieben. Spezielle Prozesseinheiten mit direktem Kontakt von Flamme und Prozessgut werden in den einzelnen Prozessen diskutiert, waehrend externe Verbrennungsprozesse zur ausschliesslichen Bereitstellung von Prozesswaerme und elektrischer Energie sektoruebergreifend in einem separaten Kapitel behandelt werden. Der Bericht schliesst mit einem Ueberblick ueber die zur Verfuegung stehenden sekundaeren Minderungsmassnahmen. Fuer die einzelnen Sektoren werden Beispiele fuer Investitionen und Kosten fuer installierte Minderungstechnologien gegeben, die als einzelfallabhaengig anzusehen sind. Zusaetzlich stellten die Anbieter von Emissionsminderungstechnologien Verfahrensbeschreibungen ihrer Produkte einschliesslich Referenzen zur Verfuegung, die im Bericht enthalten sind. (orig.)

  15. [Dimitri Steinke: Die Zivilrechtsordnungen des Baltikums unter dem Einfluss ausländischer, insbesondere deutscher Rechtsquellen. (Osnabrücker Schriften zur Rechtsgeschichte, Bd. 16.) V&R unipress. Göttingen 2009. 243 S. ISBN 978-3-89971-573-6] / M

    Index Scriptorium Estoniae

    Luts-Sootak, Marju, 1966-

    2011-01-01

    Arvustus: Dimitri Steinke. Die Zivilrechtsordnungen des Baltikums unter dem Einfluss ausländischer, insbesondere deutscher Rechtsquellen. (Osnabrücker Schriften zur Rechtsgeschichte ; 16). Göttingen, 2009

  16. 23. MPA-Seminar: Safety and reliability of plant technology with special emphasis on behaviour of pressurized components and systems at increased loading. Vol. 1. Papers 1-26; 23. MPA-Seminar: Sicherheit und Verfuegbarkeit in der Anlagentechnik mit dem Schwerpunkt Verhalten von druckfuehrenden Komponenten und Systemen bei erhoehten Belastungen. Bd. 1. Vortraege 1-26

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1998-11-01

    This book is dedicated to the components of nuclear and conventional power plants with special emphasis on the behaviour of pressurized components and systems. The following topics are discussed: 1. integrity of pipes, vessels, and components and 2. fracture mechanics

  17. Dictionary of the energy-producing industry. Nuclear and non-nuclear energy sources. Vol. 3. Fachwoerterbuch zur Energiewirtschaft. Nukleare und nichtnukleare Energietraeger. - Diccionario tecnico de terminos de la industria de energia. Recursos energeticos nucleares y no nucleares. Bd. 3. Aleman-Espanol/Espanol-Aleman

    Energy Technology Data Exchange (ETDEWEB)

    Mannhardt, K.H.

    1981-01-01

    This technical dictionary, compiled in everyday practice, gives an outline of the terminology and phraseology of a modern field of engineering. Users should have some basic knowledge of the Spanish language and also of engineering as well as access to standard-language dictionaries. Core subjects of the dictionary are nuclear power, reactor engineering, fusion technology, solar energy, wind energy, tidal energy, radiation protection, nuclear safety, coal gasification and coal liquefaction, cooperative agreements and managerial problems.

  18. Development and evaluation of a meteorological model system for assessing the effect of environmental measures on climate and air quality. Vol. 1: Main part and appendices 1 through 5. Final report; Entwicklung und Evaluierung eines meteorologischen Modellsystems zur Folgenabschaetzung von Umwelteingriffen auf Klima und Luftqualitaet. Bd. 1: Hauptteil und Anhaenge 1 bis 5. Abschlussbericht

    Energy Technology Data Exchange (ETDEWEB)

    Bigalke, K. [METCON Umweltmeteorologische Beratung, Pinneberg (Germany); Schluenzen, K.H. [Hamburg Univ. (Germany). Meteorologisches Inst.

    2001-09-01

    The project focused on the development of a low-cost planning tool for authorities and consulting engineers which meets the envisaged national quality standards (VDI standards). The program system METRAS{sup +} consists of four components for preparation, implementation and quality assurance of mesoscale model calculations, all under Windows. The program system will not be commercialized; instead, it will be made available to interested users at a small fee by the Meteorological Institute of Hamburg University. [German] Ziel war die Bereitstellung eines kostenguenstigen Planungsinstrumentes fuer Behoerden und Beratungsunternehmen, das geplante nationale Qualitaetsnormen (VDI-Richtlinie) erfuellt. Vergleichbare Modelle existieren bislang nur im wissenschaftlichen Bereich, sind kaum qualitaetsgesichert und werden u.a. aus wirtschaftlichen Erwaegungen nur in Ausnahmefaellen eingesetzt. Das Programmsystem METRAS{sup +} setzt sich aus vier Programmkomponenten zusammen, die der Vorbereitung, Durchfuehrung und Qualitaetssicherung mesoskaliger Modellrechnungen dienen. Alle Programmkomponenten laufen unter einer gemeinsamen, anwenderfreundlichen Windowsoberflaeche. Um die breite Anwendung qualifizierter Untersuchungsmethoden im Umweltconsulting zu foerdern, ist geplant, METRAS{sup +} nicht kommerziell zu vertreiben und das Programmsystem interessierten Anwendern gegen einen geringen Kostenbeitrag zur Verfuegung zu stellen. Vertrieb und Oeffentlichkeitsarbeit sollen vom Meteorologischen Institut der Universitaet Hamburg geleistet werden. (orig.)

  19. Scenarios for an integrated sustainability policy - using the example of the ''Sustainable City 2030''. Vol. 4; Szenarien fuer eine integrierte Nachhaltigkeitspolitik - am Beispiel: Die nachhaltige Stadt 2030. Bd. 4. Der Szenario-Prozess - Dokumentation der Prozessergebnisse (Materialband)

    Energy Technology Data Exchange (ETDEWEB)

    Gassner, Robert [Institut fuer Zukunftsstudien und Technologiebewertung gGmbH (IZT), Berlin (Germany)

    2013-04-15

    This project was carried out by a consortium by the Institute for Futures Studies and Technology Assessment (Berlin, Federal Republic of Germany) and German Institute of Urban Affairs (Berlin, Federal Republic of Germany) in the period between December 2009 and November 2012. The project deals with the design of sustainable urban living environments. In a preliminary planning phase, the policy challenges and actors with their interests and future expectations for the project phase have been developed. In the main phase of the project, a systematic, participatory scenario process is used. In this, first normative scenarios for the Sustainable City 2030 Council were developed. From this, options for action, elements of strategy and practical networking approaches for integrated sustainability policies were derived and substantiated with respect to the operational implementation and practical cooperation in the environmental department.

  20. Environmental law in Thuringia. Text collection with introduction. Pt. 1. Waste law, nuclear, radiation and energy law, soil protection law and land reparcelling, forestry law, fishing and hunting law; Umweltrecht in Thueringen. Textsammlung mit Einfuehrung. Bd. 1. Abfallrecht, Atom-, Strahlenschutzrecht und Energierecht, Bodenschutzrecht und Flurbereinigung, Forstrecht, Fischerei- und Jagdrecht

    Energy Technology Data Exchange (ETDEWEB)

    Schneider, Matthias Werner (ed.)

    2015-07-01

    The volume 1 of the collection on the Thuringian Environmental Law contains additional to a detailed introduction: - Waste management - Nuclear, radiation and energy law - Soil protection law and land reparcelling - Forestry, fishery and hunting law. [German] Der Band 1 der Sammlung zum Thueringer Umweltrecht enthaelt neben einer ausfuehrlichen Einleitung: - Abfallrecht - Atom-, Strahlenschutzrecht und Energierecht - Bodenschutzrecht und Flurbereinigung - Forstrecht, Fischerei- und Jagdrecht.

  1. 24. MPA-seminar: safety and reliability of plant technology with special emphasis on integrity and life management. Vol. 2. Papers 28-63; 24. MPA-Seminar: Sicherheit und Verfuegbarkeit in der Anlagentechnik mit dem Schwerpunk Integritaet und Lebensdauermanagement. Bd. 2. Vortraege 28-63

    Energy Technology Data Exchange (ETDEWEB)

    1999-09-01

    The second volume is dedicated to the safety and reliability of plant technology with special emphasis on the integrity and life management. The following topics are discussed: 1. Integrity of vessels, pipes and components. 2. Fracture mechanics. 3. Measures for the extension of service life, and 4. Online Monitoring. All 30 contributions are separately analyzed for this database. (orig.)

  2. Scenarios for an integrated sustainability policy - using the example of the ''Sustainable City 2030''. Vol. 2; Szenarien fuer eine integrierte Nachhaltigkeitspolitik - am Beispiel: Die nachhaltige Stadt 2030. Bd. 2. Teilbericht ''Kreislaufstadt 2030''

    Energy Technology Data Exchange (ETDEWEB)

    Verbuecheln, Maic; Grabow, Busso; Uttke, Angela; Schwausch, Mandy [Deutsches Inst. fuer Urbanistik (DiFu), Berlin (Germany); Gassner, Robert [Institut fuer Zukunftsstudien und Technologiebewertung gGmbH (IZT), Berlin (Germany)

    2013-04-15

    The partial report ''Recycling City 2030'' was prepared for the Federal Environment Agency (Dessau, Federal Republic of Germany) as a part of the project ''Scenarios for an integrated sustainability policy - the example of 'The Sustainable City 2030 '''. This partial report is based on research activities of the German Institute of Urban Affairs (Berlin, Federal Republic of Germany) and Institute for Futures Studies and Technology Assessment (Berlin, Federal Republic of Germany). The objectives of this partial report are: (1) Description of the challenges and trends in urban regions; (2) Recycling city and its importance in the current debate on sustainability; (3) Identification and optimization of existing cycle approaches in urban habitats; (4) Analysis of the actual state as well as designation of developments and constraints; (5) Discussion on the interface between the sectors; (6) Options for action for the interaction between the actors in interdisciplinary topics; (7) Outline of ways and perspectives of the implementation of the ''Recycling City 2030''.

  3. 23. MPA-Seminar: Safety and reliability of plant technology with special emphasis on behaviour of pressurized components and systems at increased loading. Vol. 2. Papers 27-50; 23. MPA-Seminar: Sicherheit und Verfuegbarkeit in der Anlagentechnik mit dem Schwerpunkt Verhalten von druckfuehrenden Komponenten und Systemen bei erhoehten Belastungen. Bd. 2. Vortraege 27-50

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1998-11-01

    This book is dedicated to the components of nuclear and conventional power plants with special emphasis on the behaviour of pressurized components and systems. The following topics are discussed: 1. structure and safety analysis, 2. aging phenomena, 3. nondestructive testing, and 4. optimization of in-service inspection.

  4. Pollutants, mould and cleanliness - hygiene and health hazards in the home. Seminar volume of the Central Information Bureau for Environmental Consulting in Bavaria. Vol. 17; Schadstoffe, Schimmel und Sauberkeit - wie (un)gesund ist unser Zuhause? Seminarband der Zentralen Informationsstelle Umweltberatung Bayern. Bd. 17

    Energy Technology Data Exchange (ETDEWEB)

    Behling, G.; Spoettle, M.; Koller, U. (comps.)

    2001-07-01

    The seminar investigated the technical and hygienic requirements that should be made on constructional materials and interior materials, the potential health hazards involved, and the available alternatives. The following examples were presented: Trends and specifications in low-emission furniture and wood-based materials; Analysis of current flooring materials, glues and sealings; Disinfectants as sources of room air pollution; Potential hazards in domestic hygiene; Analysis of room air pollution levels; Practical consultations in environmental medicine. [German] Welche bautechnischen und innenraumhygienischen Anforderungen sind an Baustoffe und Materialien zu stellen ? Wie beeintraechtigen diese moeglicherweise die menschliche Gesundheit und wie sind oft hochgelobte Alternativen einzuschaetzen? Diese Fragen wurden anhand verschiedener Beispiele geklaert: Entwicklungen und Richtlinien bei emissionsarmen Moebeln und Holzwerkstoffen, Bewertung derzeit aktueller Bodenbelaege, Kleber und Oberflaechenbehandlungen, Quellen fuer eine Raumluftbelastung durch Schaedlingsbekaempfungsmittel, Gefahrenpotenziale in der Haushaltshygiene, Schimmelpilze und moegliche Massnahmen, Analyse der Innenraumluftbelastung, Umweltmedizinische Beratung in der Praxis. (orig.)

  5. Textile-based sampling for potentiometric determination of ions.

    Science.gov (United States)

    Lisak, Grzegorz; Arnebrant, Thomas; Ruzgas, Tautgirdas; Bobacka, Johan

    2015-06-02

    Potentiometric sensing utilizing textile-based micro-volume sampling was applied and evaluated for the determination of clinically (Na(+), K(+), Cl(-)) and environmentally (Cd(2+), Pb(2+) and pH) relevant analytes. In this technological design, calibration solutions and samples were absorbed into textiles while the potentiometric cells (ion-selective electrodes and reference electrode) were pressed against the textile. Once the liquid, by wicking action, reached the place where the potentiometric cell was pressed onto the textile, hence closing the electric circuit, the potentiometric response was obtained. Cotton, polyamide, polyester and their blends with elastane were applied for micro-volume sampling. The textiles were found to influence the determination of pH in environmental samples with pH close to neutral and Pb(2+) at low analyte concentrations. On the other hand, textile-based micro-volume sampling was successfully applied in measurements of Na(+) using solid-contact sodium-selective electrodes utilizing all the investigated textiles for sampling. It was found that in order to extend the application of textile-based sampling toward environmental analysis of ions it will be necessary to tailor the physio-chemical properties of the textile materials. In general, textile-based sampling opens new possibilities for direct chemical analysis of small-volume samples and provide a simple and low-cost method to screen various textiles for their effects on samples to identify which textiles are the most suitable for on-body sensing. Copyright © 2015 Elsevier B.V. All rights reserved.

  6. Specific alterations in plasma proteins during depressed, manic, and euthymic states of bipolar disorder

    International Nuclear Information System (INIS)

    Song, Y.R.; Wu, B.; Yang, Y.T.; Chen, J.; Zhang, L.J.; Zhang, Z.W.; Shi, H.Y.; Huang, C.L.; Pan, J.X.; Xie, P.

    2015-01-01

    Bipolar disorder (BD) is a common psychiatric mood disorder affecting more than 1-2% of the general population of different European countries. Unfortunately, there is no objective laboratory-based test to aid BD diagnosis or monitor its progression, and little is known about the molecular basis of BD. Here, we performed a comparative proteomic study to identify differentially expressed plasma proteins in various BD mood states (depressed BD, manic BD, and euthymic BD) relative to healthy controls. A total of 10 euthymic BD, 20 depressed BD, 15 manic BD, and 20 demographically matched healthy control subjects were recruited. Seven high-abundance proteins were immunodepleted in plasma samples from the 4 experimental groups, which were then subjected to proteome-wide expression profiling by two-dimensional electrophoresis and matrix-assisted laser desorption/ionization-time-of-flight/time-of-flight tandem mass spectrometry. Proteomic results were validated by immunoblotting and bioinformatically analyzed using MetaCore. From a total of 32 proteins identified with 1.5-fold changes in expression compared with healthy controls, 16 proteins were perturbed in BD independent of mood state, while 16 proteins were specifically associated with particular BD mood states. Two mood-independent differential proteins, apolipoprotein (Apo) A1 and Apo L1, suggest that BD pathophysiology may be associated with early perturbations in lipid metabolism. Moreover, down-regulation of one mood-dependent protein, carbonic anhydrase 1 (CA-1), suggests it may be involved in the pathophysiology of depressive episodes in BD. Thus, BD pathophysiology may be associated with early perturbations in lipid metabolism that are independent of mood state, while CA-1 may be involved in the pathophysiology of depressive episodes

  7. A pesticide paradox: fungicides indirectly increase fungal infections.

    Science.gov (United States)

    Rohr, Jason R; Brown, Jenise; Battaglin, William A; McMahon, Taegan A; Relyea, Rick A

    2017-12-01

    There are many examples where the use of chemicals have had profound unintended consequences, such as fertilizers reducing crop yields (paradox of enrichment) and insecticides increasing insect pests (by reducing natural biocontrol). Recently, the application of agrochemicals, such as agricultural disinfectants and fungicides, has been explored as an approach to curb the pathogenic fungus, Batrachochytrium dendrobatidis (Bd), which is associated with worldwide amphibian declines. However, the long-term, net effects of early-life exposure to these chemicals on amphibian disease risk have not been thoroughly investigated. Using a combination of laboratory experiments and analysis of data from the literature, we explored the effects of fungicide exposure on Bd infections in two frog species. Extremely low concentrations of the fungicides azoxystrobin, chlorothalonil, and mancozeb were directly toxic to Bd in culture. However, estimated environmental concentrations of the fungicides did not reduce Bd on Cuban tree frog (Osteopilus septentrionalis) tadpoles exposed simultaneously to any of these fungicides and Bd, and fungicide exposure actually increased Bd-induced mortality. Additionally, exposure to any of these fungicides as tadpoles resulted in higher Bd abundance and greater Bd-induced mortality when challenged with Bd post-metamorphosis, an average of 71 d after their last fungicide exposure. Analysis of data from the literature revealed that previous exposure to the fungicide itraconazole, which is commonly used to clear Bd infections, made the critically endangered booroolong frog (Litoria booroolongensis) more susceptible to Bd. Finally, a field survey revealed that Bd prevalence was positively associated with concentrations of fungicides in ponds. Although fungicides show promise for controlling Bd, these results suggest that, if fungicides do not completely eliminate Bd or if Bd recolonizes, exposure to fungicides has the potential to do more harm than

  8. Substance Use Disorders and Suicide Attempts in Bipolar Subtypes

    Science.gov (United States)

    Sublette, M. Elizabeth; Carballo, Juan J.; Moreno, Carmen; Galfalvy, Hanga C.; Brent, David A.; Birmaher, Boris; Mann, J. John; Oquendo, Maria A.

    2009-01-01

    1. Abstract Bipolar disorder (BD) is associated with high rates of suicide attempt and completion. Substance use disorders (SUD) have been identified as potent risk factors for suicidal behavior in BD. However, little is known concerning differences between BD subtypes with regard to SUD as a risk factor for suicidal behavior. We studied previous suicidal behavior in adults with a major depressive episode in context of BD type I (BD-I; N=96) or BD type II (BD-II; N=42), with and without history of SUD. Logistic regressions assessed the association between SUD and suicide attempt history by BD type, and exploratory analyses examined the effects of other clinical characteristics on these relationships. SUD were associated with suicide attempt in BD-I but not BD-II, an effect not attributable to sample size differences. The higher suicide attempt rate associated with alcoholism in BD-I was mostly explained by higher aggression scores, and earlier age of BD onset increased the likelihood that alcohol use disorder would be associated with suicide attempt(s). The higher suicide attempt rate associated with other drug use disorders in BD-I was collectively explained by higher impulsivity, hostility, and aggression scores. The presence of both alcohol and drug use disorders increased odds of a history of suicide attempt in a multiplicative fashion: 97% of BD-I who had both comorbid drug and alcohol use disorders had made a suicide attempt. A critical next question is how to target SUD and aggressive traits for prevention of suicidal behavior in BD-I. PMID:18590916

  9. Significance of human beta-defensins in the epithelial lining fluid of patients with chronic lower respiratory tract infections.

    Science.gov (United States)

    Yanagi, S; Ashitani, J; Imai, K; Kyoraku, Y; Sano, A; Matsumoto, N; Nakazato, M

    2007-01-01

    Human beta-defensins (hBDs) are the most abundant antimicrobial peptides in epithelial cells, and function in the host immune system. Respiratory epithelial cells express hBDs to inhibit bacterial proliferation during respiratory tract infections. The aim of this study was to investigate the release of hBDs into the respiratory tract and their benefit as a host defence system in chronic Pseudomonas aeruginosa infections. The levels of four hBD peptides (hBD-1-hBD-4) were measured in the bronchial epithelial lining fluid (ELF) of nine patients with chronic lower respiratory tract infection caused by P. aeruginosa. Eight patients with idiopathic pulmonary fibrosis and eight volunteers free of pulmonary disease were recruited as controls. ELF was obtained by bronchoscopic microsampling and hBD levels were measured by radioimmunoassays. The antimicrobial effects of hBDs were studied individually and in combination using an in-vitro colony count assay for P. aeruginosa. Concentrations of hBD-1 and hBD-3 tended to be higher in patients with chronic lower respiratory tract infection than in the controls. hBD-2 and hBD-4 were detected in ELF from five and four of nine patients, respectively, but the hBD levels in controls were all below the limits of detection. All patients with infection caused by mucoid P. aeruginosa had detectable hBD-2 and hBD-4 levels in ELF. In-vitro colony count assays showed a potential synergism between hBD-2 and hBD-4 in inhibiting bacterial proliferation. The findings indicate that hBDs, especially hBD-2 and hBD-4, are pathophysiologically important in infections caused by mucoid strains of P. aeruginosa.

  10. Specific alterations in plasma proteins during depressed, manic, and euthymic states of bipolar disorder

    Energy Technology Data Exchange (ETDEWEB)

    Song, Y.R. [Department of Neurology, The First Affiliated Hospital of Chongqing Medical University, Chongqing (China); Chongqing Key Laboratory of Neurobiology, Chongqing (China); Institute of Neuroscience and the Collaborative Innovation Center for Brain Science, Chongqing Medical University, Chongqing (China); Wu, B. [Chongqing Key Laboratory of Neurobiology, Chongqing (China); Institute of Neuroscience and the Collaborative Innovation Center for Brain Science, Chongqing Medical University, Chongqing (China); Yang, Y.T.; Chen, J. [Department of Neurology, The First Affiliated Hospital of Chongqing Medical University, Chongqing (China); Chongqing Key Laboratory of Neurobiology, Chongqing (China); Institute of Neuroscience and the Collaborative Innovation Center for Brain Science, Chongqing Medical University, Chongqing (China); Zhang, L.J.; Zhang, Z.W. [Chongqing Key Laboratory of Neurobiology, Chongqing (China); Institute of Neuroscience and the Collaborative Innovation Center for Brain Science, Chongqing Medical University, Chongqing (China); Shi, H.Y. [Department of Neurology, The First Affiliated Hospital of Chongqing Medical University, Chongqing (China); Chongqing Key Laboratory of Neurobiology, Chongqing (China); Institute of Neuroscience and the Collaborative Innovation Center for Brain Science, Chongqing Medical University, Chongqing (China); Huang, C.L.; Pan, J.X. [Chongqing Key Laboratory of Neurobiology, Chongqing (China); Institute of Neuroscience and the Collaborative Innovation Center for Brain Science, Chongqing Medical University, Chongqing (China); Xie, P. [Department of Neurology, The First Affiliated Hospital of Chongqing Medical University, Chongqing (China); Chongqing Key Laboratory of Neurobiology, Chongqing (China); Institute of Neuroscience and the Collaborative Innovation Center for Brain Science, Chongqing Medical University, Chongqing (China)

    2015-09-08

    Bipolar disorder (BD) is a common psychiatric mood disorder affecting more than 1-2% of the general population of different European countries. Unfortunately, there is no objective laboratory-based test to aid BD diagnosis or monitor its progression, and little is known about the molecular basis of BD. Here, we performed a comparative proteomic study to identify differentially expressed plasma proteins in various BD mood states (depressed BD, manic BD, and euthymic BD) relative to healthy controls. A total of 10 euthymic BD, 20 depressed BD, 15 manic BD, and 20 demographically matched healthy control subjects were recruited. Seven high-abundance proteins were immunodepleted in plasma samples from the 4 experimental groups, which were then subjected to proteome-wide expression profiling by two-dimensional electrophoresis and matrix-assisted laser desorption/ionization-time-of-flight/time-of-flight tandem mass spectrometry. Proteomic results were validated by immunoblotting and bioinformatically analyzed using MetaCore. From a total of 32 proteins identified with 1.5-fold changes in expression compared with healthy controls, 16 proteins were perturbed in BD independent of mood state, while 16 proteins were specifically associated with particular BD mood states. Two mood-independent differential proteins, apolipoprotein (Apo) A1 and Apo L1, suggest that BD pathophysiology may be associated with early perturbations in lipid metabolism. Moreover, down-regulation of one mood-dependent protein, carbonic anhydrase 1 (CA-1), suggests it may be involved in the pathophysiology of depressive episodes in BD. Thus, BD pathophysiology may be associated with early perturbations in lipid metabolism that are independent of mood state, while CA-1 may be involved in the pathophysiology of depressive episodes.

  11. American tertiary clinic-referred bipolar II disorder versus bipolar I disorder associated with hastened depressive recurrence.

    Science.gov (United States)

    Dell'Osso, Bernardo; Shah, Saloni; Do, Dennis; Yuen, Laura D; Hooshmand, Farnaz; Wang, Po W; Miller, Shefali; Ketter, Terence A

    2017-12-01

    Bipolar disorder (BD) is a chronic, frequently comorbid condition characterized by high rates of mood episode recurrence and suicidality. Little is known about prospective longitudinal characterization of BD type II (BD II) versus type I (BD I) in relation to time to depressive recurrence and recovery from major depressive episode. We therefore assessed times to depressive recurrence/recovery in tertiary clinic-referred BD II versus I patients. Outpatients referred to Stanford BD Clinic during 2000-2011 were assessed with Systematic Treatment Enhancement Program for BD (STEP-BD) Affective Disorders Evaluation and with Clinical Monitoring Form during up to 2 years of naturalistic treatment. Prevalence and clinical correlates of bipolar subtype in recovered (euthymic ≥8 weeks) and depressed patients were assessed. Kaplan-Meier analyses assessed the relationships between bipolar subtype and longitudinal depressive severity, and Cox proportional hazard analyses assessed the potential mediators. BD II versus BD I was less common among 105 recovered (39.0 vs. 61.0%, p = 0.03) and more common among 153 depressed (61.4 vs. 38.6%, p = 0.006) patients. Among recovered patients, BD II was associated with 6/25 (24.0%) baseline unfavorable illness characteristics/mood symptoms/psychotropics and hastened depressive recurrence (p = 0.015). Among depressed patients, BD II was associated with 8/25 (33.0%) baseline unfavorable illness characteristics/mood symptoms/psychotropics, but only non-significantly associated with delayed depressive recovery. BD II versus BD I was significantly associated with current depression and hastened depressive recurrence, but only non-significantly associated with delayed depressive recovery. Research on bipolar subtype relationships with depressive recurrence/recovery is warranted to enhance clinical management of BD patients.

  12. All-in-one detector of circulating mRNA based on a smartphone

    Science.gov (United States)

    Cmiel, Vratislav; Gumulec, Jaromir; Svoboda, Ondrej; Raudenska, Martina; Hudcova, Kristyna; Sekora, Jiri; Balogh, Jaroslav; Masarik, Michal; Provaznik, Ivo

    2016-03-01

    Metallothionein is significantly elevated in various tumors, notably in prostate cancer on both mRNA and protein level. We demonstrated a strong predictive potential of free circulating metallothionein 2A isoform mRNA for patients with this cancer. Circulating mRNA detection relies on expensive equipment and requires high level of expertise. In this work we developed compact "all-in-one" laboratory system which replace microvolume spectrophotometer, thermocycler and realtime PCR machines. We managed to design and construct a microprocessor controlled heating/cooling chamber that ensures required temperature gradient. The chamber includes implemented optical system to enable fluorescence excitation and fluorescence analysis using a smart-phone.

  13. Control of solvent evaporation in hen egg white lysozyme crystallization

    Science.gov (United States)

    Wilson, L. J.; Suddath, F. L.

    1992-01-01

    An investigation of the role of solvent evaporation in tetragonal lysozyme crystallization was preformed with a device that employs N2(g) to control the evaporation of solvent from a micro-volume crystallization hanging drop. The number of crystals was found to vary with the rate at which the final supersaturation level was achieved. It was found that the more rapid the approach to supersaturation the larger the number of crystals. Accordingly, the crystals reached a smaller terminal size. Elongation of the (110) face parallel to the four-fold axis was observed with the slower evaporation rates.

  14. Detection of functional structures in isolated perfused pig heart: methods and technical principles

    Science.gov (United States)

    Hiller, Michael; Rauh, Robert; Trinks, Tobias; Kessler, Manfred D.

    2002-06-01

    Light scattering in living heart tissue is mainly caused by mitochondria, but also by actin and myosin filaments, glycogen particles and others. In living tissue these subcellular structures are not stable but rather in a permanent change. Thus, one should be able to perceive the status of scattering structures by measurement of backscattered light in microvolumes. Our recent efforts aimed at detecting these structures by use of micro lightguides and scanning tissue spectroscopy technique (EMPHO II SSK) at isolated perfused pig hearts. The paper describes the technical principles of the scanning technique and gives an overview of our latest results.

  15. What is bizarre in bizarre delusions? A critical review

    DEFF Research Database (Denmark)

    Cermolacce, Michel René Joseph; Jensen, Lars Meldgaard Sass; Parnas, J

    2010-01-01

    or incomprehensible. Then, we provide a critical review of contemporary studies on the reliability of BD and their methodological and conceptual limitations. Current approaches have focused intensely on BD's reliability and have defined BD strictly in terms of delusional content--mainly in terms of the physical...... to delusional contents alone and requires taking into account the subjective side of BD (how altered experience manifests itself) as well as the conditions of intersubjective encounter (how BD are expressed to and experienced by the clinician). The notion of "bizarreness" in schizophrenia is not purely...

  16. Pathogenic fungus Batrachochytrium dendrobatidis in marbled water frog Telmatobius marmoratus: first record from Lake Titicaca, Bolivia.

    Science.gov (United States)

    Cossel, John; Lindquist, Erik; Craig, Heather; Luthman, Kyle

    2014-11-13

    The pathogenic fungus Batrachochytrium dendrobatidis (Bd) has been associated with amphibian declines worldwide but has not been well-studied among Critically Endangered amphibian species in Bolivia. We sampled free-living marbled water frogs Telmatobius marmoratus (Anura: Leptodactylidae) from Isla del Sol, Bolivia, for Bd using skin swabs and quantitative polymerase chain reactions. We detected Bd on 44% of T. marmoratus sampled. This is the first record of Bd in amphibians from waters associated with Lake Titicaca, Bolivia. These results further confirm the presence of Bd in Bolivia and substantiate the potential threat of this pathogen to the Critically Endangered, sympatric Titicaca water frog T. culeus and other Andean amphibians.

  17. Unexplored areas of psychotherapy in bipolar disorder.

    Science.gov (United States)

    Popovic, Dina; Yildiz, Ayşegül; Murphy, Paula; Colom, Francesc

    2014-01-01

    Several psychological interventions-including group psychoeducation, family-focused psychoeducation, and interpersonal social-rhythm therapy-have demonstrated prophylactic efficacy as an adjunct to medication in bipolar disorders (BDs). The field of psychological interventions for BD has experienced impressive progress over the last 15 years. Certain unexplored areas, however, require further research in order to establish the full potential of psychological interventions for BD. Such research should focus, among other things, on cognitive impairment associated with BD, BD in the elderly, comorbid anxiety disorders and other comorbidities, the treatment of BD in pregnant women, and the improvement of patients' overall physical health.

  18. Theoretical study on the molecular structure, intermolecular ...

    Indian Academy of Sciences (India)

    Hailong Wang

    N17–C18. → BD*(π)C3–O8 and BD(π)C19–C20. →. BD*(π)C1–C2 for S3, respectively. As indicated in. Table 2, the main interactions of S4 turn out to be halo- gen bonding and hydrogen bonding interactions, which are characterized by LP(σ)N17 → BD*(σ)C4–Cl10 and. LP(π)Cl10/LP(π)O8 → BD*(σ)N21–H26, and the cor ...

  19. Comparison of a gratitude-based and cognitive restructuring intervention for body dissatisfaction and dysfunctional eating behavior in college women.

    Science.gov (United States)

    Wolfe, Wendy L; Patterson, Kaitlyn

    2017-01-01

    Researchers have investigated the efficacy of a gratitude intervention for decreasing body dissatisfaction (BD) in an internet treatment-seeking sample and demonstrated it worked equally well to decrease BD as cognitive restructuring. We extend this research by testing the efficacy of a gratitude intervention on BD, along with common sequelae of BD: dysfunctional eating, negative mood, and depressive symptoms. Females were randomly assigned to Gratitude, Cognitive Restructuring, or Control conditions. Pre- to post-intervention period comparisons found the gratitude intervention to perform better than the other conditions at increasing body esteem, decreasing BD, reducing dysfunctional eating, and reducing depressive symptoms.

  20. Longitudinal investigation of the parietal lobe anatomy in bipolar disorder and its association with general functioning.

    Science.gov (United States)

    Ferro, Adele; Bonivento, Carolina; Delvecchio, Giuseppe; Bellani, Marcella; Perlini, Cinzia; Dusi, Nicola; Marinelli, Veronica; Ruggeri, Mirella; Altamura, A Carlo; Crespo-Facorro, Benedicto; Brambilla, Paolo

    2017-09-30

    The parietal lobe (PL) supports cognitive domains, including attention and memory, which are impaired in bipolar disorder (BD). Although cross-sectional voxel-based morphometry studies found reduced PL grey matter (GM) in BD, none has longitudinally focused on PL anatomy in BD, relating it to patients' functioning. Thirty-eight right-handed BD patients and 42 matched healthy subjects (HS) underwent a Magnetic Resonance Imaging (MRI) scan at baseline. Seventeen BD patients and 16 matched HS underwent a follow-up MRI. PL white matter (WM) and GM volumes were measured. The trajectory of parietal volumes over time and the possible relation with the global functioning were investigated in both BD patients and HS. At baseline, BD patients showed significant reduced PL WM and GM and different WM laterality compared with HS. Furthermore, smaller PL WM volumes predicted lower global functioning in BD, but not in HS. At follow-up, although BD patients reported reduced PL WM compared with HS, no different pattern of volume changes over time was detected between groups. This study suggests the involvement of the PL in the pathophysiology of BD. In particular, PL WM reductions seem to predict an impairment in general functioning in BD and might represent a marker of functional outcome. Copyright © 2017. Published by Elsevier B.V.

  1. Widespread presence of the pathogenic fungus Batrachochytrium dendrobatidis in wild amphibian communities in Madagascar

    Science.gov (United States)

    Bletz, Molly C.; Rosa, Gonçalo M.; Andreone, Franco; Courtois, Elodie A.; Schmeller, Dirk S.; Rabibisoa, Nirhy H. C.; Rabemananjara, Falitiana C. E.; Raharivololoniaina, Liliane; Vences, Miguel; Weldon, Ché; Edmonds, Devin; Raxworthy, Christopher J.; Harris, Reid N.; Fisher, Matthew C.; Crottini, Angelica

    2015-01-01

    Amphibian chytridiomycosis, an emerging infectious disease caused by the fungus Batrachochytrium dendrobatidis (Bd), has been a significant driver of amphibian declines. While globally widespread, Bd had not yet been reported from within Madagascar. We document surveys conducted across the country between 2005 and 2014, showing Bd's first record in 2010. Subsequently, Bd was detected in multiple areas, with prevalence reaching up to 100%. Detection of Bd appears to be associated with mid to high elevation sites and to have a seasonal pattern, with greater detectability during the dry season. Lineage-based PCR was performed on a subset of samples. While some did not amplify with any lineage probe, when a positive signal was observed, samples were most similar to the Global Panzootic Lineage (BdGPL). These results may suggest that Bd arrived recently, but do not exclude the existence of a previously undetected endemic Bd genotype. Representatives of all native anuran families have tested Bd-positive, and exposure trials confirm infection by Bd is possible. Bd's presence could pose significant threats to Madagascar's unique “megadiverse” amphibians. PMID:25719857

  2. Genome-wide association study of behavioral disinhibition in a selected adolescent sample

    Science.gov (United States)

    Derringer, Jaime; Corley, Robin P.; Haberstick, Brett C.; Young, Susan E.; Demmitt, Brittany; Howrigan, Daniel P.; Kirkpatrick, Robert M.; Iacono, William G.; McGue, Matt; Keller, Matthew; Brown, Sandra; Tapert, Susan; Hopfer, Christian J.; Stallings, Michael C.; Crowley, Thomas J.; Rhee, Soo Hyun; Krauter, Ken; Hewitt, John K.; McQueen, Matthew B.

    2015-01-01

    Behavioral disinhibition (BD) is a quantitative measure designed to capture the heritable variation encompassing risky and impulsive behaviors. As a result, BD represents an ideal target for discovering genetic loci that predispose individuals to a wide range of antisocial behaviors and substance misuse that together represent a large cost to society as a whole. Published genome-wide association studies (GWAS) have examined specific phenotypes that fall under the umbrella of BD (e.g. alcohol dependence, conduct disorder); however no GWAS has specifically examined the overall BD construct. We conducted a GWAS of BD using a sample of 1,901 adolescents over-selected for characteristics that define high BD, such as substance and antisocial behavior problems, finding no individual locus that surpassed genome-wide significance. Although no single SNP was significantly associated with BD, restricted maximum likelihood analysis estimated that 49.3% of the variance in BD within the Caucasian sub-sample was accounted for by the genotyped SNPs (p=0.06). Gene-based tests identified seven genes associated with BD (p≤2.0×10−6). Although the current study was unable to identify specific SNPs or pathways with replicable effects on BD, the substantial sample variance that could be explained by all genotyped SNPs suggests that larger studies could successfully identify common variants associated with BD. PMID:25637581

  3. Neurocognitive features in subgroups of bipolar disorder

    Science.gov (United States)

    Aminoff, Sofie Ragnhild; Hellvin, Tone; Lagerberg, Trine Vik; Berg, Akiah Ottesen; Andreassen, Ole A; Melle, Ingrid

    2013-01-01

    Objective To examine which subgroups of DSM-IV bipolar disorder (BD) [BD type I (BD-I) or BD type II (BD-II), and subgroups based on history of psychosis, presenting polarity, and age at onset] differentiate best regarding neurocognitive measures. Methods A total of 199 patients with BD were characterized by clinical and neurocognitive features. The distribution of subgroups in this sample was: BD-I, 64% and BD-II, 36%; 60% had a history of psychosis; 57% had depression as the presenting polarity; 61% had an early onset of BD, 25% had a mid onset, and 14% had a late onset. We used multivariate regression analyses to assess relationships between neurocognitive variables and clinical subgroups. Results Both BD-I diagnosis and elevated presenting polarity were related to impairments in verbal memory, with elevated presenting polarity explaining more of the variance in this cognitive domain (22.5%). History of psychosis and BD-I diagnosis were both related to impairment in semantic fluency, with history of psychosis explaining more of the variance (11.6%). Conclusion Poor performance in verbal memory appears to be associated with an elevated presenting polarity, and poor performance in semantic fluency appears to be associated with a lifetime history of psychosis. PMID:23521608

  4. Differences in clinical presentation between bipolar I and II disorders in the early stages of bipolar disorder: A naturalistic study.

    Science.gov (United States)

    Vinberg, Maj; Mikkelsen, Rie Lambaek; Kirkegaard, Thomas; Christensen, Ellen Margrethe; Kessing, Lars Vedel

    2017-01-15

    In a naturalistic clinical study of patients in the early stages of bipolar disorders the aim was to assess differences between patients with bipolar I (BD I) and bipolar II (BD II) disorders on clinical characteristics including affective symptoms, subjective cognitive complaints, functional level, the presence of comorbid personality disorders and coping strategies. Diagnoses were confirmed using the Structured Clinical Interview for DSM-IV Disorders. Clinical symptoms were rated with the Young Mania Rating Scale and the Hamilton Depression Rating Scale, and functional status using the Functional Assessment Short Test. Cognitive complaints were assessed using the Massachusetts General Hospital Cognitive and Physical Functioning Questionnaire, the presence of comorbid personality disorders using the Standardized Assessment of Personality - Abbreviated Scale and coping style using the Coping Inventory for Stressful Situations. In total, 344 patients were included (BD I (n=163) and BD II (n=181). Patients with BD II presented with significantly more depressive symptoms, more cognitive complaints, lower overall functioning, and a higher prevalence of comorbid personality disorders. Finally, they exhibited a trend towards using less adaptive coping styles. It cannot be omitted that some patients may have progressed from BD II to BD I. Most measures were based on patient self report. Overall, BD II was associated with a higher disease burden. Clinically, it is important to differentiate BD II from BD I and research wise, there is a need for tailoring and testing specific interventions towards BD II. Copyright © 2016 Elsevier B.V. All rights reserved.

  5. Methionine sulfoxide reductase A (MsrA) associated with bipolar I disorder and executive functions in A Han Chinese population.

    Science.gov (United States)

    Ni, Peiyan; Ma, Xiaohong; Lin, Yin; Lao, Guohui; Hao, Xiaoyu; Guan, Lijie; Li, Xuan; Jiang, Zeyu; Liu, Yuping; Ye, Biyu; Liu, Xiang; Wang, Yingcheng; Zhao, Liansheng; Cao, Liping; Li, Tao

    2015-09-15

    The oxidative stress hypothesis proposed to explain bipolar I disorder (BD I) pathogenesis has gained growing attention based on its association with cognitive impairment. The aim of the present study was to explore the association of the methionine sulfoxide reductase A (MsrA) gene with BD I as well as executive functions of BD I patients. A total of 44 tagging single-nucleotide polymorphisms within the MsrA gene were selected to analyze gene association with BD I in 375 BD I patients and 475 controls in a Han Chinese population. The association of MsrA haplotypes with executive functions was analyzed in 157 clinically stable BD I patients and 210 controls. Allele frequencies of the rs4840463 polymorphism were significantly different between BD I patients and controls, and between patients with psychotic symptoms and controls. BD I patients performed more poorly in 11 of the 13 neurocognitive measurements compared with controls. Three MsrA haplotypes showed significant associations with different executive functions. The limited sample size requires a cautious conclusion, and further comprehensive approaches are needed to explore the mechanism of MsrA's effect on BD I. The rs4840463 polymorphism in the MsrA gene may be associated with the increased risk of BD I in a Chinese population. The association of MsrA haplotypes with executive functions indicated that MsrA is associated with executive function defects in BD I patients. Copyright © 2015 Elsevier B.V. All rights reserved.

  6. Prevalence of Circadian Rhythm Sleep-Wake Disorders and Associated Factors in Euthymic Patients with Bipolar Disorder.

    Directory of Open Access Journals (Sweden)

    Yoshikazu Takaesu

    Full Text Available Recent studies have suggested that there are certain pathophysiological relationships between bipolar disorder (BD and circadian rhythm dysfunction. However, apparently no studies have clarified the prevalence of circadian rhythm sleep-wake disorders (CRSWD in patients with BD. This study was set out to investigate the prevalence of CRSWD and associated factors in patients with BD. One hundred four euthymic BD outpatients participated in this study. The subjects were asked to answer questionnaires including demographic variables, clinical course of BD, and family history of psychiatric disorders and suicide. Severity of BD was assessed by the Montgomery-Åsberg Depression Rating Scale and Young Mania Rating Scale. CRSWD was diagnosed by clinical interview, together with sleep logs, according to the International Classification of Sleep Disorders, third edition (ICSD-3. Thirty-five subjects (32.4% met the criteria for CRSWD. The age at the time of investigation and that at the onset of BD were both lower in the CRSWD group than in the non-CRSWD group. The rates of family history of psychiatric disorders and suicide in the CRSWD group were higher than those in the non-CRSWD group. Multiple logistic regression analysis revealed that the presence of CRSWD was significantly associated with younger onset age of BD and family history of suicide. The prevalence of CRSWD could be quite high in BD patients. Younger onset age of BD and family history of suicide were associated with presence of CRSWD in BD patients.

  7. Genetic Association of , and - with Behcet's Disease in Saudi Patients

    Directory of Open Access Journals (Sweden)

    Fahda Al-Okaily

    2016-01-01

    Full Text Available Background HLA-B*51 has been universally associated with Behcet's disease (BD susceptibility, while different alleles of HLA-A have also been identified as independent BD susceptibility loci in various ethnic populations. The objective of this study was to investigate associations of HLA-A and - B alleles with BD in Saudi patients. Materials and Methods Genotyping for HLA-A and HLA-B was performed using HLA genotyping kit (Lab type (R SSO in 120 Saudi subjects, including 60 BD patients and 60 matched healthy controls. Results Our results revealed that frequencies of HLA-A*26, -A*31 , and - B*51 were significantly higher in BD patients than in controls, suggesting that HLA-A*26, -A*31 , and - B*51 are associated with BD. The frequency of HLA-B*15 was significantly lower in BD patients than in controls. Stratification of genotyping results into active and nonactive forms of BD revealed that the frequency of HLA-A*31 was significantly higher in the nonactive form than in the active form of BD, while there was no significant difference in the distribution of other alleles between the two forms of BD. Conclusion This study suggests that HLA-A*26, -A*31 , and - B*51 are associated with susceptibility risk to BD, while HLA-B*15 may be protective in Saudi patients. However, larger scale studies are needed to confirm these findings.

  8. The association between school exam grades and subsequent development of bipolar disorder

    DEFF Research Database (Denmark)

    Pedersen, Steffie Damgaard; Østergaard, Søren Dinesen; Petersen, Liselotte

    2018-01-01

    and bipolar I disorder (BD-I) has not been studied. Therefore, we aimed to study the association between school exam grades and subsequent development of BD and BD-I while adjusting for parental history of mental disorder. METHODS: We conducted a register-based nationwide cohort study following 505 688......OBJECTIVE: Prior studies have indicated that both high and low school grades are associated with development of bipolar disorder (BD), but these studies have not adjusted for parental history of mental disorder, which is a likely confounder. Furthermore, the association between school grades...... individuals born in Denmark between 1987 and 1995. We investigated the association between school exam grades and development of BD or BD-I with a Cox model adjusting for family history of mental disorder and other potential confounders. RESULTS: During follow-up, 900 individuals were diagnosed with BD...

  9. Confronting inconsistencies in the amphibian-chytridiomycosis system: implications for disease management.

    Science.gov (United States)

    Venesky, Matthew D; Raffel, Thomas R; McMahon, Taegan A; Rohr, Jason R

    2014-05-01

    Chytridiomycosis, caused by the pathogenic fungus Batrachochytrium dendrobatidis (Bd), is one of the largest threats to wildlife and is putatively linked to the extirpation of numerous amphibians. Despite over a decade of research on Bd, conflicting results from a number of studies make it difficult to forecast where future epizootics will occur and how to manage this pathogen effectively. Here, we emphasize how resolving these conflicts will advance Bd management and amphibian conservation efforts. We synthesize current knowledge on whether Bd is novel or endemic, whether amphibians exhibit acquired resistance to Bd, the importance of host resistance versus tolerance to Bd, and how biotic (e.g. species richness) and abiotic factors (e.g. climate change) affect Bd abundance. Advances in our knowledge of amphibian-chytrid interactions might inform the management of fungal pathogens in general, which are becoming more common and problematic globally. © 2013 The Authors. Biological Reviews © 2013 Cambridge Philosophical Society.

  10. Rare esophageal ulcers related to Behçet disease: A case report.

    Science.gov (United States)

    Jia, Ning; Tang, Yanping; Liu, Huayi; Li, Yang; Liu, Simiao; Liu, Lei

    2017-11-01

    The fundamental pathogenesis of Behçet disease (BD) is still unclear and controversial. Many cases of oral aphthous ulcers and genital ulcers related to BD are reported; nevertheless, idiopathic giant esophageal ulcers related to BD are rare. A rare case for esophageal ulcers related to BD is presented. In China, BD is represented with esophageal involvement which is called esophageal BD (EBD). A 56-year-old man diagnosed to the Gastroenterology Department of Integrated Traditional Chinese and Western Medicine Hospital, for multiple discrete, elliptical esophageal ulcers related to BD. The esophageal ulcers were treated with corticosteroid treatment for 12 weeks. The esophageal ulcers were cured. Our report might give further strength to avoiding the erroneous diagnosis or missed diagnosis for EBD, which is different from esophageal carcinoma, esophageal tuberculosis and esophageal Crohns disease.

  11. Rapid Growth Rates of Suspected Pancreatic Cyst Branch Duct Intraductal Papillary Mucinous Neoplasms Predict Malignancy.

    Science.gov (United States)

    Kwong, Wilson T; Lawson, Robert D; Hunt, Gordon; Fehmi, Syed M; Proudfoot, James A; Xu, Ronghui; Giap, Andrew; Tang, Raymond S; Gonzalez, Ingrid; Krinsky, Mary L; Savides, Thomas J

    2015-09-01

    The majority of branch duct intraductal papillary mucinous neoplasms (BD-IPMNs) are recommended for surveillance imaging based on consensus guidelines. However, growth rates that should prompt concern for malignant transformation of BD-IPMN are unknown. To determine whether BD-IPMN growth can predict an increased risk of malignancy and define growth rates concerning for malignant BD-IPMN. The study is a retrospective, multicenter study of suspected BD-IPMN patients undergoing imaging surveillance. All patients underwent EUS evaluation followed by surveillance imaging. Two hundred and eighty-four patients with suspected BD-IPMN without worrisome features or high-risk stigmata were followed for a median 56 months and underwent a median of four imaging studies. Nine patients (3.2 %) developed malignant BD-IPMN. Malignant BD-IPMN grew at a faster rate (18.6 vs. 0.8 mm/year; P = 0.05) compared to benign BD-IPMN. BD-IPMN growth rate between 2 and 5 mm/year was associated with an increased risk of malignancy with hazard ratio (HR) of 11.4 (95 % CI 2.2-58.6) when compared to subjects with BD-IPMN growth rate malignancy. Total BD-IPMN growth was also associated with increased risk of malignancy (P = 0.003) with all malignant IPMNs growing at least 10 mm prior to cancer diagnosis. BD-IPMN growth rates ≥2 mm/year and total growth of ≥10 mm should be considered worrisome features for BD-IPMN at increased risk of malignancy.

  12. A cost-effectiveness analysis of calcipotriol plus betamethasone dipropionate aerosol foam versus gel for the topical treatment of plaque psoriasis.

    Science.gov (United States)

    Foley, Peter; Garrett, Sinead; Ryttig, Lasse

    2018-01-24

    Calcipotriol 50 µg/g and betamethasone 0.5 mg/g dipropionate (Cal/BD) aerosol foam formulation provides greater effectiveness and improved patient preference compared with traditional Cal/BD formulations for the topical treatment of plaque psoriasis. To determine the cost-effectiveness of Cal/BD foam compared with Cal/BD gel from the Australian perspective. A Markov model was developed to evaluate the cost-effectiveness of topical Cal/BD foam and gel for the treatment of people with plaque psoriasis. Treatment effectiveness, safety, and utilities were based on a randomized control trial, resource use was informed by expert opinion, and unit costs were obtained from public sources. Outcomes were reported in terms of 1-year costs, quality-adjusted life years, and incremental cost-effectiveness ratios. All costs were reported in 2017 Australian Dollars. The model showed that patients using Cal/BD foam had more QALYs and higher costs over 1 year compared with patients using Cal/BD gel, resulting in a cost of $13,609 per QALY gained at 4-weeks. When 4 weeks of Cal/BD foam was compared with 8 weeks of Cal/BD gel treatment, Cal/BD foam was $8 less expensive and resulted in 0.006 more QALYs gained. Sensitivity analyses showed that, compared with Cal/BD ointment, Cal/BD foam was associated with an incremental cost of $15,091 per QALY gained. Cal/BD foam is the most cost-effective Cal/BD formulation for the topical treatment of patients with plaque psoriasis.

  13. Clinical and familial profile of bipolar disorder with and without obsessive-compulsive disorder: an Indian study

    Directory of Open Access Journals (Sweden)

    Firoz Kazhungil

    Full Text Available Abstract Introduction Comorbid obsessive-compulsive disorder (OCD is common in bipolar disorder (BD. Clinical characteristics, functionality and familial pattern of this comorbidity are largely understudied. Objective To assess clinical profile, familial loading of psychiatric disorders and level of functioning in remitted BD patients who have comorbid OCD and to compare results with those of remitted BD patients without OCD. Methods Remitted BD-I subjects were assessed using the Structured Clinical Interview for DSM-IV Axis I Disorders, Global Assessment of Functioning Scale (GAF, Hamilton Depression Rating Scale (HDRS, Young Mania Rating Scale (YMRS, Yale-Brown Obsessive-Compulsive Scale (Y-BOCS and Family Interview for Genetic Studies (FIGS. BD patients with and without OCD were compared. Group differences were analyzed using the chi-square test and the independent samples t test. Values <0.05 were considered statistically significant. Results Of the 90 remitted BD-I patients, 35.5% (n=32 had obsessive-compulsive symptoms/OCD. The BD-OCD group showed significantly lower GAF scores, higher rates of suicidal attempts, hospitalizations, manic and depressive episodes compared to the group with BD only (p<0.05. In addition, first and second-degree relatives had higher rates of BD-OCD and OCD, but not of BD. Conclusions BD-OCD is characterized by more severe BD, more dysfunction and higher familial loading of BD-OCD and OCD. Larger studies involving relatives of probands will help to confirm our findings and to delineate nosological status of BD-OCD comorbidity.

  14. Cool temperatures reduce antifungal activity of symbiotic bacteria of threatened amphibians--implications for disease management and patterns of decline.

    Directory of Open Access Journals (Sweden)

    Joshua H Daskin

    Full Text Available Chytridiomycosis, caused by the fungus Batrachochytrium dendrobatidis (Bd, is a widespread disease of amphibians responsible for population declines and extinctions. Some bacteria from amphibians' skins produce antimicrobial substances active against Bd. Supplementing populations of these cutaneous antifungal bacteria might help manage chytridiomycosis in wild amphibians. However, the activity of protective bacteria may depend upon environmental conditions. Biocontrol of Bd in nature thus requires knowledge of how environmental conditions affect their anti-Bd activity. For example, Bd-driven amphibian declines have often occurred at temperatures below Bd's optimum range. It is possible these declines occurred due to reduced anti-Bd activity of bacterial symbionts at cool temperatures. Better understanding of the effects of temperature on chytridiomycosis development could also improve risk evaluation for amphibian populations yet to encounter Bd. We characterized, at a range of temperatures approximating natural seasonal variation, the anti-Bd activity of bacterial symbionts from the skins of three species of rainforest tree frogs (Litoria nannotis, Litoria rheocola, and Litoria serrata. All three species declined during chytridiomycosis outbreaks in the late 1980s and early 1990s and have subsequently recovered to differing extents. We collected anti-Bd bacterial symbionts from frogs and cultured the bacteria at constant temperatures from 8 °C to 33 °C. Using a spectrophotometric assay, we monitored Bd growth in cell-free supernatants (CFSs from each temperature treatment. CFSs from 11 of 24 bacteria showed reduced anti-Bd activity in vitro when they were produced at cool temperatures similar to those encountered by the host species during population declines. Reduced anti-Bd activity of metabolites produced at low temperatures may, therefore, partially explain the association between Bd-driven declines and cool temperatures. We show that to

  15. DNA Extraction Method Affects the Detection of a Fungal Pathogen in Formalin-Fixed Specimens Using qPCR.

    Directory of Open Access Journals (Sweden)

    Andrea J Adams

    Full Text Available Museum collections provide indispensable repositories for obtaining information about the historical presence of disease in wildlife populations. The pathogenic amphibian chytrid fungus Batrachochytrium dendrobatidis (Bd has played a significant role in global amphibian declines, and examining preserved specimens for Bd can improve our understanding of its emergence and spread. Quantitative PCR (qPCR enables Bd detection with minimal disturbance to amphibian skin and is significantly more sensitive to detecting Bd than histology; therefore, developing effective qPCR methodologies for detecting Bd DNA in formalin-fixed specimens can provide an efficient and effective approach to examining historical Bd emergence and prevalence. Techniques for detecting Bd in museum specimens have not been evaluated for their effectiveness in control specimens that mimic the conditions of animals most likely to be encountered in museums, including those with low pathogen loads. We used American bullfrogs (Lithobates catesbeianus of known infection status to evaluate the success of qPCR to detect Bd in formalin-fixed specimens after three years of ethanol storage. Our objectives were to compare the most commonly used DNA extraction method for Bd (PrepMan, PM to Macherey-Nagel DNA FFPE (MN, test optimizations for Bd detection with PM, and provide recommendations for maximizing Bd detection. We found that successful detection is relatively high (80-90% when Bd loads before formalin fixation are high, regardless of the extraction method used; however, at lower infection levels, detection probabilities were significantly reduced. The MN DNA extraction method increased Bd detection by as much as 50% at moderate infection levels. Our results indicate that, for animals characterized by lower pathogen loads (i.e., those most commonly encountered in museum collections, current methods may underestimate the proportion of Bd-infected amphibians. Those extracting DNA from

  16. DNA Extraction Method Affects the Detection of a Fungal Pathogen in Formalin-Fixed Specimens Using qPCR.

    Science.gov (United States)

    Adams, Andrea J; LaBonte, John P; Ball, Morgan L; Richards-Hrdlicka, Kathryn L; Toothman, Mary H; Briggs, Cheryl J

    2015-01-01

    Museum collections provide indispensable repositories for obtaining information about the historical presence of disease in wildlife populations. The pathogenic amphibian chytrid fungus Batrachochytrium dendrobatidis (Bd) has played a significant role in global amphibian declines, and examining preserved specimens for Bd can improve our understanding of its emergence and spread. Quantitative PCR (qPCR) enables Bd detection with minimal disturbance to amphibian skin and is significantly more sensitive to detecting Bd than histology; therefore, developing effective qPCR methodologies for detecting Bd DNA in formalin-fixed specimens can provide an efficient and effective approach to examining historical Bd emergence and prevalence. Techniques for detecting Bd in museum specimens have not been evaluated for their effectiveness in control specimens that mimic the conditions of animals most likely to be encountered in museums, including those with low pathogen loads. We used American bullfrogs (Lithobates catesbeianus) of known infection status to evaluate the success of qPCR to detect Bd in formalin-fixed specimens after three years of ethanol storage. Our objectives were to compare the most commonly used DNA extraction method for Bd (PrepMan, PM) to Macherey-Nagel DNA FFPE (MN), test optimizations for Bd detection with PM, and provide recommendations for maximizing Bd detection. We found that successful detection is relatively high (80-90%) when Bd loads before formalin fixation are high, regardless of the extraction method used; however, at lower infection levels, detection probabilities were significantly reduced. The MN DNA extraction method increased Bd detection by as much as 50% at moderate infection levels. Our results indicate that, for animals characterized by lower pathogen loads (i.e., those most commonly encountered in museum collections), current methods may underestimate the proportion of Bd-infected amphibians. Those extracting DNA from archived museum

  17. Enhanced bioactive properties of BiodentineTM modified with bioactive glass nanoparticles

    Directory of Open Access Journals (Sweden)

    Camila CORRAL NUÑEZ

    Full Text Available Abstract Objective To prepare nanocomposite cements based on the incorporation of bioactive glass nanoparticles (nBGs into BiodentineTM (BD, Septodent, Saint-Maur-des-Fosses Cedex, France and to assess their bioactive properties. Material and Methods nBGs were synthesised by the sol-gel method. BD nanocomposites (nBG/BD were prepared with 1 and 2% nBGs by weight; unmodified BD and GC Fuji IX (GIC, GC Corporation, Tokyo, Japan were used as references. The in vitro ability of the materials to induce apatite formation was assessed in SBF by X-ray diffraction (XRD, attenuated total reflectance with Fourier transform infrared spectroscopy (ATR-FTIR, and scanning electron microscopy (SEM with energy dispersive X-ray (EDX analysis. BD and nBG/BD were also applied to dentine discs for seven days; the morphology and elemental composition of the dentine-cement interface were analysed using SEM-EDX. Results One and two percent nBG/BD composites accelerated apatite formation on the disc surface after short-term immersion in SBF. Apatite was detected on the nBG/BD nanocomposites after three days, compared with seven days for unmodified BD. No apatite formation was detected on the GIC surface. nBG/BD formed a wider interfacial area with dentine than BD, showing blockage of dentine tubules and Si incorporation, suggesting intratubular precipitation. Conclusions The incorporation of nBGs into BD improves its in vitro bioactivity, accelerating the formation of a crystalline apatite layer on its surface after immersion in SBF. Compared with unmodified BD, nBG/BD showed a wider interfacial area with greater Si incorporation and intratubular precipitation of deposits when immersed in SBF.

  18. Enhanced bioactive properties of BiodentineTM modified with bioactive glass nanoparticles

    Science.gov (United States)

    CORRAL NUÑEZ, Camila; COVARRUBIAS, Cristian; FERNANDEZ, Eduardo; de OLIVEIRA, Osmir Batista

    2017-01-01

    Abstract Objective To prepare nanocomposite cements based on the incorporation of bioactive glass nanoparticles (nBGs) into BiodentineTM (BD, Septodent, Saint-Maur-des-Fosses Cedex, France) and to assess their bioactive properties. Material and Methods nBGs were synthesised by the sol-gel method. BD nanocomposites (nBG/BD) were prepared with 1 and 2% nBGs by weight; unmodified BD and GC Fuji IX (GIC, GC Corporation, Tokyo, Japan) were used as references. The in vitro ability of the materials to induce apatite formation was assessed in SBF by X-ray diffraction (XRD), attenuated total reflectance with Fourier transform infrared spectroscopy (ATR-FTIR), and scanning electron microscopy (SEM) with energy dispersive X-ray (EDX) analysis. BD and nBG/BD were also applied to dentine discs for seven days; the morphology and elemental composition of the dentine-cement interface were analysed using SEM-EDX. Results One and two percent nBG/BD composites accelerated apatite formation on the disc surface after short-term immersion in SBF. Apatite was detected on the nBG/BD nanocomposites after three days, compared with seven days for unmodified BD. No apatite formation was detected on the GIC surface. nBG/BD formed a wider interfacial area with dentine than BD, showing blockage of dentine tubules and Si incorporation, suggesting intratubular precipitation. Conclusions The incorporation of nBGs into BD improves its in vitro bioactivity, accelerating the formation of a crystalline apatite layer on its surface after immersion in SBF. Compared with unmodified BD, nBG/BD showed a wider interfacial area with greater Si incorporation and intratubular precipitation of deposits when immersed in SBF. PMID:28403358

  19. Calcipotriol plus betamethasone dipropionate aerosol foam provides superior efficacy vs. gel in patients with psoriasis vulgaris: randomized, controlled PSO-ABLE study.

    Science.gov (United States)

    Paul, C; Stein Gold, L; Cambazard, F; Kalb, R E; Lowson, D; Bang, B; Griffiths, C E M

    2017-01-01

    Fixed combination calcipotriol 50 μg/g (Cal) plus betamethasone 0.5 mg/g (BD) foam has been developed as a new treatment option for patients with psoriasis. The randomized, parallel-group, investigator-blinded Phase III, 12-week PSO-ABLE study compared the efficacy and safety of Cal/BD foam with Cal/BD gel. Patients aged ≥18 years with mild-to-severe psoriasis were randomized 4:4:1:1 to once-daily Cal/BD foam, Cal/BD gel, foam vehicle or gel vehicle (NCT02132936). The primary efficacy endpoint was the proportion of patients who were clear/almost clear with a ≥ 2 grade improvement according to the physician's global assessment of disease severity (i.e. treatment success) at week 4 for Cal/BD foam vs. week 8 for Cal/BD gel. Secondary efficacy endpoints included: proportion of patients achieving at least a 75% reduction in modified psoriasis area and severity index (mPASI75), and time to treatment success (TTTS). Safety was monitored throughout. A total of 463 patients were randomized: Cal/BD foam (n = 185), Cal/BD gel (n = 188), foam vehicle (n = 47), gel vehicle (n = 43); overall completion rate was 90%. Cal/BD foam achieved higher treatment success rates (38% vs. 22%; P < 0.001) and mPASI75 (52% vs. 35%; P < 0.001) by week 4 than Cal/BD gel by week 8. Median TTTS with Cal/BD foam was 6 weeks; this could not be determined for Cal/BD gel as 50% treatment success was not achieved (P < 0.001). Adverse drug reactions were reported in 14 (7.6%) Cal/BD aerosol foam patients and 7 (3.7%) Cal/BD gel patients; all were single events except for itch with Cal/BD aerosol foam (n = 5; 2.7%) and worsening psoriasis with Cal/BD gel (n = 3; 1.6%). Cal/BD aerosol foam showed significantly greater efficacy after 4 weeks, than 8 weeks of treatment with Cal/BD gel, with similar tolerability. © 2016 European Academy of Dermatology and Venereology.

  20. Quantificação de células CD 34+ em sangue periférico, produto de aférese e cordão umbilical: estudo comparativo de três diferentes metodologias

    Directory of Open Access Journals (Sweden)

    Bacal Nydia S.

    2001-01-01

    Full Text Available A quantificação das células CD34+ em sangue periférico é utilizada para determinar o melhor momento de iniciar a aférese, enquanto que na leucoaférese e no sangue de cordão umbilical determinam a quantidade de células CD34+ para o transplante de células progenitoras. O objetivo deste trabalho foi comparar três diferentes metodologias de quantificação de células CD34+. Foram utilizados três diferentes tipos de amostras: a 32 amostras de sangue periférico, coletadas de pacientes estimulados com G-CSF 50 mg/Kg/dose total, sem quimioterapia na mobilização. b 31 amostras de produto de aférese de pacientes estimulados com o mesmo protocolo de G-CSF. c 20 amostras de sangue de cordão coletadas em CPDA-1, por punção de veia umbilical. As amostras permaneceram à temperatura ambiente no máximo até 24h da análise. O citômetro de fluxo utilizado foi o Epics XL-MCL (Coulter com os protocolos de dupla plataforma: ISHAGE e Mulhouse modificado para análise de maior numero de eventos, e o citômetro Imagn 2000 (Biometric Imaging de plataforma única, conforme técnicas recomendadas. Os anticorpos monoclonais utilizados foram: CD45-FITC, CD34-PE, e isotipo IgG1-PE da Immunotech. As análises estatísticas foram: ANOVA e correlação de teste t de Student. Os resultados não apresentaram diferenças estatisticamente significativas nos três métodos.

  1. Strontium in coral aragonite: 3. Sr coordination and geochemistry in relation to skeletal architecture

    Science.gov (United States)

    Allison, Nicola; Finch, Adrian A.; Newville, Matthew; Sutton, Stephen R.

    2005-08-01

    Use of the coral Sr palaeothermometer assumes that the Sr in coral skeletons is substituted randomly for Ca in the aragonite structure. The presence of Sr in additional phases e.g., strontianite, or the non random distribution of Sr across metal sites in aragonite, would complicate the Sr/Ca-sea surface temperature relationship. We have used Sr K-edge microEXAFS (extended X-ray absorption fine structure) to determine the structural state of Sr across selected microvolumes of four coral skeletons ( Porites lobata, Acropora palmata, Pavona clavus, and Montastrea annularis). We used a 5 × 3 μm beam to analyse specific areas of the coral skeletal architecture, i.e., centres of calcification, fasciculi, and dissepiments. All EXAFS analyses refine, within error, to an ideally substituted Sr in aragonite, and we found no evidence of strontianite or partly ordered structural states. Anisotropy in the first shell responses results from the fact that the analysed microvolumes are not necessarily averaged for the responses of all crystal orientations in the aragonite. Although secondary ion mass spectrometry confirmed that Sr/Ca composition can vary substantially between skeletal components, we find no evidence for any contrast in Sr structural state. Sr heterogeneity may result from kinetic effects, reflecting complex disequilibrium processes during crystal precipitation, or biological effects, resulting from variations in the composition of the calcifying fluid which are biologically mediated.

  2. Filling a gap in the distribution of Batrachochytrium dendrobatidis: evidence in amphibians from northern China.

    Science.gov (United States)

    Zhu, Wei; Fan, Liqing; Soto-Azat, Claudio; Yan, Shaofei; Gao, Xu; Liu, Xuan; Wang, Supen; Liu, Conghui; Yang, Xuejiao; Li, Yiming

    2016-03-30

    Chytridiomycosis caused by Batrachochytrium dendrobatidis (Bd) has been recognized as a major driver of amphibian declines worldwide. Central and northern Asia remain as the greatest gap in the knowledge of the global distribution of Bd. In China, Bd has recently been recorded from south and central regions, but areas in the north remain poorly surveyed. In addition, a recent increase in amphibian farming and trade has put this region at high risk for Bd introduction. To investigate this, we collected a total of 1284 non-invasive skin swabs from wild and captive anurans and caudates, including free-ranging, farmed, ornamental, and museum-preserved amphibians. Bd was detected at low prevalence (1.1%, 12 of 1073) in live wild amphibians, representing the first report of Bd infecting anurans from remote areas of northwestern China. We were unable to obtain evidence of the historical presence of Bd from museum amphibians (n = 72). Alarmingly, Bd was not detected in wild amphibians from the provinces of northeastern China (>700 individuals tested), but was widely present (15.1%, 21 of 139) in amphibians traded in this region. We suggest that urgent implementation of measures is required to reduce the possibility of further spread or inadvertent introduction of Bd to China. It is unknown whether Bd in northern China belongs to endemic and/or exotic genotypes, and this should be the focus of future research.

  3. Experimental Study of Rheological Properties and Oil Displacement Efficiency in Oilfields for a Synthetic Hydrophobically Modified Polymer.

    Science.gov (United States)

    Liu, Pengcheng; Mu, Zhenbao; Wang, Chao; Wang, Yanling

    2017-08-18

    In a previous study, we developed a synthetic hydrophobically modified hydroxyethyl cellulose (HEC) using bromododecane (BD), which we denote as BD-HMHEC. In this work, we continually investigate the rheological properties and its oil displacement efficiency in PuTao well area in Daqing oilfields, China. Results show that BD-HMHEC solution has good viscosification, thermal-resistance, salt-tolerance, shear resistance, and acid/alkali resistance. The storage modulus (G') and the loose modulus (G") of the BD-HMHEC solutions increase significantly with increasing BD-HMHEC concentration, and the solution becomes viscoelastic at a sufficiently high BD-HMHEC concentration. The core flooding results showed BD-HMHEC flooding improves oil recovery by 7-14% in comparison with HEC flooding at concentrations of 4,000 mg/L under equivalent conditions. Moreover, BD-HMHEC flooding improves oil recovery by 7-8% after conducting water and hydrolyzed polyacrylamide (HPAM) flooding. The oil displacement mechanism of BD-HMHEC solutions is discussed based on a visual evaluation. The results indicate that BD-HMHEC flooding is a feasible means for improving oil recovery after water/HPAM flooding.

  4. Are the adverse effects of stressors on amphibians mediated by their effects on stress hormones?

    Science.gov (United States)

    Gabor, Caitlin R; Knutie, Sarah A; Roznik, Elizabeth A; Rohr, Jason R

    2018-02-01

    Adverse effects of anthropogenic changes on biodiversity might be mediated by their impacts on the stress response of organisms. To test this hypothesis, we crossed exposure to metyrapone, a synthesis inhibitor of the stress hormone corticosterone, with exposure to the herbicide atrazine and the fungal pathogen Batrachochytrium dendrobatidis (Bd) to assess whether the effects of these stressors on tadpoles and post-metamorphic frogs were mediated by corticosterone. Metyrapone countered atrazine- and Bd-induced corticosterone elevations. However, atrazine- and Bd-induced reductions in body size were not mediated by corticosterone because they persisted despite metyrapone exposure. Atrazine lowered Bd abundance without metyrapone but increased Bd abundance with metyrapone for tadpoles and frogs. In contrast, atrazine reduced tolerance of Bd infections because frogs exposed to atrazine as tadpoles had reduced growth with Bd compared to solvent controls; this effect was not countered by metyrapone. Our results suggest that the adverse effects of atrazine and Bd on amphibian growth, development, and tolerance of infection are not mediated primarily by corticosterone. A possible mechanism for these effects is energy lost from atrazine detoxification, defense against Bd, or repair from damage caused by atrazine and Bd. Additional studies are needed to evaluate how often the effects of anthropogenic stressors are mediated by stress hormones.

  5. Validation of the bipolar disorder etiology scale based on psychological behaviorism theory and factors related to the onset of bipolar disorder.

    Directory of Open Access Journals (Sweden)

    Jae Woo Park

    Full Text Available OBJECTIVES: The aim of this study was to identify psychosocial factors related to the onset of bipolar I disorder (BD. To do so, the Bipolar Disorder Etiology Scale (BDES, based on psychological behaviorism, was developed and validated. Using the BDES, common factors related to both major depressive disorder (MDD and BD and specific factors related only to BD were investigated. METHOD: The BDES, which measures 17 factors based on psychological behaviorism hypotheses, was developed and validated. This scale was administered to 113 non-clinical control subjects, 30 subjects with MDD, and 32 people with BD. ANOVA and post hoc analyses were conducted. Subscales on which MDD and BD groups scored higher than controls were classified as common factors, while those on which the BD group scored higher than MDD and control groups were classified as specific factors. RESULTS: The BDES has acceptable reliability and validity. Twelve common factors influence both MDD and BD and one specific factor influences only BD. Common factors include the following: learning grandiose self-labeling, learning dangerous behavior, reinforcing impulsive behavior, exposure to irritability, punishment of negative emotional expression, lack of support, sleep problems, antidepressant problems, positive arousal to threat, lack of social skills, and pursuit of short-term pleasure. The specific factor is manic emotional response. CONCLUSIONS: Manic emotional response was identified as a specific factor related to the onset of BD, while parents' grandiose labeling is a candidate for a specific factor. Many factors are related to the onset of both MDD and BD.

  6. Validation of the bipolar disorder etiology scale based on psychological behaviorism theory and factors related to the onset of bipolar disorder.

    Science.gov (United States)

    Park, Jae Woo; Park, Kee Hwan

    2014-01-01

    The aim of this study was to identify psychosocial factors related to the onset of bipolar I disorder (BD). To do so, the Bipolar Disorder Etiology Scale (BDES), based on psychological behaviorism, was developed and validated. Using the BDES, common factors related to both major depressive disorder (MDD) and BD and specific factors related only to BD were investigated. The BDES, which measures 17 factors based on psychological behaviorism hypotheses, was developed and validated. This scale was administered to 113 non-clinical control subjects, 30 subjects with MDD, and 32 people with BD. ANOVA and post hoc analyses were conducted. Subscales on which MDD and BD groups scored higher than controls were classified as common factors, while those on which the BD group scored higher than MDD and control groups were classified as specific factors. The BDES has acceptable reliability and validity. Twelve common factors influence both MDD and BD and one specific factor influences only BD. Common factors include the following: learning grandiose self-labeling, learning dangerous behavior, reinforcing impulsive behavior, exposure to irritability, punishment of negative emotional expression, lack of support, sleep problems, antidepressant problems, positive arousal to threat, lack of social skills, and pursuit of short-term pleasure. The specific factor is manic emotional response. Manic emotional response was identified as a specific factor related to the onset of BD, while parents' grandiose labeling is a candidate for a specific factor. Many factors are related to the onset of both MDD and BD.

  7. Executive functioning and alcohol binge drinking in university students.

    Science.gov (United States)

    Parada, María; Corral, Montserrat; Mota, Nayara; Crego, Alberto; Rodríguez Holguín, Socorro; Cadaveira, Fernando

    2012-02-01

    Binge drinking (BD) is prevalent among college students. Studies on alcoholism have shown that the prefrontal cortex is vulnerable to the neurotoxic effects of alcohol. The prefrontal cortex undergoes both structural and functional changes during adolescence and young adulthood. Sex differences have been observed in brain maturation and in alcohol-induced damage. The objective of the present study was to analyze the relationship between BD and cognitive functions subserved by the prefrontal cortex in male and female university students. The sample comprised 122 undergraduates (aged 18 to 20 years): 62 BD (30 females) and 60 non-BD (29 females). Executive functions were assessed by WMS-III (Backward Digit Span and Backward Spatial Span), SOPT (abstract designs), Letter Fluency (PMR), BADS (Zoo Map and Key Search) and WCST-3. BD students scored lower in the Backward Digit Span Subtest and generated more perseverative responses in the SOPT In relation to interaction BD by sex, BD males scored lower in the Backward Digit Span test than BD females and non-BD males. BD is associated with poorer performance of executive functions subserved by the dorsolateral prefrontal cortex. The results do not support enhanced vulnerability of women to alcohol neurotoxic effects. These difficulties may reflect developmental delay or frontal lobe dysfunction. Copyright © 2011 Elsevier Ltd. All rights reserved.

  8. Greater executive and visual memory dysfunction in comorbid bipolar disorder and substance use disorder.

    Science.gov (United States)

    Marshall, David F; Walker, Sara J; Ryan, Kelly A; Kamali, Masoud; Saunders, Erika F H; Weldon, Anne L; Adams, Kenneth M; McInnis, Melvin G; Langenecker, Scott A

    2012-12-30

    Measures of cognitive dysfunction in Bipolar Disorder (BD) have identified state and trait dependent metrics. An influence of substance abuse (SUD) on BD has been suggested. This study investigates potential differential, additive, or interactive cognitive dysfunction in bipolar patients with or without a history of SUD. Two hundred fifty-six individuals with BD, 98 without SUD and 158 with SUD, and 97 Healthy Controls (HC) completed diagnostic interviews, neuropsychological testing, and symptom severity scales. The BD groups exhibited poorer performance than the HC group on most cognitive factors. The BD with SUD exhibited significantly poorer performance than BD without SUD in visual memory and conceptual reasoning/set-shifting. In addition, a significant interaction effect between substance use and depressive symptoms was found for auditory memory and emotion processing. BD patients with a history of SUD demonstrated worse visual memory and conceptual reasoning skills above and beyond the dysfunction observed in these domains among individuals with BD without SUD, suggesting greater impact on integrative, gestalt-driven processing domains. Future research might address longitudinal outcome as a function of BD, SUD, and combined BD/SUD to evaluate neural systems involved in risk for, and effects of, these illnesses. Published by Elsevier Ireland Ltd.

  9. Systemic autoimmune diseases are associated with an increased risk of bipolar disorder: A nationwide population-based cohort study.

    Science.gov (United States)

    Wang, Ling-Yi; Chiang, Jen-Huai; Chen, Shih-Fen; Shen, Yu-Chih

    2018-02-01

    Studies suggested autoimmunity plays a role in the etiology of bipolar disorder (BD). This study aimed to investigate the association between systemic autoimmune diseases (SADs) and the subsequent development of BD, and examine the potential risk factors for developing BD. Patients with SADs were identified in the Taiwan National Health Insurance Program (NHIP). A comparison cohort was created by matching patients without SADs with age. The SADs cohort consisted of 65,498 while the comparison cohort consisted of 261,992 patients. The incidence of BD was evaluated in both cohorts. The major finding was the discovery of a higher incidence of subsequent BD among patients with SADs (adjusted hazard ratio: 1.98). Specifically, the risk of BD was observed to be significant increase in systemic lupus erythematosus, rheumatoid arthritis, autoimmune vasculitis, Sicca syndrome and Crohn's disease. Furthermore, our study revealed some potential risk factors for developing BD including female, younger age and patients who lived in eastern Taiwan. Also, some comorbidities including dyslipidemia, chronic obstructive pulmonary disease, diabetes mellitus, asthma, cerebrovascular disease, alcohol used disorder, liver cirrhosis, and malignancies were potential risk factors for incident BD. The diagnosis of SADs was based on the catastrophic illness certificate defined by Taiwanese NHIP. Thus, not every form of SADs was explored for subsequent developing BD. This study confirms that SADs are associated with higher incidence of BD, suggesting that abnormal autoimmune process is associated with increased expression of psychiatric disturbances. Copyright © 2017 Elsevier B.V. All rights reserved.

  10. Glial cells as key elements in the pathophysiology and treatment of bipolar disorder.

    Science.gov (United States)

    Keshavarz, Mojtaba

    2017-06-01

    The exact pathophysiology of bipolar disorder (BD) is not yet fully understood, and there are many questions in this area which should be answered. This review aims to discuss the roles of glial cells in the pathophysiology of BD and their contribution to the mechanism of action of mood-stabilising drugs. We critically reviewed the most recent advances regarding glial cell roles in the pathophysiology and treatment of BD and the neuroprotective and neurotrophic effects of these cells. Postmortem studies revealed a decrease in the glial cell number or density in the specific layers of prefrontal and anterior cingulate cortex in the patients with BD, whereas there was no difference in other brain regions, such as entorhinal cortex, amygdala and hippocampus. Astrocytes and oligodendrocytes were the most important glial types that were responsible for the glial reduction, but microglia activation rather than loss may be implicated in BD. The decreased number or density of glial cells may contribute to the pathological changes observed in neurons in the patients with BD. Alteration of specific neurotrophic factors such as glial cell line-derived neurotrophic factor and S100B may be an important feature of BD. Glial cells mediate the therapeutic effects of mood-stabilising agents in the treatment of BD. Recent studies provide important evidence on the impairment of glial cells in the pathophysiology and treatment of BD. However, future controlled studies are necessary to elucidate different aspects of glial cells contribution to BD, and the mechanism of action of mood-stabilising drugs.

  11. Bipolar disorder patients have similar levels of education but lower socio-economic status than the general population.

    Science.gov (United States)

    Schoeyen, Helle K; Birkenaes, Astrid B; Vaaler, Arne E; Auestad, Bjoern H; Malt, Ulrik F; Andreassen, Ole A; Morken, Gunnar

    2011-03-01

    There is conflicting evidence regarding the educational level and its importance for social and occupational functioning in bipolar disorder (BD). The aim of this study was to investigate how educational achievement relates to function in BD compared with the general population, and which clinical factors are associated with level of education. Hospitalized patients with DSM-IV BD (N=257; 69.3% BD I; 25.7% BD II; 5.1 BD NOS; 51.4% females) were consecutively recruited from mental health clinics throughout Norway and compared with a geographically matched reference sample from the general population (N=56,540) on levels of education, marital status, income, and disability benefits. Further analyses of association were carried out using logistic regression analyses. A significantly higher proportion of subjects in the BD group than in the reference group was single, had low income, or was disabled. No between-group difference was found in educational level. In the reference group education was inversely correlated with the risk of being disabled, but no such relationship was found in the BD group. Rapid cycling and recurring depressive episodes were the only clinical characteristics associated with low educational level. Acutely admitted patients might not be representative for milder forms of disease. Despite similar levels of education, BD patients had lower social and occupational function than the general population, and no association was found between education and disability for BD patients. Copyright © 2010 Elsevier B.V. All rights reserved.

  12. The prevalence of Behçet's disease in Korea: data from Health Insurance Review and Assessment Service from 2011 to 2015.

    Science.gov (United States)

    Kim, Ji Na; Kwak, Sang Gyu; Choe, Jung-Yoon; Kim, Seong-Kyu

    2017-01-01

    The aim of this study is to identify the prevalence of Behçet's disease (BD) from data in the Healthcare Bigdata Hub of the Health Insurance Review & Assessment (HIRA) Service from 2011 to 2015 in Korea. This study collected information on primary and auxiliary diagnoses of BD (M352) by physicians according to the Korean Standard Classification of Diseases (KCD) codes. The prevalence of BD was assessed on the basis of age, sex, and geographical distribution. We used time series analysis, using the ARIMA model for the expected prevalence of BD from 2016 to 2025. The overall prevalence of BD was gradually increased, ranging from 32.8 to 35.7 per 100,000 population over the study period. The male to female ratio of BD ranged from 0.54:1 to 0.56:1, revealing a female predominance from 2011 to 2015. Among five districts in Korea, the prevalence in the Seoul Metropolitan district was the highest, with a slowly increasing trend for the study period, accounting for about 60.3% of total BD patients. The expected prevalence of BD patients was estimated to range from 36.9 (95% CI 35.0 - 39.0) to 44.7 (95% CI 40.2 - 49.6) between 2016 and 2025. This study found that the overall prevalence of BD is estimated to be approximately 35.0 per 100,000 population, with female predominance, and predicts gradually increased prevalence of BD in Korea.

  13. Relationship between personality disorder functioning styles and the emotional states in bipolar I and II disorders.

    Directory of Open Access Journals (Sweden)

    Jiashu Yao

    Full Text Available Bipolar disorder types I (BD I and II (BD II behave differently in clinical manifestations, normal personality traits, responses to pharmacotherapies, biochemical backgrounds and neuroimaging activations. How the varied emotional states of BD I and II are related to the comorbid personality disorders remains to be settled.We therefore administered the Plutchick - van Praag Depression Inventory (PVP, the Mood Disorder Questionnaire (MDQ, the Hypomanic Checklist-32 (HCL-32, and the Parker Personality Measure (PERM in 37 patients with BD I, 34 BD II, and in 76 healthy volunteers.Compared to the healthy volunteers, patients with BD I and II scored higher on some PERM styles, PVP, MDQ and HCL-32 scales. In BD I, the PERM Borderline style predicted the PVP scale; and Antisocial predicted HCL-32. In BD II, Borderline, Dependent, Paranoid (- and Schizoid (- predicted PVP; Borderline predicted MDQ; Passive-Aggressive and Schizoid (- predicted HCL-32. In controls, Borderline and Narcissistic (- predicted PVP; Borderline and Dependent (- predicted MDQ.Besides confirming the different predictability of the 11 functioning styles of personality disorder to BD I and II, we found that the prediction was more common in BD II, which might underlie its higher risk of suicide and poorer treatment outcome.

  14. Between-race differences in the effects of breast density information and information about new imaging technology on breast-health decision-making.

    Science.gov (United States)

    Manning, Mark; Purrington, Kristen; Penner, Louis; Duric, Neb; Albrecht, Terrance L

    2016-06-01

    Some US states have mandated that women be informed when they have dense breasts; however, little is known about how general knowledge about breast density (BD) affects related health decision-making. We examined the effects of BD information and imaging technology information on 138 African-American (AA) and European-American (EA) women's intentions to discuss breast cancer screening with their physicians. Women were randomly assigned to receive BD information and/or imaging technology information via 2 by 2 factorial design, and completed planned behavior measures (e.g., attitudes, intentions) related to BC screening. Attitudes mediated the effects of BD information, and the mediation was stronger for AA women compared to EA women. Effects were more robust for BD information compared to imaging technology information. Results of moderator analyses revealed suppressor effects of injunctive norms that were moderated by imaging technology information. Information about BD favorably influences women's intentions to engage in relevant breast health behaviors. Stronger attitude mediated-effects for AA women suggest greater scrutiny of BD information. Since BD information may influence women's intentions to discuss BC screening, strategies to effectively present BD information to AA women should be investigated given the likelihood of their increased scrutiny of BD information. Copyright © 2016 Elsevier Ireland Ltd. All rights reserved.

  15. Ecdysis Triggering Hormone Signaling (ETH/ETHR-A Is Required for the Larva-Larva Ecdysis in Bactrocera dorsalis (Diptera: Tephritidae

    Directory of Open Access Journals (Sweden)

    Yan Shi

    2017-08-01

    Full Text Available Insects must undergo ecdysis for successful development and growth, and the ecdysis triggering hormone (ETH, released by the Inka cells, is a master hormone in this process. In this study, we determined the sequence of the ETH precursor and receptors in an agriculturally important pest insect, the oriental fruit fly Bactrocera dorsalis (Hendel. We identified two functionally distinct splice receptor isoforms: BdETH-R-A and BdETH-R-B, and when expressed in Chinese hamster ovary (CHO-WTA11 cells, they exhibited a high sensitivity to the two mature peptides BdETH1 and BdETH2. The BdETH transcript was detected in the tracheal tissue of the larvae. Inka cells were identified with immunohistochemical antibody staining against Drosophila melanogaster ETH1, and in situ hybridization with specific DNA probes. Selective RNA silencing of BdETH or BdETH-R-A, but not of BdETH-R-B, caused developmental failure at ecdysis. The dsRNA-treated larvae displayed tracheal defects and could not shed the old cuticle followed by death. Our results demonstrated that BdETH, via activation of BdETH-R-A but not ETH-R-B, plays an essential role in regulating the process of larva-larva ecdysis in B. dorsalis.

  16. cDNA CLONING AND TRANSCRIPTIONAL REGULATION OF THE CECROPIN AND ATTACIN FROM THE ORIENTAL FRUIT FLY, Bactrocera dorsalis (DIPTERA: TEPHRITIDAE).

    Science.gov (United States)

    Liao, Yin-Yin; Zuo, Yu-Han; Tsai, Cheng-Lung; Hsu, Chia-Ming; Chen, Mei-Er

    2015-06-01

    We described the cDNA cloning of two antimicrobial peptides (AMPs), cecropin (BdCec), and attacin C (BdAttC), from the oriental fruit fly, Bactrocera dorsalis (Hendel), a serious insect pest of fruit trees. Using rapid amplification of cDNA ends, fragments encompassing the entire open reading frames of BdCec and BdAttC were cloned and sequenced. The complete 425 bp cDNA of BdCec encodes a protein of 64 amino acids with a predicted molecular weight of 6.84 kDa. The 931 bp cDNA of BdAttC encodes a protein of 239 residues with a predicted molecular weight of 24.97 kDa. Real-time quantitative RT-PCR demonstrated that the developmental transcription profiles of BdCec and BdAttC were similar in each larvae, pupae, and adults. The constitutive expression levels of both AMPs were high in the first-instar and late third-instar larvae, suggesting that their antimicrobial activity is active in the newly hatched larvae and just before pupation. The basal expression levels were not significant different in adult fat bodies. The expression of BdCec and BdAttC was upregulated after bacterial challenge in adult fat bodies. The ratio of inducible expression to constitutive expression was lower in males compared to females. © 2015 Wiley Periodicals, Inc.

  17. Impulse oscillometry at preschool age is a strong predictor of lung function by flow-volume spirometry in adolescence.

    Science.gov (United States)

    Lauhkonen, Eero; Riikonen, Riikka; Törmänen, Sari; Koponen, Petri; Nuolivirta, Kirsi; Helminen, Merja; Toikka, Jyri; Korppi, Matti

    2018-05-01

    The transition from early childhood wheezing to persistent asthma is linked to lung function impairment over time. Little is known how the methods used to study lung function at different ages correlate longitudinally. Sixty-four children with a history of hospitalization for bronchiolitis before 6 months of age were prospectively studied with impulse oscillometry (IOS) at the mean age of 6.3 years and these preschool IOS results were compared with flow-volume spirometry (FVS) measurements at mean age of 11.4 years. The baseline respiratory system resistance at 5 Hz (Rrs5) showed a modest statistically significant correlation with all baseline FVS parameters except FVC. The post-bronchodilator (post-BD) Rrs5 showed a modest statistically significant correlation with post-BD FEV 1 and FEV 1 /FVC. The bronchodilator-induced decrease in Rrs5 showed a modest statistically significant correlation with the percent increase in FEV 1 . Baseline and post-BD respiratory reactance at 5 Hz (Xrs5) showed a modest statistically significant correlation with baseline and post-BD FVS parameters except post-BD FEV 1 /FVC, respectively, and post-BD Xrs5 showed a strong correlation with post-BD FVC (ρ = 0.61) and post-BD FEV 1 (ρ = 0.59). In adjusted linear regression, preschool Xrs5 remained as a statistically significant independent predictor of FVS parameters in adolescence; the one-unit decrease in the Z-score of preschool post-BD Xrs5 predicted 9.6% lower post-BD FEV 1 , 9.3% lower post-BD FVC, and 9.7% lower post-BD MEF 50 when expressed as %-predicted parameters. Persistent post-BD small airway impairment in children with a history of bronchiolitis detected with IOS at preschool age predicted FVS results measured in early adolescence. © 2018 Wiley Periodicals, Inc.

  18. Assessment of the hepatitis B birth dose vaccination program, Papua New Guinea, 2014.

    Science.gov (United States)

    Wiesen, Eric; Lagani, William; Sui, Gerard; Arava, Johnnie; Reza, Salim; Diorditsa, Sergey; Lin, Yung-Ching

    2016-01-12

    Papua New Guinea (PNG) implemented hepatitis B birth dose (BD) vaccination in 2005 yet since that time coverage has remained low, allowing mother-to-child transmission to occur. We conducted a field assessment of the BD vaccination program to develop strategies for improving the BD coverage. We selected five provinces with higher hepatitis B prevalence and five with lower prevalence based on the results of a 2013 hepatitis B serological survey. Within each province, we interviewed district and provincial health officers, health workers, village volunteers, and caregivers from ten randomly selected health facilities. Data were collected on knowledge, practice, vaccine management and data recording/reporting. To identify enabling factors and barriers, we compared health facilities with higher BD coverage with those with lower coverage, and compared caregivers whose children received BD with those whose children did not. Overall timely BD coverage was 31% and BD vaccination was taking place in 81% of sampled health facilities. Lack of cold chain and vaccine were the major reasons for not providing the BD. Insufficiencies in supervision, vaccine management, community outreach, and data management were identified as obstacles to achieving high timely hepatitis B BD coverage. Good supervision, knowledge of hepatitis B and hepatitis B vaccination, antenatal care including information about the hepatitis B BD, provision of vaccine refrigerators in maternity wards, and outreach vaccination for home deliveries were associated with higher timely BD coverage. Several steps will likely be effective in improving BD coverage: strengthening training and supervision among health workers and officers, educating caregivers on the benefits of the BD and delivery in health facilities, improving vaccine management, and improving data quality. Considerable effort and leadership will be needed to achieve these steps. Copyright © 2015. Published by Elsevier Ltd.

  19. Differences in Butadiene Adduct Formation between Rats and Mice Not Due to Selective Inhibition of CYP2E1 by Butadiene Metabolites

    Science.gov (United States)

    Pianalto, Kaila M.; Hartman, Jessica H.; Boysen, Gunnar; Miller, Grover P.

    2013-01-01

    CYP2E1 metabolizes 1,3-butadiene (BD) into genotoxic and possibly carcinogenic 1,2-epoxy-3-butene (EB), 1,2:3,4-diepoxybutane (DEB), and 1,2-epoxy-3,4-butanediol (EB-diol). The dose response of DNA and protein adducts derived from BD metabolites increase linearly at low BD exposures and then saturate at higher exposures in rats, but not mice. It was hypothesized that differences in adduct formation between rodents reflect more efficient BD oxidation in mice than rats. Herein, we assessed whether BD-derived metabolites selectively inhibit rat but not mouse CYP2E1 activity using B6C3F1 mouse and Fisher 344 rat liver microsomes. Basal CYP2E1 activities toward 4-nitrophenol were similar between rodents. Through IC50 studies, EB was the strongest inhibitor (IC50 54 μM, mouse; 98 μM, rat), BD-diol considerably weaker (IC50 1200 μM, mouse; 1000 μM, rat), and DEB inhibition nonexistent (IC50 >25 mM). Kinetic studies showed that in both species EB and BD-diol inhibited 4-nitrophenol oxidation through two-site mechanisms in which inhibition constants reflected trends observed in IC50 studies. None of the reactive epoxide metabolites inactivated CYP2E1 irreversibly. Thus, there was no selective inhibition or inactivation of rat CYP2E1 by BD metabolites relative to mouse Cyp2e1, and it can be inferred that CYP2E1 activity toward BD between rodent species would similarly not be impacted by the presence of BD metabolites. Inhibition of CYP2E1 by BD metabolites is then not responsible for the reported species difference in BD metabolism, formation of BD-derived DNA and protein adducts, mutagenicity and tumorigenesis. PMID:24021170

  20. Frequency of Behçet's disease among a group of visually impaired adults.

    Science.gov (United States)

    Uyaroglu, Oguz Abdullah; Seyhoglu, Emrah; Erden, Abdulsamet; Vahabov, Cevanşir; Babaoglu, Hakan; Armagan, Berkan; Sari, Alper; Kilic, Levent; Tatar, Olcay; Bilgen, Sule Apras; Karadag, Omer; Kalyoncu, Umut

    2018-03-09

    Behçet's disease (BD) is one of the reasons of acquired visual impairment among young adults. Ocular involvement is a significant cause of disability in BD. The objective of this study is to assess the prevalence of BD among a group of adults who has visual impairment. Ankara Metropolitan Municipality Education and Technology Center is one of the official institutions which records and follows the demographic data of visually impaired people in Turkey. In November 2014, there were 675 visually impaired people recorded at this center. Medical history was taken from 294 adults by phone in November and December of 2014. Participants were asked if the visual impairment had been either acquired or congenital. If the patients had BD or suspicious BD, they were recalled for detailed investigation which would be carried out by an internist, a rheumatologist and an ophthalmologist. Two hundred thirteen of 294 (72.4%) visually impaired adults were male. One hundred nine of 294 (37.1%) had acquired visual impairment. Six (5.5%) of those 109 patients had BD. Overall prevalence of BD among study group was 2.04%.The median age of people with BD was 35 years. The median age at BD diagnosis was 16.5 years and the median duration from diagnosis to visual loss was 2.5 years. BD is still one of the causes of acquired visual impairment in Turkey. In this study, BD prevalence among a visually impaired adult group was 2.04%. BD accounted for 5.5% among adults who had acquired visual impairment. In a study of 1965, BD prevalence among people with acquired blindness was 12%. However, this study was conducted at pre-immunosuppressive period. Our prevalence is obviously lower than those studies. Extended population-based studies are needed for population estimations.

  1. Heterogeneous occupancy and density estimates of the pathogenic fungus Batrachochytrium dendrobatidis in waters of North America

    Science.gov (United States)

    Chestnut, Tara E.; Anderson, Chauncey; Popa, Radu; Blaustein, Andrew R.; Voytek, Mary; Olson, Deanna H.; Kirshtein, Julie

    2014-01-01

    Biodiversity losses are occurring worldwide due to a combination of stressors. For example, by one estimate, 40% of amphibian species are vulnerable to extinction, and disease is one threat to amphibian populations. The emerging infectious disease chytridiomycosis, caused by the aquatic fungus Batrachochytrium dendrobatidis (Bd), is a contributor to amphibian declines worldwide. Bd research has focused on the dynamics of the pathogen in its amphibian hosts, with little emphasis on investigating the dynamics of free-living Bd. Therefore, we investigated patterns of Bd occupancy and density in amphibian habitats using occupancy models, powerful tools for estimating site occupancy and detection probability. Occupancy models have been used to investigate diseases where the focus was on pathogen occurrence in the host. We applied occupancy models to investigate free-living Bd in North American surface waters to determine Bd seasonality, relationships between Bd site occupancy and habitat attributes, and probability of detection from water samples as a function of the number of samples, sample volume, and water quality. We also report on the temporal patterns of Bd density from a 4-year case study of a Bd-positive wetland. We provide evidence that Bd occurs in the environment year-round. Bd exhibited temporal and spatial heterogeneity in density, but did not exhibit seasonality in occupancy. Bd was detected in all months, typically at less than 100 zoospores L−1. The highest density observed was ∼3 million zoospores L−1. We detected Bd in 47% of sites sampled, but estimated that Bd occupied 61% of sites, highlighting the importance of accounting for imperfect detection. When Bd was present, there was a 95% chance of detecting it with four samples of 600 ml of water or five samples of 60 mL. Our findings provide important baseline information to advance the study of Bd disease ecology, and advance our understanding of amphibian exposure

  2. Improving care and wellness in bipolar disorder: origins, evolution and future directions of a collaborative knowledge exchange network.

    Science.gov (United States)

    Michalak, Erin E; Hole, Rachelle; Livingston, James D; Murray, Greg; Parikh, Sagar V; Lapsley, Sara; McBride, Sally

    2012-09-10

    The Collaborative RESearch team to study psychosocial factors in bipolar disorder (CREST.BD) is a multidisciplinary, cross-sectoral network dedicated to both fundamental research and knowledge exchange on bipolar disorder (BD). The core mission of the network is to advance the science and understanding of psychological and social issues associated with BD, improve the care and wellness of people living with BD, and strengthen services and supports for these individuals. CREST.BD bridges traditional and newer research approaches, particularly embracing community-based participatory research (CBPR) methods. Membership of CREST is broad, including academic researchers, people with BD, their family members and supports, and a variety of health care providers. Here, we describe the origins, evolution, approach to planning and evaluation and future vision for our network within the landscape of CBPR and integrated knowledge translation (KT), and explore the keys and challenges to success we have encountered working within this framework.

  3. Improving care and wellness in bipolar disorder: origins, evolution and future directions of a collaborative knowledge exchange network

    Directory of Open Access Journals (Sweden)

    Michalak Erin E

    2012-09-01

    Full Text Available Abstract The Collaborative RESearch team to study psychosocial factors in bipolar disorder (CREST.BD is a multidisciplinary, cross-sectoral network dedicated to both fundamental research and knowledge exchange on bipolar disorder (BD. The core mission of the network is to advance the science and understanding of psychological and social issues associated with BD, improve the care and wellness of people living with BD, and strengthen services and supports for these individuals. CREST.BD bridges traditional and newer research approaches, particularly embracing community-based participatory research (CBPR methods. Membership of CREST is broad, including academic researchers, people with BD, their family members and supports, and a variety of health care providers. Here, we describe the origins, evolution, approach to planning and evaluation and future vision for our network within the landscape of CBPR and integrated knowledge translation (KT, and explore the keys and challenges to success we have encountered working within this framework.

  4. Malware Memory Analysis of the IVYL Linux Rootkit: Investigating a Publicly Available Linux Rootkit Using the Volatility Memory Analysis Framework

    Science.gov (United States)

    2015-04-01

    0xffffffffa02bd020 /lib/modules/2.6.38-...et/wireless/ orinoco readdir 0xffffffffa02bd020 /lib/modules/2.6.38-...et/wireless/prism54 readdir... rivers /block/paride readdir 0xffffffffa02bd020 /lib/modules/2.6.38-... rivers /gpu/drm/i810 readdir 0xffffffffa02bd020 /lib/modules/2.6.38-... rivers /gpu...drm/i830 readdir 0xffffffffa02bd020 /lib/modules/2.6.38-... rivers /gpu/drm/i915 readdir 0xffffffffa02bd020 /lib/modules/2.6.38-... rivers /gpu/drm/r128

  5. Levels of soluble Fas/APO-1 in patients with Behçet's disease

    Directory of Open Access Journals (Sweden)

    K. Hamzaoui

    1998-01-01

    Full Text Available The aim of this study was to quantify soluble Fas/APO1 (sFas/APO-1 protein in the serum of patients with Behcet's disease (BD in active and inactive stages, compared with patients with systemic lupus erythematosus (SLE and patients with rheumatoid arthritis (RA. Soluble Fas/APO-1 was quantified using a sandwich enzyme-linked immunosorbent assay. Increased serum sFas/APO-1 levels were observed in active BD, compared with inactive BD, RA patients and SLE patients. Increased serum sFas/APO-1 levels were correlated with the presence of neurologic manifestations or pulmonary involvement in active BD. In conclusion, increased levels of sFas/APO-1 occurred frequently and exclusively in active BD patients. Preliminary evidence suggested that elevated levels of sFas/APO-1 are associated with the clinical stage and clinical manifestations in BD.

  6. Genome-wide transcriptional response of Silurana (Xenopus tropicalis to infection with the deadly chytrid fungus.

    Directory of Open Access Journals (Sweden)

    Erica Bree Rosenblum

    Full Text Available Emerging infectious diseases are of great concern for both wildlife and humans. Several highly virulent fungal pathogens have recently been discovered in natural populations, highlighting the need for a better understanding of fungal-vertebrate host-pathogen interactions. Because most fungal pathogens are not fatal in the absence of other predisposing conditions, host-pathogen dynamics for deadly fungal pathogens are of particular interest. The chytrid fungus Batrachochytrium dendrobatidis (hereafter Bd infects hundreds of species of frogs in the wild. It is found worldwide and is a significant contributor to the current global amphibian decline. However, the mechanism by which Bd causes death in amphibians, and the response of the host to Bd infection, remain largely unknown. Here we use whole-genome microarrays to monitor the transcriptional responses to Bd infection in the model frog species, Silurana (Xenopus tropicalis, which is susceptible to chytridiomycosis. To elucidate the immune response to Bd and evaluate the physiological effects of chytridiomycosis, we measured gene expression changes in several tissues (liver, skin, spleen following exposure to Bd. We detected a strong transcriptional response for genes involved in physiological processes that can help explain some clinical symptoms of chytridiomycosis at the organismal level. However, we detected surprisingly little evidence of an immune response to Bd exposure, suggesting that this susceptible species may not be mounting efficient innate and adaptive immune responses against Bd. The weak immune response may be partially explained by the thermal conditions of the experiment, which were optimal for Bd growth. However, many immune genes exhibited decreased expression in Bd-exposed frogs compared to control frogs, suggesting a more complex effect of Bd on the immune system than simple temperature-mediated immune suppression. This study generates important baseline data for ongoing

  7. Sexual behavior in women with bipolar disorder.

    Science.gov (United States)

    Mazza, Marianna; Harnic, Desiree; Catalano, Valeria; Di Nicola, Marco; Bruschi, Angelo; Bria, Pietro; Daniele, Antonio; Mazza, Salvatore

    2011-06-01

    There is a lack of studies regarding sexuality and sexual behavior in women with bipolar disorder. The aim of this study is to investigate sexual behavior in women affected by bipolar disorder in order to stimulate interest and debate in this area of care. Sixty women (30 BD I and 30 BD II) consent to participate in the study and were included in the sample. Moreover, sixty female healthy subjects without histories of psychiatric disorders were recruited as normal controls. Patients and healthy subjects were given the Sexual Interest and Sexual Performance Questionnaire, a questionnaire devised to explore various aspects of sexual behavior. The results of the present study suggest an increase of sexual interest in patients with BD I as compared both with BD II patients and healthy controls. In women with BD I such increase of interest was detected on some items of section I of the Sexual Interest and Sexual Performance Questionnaire, in particular "Actual Value of Sexuality" and "Implicit Sexual Interest", which implicitly explore sexual interest without overtly focusing upon sexual problems. Moreover, we observed a higher desired frequency of intercourse in women with BD I than BD II and a higher occurrence of repeated sexual intercourse in women with BD I than BD II. The main finding of the present study was an increase of sexual interest in BD I as compared with BD II female patients and normal controls. This result was detected when sexual interest was explored implicitly. Our study is limited by the small size of our subject groups. Further investigations on larger subject samples are needed to better clarify particular aspects of sexual behavior of BD patients. Copyright © 2010 Elsevier B.V. All rights reserved.

  8. Headache Could Be Finding of Sinus Vein Thrombosis in Behcets Patients

    OpenAIRE

    Halil Sen

    2014-01-01

    Globally Behcet%u2019s disease (BD) is most frequently seen in Turkey and takes its name from the Turkish dermatologist Hulusi Behcet. Basic findings of the disease are the triad of genital ulcers, oral ulcers and uveitis. Neurological involvement in BD appears an average of 5 years after the beginning of disease, or the first appearance of the disease may be neurological findings. Sinus vein thrombosis (SVT) is among neurological involvements observed in BD. However diagnosis of SVT is diffi...

  9. Harnessing the potential of community-based participatory research approaches in bipolar disorder.

    Science.gov (United States)

    Michalak, Erin E; Jones, Steven; Lobban, Fiona; Algorta, Guillermo Perez; Barnes, Steven J; Berk, Lesley; Berk, Michael; Hole, Rachelle; Lapsley, Sara; Maxwell, Victoria; Milev, Roumen; McManamy, John; Murray, Greg; Tohen, Mauricio; Tse, Samson; Sanchez de Carmona, Manuel; Johnson, Sheri L

    2016-12-01

    Despite the rapid growth in the sophistication of research on bipolar disorder (BD), the field faces challenges in improving quality of life (QoL) and symptom outcomes, adapting treatments for marginalized communities, and disseminating research insights into real-world practice. Community-based participatory research (CBPR)-research that is conducted as a partnership between researchers and community members-has helped address similar gaps in other health conditions. This paper aims to improve awareness of the potential benefits of CBPR in BD research. This paper is a product of the International Society for Bipolar Disorders (ISBD) Taskforce on Community Engagement which includes academic researchers, healthcare providers, people with lived experience of BD, and stakeholders from BD community agencies. Illustrative examples of CBPR in action are provided from two established centres that specialize in community engagement in BD research: the Collaborative RESearch Team to study psychosocial issues in BD (CREST.BD) in Canada, and the Spectrum Centre for Mental Health Research in the United Kingdom. We describe the philosophy of CBPR and then introduce four core research areas the BD community has prioritized for research: new treatment approaches, more comprehensive outcome assessments, tackling stigma, and enhanced understanding of positive outcomes. We then describe ways in which CBPR is ideal for advancing each of these research areas and provide specific examples of ways that CBPR has already been successfully applied in these areas. We end by noting potential challenges and mitigation strategies in the application of CBPR in BD research. We believe that CBPR approaches have significant potential value for the BD research community. The observations and concerns of people with BD, their family members, and supports clearly represent a rich source of information. CBPR approaches provide a collaborative, equitable, empowering orientation to research that builds

  10. The Role of U2AF1 Mutations in the Pathogenesis of Myelodysplastic Syndromes

    Science.gov (United States)

    2016-12-01

    KLS cells as described above using Annexin V-APC (2.5 ml, BD Biosciences, #550474) incubated in 1 Annexin V binding buffer (BD Biosciences). All other... incubations occurred in FACS buffer. All flow cytometry analyses were performed using FACScan or Gallios cytometers (BD Biosciences) and analysed...syndromes using a novel claims-based algorithm : high number of uncaptured cases by cancer registries. Blood 117, 7121–7125 (2011). 3. Troy, J. D., Atallah, E

  11. Bipolar II disorder as a risk factor for postpartum depression.

    Science.gov (United States)

    Mandelli, Laura; Souery, Daniel; Bartova, Lucie; Kasper, Siegfried; Montgomery, Stuart; Zohar, Joseph; Mendlewicz, Julien; Serretti, Alessandro

    2016-11-01

    There is evidence for a bipolar diathesis in postpartum depression (PPD) and women presenting with a first PPD frequently receive a diagnosis of bipolar type II disorder (BD-II). However formal evidence for an association between BD-II and PPD has not yet been reported. In the present study we tested a potential association between BD-II and PPD. Parous women with a diagnosis of bipolar type I disorder (BD-I) (n=93), BD-II (n=36) or major depressive disorder (MDD) (n=444) were considered in the present study. All women were retrospectively evaluated for history of PPD (DSM-IV criteria) and other clinical and socio-demographic features. Women with a history of PDD (n=139, 24%) were younger, younger at illness onset and had more family history for BD compared to women without history of PPD (n=436, 75.9%). Half of BD-II women reported PPD (50%), compared to less than one-third of BD-I and MDD women (respectively 27.5% and 21.6%) (p=0.004). Limitations include the retrospective assessment of PPD and no available data about the timing of postpartum episodes, illness onset or psychiatric care before or after childbirth, and the number of postpartum episodes. BD-II may confer a remarkable risk for PPD, which may be even higher than that of women affected by BD-I disorder. Careful monitoring of BD-II women during the pregnancy and postpartum period, as well as assessment of bipolar features in women with a PPD without a current diagnosis of BD are recommended. Copyright © 2016 Elsevier B.V. All rights reserved.

  12. Treatment implications of predominant polarity and the polarity index: a comprehensive review.

    Science.gov (United States)

    Carvalho, Andre F; Quevedo, João; McIntyre, Roger S; Soeiro-de-Souza, Márcio G; Fountoulakis, Konstantinos N; Berk, Michael; Hyphantis, Thomas N; Vieta, Eduard

    2014-10-31

    Bipolar disorder (BD) is a serious and recurring condition that affects approximately 2.4% of the global population. About half of BD sufferers have an illness course characterized by either a manic or a depressive predominance. This predominant polarity in BD may be differentially associated with several clinical correlates. The concept of a polarity index (PI) has been recently proposed as an index of the antimanic versus antidepressive efficacy of various maintenance treatments for BD. Notwithstanding its potential clinical utility, predominant polarity was not included in the DSM-5 as a BD course specifier. Here we searched computerized databases for original clinical studies on the role of predominant polarity for selection of and response to pharmacological treatments for BD. Furthermore, we systematically searched the Pubmed database for maintenance randomized controlled trials (RCTs) for BD to determine the PI of the various pharmacological agents for BD. We found support from naturalistic studies that bipolar patients with a predominantly depressive polarity are more likely to be treated with an antidepressive stabilization package, while BD patients with a manic-predominant polarity are more frequently treated with an antimanic stabilization package. Furthermore, predominantly manic BD patients received therapeutic regimens with a higher mean PI. The calculated PI varied from 0.4 (for lamotrigine) to 12.1 (for aripiprazole). This review supports the clinical relevance of predominant polarity as a course specifier for BD. Future studies should investigate the role of baseline, predominant polarity as an outcome predictor of BD maintenance RCTs. © The Author 2015. Published by Oxford University Press on behalf of CINP.

  13. Is Chytridiomycosis an Emerging Infectious Disease in Asia?

    Science.gov (United States)

    Swei, Andrea; Rowley, Jodi J. L.; Rödder, Dennis; Diesmos, Mae L. L.; Diesmos, Arvin C.; Briggs, Cheryl J.; Brown, Rafe; Cao, Trung Tien; Cheng, Tina L.; Chong, Rebecca A.; Han, Ben; Hero, Jean-Marc; Hoang, Huy Duc; Kusrini, Mirza D.; Le, Duong Thi Thuy; McGuire, Jimmy A.; Meegaskumbura, Madhava; Min, Mi-Sook; Mulcahy, Daniel G.; Neang, Thy; Phimmachak, Somphouthone; Rao, Ding-Qi; Reeder, Natalie M.; Schoville, Sean D.; Sivongxay, Niane; Srei, Narin; Stöck, Matthias; Stuart, Bryan L.; Torres, Lilia S.; Tran, Dao Thi Anh; Tunstall, Tate S.; Vieites, David; Vredenburg, Vance T.

    2011-01-01

    The disease chytridiomycosis, caused by the fungus Batrachochytrium dendrobatidis (Bd), has caused dramatic amphibian population declines and extinctions in Australia, Central and North America, and Europe. Bd is associated with >200 species extinctions of amphibians, but not all species that become infected are susceptible to the disease. Specifically, Bd has rapidly emerged in some areas of the world, such as in Australia, USA, and throughout Central and South America, causing population and species collapse. The mechanism behind the rapid global emergence of the disease is poorly understood, in part due to an incomplete picture of the global distribution of Bd. At present, there is a considerable amount of geographic bias in survey effort for Bd, with Asia being the most neglected continent. To date, Bd surveys have been published for few Asian countries, and infected amphibians have been reported only from Indonesia, South Korea, China and Japan. Thus far, there have been no substantiated reports of enigmatic or suspected disease-caused population declines of the kind that has been attributed to Bd in other areas. In order to gain a more detailed picture of the distribution of Bd in Asia, we undertook a widespread, opportunistic survey of over 3,000 amphibians for Bd throughout Asia and adjoining Papua New Guinea. Survey sites spanned 15 countries, approximately 36° latitude, 111° longitude, and over 2000 m in elevation. Bd prevalence was very low throughout our survey area (2.35% overall) and infected animals were not clumped as would be expected in epizootic events. This suggests that Bd is either newly emerging in Asia, endemic at low prevalence, or that some other ecological factor is preventing Bd from fully invading Asian amphibians. The current observed pattern in Asia differs from that in many other parts of the world. PMID:21887238

  14. Beta-defensins-2 expressions in gingival epithelium cells after probiotic Lactobacillus reuteri induction

    Directory of Open Access Journals (Sweden)

    Tuti Kusumaningsih

    2016-12-01

    Full Text Available Background: Beta-defensins (BD are antimicrobial peptides that play a role in defense against pathogens. Beta-defensins (BD are expressed by a variety of epithelial cells, including gingival epithelium, salivary glands, saliva and salivary duct. BD-1 is expressed constitutively, while BD-2 and BD-3 expressions can be induced by commensal bacteria. Probiotics are commensal bacteria, thus L. reuteri as probiotic bacteria may act as “inducer” for BD-2 in epithelial gingiva. S. mutans is the main bacteria causing dental caries and sensitive to BD-2. Purpose: This study was aimed to prove that the administration of probiotic L. reuteri may improve BD-2 expressions in the gingiva epithelium. Method: This study was conducted in vivo using twenty-four male Rattus norvegicus Wistar strains aged 10-12 weeks and weighed 120-150 g. Those rats were randomly divided into four groups, namely negative control group (not induced with L. reuteri or S. mutans, positive control group (induced with S. mutans for 14 days, treatment group 1 (induced with L. reuteri for 14 days and S. mutans for 7 days, and treatment group 2 (induced with L. reuteri and S. mutans for 14 days concurrently. The concentration of L. reuteri used was 4x108cfu/ml, while the concentration of S. mutans was 1x 1010cfu/ml. 0.1 ml of each was dropped in the region of the mandibular incisors. BD-2 expression was calculated using immunohistochemical method. The difference of BD-2 expressions in gingival epithelial cells in the respective groups was analyzed by Anova/SPSS. Results: There were significant differences in BD-2 expressions in gingival epithelial cells in each group based on the results of Anova test (p=0.001. Conclusion: The administration of probiotic L. reuteri is able to increase BD-2 expressions in gingival epithelial cells.

  15. Efficacy of infliximab in refractory posterior uveitis in Behcet's disease patients

    OpenAIRE

    Ayman K. El Garf; Amira A. Shahin; Sherif A. Shawky; Mohammed A. Azim; Dina A. Effat; Sherry K. Abdelrahman

    2018-01-01

    Aim of the work: Ocular manifestations are the main cause of morbidity in Behcet's disease (BD). Infliximab (IFX), a chimeric monoclonal antibody directed against tumor necrosis factor-alpha, may be efficient in refractory uveitis due to BD. The aim of this study was to assess the efficacy and safety of IFX in the treatment of patients with BD-associated refractory posterior uveitis (PU). Patient and Methods: Twenty patients with refractory Behcet's PU received IFX therapy as intravenous infu...

  16. The Neuropharmacology of Psychosis

    OpenAIRE

    Tamminga, Carol A.; Davis, John M.

    2007-01-01

    Antipsychotic drugs (APDs) are therapeutic in psychotic disorders. They are not specific treatments for schizophrenia (SZ) but useful in bipolar disorder (BD), psychotic depression, Alzheimers disease, and other psychotic diagnoses. In this perspective, we discuss the actions of APDs for the treatment of both SZ and bipolar-1 disorder (BD-1) with a specific focus on the implications of these data for the whole group of psychotic diagnoses. Both schizophrenic and BD-1 are characterized by seve...

  17. Association of killer cell immunoglobulin-like receptor (KIR) genes and their HLA ligands with susceptibility to Behçet's‎ disease.

    Science.gov (United States)

    Mohammad-Ebrahim, H; Kamali-Sarvestani, E; Mahmoudi, M; Beigy, M; Karami, J; Ahmadzadeh, N; Shahram, F

    2018-03-01

    Behçet's disease (BD) is a systemic inflammatory disorder with remissions and exacerbations. It is thought that defects in the natural killer (NK) cell repertoire may be involved in BD through killer cell immunoglobulin-like receptors (KIRs). This study aimed to evaluate KIR and HLA genes, their interactions in BD patients, and their associations with clinical manifestations. The presence or absence of KIR and HLA alleles and genotypes was analysed by polymerase chain reaction sequence-specific primer on genomic DNA of 397 BD patients and 300 healthy controls. None of the KIR genes showed significant effects on BD susceptibility. HLA-C1 Asn80 showed a protective effect against BD, whereas HLA-C2 Lys80 , HLA-B-Bw4 Ile80 , HLA-B5, and HLA-B51 were associated with a susceptibility risk for BD. In the combination of KIR and HLA genes, the frequencies of HLA genotypes no. 2, 3, 5, and 8, and inhibitory KIR no. 4 were significantly higher in patients than in controls. The frequencies of KIR genotype no. 3 and HLA genotypes no. 1, 4, 6, 7, and 9 were significantly lower in patients than in controls. There were many associations between KIR and HLA genes with clinical features of BD. Differences in the frequency of HLA genes, KIR-HLA interactions, and genotypes between BD and healthy controls and their associations with clinical manifestations indicate that NK cells are involved in BD pathogenesis. The observed differences indicated an NK cell activity imbalance in BD patients, and suggest a role of the KIR-HLA repertoire in the development of BD.

  18. Circadian Phase Preference in Pediatric Bipolar Disorder

    Directory of Open Access Journals (Sweden)

    Kerri L. Kim

    2014-03-01

    Full Text Available Pediatric bipolar disorder (BD rates have notably increased over the past three decades. Given the significant morbidity and mortality associated with BD, efforts are needed to identify factors useful in earlier detection to help address this serious public health concern. Sleep is particularly important to consider given the sequelae of disrupted sleep on normative functioning and that sleep is included in diagnostic criteria for both Major Depressive and Manic Episodes. Here, we examine one component of sleep—i.e., circadian phase preference with the behavioral construct of morningness/eveningness (M/E. In comparing 30 BD and 45 typically developing control (TDC participants, ages 7–17 years, on the Morningness-Eveningness Scale for Children (MESC, no between-group differences emerged. Similar results were found when comparing three groups (BD−ADHD; BD+ADHD; TDC. Consistent with data available on circadian phase preference in adults with BD, however, we found that BD adolescents, ages 13 years and older, endorsed significantly greater eveningness compared to their TDC peers. While the current findings are limited by reliance on subjective report and the high-rate of comorbid ADHD among the BD group, this finding that BD teens demonstrate an exaggerated shift towards eveningness than would be developmentally expected is important. Future studies should compare the circadian rhythms across the lifespan for individuals diagnosed with BD, as well as identify the point at which BD youth part ways with their healthy peers in terms of phase preference. In addition, given our BD sample was overall euthymic, it may be that M/E is more state vs. trait specific in latency age youth. Further work would benefit from assessing circadian functioning using a combination of rating forms and laboratory-based measures. Improved understanding of sleep in BD may identify behavioral targets for inclusion in prevention and intervention protocols.

  19. Hybrid Approach for Biliary Interventions Employing MRI-Guided Bile Duct Puncture with Near-Real-Time Imaging

    Energy Technology Data Exchange (ETDEWEB)

    Wybranski, Christian, E-mail: Christian.Wybranski@uk-koeln.de [University Hospital of Cologne, Department of Diagnostic and Interventional Radiology (Germany); Pech, Maciej [Otto-von-Guericke University Medical School, Department of Radiology and Nuclear Medicine (Germany); Lux, Anke [Otto-von-Guericke University Medical School, Institute of Biometry and Medical Informatics (Germany); Ricke, Jens; Fischbach, Frank; Fischbach, Katharina [Otto-von-Guericke University Medical School, Department of Radiology and Nuclear Medicine (Germany)

    2017-06-15

    ObjectiveTo assess the feasibility of a hybrid approach employing MRI-guided bile duct (BD) puncture for subsequent fluoroscopy-guided biliary interventions in patients with non-dilated (≤3 mm) or dilated BD (≥3 mm) but unfavorable conditions for ultrasonography (US)-guided BD puncture.MethodsA total of 23 hybrid interventions were performed in 21 patients. Visualization of BD and puncture needles (PN) in the interventional MR images was rated on a 5-point Likert scale by two radiologists. Technical success, planning time, BD puncture time and positioning adjustments of the PN as well as technical success of the biliary intervention and complication rate were recorded.ResultsVisualization even of third-order non-dilated BD and PN was rated excellent by both radiologists with good to excellent interrater agreement. MRI-guided BD puncture was successful in all cases. Planning and BD puncture times were 1:36 ± 2.13 (0:16–11:07) min. and 3:58 ± 2:35 (1:11–9:32) min. Positioning adjustments of the PN was necessary in two patients. Repeated capsular puncture was not necessary in any case. All biliary interventions were completed successfully without major complications.ConclusionA hybrid approach which employs MRI-guided BD puncture for subsequent fluoroscopy-guided biliary intervention is feasible in clinical routine and yields high technical success in patients with non-dilated BD and/or unfavorable conditions for US-guided puncture. Excellent visualization of BD and PN in near-real-time interventional MRI allows successful cannulation of the BD.

  20. Brain activation during self- and other-reflection in bipolar disorder with a history of psychosis: Comparison to schizophrenia

    Directory of Open Access Journals (Sweden)

    Liwen Zhang

    2015-01-01

    Conclusions: BD patients showed less activation in the PCC/precuneus during other-reflection. This may support an account of impaired integration of emotion and memory (evaluation of past and current other-related information in BD patients. Correlation differences of the PCC/precuneus activation with the cognitive insight in patients with BD and SZ might reflect an important difference between these disorders, which may help to further explore potentially distinguishing markers.

  1. Potential brain death organ donors - challenges and prospects: A single center retrospective review

    Directory of Open Access Journals (Sweden)

    Yousef Al-Maslamani

    2014-01-01

    Full Text Available Organ donation after brain death (BD is a major source for obtaining transplantable organs for patients with end-stage organ disease (ESOD. This retrospective, descriptive study was carried out on all potential BD patients admitted in different intensive care units (ICUs of the Hamad medical Corporation (HMC, Doha, Qatar during a period from January 2011 to April 2012. Our aim was to evaluate various demographic criteria and challenges of organ donation among potential BD organ donors and plan a strategy to improve the rate of organ donation in Qatar. Various aspects of BD patients in the ICUs and their possible effects on organ donation were studied. The time intervals analyzed to determine the possible causes of delay of organ retrieval were: time of diagnosing fixed dilated pupils in the ICU, to performing the first BD test, then to the second BD test, to family approach, to organ retrieval and/or circulatory death (CD without organ retrieval. There were a total of 116 potential BD organ donors of whom 96 (82.75% were males and 20 (17.25% were females. Brain hemorrhage and head injury contributed to 37 (31.9% and 32 (27.6% BD cases, respectively. Time interval between diagnosing fixed dilated pupil and performing the first test of BD was delayed >24 h in 79% of the cases and between the first and second BD tests was >6 h in 70.8% of the cases. This delay is not compatible with the Hamad Medical Corporation (HMC policy for BD diagnosis and resulted in a low number of organs retrieved. BD organ donation, a potential source for organs to save patients with ESOD has several pitfalls and every effort should be made to increase the awareness of the public as well as medical personnel to optimize donation efficacy.

  2. The Effect of Human Impact on Batrachochytrium dendrobatidis prevalence in Taricha torosa

    Science.gov (United States)

    Deng, V.; Macario, E.; Tumey, C.

    2014-12-01

    Batrachochytrium dendrobatidis (Bd) is emerging as a major cause of the amphibian extinction. As amphibians serve an important role as indicator species in their ecosystem and play a vital role in the food chain, Bd will not only affect the amphibian population but also the health of the environment. Bd is an aquatic fungus that blocks the porous skin of amphibians which interrupts electrolyte, gas and water transfer. This imbalances the electrolyte system which causes cells and organs to malfunction, therefore killing the amphibian. While frogs are more common for Bd, it is not often found in newts. However, Dr. Vance Vredenburg recently found an outbreak of Bd in Taricha torosa in Marin Headlands, California. This location was used in the research as the sample site with most human impact and was expected to have the highest prevalence according to the proposed hypothesis that more human impact will correspond with a higher prevalence of Bd. Decreasing the level of human impact, Fairfield Osborn Preserve and Galbreath Preserve were picked as the other sample sites. After the samples went through qPCR, all of them came back negative for Bd. These results did not support the hypothesis, however, it contributed data to explaining the dynamics of Bd when combined with Dr. Vance Vredenburg's data from 2 months earlier. Within the two months, there was a huge difference in the prevalence of Bd as it dropped from 88% to 0%. This shows that Taricha torosa does in fact get Bd. However, it is rarely detected because Bd is fast-acting and has high mortality rates. Therefore, it is least likely for current nonspecific surveys to swab the newts during a short but lethal Bd outbreak.

  3. Molecular Characterization and Expression Profiling of Brachypodium distachyon L. Cystatin Genes Reveal High Evolutionary Conservation and Functional Divergence in Response to Abiotic Stress

    Directory of Open Access Journals (Sweden)

    Saminathan Subburaj

    2017-05-01

    Full Text Available Cystatin is a class of proteins mainly involved in cysteine protease inhibition and plant growth and development, as well as tolerance under various abiotic stresses. In this study, we performed the first comprehensive analysis of the molecular characterization and expression profiling in response to various abiotic stresses of the cystatin gene family in Brachypodium distachyon, a novel model plant for Triticum species with huge genomes. Comprehensive searches of the Brachypodium genome database identified 25 B. distachyon cystatin (BdC genes that are distributed unevenly on chromosomes; of these, nine and two were involved in tandem and segmental duplication events, respectively. All BdC genes had similar exon/intron structural organization, with three conserved motifs similar to those from other plant species, indicating their high evolutionary conservation. Expression profiling of 10 typical BdC genes revealed ubiquitous expression in different organs at varying expression levels. BdC gene expression in seedling leaves was particularly highly induced by various abiotic stresses, including the plant hormone abscisic acid and various environmental cues (cold, H2O2, CdCl2, salt, and drought. Interestingly, most BdC genes were significantly upregulated under multiple abiotic stresses, including BdC15 under all stresses, BdC7-2 and BdC10 under five stresses, and BdC7-1, BdC2-1, BdC14, and BdC12 under four stresses. The putative metabolic pathways of cytastin genes in response to various abiotic stresses mainly involve the aberrant protein degradation pathway and reactive oxygen species (ROS-triggered programmed cell death signaling pathways. These observations provide a better understanding of the structural and functional characteristics of the plant cystatin gene family.

  4. Comorbidity between attention deficit hyperactivity disorder (ADHD) and bipolar disorder in a specialized mood disorders outpatient clinic.

    Science.gov (United States)

    Perroud, Nader; Cordera, Paolo; Zimmermann, Julien; Michalopoulos, Giorgio; Bancila, Victor; Prada, Paco; Dayer, Alexandre; Aubry, Jean-Michel

    2014-10-01

    Comorbidity between ADHD and Bipolar Disorder (BD) is associated with greater severity of BD. The current study aims at investigating, in a specialized mood disorders clinic, the percentage of comorbid ADHD-BD subjects and assessing the impact of ADHD on the severity of BD. Out of 539 mood disorders subjects, the medical records of 138 BD subjects were scrutinized in terms of their clinical and demographic characteristics, and their scores at the Adult ADHD Self-Report Scale (ASRS-v1.1) Symptom Checklist were logged. Those positively scoring at the ASRS-v1.1 underwent clinical assessment by a senior psychiatrist specialized in ADHD. Comorbid ADHD-BD subjects were then compared with BD sufferers without ADHD. Sixty-three (45.65%) of the participants were screened positive at the ASRS-v1.1. 49 were clinically assessed for the presence of ADHD. Only 27 (55%) received a diagnosis of ADHD. Comorbid ADHD-BD subjects were found to be younger at the onset of BD, showed higher numbers of depressive episodes, more anxiety and substance use disorders, more borderline personality traits and greater cyclothymic temperament. Comorbid BD-ADHD subjects reported more childhood emotional abuse. Some subjects were unreachable and thus not clinically assessed for ADHD. More than 20% of BD subjects were suffering from ADHD. The comorbidity of the two disorders was associated with worse outcomes, possibly resulting from stressful early-life events. More than 40% of the subjects who scored positively at the ASRS-v1.1 did not suffer from ADHD, which suggests that this scale should be used with caution in BD subjects. Copyright © 2014 Elsevier B.V. All rights reserved.

  5. Measurement and analysis of environmental exposure factors in the Federal Republic of Germany 1985/86. 1. environmental survey. Vol. 3c. Indoor situation in homes: Indoor air. Description of VOC in the indoor air of the Federal Republic of Germany; Messung und Analyse von Umweltbelastungsfaktoren in der Bundesrepublik Deutschland 1985/86. 1. Umwelt-Survey. Bd. 3c. Wohn-Innenraum: Raumluft. Deskription fluechtiger organischer Verbindungen in der Raumluft der Bundesrepublik Deutschland

    Energy Technology Data Exchange (ETDEWEB)

    Krause, C.; Chutsch, M.; Henke, M.; Huber, M.; Kliem, C.; Leiske, M.; Mailahn, M.; Schulz, C.; Schwarz, E.; Seifert, B.; Ullrich, D.

    1992-05-01

    This volume is based upon the data of the research project ``Environment and Health - Measurement and Analysis of Environmental Exposure Factors in the Federal Republic of Germany 1985/86`` (1st Environment Survey). These data were established for a representative sample of n=2731 cases selected by age, sex, and community size. It constitutes part C of the third report volume and contains the description of the concentrations of a large number of volatile organic compounds (VOC) in indoor air from households of the general population of the Federal Republic of Germany (sub-sample). Function and objectives of this third part of evaluated data are to give, as far as possible, a precise assessment of the exposure to VOC in households among the general population of the Federal Republic of Germany in 1985/86. This is to gie interested persons an orientation and a classifying survey of laboratory results to be evaluatd. In this sense, the estimated distributions of the measured concentrations are presented for the entire population as well as for the below menioned subpopulations classified by outdoor temperatures, community size, type of region, number of persons in industrial jobs in the urban/rural area, building density, year of construction of the house, floor area of home, type of heating, type of fuel, number of persons in household, children (below 14 years) in household, smokers in household, age of floor covering, age of wall coating, age of furniture, new painting/wall-paper/furniture in recent months, presence of chipboard on walls/floor, furniture from chipboard (in the case of formaldehyde only), use of insecticides, room fresheners/deodorants in toilet and of cleansing agents/disinfectants. (orig.) [Deutsch] Der vorliegende Berichtsband basiert auf den Daten der Studie ``Messung und Analyse von Umweltbelastungsfaktoren in der Bundesrepublik Deutschland 1985/86 - Umwelt und Gesundheit`` (1. Umwelt-Survey), der eine nach Alter, Geschlecht und Gemeindegroessenklasse repraesentative Stichprobe von n=2731 Faellen zugrunde liegt. Er ist Teil C des dritten Berichtsbands und enthaelt die Deskription der Gehalte zahlreicher fluechtiger organischer Verbindungen in der Raumluft der Haushalte der Allgemeinbevoelkerung der Bundesrepublik Deutschland (Unterstichprobe). Funktion und Zielsetzung dieses dritten Auswertungsteils bestehen in der moeglichst praezisen Schaetzung der tatsaechlichen Schadstoffbelastungen der Haushalte der Allgemeinbevoelkerung in der Bundesrepublik Deutschland waehrend der Jahre 1985/86. Damit soll Interessierten die Moeglichkeit einer Orientierung und uebersichtsmaessigen Einordnung zu bewertender Untersuchungsergebnisse gegeben werden. Im Sinne dieser Vergleichsfunktion werden die geschaetzten Verteilungen der gemessenen Gehalte in der Gesamtpopulation und in nachstehend genannten Teilpopulationen wiedergegeben: Ausstentemperaturklasse, Gemeindegroessenklasse, Regionstyp, Industriebeschaeftigtenzahl im Kreis, Bebauungsart, Baujahr des Hauses, Wohnflaeche, Heizungsart, Brennstoff/Energietraeger, Anzahl der Personen im Haushalt, Raucher im Haushalt, Kinder (unter 14 Jahren) im Haushalt, Altersklasse des Bodenbelages, Altersklasse des Wandbelages, Altersklasse der Moebel, Renovierung/Neumoeblierung waehrend der letzten Monate, Vorhandensein von Spanplatten an Wand, Fussboden, Vorhandensein von Moeblen aus gepresster Spanplatte (nur im Fall von Formaldehyd), Anwendung von Insektiziden bzw. Geruchsverbesserern/Toilettensteinen bzw. von Sanitaerreinigern/Desinfektionsmitteln. Gesicherte kausale Aussagen lassen sich aus rein deskriptiven Analysen nicht herleiten. (orig.)

  6. Effects of a chemical plant on surface water, illustrated by the example of the chemical plant at Berlin-Adlershof/Gruenau. Vol.3 in the series: Site profiles of persistent chlorinated hydrocarbons - cause-oriented monitoring in aquatic media; Auswirkungen eines Chemiestandortes auf umliegende Gewaesser dargestellt am Beispiel der chemischen Fabrik in Berlin-Adlershof/Gruenau. Bd. 3 der Reihe: Standortprofile persistenter chlorierter Kohlenwasserstoffe - ursachenorientiertes Monitoring in aquatischen Medien

    Energy Technology Data Exchange (ETDEWEB)

    Heinisch, E.; Kettrup, A.; Bergheim, W.; Wenzel, S.

    2002-06-01

    Primary data which were obtained on the basis of official surveys by the Senatsverwaltung fuer Stadtentwicklung/Fischereiamt des Landes Berlin for sDDT ({sigma} DDT, DDE, DDD, DDMU), sHCH ({sigma}{alpha}-, {beta}-, {gamma}-, {delta}-, {epsilon}-HCH), sPCB ({sigma} Cong. 28, 52, 101, 138, 153, 180) and HCB in surface water, surface sediment, suspended matter, breams (Abramis brama) and eels (Anguilla anguilla) a cause-oriented monitoring was elaborated concerning the load of waters of Berlin for the period 1983-2000. The structuring of the data consolidated statistically was made according to longitudinal profiles (Teltowkanal from the entrance to the Griebnitzsee, Spree-Oder-System from Seddinsee via Ober-, Stadt- and Unterspree to the mouth into the Havel in Spandau, the Havel from Niederneuendorfer See till Suedliche Unterhavel, the lakes in Grunewald till the city area in Charlottenburg, the lakes in the north of Berlin) as well as time series. The chemical enterprise in Adlershof/Gruenau which produced DDT containing preparations till 1985 and lindane containing preparations till 1989 was identified as the outstanding source of sDDT and sHCH loads. (orig.) [German] Auf der Basis amtlicher Erhebungen durch die Senatsverwaltung fuer Stadtentwicklung/Fischereiamt des Landes Berlin gewonnene Primaerdaten von sDDT ({sigma} DDT, DDE, DDD, DDMU), sHCH ({sigma}{alpha}-, {beta}-, {gamma}-, {delta}-, {epsilon}-HCH), sPCB ({sigma} Kong. 28, 52, 101, 138, 153, 180) und HCB in Oberflaechenwasser, Oberflaechensediment, Schwebstoffen, Brassen/Bleien (Abramis brama) und Aalen (Anguilla anguilla) wurde ein ursachenorientiertes Monitoring ueber die Belastung Berliner Gewaesser erarbeitet, das den Zeitraum von 1983-2000 umfasst. Die Strukturierung der statistisch aufgearbeiteten Werte erfolgte einmal nach Laengsprofilen (Teltowkanal von der Einfahrt bis zum Griebnitzsee, Spree-Oder-System vom Seddinsee ueber die Ober-, Stadt- und Unterspree bis zur Muendung in die Havel in Spandau, die Havel vom Niederneuendorfer See bis zur suedlichen Unterhavel, die Seen im Grunewald bis zum Stadtgebiet in Charlottenburg, die Seen im Norden von Berlin) sowie nach Zeitreihen. Als herausragender Verursacher von sDDT- und sHCH-Belastungen wurde die chemische Fabrik in Adlershof/Gruenau ermittelt, die bis 1985 DDT- und bis 1989 Lindan-enthaltende Handelspraeparate herstellte. (orig.)

  7. Effects of the ecological tax reform on the national economy. Vol. II of the final report of the project 'Quantification of the effects of the ecological tax reform on the environment, the labour market, and innovation'; Gesamtwirtschaftliche Effekte der oekologischen Steuerreform. Bd. II des Endberichts fuer das Vorhaben: ''Quantifizierung der Effekte der Oekologischen Steuerreform auf Umwelt, Beschaeftigung und Innovation''

    Energy Technology Data Exchange (ETDEWEB)

    Kohlhaas, Michael

    2005-08-15

    The economic effects of the ecological tax reform were investigated using the empirical equilibrium model LEAN2000. The calculations are an update of the analysis made by Bach et al. (2001). They were necessary as the earlier investigation was based on the laws prevailing in 2000 and boundary conditions were changed dramatically by the law on ecological tax reform of 23 December 2002. The investigation was based on the data calculated in part I of this project and using LEAN, a sequential-dynamic general equilibrium model comprising 13 sectors and (in the version used in the project) two regions (Germany and the remaining EU15). The electricity sector defines six different power generation technologies (coal, lignite, petroleum, gas, nuclear power, renewable energy sources). The model simulations mostly confirm the results of Bach et al. (2001): The ecological tax reform will help reduce CO2 emissions in Germany without negative effects on economic development. Additional jobs could be created at the same time by reducing old age insurance. The success of this measure will depend on wage demands, i.e. their reaction to changes in the job situation. It was also investigated how ecological tax models will affect the national economy. According to the model calculations, the effects are in the right direction but very low. This may be due to the fact that some industries may find it more favourable not to use energy efficiently but to make use of surplus settlement regulations. [German] In dieser Untersuchung werden Modellrechnungen zu den gesamtwirtschaftlichen Auswirkungen der oekologischen Steuerreform (OeSR) mit dem empirischen Gleichgewichtsmodell LEAN2000 durchgefuehrt. Diese Berechnungen stellen eine Aktualisierung der Analyse von Bach et al. (2001) dar. Die Neuberechnungen wurden notwendig, da die fruehere Untersuchung den Gesetzesstand im Jahr 2000 zu Grunde gelegt hat. Mit dem Gesetz zur Fortentwicklung der oekologischen Steuerreform vom 23.12.2002 wurden die Rahmenbedingungen jedoch erheblich veraendert. So wurden einige Steuersaetze erhoeht und die Sonderregelungen modifiziert, die Teilen der Wirtschaft gewaehrt werden, um die Belastungen durch die OeSR zu begrenzen. Die Untersuchung erfolgt auf der Basis der im ersten Teil dieses Teilprojekts berechneten Daten zur Be- und Entlastung einzelner Wirtschaftsbereiche und unter Beruecksichtigung einzel- und gesamtwirtschaftlicher Anpassungsreaktionen. Fuer die Berechnung wird LEAN eingesetzt, ein sequentiell-dynamisches berechenbares allgemeines Gleichgewichtsmodell mit 13 Sektoren und (in der fuer dieses Projekt verwendeten Version) zwei Regionen (Deutschland und die uebrige EU15). Fuenf der Sektoren entsprechen den Energietraegern Steinkohle, Braunkohle, Mineraloel, Gas und Elektrizitaet. Der Elektrizitaetssektor unterscheidet sechs verschiedene Erzeugungstechnologien (Steinkohle, Braunkohle, Oel, Gas, Kernenergie und regenerierbare Energien). Die Modellsimulationen bestaetigen im Wesentlichen die Ergebnisse von Bach et al. (2001): Die OeSR in Deutschland ist geeignet, einen substanziellen Beitrag zur Verminderung der CO2-Emissionen herbeizufuehren, ohne die wirtschaftliche Entwicklung zu beeintraechtigen. Gleichzeitig kann ueber die Senkung der Rentenversicherungsbeitraege ein Anreiz gegeben werden, zusaetzliche Arbeitsplaetze zu schaffen. Ob und in welchem Umfang dies gelingt, haengt in dem Modell davon ab, wie stark die Lohnforderungen auf eine Veraenderung der Beschaeftigungssituation reagieren. Darueber hinaus wurde untersucht, wie sich die Neuregelung der Sonderregelungen fuer die Wirtschaft auswirkt, deren Ziel es war, oekologische Anreize zur effizienten Energienutzung zu verstaerken, ohne die internationale Wettbewerbssituation der Unternehmen zu gefaehrden. Nach den Modellrechnungen gehen die Effekte zwar in die richtige Richtung, sind quantitativ aber sehr gering. Dazu traegt vor allem bei, dass fuer einen Teil der Unternehmen durch die Neugestaltung der Anreiz, Energie effizient einzusetzen, nicht steigt, sondern sogar sinkt, weil sie im Gegensatz zur alten Regelung jetzt den so genannten Spitzenausgleich in Anspruch nehmen koennen.

  8. The BdV screen of memory and Ciutat d'Asunción boulevard at the Baró de Viver neighborhood (Barcelona: (rethinking citizens' participation in urban design El mural de la memoria y la Rambla Ciutat d’Asunción del barrio de Baró de Viver (Barcelona: repensado la participación ciudadana en el diseño urbano

    Directory of Open Access Journals (Sweden)

    Tomeu Vidal

    2012-03-01

    Full Text Available

    We present a case of citizen participation to design some public spaces in Baró de Viver, a neighbourhood of the city of Barcelona. Our aim is to reflect on the ways to understand citizen participation in political and academic agenda, the role of different actors (citizens, professionals, politicians... and strategies and methods used in participatory urban planning. The experience showed in this paper is located in a scale of urban design very close and well known to the people. We begin with a brief historical overview of the neighborhood where the project arose. Then we give an account of the stages of the participatory process, showing the main milestones, features and methods. Finally we propose some ideas to rethink the conceptual and methodological aspects of the intervention and urban research in environmental psychology and people-environment studies.

    En este artículo presentamos una experiencia de participación ciudadana para diseñar varios espacios públicos del barrio de Baró de Viver, en Barcelona. El objetivo es reflexionar en torno a la manera de entender la participación ciudadana en las agendas política y académica, el papel de los diferentes actores (ciudadanos, técnicos, políticos… y las estrategias y métodos utilizados en las decisiones sobre el espacio de la ciudad. La experiencia se sitúa en la escala de diseño urbano que, por su cotidianeidad, suele provocar más implicación entre la ciudadanía. Empezamos con una breve descripción histórica y social del barrio donde surge el proyecto, para luego dar cuenta de las etapas del proceso participativo, describiendo sus principales hitos, características y métodos desarrollados. Concluimos con algunos elementos de reflexión en torno a los objetivos planteados, con el fin de repensar los fundamentos conceptuales y metodológicos de la intervención y la investigación urbanas en la psicología ambiental y disciplinas afines.

  9. Cognition in older adults with bipolar disorder versus major depressive disorder.

    Science.gov (United States)

    Gildengers, Ariel G; Butters, Meryl A; Chisholm, Denise; Anderson, Stewart J; Begley, Amy; Holm, Margo; Rogers, Joan C; Reynolds, Charles F; Mulsant, Benoit H

    2012-03-01

    Bipolar disorder (BD) and major depressive disorder (MDD) are associated with cognitive dysfunction in older age during both acute mood episodes and remitted states. The purpose of this study was to investigate for the first time the similarities and differences in the cognitive function of older adults with BD and MDD that may shed light on mechanisms of cognitive decline. A total of 165 subjects with BD (n = 43) or MDD (n = 122), ages ≥ 65 years [mean (SD) 74.2 (6.2)], were assessed when euthymic, using comprehensive measures of cognitive function and cognitive-instrumental activities of daily living (C-IADLs). Test results were standardized using a group of mentally healthy individuals (n = 92) of comparable age and education level. Subjects with BD and MDD were impaired across all cognitive domains compared with controls, most prominently in Information Processing Speed/Executive Function. Despite the protective effects of having higher education and lower vascular burden, BD subjects were more impaired across all cognitive domains compared with MDD subjects. Subjects with BD and MDD did not differ significantly in C-IADLs. In older age, patients with BD have worse overall cognitive function than patients with MDD. Our findings suggest that factors intrinsic to BD appear to be related to cognitive deterioration and support the understanding that BD is associated with cognitive decline. © 2012 John Wiley and Sons A/S.

  10. Selectivity analyses of γ-benzylidene digoxin derivatives to different Na,K-ATPase α isoforms: a molecular docking approach.

    Science.gov (United States)

    Pessôa, Marco T C; Alves, Silmara L G; Taranto, Alex G; Villar, José A F P; Blanco, Gustavo; Barbosa, Leandro A

    2018-12-01

    Digoxin and other cardiotonic steroids (CTS) exert their effect by inhibiting Na,K-ATPase (NKA) activity. CTS bind to the various NKA isoforms that are expressed in different cell types, which gives CTS their narrow therapeutic index. We have synthesised a series of digoxin derivatives (γ-Benzylidene digoxin derivatives) with substitutions in the lactone ring (including non-oxygen and ether groups), to obtain CTS with better NKA isoform specificity. Some of these derivatives show some NKA isoform selective effects, with BD-3, BD-8, and BD-13 increasing NKA α2 activity, BD-5 inhibiting NKA α1 and NKA α3, BD-10 reducing NKA α1, but stimulating NKA α2 and α3; and BD-14, BD-15, and BD-16 enhancing NKA α3 activity. A molecular-docking approach favoured NKA isoform specific interactions for the compounds that supported their observed activity. These results show that BD compounds are a new type of CTS with the capacity to target NKA activity in an isoform-specific manner.

  11. Distribution and pathogenicity of Batrachochytrium dendrobatidis in boreal toads from the grand teton area of western wyoming

    Science.gov (United States)

    Murphy, P.J.; St-Hilaire, S.; Bruer, S.; Corn, P.S.; Peterson, C.R.

    2009-01-01

    The pathogen Batrachochytrium dendrobatidis (Bd), which causes the skin disease chytridiomycosis, has been linked to amphibian population declines and extinctions worldwide. Bd has been implicated in recent declines of boreal toads, Bufo boreas boreas, in Colorado but populations of boreal toads in western Wyoming have high prevalence of Bd without suffering catastrophic mortality. In a field and laboratory study, we investigated the prevalence of Bd in boreal toads from the Grand Teton ecosystem (GRTE) in Wyoming and tested the pathogenicity of Bd to these toads in several environments. The pathogen was present in breeding adults at all 10 sites sampled, with a mean prevalence of 67%. In an experiment with juvenile toadlets housed individually in wet environments, 106 zoospores of Bd isolated from GRTE caused lethal disease in all Wyoming and Colorado animals within 35 days. Survival time was longer in toadlets from Wyoming than Colorado and in toadlets spending more time in dry sites. In a second trial involving Colorado toadlets exposed to 35% fewer Bd zoospores, infection peaked and subsided over 68 days with no lethal chytridiomycosis in any treatment. However, compared with drier aquaria with dry refuges, Bd infection intensity was 41% higher in more humid aquaria and 81% higher without dry refuges available. Our findings suggest that although widely infected in nature, Wyoming toads may escape chytridiomycosis due to a slight advantage in innate resistance or because their native habitat hinders Bd growth or provides more opportunities to reduce pathogen loads behaviorally than in Colorado. ?? 2009 International Association for Ecology and Health.

  12. Binswanger's Disease

    Science.gov (United States)

    ... adult years, by controlling risk factors such as hypertension, diabetes, and smoking. View Full Treatment Information Definition Binswanger's disease (BD), also called subcortical vascular dementia, ...

  13. Detection of the Amphibian Chytrid Fungus Batrachochytrium dendrobatidis in Museum Specimens of Andean Aquatic Birds: Implications for Pathogen Dispersal.

    Science.gov (United States)

    Burrowes, Patricia A; De la Riva, Ignacio

    2017-04-01

    The occurrence of the pathogenic chytrid fungus Batrachochytrium dendrobatidis (Bd) in the feet of live waterfowl has been documented, but the potential role of birds as dispersers has not been studied. We report the presence of Bd in the feet of preserved aquatic birds in the Bolivian high Andes during the time of drastic amphibian declines in the country. We sampled 48 aquatic birds from the Bolivian Andes that were preserved in museum collections. Birds were sampled for the presence of Bd DNA by swabbing, taking small pieces of tissue from toe webbing, or both. We detected Bd by DNA using quantitative PCR in 42% of the birds sampled via toe tissue pieces. This method was significantly better than swabbing at detecting Bd from bird feet. We confirmed Bd presence by sequencing Bd -positive samples and found 91-98% homology with Bd sequences from GenBank. Our study confirms that aquatic birds can carry Bd and thus may serve as potential vectors of this pathogen across large distances and complex landscapes. In addition, we recommend using DNA from preserved birds as a novel source of data to test hypotheses on the spread of chytridiomycosis in amphibians.

  14. Amphibian Chytrid Fungus in Madagascar neither Shows Widespread Presence nor Signs of Certain Establishment.

    Science.gov (United States)

    Kolby, Jonathan E; Skerratt, Lee F

    2015-01-01

    The global spread of amphibian chytrid fungus (Batrachochytrium dendrobatidis, Bd) is associated with amphibian mass mortality, population decline, and extinction. Over the past decade, concern has been expressed for the potential introduction of Bd to Madagascar, a global hotspot of amphibian biodiversity. Following years without detection, widespread Bd presence in Madagascar has now been reported (Bletz et al. 2015a), raising international conservation concern. Before reacting to this finding with a significant management response, the accuracy and context of the data warrant cautious review. Re-examination of a 10-year dataset together with results from more recent surveillance (Kolby et al. 2015) does not yet demonstrate widespread Bd presence. Detection of Bd at "positive" locations in Madagascar has been inconsistent for unknown reasons. Whether Bd is established in Madagascar (i.e. populations are self-sustaining) or instead requires continued introduction to persist also remains uncertain. The deployment of emergency conservation rescue initiatives is expected to target areas where the distribution of Bd and the risk of chytridiomycosis endangering amphibians is believed to overlap. Thus, erroneous description of Bd presence would misdirect limited conservation resources. Standardized surveillance and confirmatory surveys are now imperative to reliably characterize the distribution, potential spread, virulence and overall risk of Bd to amphibians in Madagascar.

  15. High prevalence of the amphibian chytrid pathogen in Gabon.

    Science.gov (United States)

    Bell, Rayna C; Gata Garcia, Adriana V; Stuart, Bryan L; Zamudio, Kelly R

    2011-03-01

    Amphibian chytridiomycosis is an infectious disease caused by the fungus Batrachochytrium dendrobatidis (Bd) that is implicated in the worldwide decline and extinction of amphibians. Africa has been proposed as a potential source for the global expansion of Bd, yet the distribution of Bd across the continent remains largely unexplored. Using quantitative polymerase chain reaction (qPCR), we screened for the presence of Bd in 166 adult anurans from two national parks in Gabon (Monts de Cristal and Ivindo). Bd was detected in 20 of the 42 species and was present at all three sites surveyed (two in Monts de Cristal, and one in Ivindo) with high prevalence (19.6%-36.0%). Both national parks were Bd-positive at all elevations and across habitat types, though no dead or dying frogs were encountered. To our knowledge, this study presents the first evidence of Bd in Gabon and the first record of infection for 19 of the 20 species that were Bd-positive. Documenting the distribution and virulence of Bd across Africa will be essential for understanding the dynamics of amphibian chytridiomycosis across the globe.

  16. Immune dysfunction in bipolar disorder and suicide risk: is there an association between peripheral corticotropin-releasing hormone and interleukin-1β?

    Science.gov (United States)

    Monfrim, Xênia; Gazal, Marta; De Leon, Pâmela B; Quevedo, Luciana; Souza, Luciano D; Jansen, Karen; Oses, Jean P; Pinheiro, Ricardo T; Silva, Ricardo A; Lara, Diogo R; Ghisleni, Gabriele; Spessato, Barbara; Kaster, Manuella P

    2014-11-01

    The aim of the present study was to investigate the relationship between peripheral levels of corticotropin-releasing hormone (CRH) and interleukin-1β (IL-1β) in individuals with bipolar disorder (BD) with and without suicide risk (SR), and controls. A total of 120 young adults (40 controls, 40 subjects with BD without SR, and 40 subjects with BD with SR) were enrolled from a population-based study carried out in the city of Pelotas, Brazil. BD and SR were assessed through the Mini International Neuropsychiatric Interview (MINI 5.0), and peripheral markers were evaluated by enzyme-linked immunosorbent assay (ELISA). Levels of CRH were significantly lower both in subjects with BD without SR (p = 0.04) and subjects with BD with SR (p = 0.02) when compared to controls. However, levels of IL-1β were increased in subjects with BD with SR (p = 0.05) when compared to controls. Sociodemographic and clinical variables, current mood episode, and use of psychiatric medications were not associated with changes in these markers. No correlation was found between peripheral levels of CRH and IL-1β (p = 0.60) in the population or in the BD with SR group (p = 0.88). These results suggest that peripheral mechanisms linking stress hormones and the immune system might be critical patterns involved in suicidal behavior associated with BD. © 2014 John Wiley & Sons A/S. Published by John Wiley & Sons Ltd.

  17. Prediction of vulnerability to bipolar disorder using multivariate neurocognitive patterns: a pilot study.

    Science.gov (United States)

    Wu, Mon-Ju; Mwangi, Benson; Passos, Ives Cavalcante; Bauer, Isabelle E; Cao, Bo; Frazier, Thomas W; Zunta-Soares, Giovana B; Soares, Jair C

    2017-09-01

    Bipolar disorder (BD) is a common disorder with high reoccurrence rate in general population. It is critical to have objective biomarkers to identify BD patients at an individual level. Neurocognitive signatures including affective Go/No-go task and Cambridge Gambling task showed the potential to distinguish BD patients from health controls as well as identify individual siblings of BD patients. Moreover, these neurocognitive signatures showed the ability to be replicated at two independent cohorts which indicates the possibility for generalization. Future studies will examine the possibility of combining neurocognitive data with other biological data to develop more accurate signatures.

  18. Neurocognitive profile of euthymic Japanese patients with bipolar disorder.

    Science.gov (United States)

    Ishisaka, Nozomi; Shimano, Satomi; Miura, Tomofumi; Motomura, Keisuke; Horii, Machiko; Imanaga, Hisako; Kishimoto, Junji; Kaneda, Yasuhiro; Sora, Ichiro; Kanba, Shigenobu

    2017-06-01

    Neurocognitive impairment is one of the core symptoms of bipolar disorder (BD). The MATRICS Cognitive Consensus Battery (MCCB) is a potential consensus assessment tool to evaluate cognitive function in patients with BD. Here, we report on cognitive deficits evaluated using the MCCB Japanese version (MCCB-J) in euthymic Japanese patients with BD, and compare them with scores in previous studies. We compared neurocognitive function in 25 patients with euthymic BD and 53 healthy controls (HC). Additionally, we searched all available databases for studies that have evaluated cognitive function in BD using the MCCB, and conducted a meta-analysis. Canonical discriminant analysis revealed significant differences in MCCB-J domain scores between BD and HC. Patients with BD performed significantly worse on visual learning, social cognition, speed of processing, and MCCB composite scores. Our meta-analysis revealed that patients with BD performed worse than HC, as reflected by MCCB composite scores and scores on all seven cognitive domains. However, there are differences in the cognitive deficits identified in previous studies compared with our participants, particularly social cognition. As reported in previous studies, neurocognitive deficits were observed in Japanese euthymic BD patients assessed using the MCCB-J. Further study is needed to clarify whether differences in social cognition between this study and previous studies are a result of coping mechanisms for social settings in Japanese populations. © 2016 The Authors. Psychiatry and Clinical Neurosciences © 2016 Japanese Society of Psychiatry and Neurology.

  19. Distribution limits of Batrachochytrium dendrobatidis: a case study in the Rocky Mountains, USA

    Science.gov (United States)

    Hossack, Blake R.; Muths, Erin L.; Anderson, Chauncey W.; Kirshtein, Julie D.; Corn, P. Stephen

    2009-01-01

    Knowledge of the environmental constraints on a pathogen is critical to predicting its dynamics and effects on populations. Batrachochytrium dendrobatidis (Bd), an aquatic fungus that has been linked with widespread amphibian declines, is ubiquitous in the Rocky Mountains. As part of assessing the distribution limits of Bd in our study area, we sampled the water column and sediments for Bd zoospores in 30 high-elevation water bodies that lacked amphibians. All water bodies were in areas where Bd has been documented from neighboring, lower-elevation areas. We targeted areas lacking amphibians because existence of Bd independent of amphibians would have both ecologic and management implications. We did not detect Bd, which supports the hypothesis that it does not live independently of amphibians. However, assuming a detection sensitivity of 59.5% (based on sampling of water where amphibians tested positive for Bd), we only had 95% confidence of detecting Bd if it was in > or =16% of our sites. Further investigation into potential abiotic reservoirs is needed, but our results provide a strategic step in determining the distributional and environmental limitations of Bd in our study region.

  20. NanoHPLC-nanoESI(+)-MS/MS quantitation of bis-N7-guanine DNA-DNA cross-links in tissues of B6C3F1 mice exposed to subppm levels of 1,3-butadiene.

    Science.gov (United States)

    Sangaraju, Dewakar; Goggin, Melissa; Walker, Vernon; Swenberg, James; Tretyakova, Natalia

    2012-02-07

    1,3-Butadiene (BD) is an important industrial chemical and a common environmental pollutant present in urban air. BD is classified as a human carcinogen based on epidemiological evidence for an increased incidence of leukemia in workers occupationally exposed to BD and its potent carcinogenicity in laboratory mice. A diepoxide metabolite of BD, 1,2,3,4-diepoxybutane (DEB), is considered the ultimate carcinogenic species of BD due to its ability to form genotoxic DNA-DNA cross-links. We have previously employed capillary HPLC-ESI(+)-MS/MS (liquid chromatography-electrospray ionization tandem mass spectrometry) methods to quantify DEB-induced DNA-DNA conjugates, e.g. 1,4-bis-(guan-7-yl)-2,3-butanediol (bis-N7G-BD), 1-(guan-7-yl)-4-(aden-1-yl)-2,3-butanediol (N7G-N1A-BD), and 1,N(6)-(1-hydroxymethyl-2-hydroxypropan-1,3-diyl)-2'-deoxyadenosine (1,N(6)-HMHP-dA), in tissues of laboratory mice exposed to 6.25-625 ppm BD (Goggin et al. Cancer Res. 2009, 69(6), 2479-2486). However, typical BD human exposure levels are 0.01 to 3.2 ppb in urban air and 1-2.0 ppm in an occupational setting, requiring greater detection sensitivity for these critical lesions. In the present study, a nanoHPLC-nanoESI(+)-MS/MS method was developed for ultrasensitive, accurate, and precise quantitation of bis-N7G-BD in tissues of laboratory mice treated with low ppm and subppm concentrations of BD. The LOD value of the new method is 0.5 fmol/100 μg DNA, and the LOQ is 1.0 fmol/100 μg DNA, making it possible to quantify bis-N7G-BD adducts present at concentrations of 3 per 10(9) nucleotides. Bis-N7G-BD adduct amounts in liver tissues of mice exposed to 0.5, 1.0, and 1.5 ppm BD for 2 weeks were 5.7 ± 3.3, 9.2 ± 1.5, and 18.6 ± 6.9 adducts per 10(9) nucleotides, respectively, suggesting that bis-N7G-BD adduct formation is more efficient under low exposure conditions. To our knowledge, this is the first quantitative analysis of DEB specific DNA adducts following low ppm and subppm exposure to BD

  1. Cognitive performance is impaired in euthymic Chinese patients with Bipolar 1 Disorder.

    Science.gov (United States)

    Eric, Y W; Halari, Rozmin; Cheng, Koi Men; Leung, Siu Kau; Young, Allan H

    2013-10-01

    Data from euthymic patients with Bipolar Disorder (BD) has shown cognitive impairment and the notion that sufferers of BD achieve full recovery between illness episodes is questionable. These findings have not been replicated in a Chinese population. The present study examined the cognitive profile of euthymic Chinese patients with Bipolar 1 Disorder (BD-1) and matched healthy control participants. Euthymic patients with BD-1 and matched controls (n=104 in total) completed serial measures to assess mood and also completed an IQ test and the Central Nervous System Vital Signs (CNSVS) computerized battery assessing memory (verbal and visual), executive functions, attention, psychomotor and processing speed. Patients with BD-1 performed worse than controls on all cognitive domains. When using 2 or more scores below the 5th percentile as a cutoff for neurocognitive impairment, 46.2% of the patients with BD-1 and none of the control sample scored in this range (p<.001). Correlational analysis among the illness variables in BD-1 revealed that cognitive performance was inversely correlated with the number of manic episodes and duration of illness. It was not possible to determine the causal relationship between associated illness and performance. The effect of medication on cognitive performance requires further study. Euthymic Chinese patients with BD-1 demonstrate marked cognitive impairments and these correlated with illness parameters. Cognitive impairment in BD may be independent of language and culture. © 2013 Elsevier B.V. All rights reserved.

  2. A newly isolated Bacillus licheniformis strain thermophilically produces 2,3-butanediol, a platform and fuel bio-chemical.

    Science.gov (United States)

    Li, Lixiang; Zhang, Lijie; Li, Kun; Wang, Yu; Gao, Chao; Han, Binbin; Ma, Cuiqing; Xu, Ping

    2013-08-28

    2,3-Butanediol (2,3-BD), a platform and fuel bio-chemical, can be efficiently produced by Klebsiella pneumonia, K. oxytoca, and Serratia marcescens. However, these strains are opportunistic pathogens and not favorable for industrial application. Although some generally regarded as safe (GRAS) microorganisms have been isolated in recent years, there is still a demand for safe 2,3-BD producing strains with high productivity and yield under thermophilic fermentation. Bacillus licheniformis strain 10-1-A was newly isolated for 2,3-BD production. The optimum temperature and medium pH were 50°C and pH 7.0 for 2,3-BD production by strain 10-1-A. The medium composition was optimized through Plackett-Burman design and response surface methodology techniques. With a two-stage agitation speed control strategy, 115.7 g/L of 2,3-BD was obtained from glucose by fed-batch fermentation in a 5-L bioreactor with a high productivity (2.4 g/L·h) and yield (94% of its theoretical value). The 2,3-BD produced by strain 10-1-A comprises (2R,3R)-2,3-BD and meso-2,3-BD with a ratio of nearly 1:1. The bdh and gdh genes encoding meso-2,3-butanediol dehydrogenase (meso-BDH) and glycerol dehydrogenase (GDH) of strain 10-1-A were expressed in Escherichia coli and the proteins were purified. meso-2,3-BD and (2R,3R)-2,3-BD were transformed from racemic acetoin by meso-BDH and GDH with NADH, respectively. Compared with the reported GRAS 2,3-BD producers, B. licheniformis 10-1-A could thermophilically produce 2,3-BD with a high concentration, productivity and yield. Thus, the newly isolated GRAS strain 10-1-A might be a promising strain for industrial production of 2,3-BD. Two key enzymes for meso-2,3-BD and (2R,3R)-2,3-BD production were purified and further studied, and this might be helpful to understand the mechanism for 2,3-BD stereoisomers forming in B. licheniformis.

  3. Gene expression differs in susceptible and resistant amphibians exposed toBatrachochytrium dendrobatidis.

    Science.gov (United States)

    Eskew, Evan A; Shock, Barbara C; LaDouceur, Elise E B; Keel, Kevin; Miller, Michael R; Foley, Janet E; Todd, Brian D

    2018-02-01

    Chytridiomycosis, the disease caused by the fungal pathogen Batrachochytrium dendrobatidis ( Bd ), has devastated global amphibian biodiversity. Nevertheless, some hosts avoid disease after Bd exposure even as others experience near-complete extirpation. It remains unclear whether the amphibian adaptive immune system plays a role in Bd defence. Here, we describe gene expression in two host species-one susceptible to chytridiomycosis and one resistant-following exposure to two Bd isolates that differ in virulence. Susceptible wood frogs ( Rana sylvatica ) had high infection loads and mortality when exposed to the more virulent Bd isolate but lower infection loads and no fatal disease when exposed to the less virulent isolate. Resistant American bullfrogs ( R. catesbeiana ) had high survival across treatments and rapidly cleared Bd infection or avoided infection entirely. We found widespread upregulation of adaptive immune genes and downregulation of important metabolic and cellular maintenance components in wood frogs after Bd exposure, whereas American bullfrogs showed little gene expression change and no evidence of an adaptive immune response. Wood frog responses suggest that adaptive immune defences may be ineffective against virulent Bd isolates that can cause rapid physiological dysfunction. By contrast, American bullfrogs exhibited robust resistance to Bd that is likely attributable, at least in part, to their continued upkeep of metabolic and skin integrity pathways as well as greater antimicrobial peptide expression compared to wood frogs, regardless of exposure. Greater understanding of these defences will ultimately help conservationists manage chytridiomycosis.

  4. Morphometric characterization of Binswanger's disease: Comparison with Alzheimer's disease

    Energy Technology Data Exchange (ETDEWEB)

    Shiino, Akihiko, E-mail: shiino@belle.shiga-med.ac.jpc.jp [Biomedical MR Science Center, Shiga University of Medical Science, Seta, Ohtsu, Shiga 520-2192 (Japan); Akiguchi, Ichiro; Watanabe, Toshiyuki; Shirakashi, Yoshitomo [Center of Neurological and Cerebrovascular Disease, Takeda Hospital (Japan); Nozaki, Kazuhiko [Department of Neurosurgery, Shiga University of Medical Science (Japan); Tooyama, Ikuo [Molecular Neuroscience Research Center, Shiga University of Medical Science (Japan); Inubushi, Toshiro [Biomedical MR Science Center, Shiga University of Medical Science, Seta, Ohtsu, Shiga 520-2192 (Japan)

    2012-09-15

    Background and purpose: Dementia due to hypertensive vascular disease is a potential target to treat prophylactively before it progresses insidiously. Binswanger's disease (BD) is a type of subcortical vascular dementia, but its clinical features and pathophysiology are still obscure. We therefore tried to find a topographic distribution of brain atrophy in BD by morphometric analysis. Methods: Twenty patients with BD, 50 patients with AD, and 80 elderly controls were recruited. We contrasted the gray matter atrophy of BD to that of AD to identify a pathognomic pattern using magnetic resonance imaging. We used DARTEL (diffeomorphic anatomical registration through exponential Lie algebra) for voxel-based morphometry, expecting that its sophisticated algorithm would work well to deal with the subjects with brain atrophy. Results: Atrophy of cortices was predominant in the posterior cortices in AD but was in the anterior cortices in BD. Atrophy of amygdala and hippocampus was similar in each disease. In contrast, thalamus, caudate nucleus, insula, anterior cingulate cortex, and frontal cortices were significantly more atrophied in BD than in AD (z-score >3). Conclusions: We demonstrated topographic patterns of brain atrophy in BD. Since affected regions of BD match with the anatomical connections of frontal–subcortical circuits, it seems reasonable to suppose that BD pathology is the result of hypertensive vascular disease and subsequent regression from the white matter injuries.

  5. Divergent Urinary Metabolic Phenotypes between Major Depressive Disorder and Bipolar Disorder Identified by a Combined GC-MS and NMR Spectroscopic Metabonomic Approach.

    Science.gov (United States)

    Chen, Jian-Jun; Zhou, Chan-Juan; Liu, Zhao; Fu, Yu-Ying; Zheng, Peng; Yang, De-Yu; Li, Qi; Mu, Jun; Wei, You-Dong; Zhou, Jing-Jing; Huang, Hua; Xie, Peng

    2015-08-07

    Bipolar disorder (BD) is a complex debilitating mental disorder that is often misdiagnosed as major depressive disorder (MDD). Therefore, a large percentage of BD subjects are incorrectly treated with antidepressants in clinical practice. To address this challenge, objective laboratory-based tests are needed to discriminate BD from MDD patients. Here, a combined gas chromatography-mass spectrometry (GC-MS)-based and nuclear magnetic resonance (NMR) spectro