Directory of Open Access Journals (Sweden)
Thaís Luciana Betto
2013-09-01
Full Text Available O objetivo deste trabalho foi estudar o tratamento biológico de efluente de indústria de vegetais congelados em Reator em Batelada Sequencial (RBS, verificando o efeito da concentração de Sólidos Suspensos Voláteis (SSV, Demanda Química de Oxigênio inicial (DQOi e aeração na remoção biológica de carbono e nitrogênio, a fim de obter um efluente tratado que atenda aos padrões de lançamento recomendados pela legislação ambiental brasileira. Nesta pesquisa, o tratamento dos efluentes foi feito em um RBS, utilizando concentração de SSV variando entre 2000 mg.L-1 e 4000 mg.L-1, DQOi variando entre 300 mg.L-1 e 600 mg.L-1, e quantidade de aeração variando entre 3 L.min-1 e 6 L.min-1. Os resultados mostram que a maior eficiência de remoção para DQO foi de 88%, e para nitrogênio total Kjeldahl (NTK foi de 74,9%. As condições otimizadas para remoção de DQO e NTK do efluente estudado foram: DQO inicial de 600 mg.L-1, aeração de 4,5 L.min-1 e concentração de SSV de 2000 mg.L-1
Directory of Open Access Journals (Sweden)
Roberto Alves de Oliveira
2009-12-01
Full Text Available Neste estudo avaliou-se o desempenho de um reator anaeróbio operado em batelada sequencial, em escala piloto, com volume total de 280 L, no tratamento de águas residuárias de suinocultura. As cargas orgânicas volumétricas aplicadas no reator foram de 4,42; 5,27; 9,33 e 11,79 g DQOtotal (L d-1. As eficiências médias de remoção de DQOtotal, sólidos suspensos totais (SST e sólidos suspensos voláteis (SSV variaram de 56 a 87%. O nitrogênio total Kjedahl (NTK, fósforo total (P-total e magnésio (Mg foram removidos com eficiências médias de 26 a 39%. As produções volumétricas de metano variaram de 0,50 a 0,64 L CH4 (L reator d-1 e não foram observadas diferenças significativas. As relações sólidos voláteis/sólidos totais (SV/ST do lodo de tal reator variaram de 0,74 a 0,58. As maiores concentrações médias de nutrientes no lodo do reator foram para o nitrogênio, fósforo, ferro e cálcio, com valores de 30.610 a 64.400, 1.590 a 9.870, 6.180 a 8.700 e 1.180 a 6.760 mg kg-1 base seca, respectivamente.In the present study, we evaluated an anaerobic sequencing batch reactor, in pilot scale and with a total volume of 280 L, for the treatment of swine wastewater. The organic loading rates applied in such reactor were 4.42; 5.27; 9.33 and 11.79 g CODtotal (L d-1. The average efficiencies of removal of CODtotal total solids suspension (TSS and volatile suspension solids (VSS varied from 56 to 87%. The nutrients total Kjedahl nitrogen (TKN, total phosphorus (total P and Mg were removed with average efficiencies from 26 to 39%. The volumetric methane productions varied from 0.50 to 0.64 L CH4 (L reactor d-1 and did not present significant differences. The VS/TS relations of the aforementioned reactor's sludge varied from 0.74 to 0.58. The highest mean concentrations of nutrients in the reactor sludge were those of nitrogen, phosphorus, iron and calcium, with values from 30.610 to 64.400, 1.590 to 9.870, 6.180 to 8.700 and 1.180 to 6
RbsR Activates Capsule but Represses the rbsUDK Operon in Staphylococcus aureus.
Lei, Mei G; Lee, Chia Y
2015-12-01
Staphylococcus aureus capsule is an important virulence factor that is regulated by a large number of regulators. Capsule genes are expressed from a major promoter upstream of the cap operon. A 10-bp inverted repeat (IR) located 13 bp upstream of the -35 region of the promoter was previously shown to affect capsule gene transcription. However, little is known about transcriptional activation of the cap promoter. To search for potential proteins which directly interact with the cap promoter region (Pcap), we directly analyzed the proteins interacting with the Pcap DNA fragment from shifted gel bands identified by electrophoretic mobility shift assay. One of these regulators, RbsR, was further characterized and found to positively regulate cap gene expression by specifically binding to the cap promoter region. Footprinting analyses showed that RbsR protected a DNA region encompassing the 10-bp IR. Our results further showed that rbsR was directly controlled by SigB and that RbsR was a repressor of the rbsUDK operon, involved in ribose uptake and phosphorylation. The repression of rbsUDK by RbsR could be derepressed by D-ribose. However, D-ribose did not affect RbsR activation of capsule. Staphylococcus aureus is an important human pathogen which produces a large number of virulence factors. We have been using capsule as a model virulence factor to study virulence regulation. Although many capsule regulators have been identified, the mechanism of regulation of most of these regulators is unknown. We show here that RbsR activates capsule by direct promoter binding and that SigB is required for the expression of rbsR. These results define a new pathway wherein SigB activates capsule through RbsR. Our results further demonstrate that RbsR inhibits the rbs operon involved in ribose utilization, thereby providing an example of coregulation of metabolism and virulence in S. aureus. Thus, this study further advances our understanding of staphylococcal virulence regulation
Cardioplegia retrógrada seqüencial Sequencial retrograde cardioplegy
Directory of Open Access Journals (Sweden)
Otoni M Gomes
1996-09-01
Full Text Available Estudou-se o padrão de distribuição miocárdica de solução cardioplégica (SC cristalóide gelada (3ºC - 4ºC perlundida nos corações de 15 cães mestiços com pesos variáveis entre 10-15 kg. Após anestesia e toracotomia mediana anterior, o pericárdio foi aberto, sendo estabelecida circulação extracorpórea. As seguintes vias foram empregadas para injeção cardioplégica: 1 Anterógrada - por canulação da aorta ascendente a montante da pinça de oclusão; 2 Retrógrada Seletiva - através de cânula com balão auto-inflável introduzido no seio coronário (SCo; 3 Retrógrada Total - através de cânula introduzida no átrio direito (AD; 4 Retrógrada Seqüencial SCo-AD - com a SC injetada primeiro pelo seio coronário até a temperatura dosepto interventricular atingir 16ºC e, em seqüência, pela cãnuia no átrio direito como na técnica retrógrada total, como tronco arterial pulmonar ocluído;5Retrógrada Seqüencial SCo-VD-com a cavidade do ventrículo direito perfundida por cânula passada através da valva tricúspide. Controlou-se a variação da temperatura miocárdica no ventrículo esquerdo, VD, AD e região dono sinoatrial, por meio de teletermòmetro Ômega com termistor de agulha. Pode-se constatar que o esfriamento cardíaco uniforme, o menor volume e o menor tempo de injeção ocorreram com a técnica anterógrada, seguida em excelência pelas técnicas retrógradas seqüenciais SCo-AD e SCo-VD. Concluiu-se que a técnica de cardioplegia retrógrada sequencial é significantemente melhor que as retrógradas seletivas pelo SCo e total pelo AD, como usualmente empregadas para proteção miocárdica, quando comparadas com a técnica de perfusão anterógrada pela aorta.The distribution pattern of a cold (3-4ºC, crystalloid cardioplegic solution (CS in the myocardium was studied in 15 mongrel dogs, with 10-15 kg of body weight. Alter anesthesia and median sternal thoracotomy. The pericardium was opened and
Directory of Open Access Journals (Sweden)
Luciene Alves Batista Siniscalchi
2016-03-01
Full Text Available RESUMO Nesse estudo, microrganismos metanotróficos foram enriquecidos a partir de lodo proveniente de um reator UASB tratando esgotos domésticos em reator em batelada sequencial (RBS com meio autotrófico contendo nitrito e nitrato. As eficiências médias de remoção de nitrito e nitrato foram de 68% e 53%, respectivamente, provavelmente devido à atividade heterotrófica desnitrificante. A detecção de arquéias dos grupos ANME-I e ANME-II foram realizadas por PCR durante todo período de cultivo. A estrutura da comunidade microbiana presente no inóculo e enriquecida no RBS após 100 dias de operação foi estudada por pirosequenciamento. Os resultados das análises demonstraram que a comunidade enriquecida no reator foi diferente à inoculada. Os filos dominantes no inóculo foram Synergistestes , Firmicutes e Euryarchaeota , ao passo que na biomassa enriquecida Planctomycetes, Verrucomicrobia, Chloroflexi e Proteobacteria predominaram. As condições de cultivo do RBS reduziram a abundância de Methanobacterium (8% para 1% e selecionaram bactérias metanotróficas como Methylocaldum , Methylocistis e Methylosinus . As sequências de Methylocaldum sp. apresentaram abundância relativa de 2.5%. A presença e elevada predominância do filo Verrucomicrobia na biomassa enriquecida do RBS sugere que outras espécies de metanotróficas, ainda pouco conhecidas, relacionadas a este filo podem estar presentes no reator. O potencial de oxidação anaeróbia do metano foi determinado para ambas amostras e revelaram que a atividade metanotrófica da biomassa foi aproximadamente três vezes maior que a do inóculo. Em suma, estes resultados sugerem que o inóculo usado e as condições de cultivo aplicadas foram adequados para o enriquecimento de metanotróficas.
Surface analysis by RBS and NRA
International Nuclear Information System (INIS)
Braun, M.
1984-01-01
The use of Rutherford backscattering spectroscopy (RBS) and nuclear reaction analysis (NRA) for surface analysis is discussed. For the RBS technique, emphasis is laid on cases which are not discussed in existing review articles of the subject. The present work intends to describe a calculation procedure with the aid of which it is possible to obtain the depth distribution of a high concentration and non-homogeneously binary compound sample. This complicates the determination of the stopping and scattering cross-sections of the incoming particles at a certain depth below the surface. In addition, a method is described by which the thickness and composition of a two-element film, deposited on a single-element substrate, can be determined by RBS. One advantage with the method presented here is that it is not necessary to detect any signals from the lighter component of the film, in order to determine the composition. This improves the RBS technique to study light elements in connection with thin layers. Finally, the NRA method to measure concentration distributions of deuterium beneath a surface is presented. In the case discussed here, the analysis is done by the D( 3 He, H) 4 He nuclear reaction. (author)
Energy Technology Data Exchange (ETDEWEB)
Ophel, T.R. [Australian National Univ., Canberra, ACT (Australia); Mitchell, I.V. [University of Western Ontario, London, ON (Canada). Dept. of Physics
1996-12-31
Measurements of RBS using {sup 28}Si beams have been made to evaluate the enhancement of sensitivity that should obtain from kinematic suppression of silicon substrate scattering. Two detection methods were tried. Aside from a surface barrier detector, a magnetic spectrometer, instrumented with a multi-electrode gas focal plane detector, was used to indicate the resolution attainable with low energy {sup 28}Si ions. The results confirm that kinematically suppressed RBS does provide greatly improved sensitivity. 5 refs., 2 figs.
Energy Technology Data Exchange (ETDEWEB)
Ophel, T R [Australian National Univ., Canberra, ACT (Australia); Mitchell, I V [University of Western Ontario, London, ON (Canada). Dept. of Physics
1997-12-31
Measurements of RBS using {sup 28}Si beams have been made to evaluate the enhancement of sensitivity that should obtain from kinematic suppression of silicon substrate scattering. Two detection methods were tried. Aside from a surface barrier detector, a magnetic spectrometer, instrumented with a multi-electrode gas focal plane detector, was used to indicate the resolution attainable with low energy {sup 28}Si ions. The results confirm that kinematically suppressed RBS does provide greatly improved sensitivity. 5 refs., 2 figs.
Determination of accurate metal silicide layer thickness by RBS
International Nuclear Information System (INIS)
Kirchhoff, J.F.; Baumann, S.M.; Evans, C.; Ward, I.; Coveney, P.
1995-01-01
Rutherford Backscattering Spectrometry (RBS) is a proven useful analytical tool for determining compositional information of a wide variety of materials. One of the most widely utilized applications of RBS is the study of the composition of metal silicides (MSi x ), also referred to as polycides. A key quantity obtained from an analysis of a metal silicide is the ratio of silicon to metal (Si/M). Although compositional information is very reliable in these applications, determination of metal silicide layer thickness by RBS techniques can differ from true layer thicknesses by more than 40%. The cause of these differences lies in how the densities utilized in the RBS analysis are calculated. The standard RBS analysis software packages calculate layer densities by assuming each element's bulk densities weighted by the fractional atomic presence. This calculation causes large thickness discrepancies in metal silicide thicknesses because most films form into crystal structures with distinct densities. Assuming a constant layer density for a full spectrum of Si/M values for metal silicide samples improves layer thickness determination but ignores the underlying physics of the films. We will present results of RBS determination of the thickness various metal silicide films with a range of Si/M values using a physically accurate model for the calculation of layer densities. The thicknesses are compared to scanning electron microscopy (SEM) cross-section micrographs. We have also developed supporting software that incorporates these calculations into routine analyses. (orig.)
PIXE and RBS applied to cultural heritage objects: Complementarity and limitations
International Nuclear Information System (INIS)
Morelle, M.; El Masri, Y.; Heitz, Ch.; Prieels, R.; Van Mol, J.; Dran, J.-C.; Salomon, J.; Calligaro, T.; Dubus, M.
2005-01-01
This paper reports on the use of PIXE and RBS (resonant and non-resonant RBS) implemented with proton beams to simultaneously analyse light and heavy elements in materials of cultural heritage significance, as exemplified by Russian icons or in lead seals. It is shown that in spite of its poor mass resolution RBS with protons can provide useful information when combined with PIXE. In the case of Russian icons, it is possible to discriminate between an Au-Ag bilayer and an alloy of these metals in the gilds. However, when applied to lead seals RBS with protons encounters a significant limitation due to some deficiency in the available computer programs used for spectrum processing
Seleção de variáveis para clusterização de bateladas produtivas através de ACP e remapeamento kernel
Directory of Open Access Journals (Sweden)
Victor Leonardo Cervo
2015-12-01
Full Text Available Técnicas de clusterização visam à formação de grupos de observações homogêneas dentro de um mesmo grupo e significativamente distintas das observações inseridas em outros grupos. Em processos industriais cuja produção é apoiada em bateladas, a definição de famílias (grupos de bateladas com perfis semelhantes auxilia na definição de estratégias de controle e monitoramento desses processos. Este artigo propõe um método para seleção das variáveis de clusterização mais relevantes para formação de famílias de bateladas. Para tanto, integra funções kernel a um novo índice de importância de variáveis gerado a partir dos parâmetros oriundos da Análise de Componentes Principais (ACP. A qualidade dos agrupamentos formados é avaliada através do Silhouette Index (SI. Quando aplicada em três processos produtivos, a sistemática proposta reteve em média 5,16% das variáveis iniciais e elevou o SI médio em 235,4% frente à utilização de todas as variáveis. Um estudo de simulação também é realizado para avaliar a robustez do método.
Analysis of kidney stones by PIXE and RBS techniques
Energy Technology Data Exchange (ETDEWEB)
Alkofai, M M [Physics Dept., Yarmouk University, Irbid, (Jordan); Hallak, A B [Research Institute, King Fahd University of Petroleum and Minerals, Dhahran 31261, (Saudi Arabia)
1995-10-01
Human kidney stones were analyzed by PIXE and RBS techniques using 2 MeV He{sup ++} beam. The stones were found to contain the elements: C, N, O, F, Na, Mg, Si, P, S, Cl, K, Ca, Fe and Br. Results obtained by PIXE agree with the results obtained by RBS within experimental errors. A Mechanism for the formation of the kidney stones is suggested. 3 figs., 1 tab.
Analysis of kidney stones by PIXE and RBS techniques
International Nuclear Information System (INIS)
Alkofai, M.M.; Hallak, A.B.
1995-01-01
Human kidney stones were analyzed by PIXE and RBS techniques using 2 MeV He ++ beam. The stones were found to contain the elements: C, N, O, F, Na, Mg, Si, P, S, Cl, K, Ca, Fe and Br. Results obtained by PIXE agree with the results obtained by RBS within experimental errors. A Mechanism for the formation of the kidney stones is suggested. 3 figs., 1 tab
Computer simulation of RBS spectra from samples with surface roughness
Energy Technology Data Exchange (ETDEWEB)
Malinský, P., E-mail: malinsky@ujf.cas.cz [Nuclear Physics Institute of the Academy of Sciences of the Czech Republic, v. v. i., 250 68 Rez (Czech Republic); Department of Physics, Faculty of Science, J. E. Purkinje University, Ceske mladeze 8, 400 96 Usti nad Labem (Czech Republic); Hnatowicz, V., E-mail: hnatowicz@ujf.cas.cz [Nuclear Physics Institute of the Academy of Sciences of the Czech Republic, v. v. i., 250 68 Rez (Czech Republic); Macková, A., E-mail: mackova@ujf.cas.cz [Nuclear Physics Institute of the Academy of Sciences of the Czech Republic, v. v. i., 250 68 Rez (Czech Republic); Department of Physics, Faculty of Science, J. E. Purkinje University, Ceske mladeze 8, 400 96 Usti nad Labem (Czech Republic)
2016-03-15
A fast code for the simulation of common RBS spectra including surface roughness effects has been written and tested on virtual samples comprising either a rough layer deposited on a smooth substrate or smooth layer deposited on a rough substrate and simulated at different geometries. The sample surface or interface relief has been described by a polyline and the simulated RBS spectrum has been obtained as the sum of many particular spectra from randomly chosen particle trajectories. The code includes several procedures generating virtual samples with random and regular (periodical) roughness. The shape of the RBS spectra has been found to change strongly with increasing sample roughness and an increasing angle of the incoming ion beam.
RBS/NRA/channeling analysis of implanted immiscible species
International Nuclear Information System (INIS)
Naramoto, H.; Yamamoto, S.; Narumi, K.
2000-01-01
Ion implantation of immiscible elements was performed to prepare supersaturated substance for further heat treatment. 63 Cu ion implantation was made at low temperature into Nb(1 0 0), (1 1 0) and (1 1 1) single crystal films on sapphire, and the induced lattice damage and the lattice location of implanted Cu atoms were analyzed by 2.7 MeV 4 He + RBS/channeling. The coherent segregation of 63 Cu atoms with specific crystallographic orientations was found in the near surface region (Cu(1 0 0)/Nb(1 0 0), Cu(1 1 1)/Nb(1 1 0) and Cu(1 1 0)/Nb(1 1 1)). The same kind of study was also made in Ir(1 0 0)/MgO(1 0 0) implanted with 50 keV 12 C + ions. In addition to 2 MeV 4 He + RBS/channeling, 1.22 MeV d + RBS/NRA/channeling was employed to detect implanted 12 C atoms. The results suggest that 12 C atoms are aligned along Ir direction at least by low temperature implantation followed by thermal annealing
Shimada, Tomohiro; Kori, Ayako; Ishihama, Akira
2013-07-01
Escherichia coli is able to utilize d-ribose as its sole carbon source. The genes for the transport and initial-step metabolism of d-ribose form a single rbsDACBK operon. RbsABC forms the ABC-type high-affinity d-ribose transporter, while RbsD and RbsK are involved in the conversion of d-ribose into d-ribose 5-phosphate. In the absence of inducer d-ribose, the ribose operon is repressed by a LacI-type transcription factor RbsR, which is encoded by a gene located downstream of this ribose operon. At present, the rbs operon is believed to be the only target of regulation by RbsR. After Genomic SELEX screening, however, we have identified that RbsR binds not only to the rbs promoter but also to the promoters of a set of genes involved in purine nucleotide metabolism. Northern blotting analysis indicated that RbsR represses the purHD operon for de novo synthesis of purine nucleotide but activates the add and udk genes involved in the salvage pathway of purine nucleotide synthesis. Taken together, we propose that RbsR is a global regulator for switch control between the de novo synthesis of purine nucleotides and its salvage pathway. © 2013 Federation of European Microbiological Societies. Published by John Wiley & Sons Ltd. All rights reserved.
Proton RBS measurement of the oxygen in heavy-metal oxides
International Nuclear Information System (INIS)
Xie, T.; Ryan, S.R.; Fischbeck, H.J.
1989-01-01
Although the stoichoimetry of high-T c superconductors is often measured using alpha-particle RBS, the small Rutherford cross section for oxygen relative to the high-Z components makes a determination of the oxygen content difficult. Above 1 MeV, the cross section for proton backscattering from oxygen becomes significantly greater than the Rutherford cross section. Studies of proton backscattering in CuO between 0.6 and 2.0 MeV show that it is possible to measure the oxygen content of high-Z metal oxides. RBS simulations using the Bragg-rule stopping power consistently underestimate the low-energy yield. Scaling the stopping power by a linear function of energy to reduce loss at low energy improves the simulation in CuO, Cu and Au. This general result suggests that the standard RBS simulation procedure may omit some relevant physics. (orig.)
Structural characterization of Fe/Ag bilayers by RBS and AFM
International Nuclear Information System (INIS)
Tunyogi, A.; Tancziko, F.; Osvath, Z.; Paszti, F.
2008-01-01
Fe/Ag thin films are intensively investigated due to their special magnetic properties. Recently a deposition-order dependent asymmetric interface has been found. When iron is grown on silver, the interface is sharp, while the growth of Ag on Fe results in a long, low-energy tail of the Ag peak in the Rutherford backscattering spectrometry (RBS) spectra. The main purpose of this paper is to show that the low-energy Ag tail is caused by grain boundary diffusion, and that, when elevating the growing temperature of the Ag layer this effect becomes more significant. Two sets of polycrystalline and epitaxial Fe/Ag bilayers were prepared simultaneously onto Si(1 1 1) and MgO(1 0 0), respectively. The iron layers were grown at 250 deg. C and annealed at 450 deg. C in both sets, while the Ag layer was grown in the first set at room temperature (RT) and in the second set at 250 deg. C (HT). The sample composition, the interface sharpness and the quality of the epitaxy were studied by Rutherford backscattering spectrometry (RBS) combined with channeling effect. The surface morphology was determined by atomic force microscopy (AFM). RBS spectra show that in the case of RT samples the epitaxial MgO/Fe/Ag bilayer has sharp, well-defined interface, while for the polycrystalline Si/Fe/Ag sample the silver peak has a low-energy tail. Both the Fe and Ag peaks smeared out in the case of HT samples. AFM-images show that the RT samples have a continuous Ag layer, while the HT samples have fragmented surfaces. The RBS spectra taken on the HT samples were successfully simulated by the RBS-MAST code taking into account their fragmented structures.
RBS Characterization of Yttrium Iron Garnet Thin Films
International Nuclear Information System (INIS)
Roumie, M; Abdel samad, B.
2008-01-01
Magnetic materials such as yttrium iron garnet (YIG) are of great importance for its magneto-optic properties and for their potential applications in the domain of optical telecommunications. The deposition of thin films of YIG, on quartz or GGG (gadolinium gallium garnet) substrate, was performed using radio frequency non reactive magnetron sputtering, followed by high temperature annealing which is needed to enhance the crystallinity of the layers. Rutherford backscattering spectrometry RBS was used to determine the thickness and stoichiometry of the performed layers in order to investigate correlations between growth conditions and the quality of the final material. RBS measurements showed the influence of the deposition time and the temperature substrate on the film growth and its stoichiometry. (author)
Advanced capabilities and applications of a sputter-RBS system
International Nuclear Information System (INIS)
Brijs, B.; Deleu, J.; Beyer, G.; Vandervorst, W.
1999-01-01
In previous experiments, sputter-RBS 1 has proven to be an ideal tool to study the interaction of low energy ions. This contribution employs the same methodology to identify surface contamination induced during sputtering and to the determine absolute sputter yields. In the first experiment ERDA analysis was used to study the evolution of Hydrogen contamination during sputter-RBS experiments. Since the determination of Hydrogen concentration in very thin near surface layers is frequently limited by the presence of a strong surface peak of Hydrogen originating from adsorbed contamination of the residual vacuum, removal of this contamination would increase the sensitivity for Hydrogen detection in the near sub surface drastically. Therefore low energy (12 keV) Argon sputtering was used to remove the Hydrogen surface peak. However enhanced Hydrogen adsorption was observed related to the Ar dose. This experiment shows that severe vacuum conditions and the use of high current densities/sputter yields are a prerequisite for an efficient detection of Hydrogen in the near surface layers. In the second experiment, an attempt was made to determine the sputter yield of Cu during low energy (12 keV) Oxygen bombardment. In order to determine the accumulated dose of the low energy ion beam, a separate Faraday cup in combination with a remote controlled current have been added to the existing sputter-RBS set-up. Alternating sputtering and RBS analysis seem to be an adequate tool for the determination of the absolute sputter yield of Cu and this as well in the as under steady state conditions
International Nuclear Information System (INIS)
Norton, G.A.; Schroeder, J.B.; Klody, G.M.; Strathman, M.D.
1989-01-01
The NEC 3S-R10 automated RBS spectrometer system includes the features required for routine application of Rutherford backscattering (RBS) and related techniques for materials analysis in both research and industrial settings. The NEC Model 3SDH Pelletron accelerator system provides stable, monoenergetic beams of helium ions up to 3.3 MeV and protons to 2.2 MeV and has heavy ion capability. The analytical end station is the fully computerized Charles Evans and Associates Model RBS-400. Automated features include sample positioning (precision 4-axis goniometer), channeling alignment, polar plot generation, and data acquisition and reduction. Computer automation of accelerator and chamber functions includes storage and recall of operating parameters. Unattended data acquisition, e.g., overnight or over a weekend, is possible for up to 100 samples per batch for random orientation, rotating random or channeling analyses at any sample location. Single samples may be up to 50 cm in diameter. A laser for sample alignment and a TV for video monitoring are included. Simultaneous detection (up to 4 detectors) at normal and grazing angles, external control of grazing angle detector position, and transmission scattering capabiltiy enhance system flexibility. The system is also compatible with PIXE, NRA, and hydrogen forward-backscattering analyses. Data reduction is part of the computer system, which features displays (several formats) and manipulation of up to five spectra at one time using constant multipliers or point by point operations between spectra. (orig.)
Combined RBS and TEM characterization of nano-SiGe layers embedded in SiO2
International Nuclear Information System (INIS)
Kling, A.; Ortiz, M.I.; Sangrador, J.; Rodriguez, A.; Rodriguez, T.; Ballesteros, C.; Soares, J.C.
2006-01-01
Grazing incidence RBS has been tested as a technique to detect and characterize SiGe nanoparticles embedded in a SiO 2 matrix. Suitable structures were deposited by low pressure chemical vapour deposition and characterized by TEM and RBS. The layers containing nanoparticles have been modelled by stacks of sublayers consisting of SiGeO layers with compositions calculated according to presumed shapes, sizes, Si/Ge ratios and particle area densities and used as input for RUMP. The nanoparticle parameters obtained by fitting the experimental RBS spectra agree well with the findings by TEM. This demonstrates that RBS is a useful and fast technique to characterize this kind of structures
Use of reference samples for more accurate RBS analyses
International Nuclear Information System (INIS)
Lanford, W.A.; Pelicon, P.; Zorko, B.; Budnar, M.
2002-01-01
While one of the primary assets of RBS analysis is that it is quantitative without use of reference samples, for certain types of analyses the precision of the method can be improved by measuring RBS spectra of unknowns relative to the RBS spectra of a similar known sample. The advantage of such an approach is that one can reduce (or eliminate) the uncertainties that arise from error in the detector solid angle, beam current integration efficiency, scattering cross-section, and stopping powers. We have used this approach extensively to determine the composition (x) of homogeneous thin films of TaN x using as reference samples films of pure Ta. Our approach is to measure R=(Ta count) unknown /(Ta count) standard and use RUMP to determine the function x(R). Once the function x(R) has been determined, this approach makes it easy to analyze many samples quickly. Other analyses for which this approach has proved useful are determination of the composition (x) of WN x , SiO x H y and SiN x H y , using W, SiO 2 and amorphous Si as reference samples, respectively
Energy Technology Data Exchange (ETDEWEB)
Wielunski, L.S.; Kenny, M.J. [CSIRO, Lindfield, NSW (Australia). Applied Physics Div.
1993-12-31
Rutherford Backscattering Spectrometry (RBS) is an ion beam analysis technique used in many fields. The high depth and mass resolution of RBS make this technique very useful in semiconductor material analysis [1]. The use of ion channeling in combination with RBS creates a powerful technique which can provide information about crystal quality and structure in addition to mass and depth resolution [2]. The presence of crystal defects such as interstitial atoms, dislocations or dislocation loops can be detected and profiled [3,4]. Semiconductor materials such as CdTe, HgTe and Hg+xCd{sub 1-x}Te generate considerable interest due to applications as infrared detectors in many technological areas. The present paper demonstrates how automatic RBS and multidirectional channeling analysis can be used to evaluate crystal quality and near surface defects. 6 refs., 1 fig.
Energy Technology Data Exchange (ETDEWEB)
Wielunski, L S; Kenny, M J [CSIRO, Lindfield, NSW (Australia). Applied Physics Div.
1994-12-31
Rutherford Backscattering Spectrometry (RBS) is an ion beam analysis technique used in many fields. The high depth and mass resolution of RBS make this technique very useful in semiconductor material analysis [1]. The use of ion channeling in combination with RBS creates a powerful technique which can provide information about crystal quality and structure in addition to mass and depth resolution [2]. The presence of crystal defects such as interstitial atoms, dislocations or dislocation loops can be detected and profiled [3,4]. Semiconductor materials such as CdTe, HgTe and Hg+xCd{sub 1-x}Te generate considerable interest due to applications as infrared detectors in many technological areas. The present paper demonstrates how automatic RBS and multidirectional channeling analysis can be used to evaluate crystal quality and near surface defects. 6 refs., 1 fig.
RBS and RNRA studies on sorption of europium by apatite
Energy Technology Data Exchange (ETDEWEB)
Ohnuki, Toshihiko; Kozai, Naofumi; Isobe, Hiroshi [Japan Atomic Energy Research Inst., Tokai, Ibaraki (Japan). Tokai Research Establishment; Murakami, Takashi; Yamamoto, Shunya; Aoki, Yasushi; Naramoto, Hiroshi
1997-03-01
The sorption mechanism of europium, alternative of trivalent TRU has been studied based on the depth profiles of elements obtained by Rutherford Backscattering Spectroscopy (RBS) and Resonant Nuclear Reaction Analysis (RNRA). The positive peak for Eu and the negative peak for Ca were observed in the subtracted RBS spectra of the apatites on which Eu was sorbed from that of the fresh apatite. This indicates that Eu was sorbed on apatite, while a fraction of Ca was released from apatite. The peak height for Eu in the RBS spectrum of the apatite obtained at 75degC was higher than that of the apatite at 40degC. The depth profile of hydrogen of the apatite on which Eu was sorbed was similar to that of the fresh apatite. The concentration of Eu in the solution decreased with increasing temperature. On the contrary, the concentration of Ca increased with increasing temperature. Thus, it is concluded that a fraction of Eu is exchanged for Ca in the structure of apatite. (author)
Armbruster, Chelsie E; Pang, Bing; Murrah, Kyle; Juneau, Richard A; Perez, Antonia C; Weimer, Kristin E D; Swords, W Edward
2011-11-01
Nontypeable Haemophilus influenzae (NTHI) is a respiratory commensal and opportunistic pathogen, which persists within biofilms on airway mucosal surfaces. For many species, biofilm formation is impacted by quorum signalling. Our prior work shows that production of autoinducer-2 (AI-2) promotes biofilm development and persistence for NTHI 86-028NP. NTHI 86-028NP encodes an ABC transporter annotated as a ribose transport system that includes a protein (RbsB) with similarity to the Escherichia coli LsrB and Aggregatibacter actinomycetemcomitans RbsB proteins that bind AI-2. In this study, inactivation of rbsB significantly reduced uptake of AI-2 and the AI-2 precursor dihydroxypentanedione (DPD) by NTHI 86-028NP. Moreover, DPD uptake was not competitively inhibited by ribose or other pentose sugars. Transcript levels of rbsB increased in response to DPD and as bacteria approached stationary-phase growth. The NTHI 86-028NP rbsB mutant also formed biofilms with significantly reduced thickness and total biomass and reduced surface phosphorylcholine, similar to a luxS mutant. Infection studies revealed that loss of rbsB impaired bacterial persistence in the chinchilla middle ear, similar to our previous results with luxS mutants. Based on these data, we conclude that in NTHI 86-028NP, RbsB is a LuxS/AI-2 regulated protein that is required for uptake of and response to AI-2. © 2011 Blackwell Publishing Ltd.
Experimental and Numerical Assessment of a New Alternative of RBS Moment Connection
International Nuclear Information System (INIS)
Mirghaderi, Rasoul; Imanpour, Ali; Keshavarzi, Farhad; Torabian, Shahab
2008-01-01
Reduced beam section (RBS) connection has been known as a famous connection for steel moment-resisting seismic frames in high-rise buildings, because of their economical advantages and seismic ductility. In the ordinary RBS connection, often portions of the beam flanges are selectively trimmed in the region adjacent to the beam-to-column connection, and beam section is weakened in the plastic hinge region; section weakening concept in the plastic hinge region of beam cause to reduction of beam plastic section modulus in this region, and force plastic hinge to occur within the reduced section.This paper presents a new alternative of RBS connection that has been used aforesaid weakening concept in it, with this difference that corrugated steel plate webs instead of beam flange cutting has been used in limited specific length near the column face. Corrugated steel plates because of their accordion effect don't have bending rigidity, then using of these plates in plastic hinge region reduces the beam plastic section modulus and plastic hinge is formed in corrugated region. For investigating the seismic behavior and performance of new RBS moment connection, experimental specimen of new RBS connection were subjected to cyclic load, and finite element analysis were executed. The result of cyclic test and numerical analysis specified that the corrugated webs improved the plastic stability and provided capability of large plastic rotation at the plastic hinge location without any appreciable buckling and brittle fractures in this region. The test observations also showed that the specimens' plastic rotations exceeded 0.04 rad without any local and global buckling. All of the analytical results for proposed connection are generally in good agreement with the test observations
Rbs1, a new protein implicated in RNA polymerase III biogenesis in yeast Saccharomyces cerevisiae.
Cieśla, Małgorzata; Makała, Ewa; Płonka, Marta; Bazan, Rafał; Gewartowski, Kamil; Dziembowski, Andrzej; Boguta, Magdalena
2015-04-01
Little is known about the RNA polymerase III (Pol III) complex assembly and its transport to the nucleus. We demonstrate that a missense cold-sensitive mutation, rpc128-1007, in the sequence encoding the C-terminal part of the second largest Pol III subunit, C128, affects the assembly and stability of the enzyme. The cellular levels and nuclear concentration of selected Pol III subunits were decreased in rpc128-1007 cells, and the association between Pol III subunits as evaluated by coimmunoprecipitation was also reduced. To identify the proteins involved in Pol III assembly, we performed a genetic screen for suppressors of the rpc128-1007 mutation and selected the Rbs1 gene, whose overexpression enhanced de novo tRNA transcription in rpc128-1007 cells, which correlated with increased stability, nuclear concentration, and interaction of Pol III subunits. The rpc128-1007 rbs1Δ double mutant shows a synthetic growth defect, indicating that rpc128-1007 and rbs1Δ function in parallel ways to negatively regulate Pol III assembly. Rbs1 physically interacts with a subset of Pol III subunits, AC19, AC40, and ABC27/Rpb5. Additionally, Rbs1 interacts with the Crm1 exportin and shuttles between the cytoplasm and nucleus. We postulate that Rbs1 binds to the Pol III complex or subcomplex and facilitates its translocation to the nucleus. Copyright © 2015, American Society for Microbiology. All Rights Reserved.
Various advanced capabilities of the RBS setup at IMEC
International Nuclear Information System (INIS)
Brijs, B.; Coster, W. de; Vandervorst, W.
1992-01-01
This article describes the various capabilities of the ion-beam analysis facility at IMEC which is designed to fulfill two needs. One is the high volume analysis service of material originating from the processing and material development groups at IMEC and the other is the research associated with gaining improved insight in the different analysis methods used for semiconductors, in particular all the aspects related with ion sputtering, and the development of improved analysis capabilities in order to cope with the demands from the analysis service. The latter includes the incorporation of a TOF spectrometer for heavy-ion RBS and ERD, the investigation towards the application of heavy-ion RBS for improved sensitivity, the application of angle resolved image scans for fast and certified channeling analysis and resonant analysis by automated energy scanning. (orig.)
Heavy ion scattering: High energy limits of RBS and ERD
International Nuclear Information System (INIS)
Rauhala, E.
1994-01-01
Elastic scattering of 7 Li ions by oxygen and 12 C, 14 N and 16 O ions by aluminum, silicon, titanium and sulfur have been studied below the Coulomb barrier energies 3-30 MeV in the angular range of 78 degrees - 170 degrees. By kinematically reversing the reactions, the recoiling of carbon, nitrogen and oxygen by 40-100 MeV 27 Al, 28 Si, 32S and 48 Ti ions into recoil angles of 20 degrees, 25 degrees, 30 degrees and 40 degrees has also been investigated. Excitation functions and angular distributions are presented. Contrary to the case of light H and He ions, the heavy ion scattering cross sections fall off rapidly above the non-Rutherford threshold energy, rendering heavy ion RBS and ERD spectrometry worthless. Both classical and wave mechanical calculations have been attempted for predicting the RBS threshold energies. Simple calculations give moderate accuracy, while the more extensive nuclear potential perturbation approach relies on parameters fitted for the particular experiment. The authors present a general classical semi-empirical model for both direct scattering (RBS) and the kinematically reversed reactions (ERD), accurately reproducing the experimental data. The model is based on parameters fitted from the present scattering experiments and from an extensive literature survey
Frühauf, Anika; Niedermeier, Martin; Ruedl, Gerhard; Barlow, Matthew; Woodman, Tim; Kopp, Martin
2017-11-23
Background High-risk sports, particularly climbing, kayaking and extreme skiing, have become increasingly popular. The most widely used psychological survey instrument with regard to risk behaviour in sports is the Sensation Seeking Model, mostly assessed by the Sensation Seeking Scale (SSS-V). Until recently, the literature discussed risk behaviour solely through this model. However, this scale does not measure risk-taking behaviours. In contrast, the Risk-Taking Behaviour Scale (RBS-K) is a three-item scale that measures risk behaviour in high-risk sports. This study aimed to validate a German language version of the RBS-K. Methods The RBS-K was translated and back-translated between English and German. High-risk sports participants (n = 2399) completed the German version of the RBS-K. Of those participants, 820 completed the RBS-K in person as part of a field survey and 1579 participated in an online survey. To validate the questionnaire, the SSS-V, accident involvement, age and sex were evaluated. The RBS-K divides the sample into deliberate risk takers (mean + standard deviation) and risk-averse persons (mean - standard deviation). We tested for internal consistency and correlations with SSS-V, age, sex and accident involvement. Group differences were calculated between deliberate risk takers and risk-averse persons. Results For internal consistency, we obtained a Cronbach's alpha of 0.56 and a McDonald's omega of 0.63. Significant correlations were shown between RBS-K and SSS-V as well as age and sex. Compared to risk-averse persons (n = 643, 26.8 %), deliberate risk takers (n = 319, 13.3 %) scored significantly higher in sensation seeking, were significantly younger and primarily male and had a significantly higher accident involvement. Conclusion The RBS-K discriminates well for age, sex and accident involvement. Also, correlations between the RBS-K and the well-established SSS-V are acceptable. With regard to the results and its
Timepix and FitPix detection system for RBS/C materials analysis
David-Bosne, Eric; Wahl, Ulrich
This thesis reports the implementation of a Timepix position sensitive detector in a ion beam facility with a 0.5 mm collimated beam of 2MeV 1H$^{+}$ and 4He$^{+}$ for use in Rutherford Back-scattering Spectrometry channeling (RBS/C). A complete description is given of the methodology used for energy calibration, RBS data analysis and simulation with the FLUX Monte Carlo simulation program. Energy calibration was performed with internal test pulses and resulting resolution and accuracy were verified in two ways. The first time using a triple alpha source with the isotopes $^{239}$Pu, $^{241}$Am and $^{244}$Cm and secondly using a RBS spectrum of a thin film sample of Au/SiO$_{2}$/C. Setup characterization for channeling measurements was performed using single crystals of Si, 6H$^{-}$SiC and SrTiO$_{3}$. An energy resolution of 47.2 keV at 1862 keV for He$^{+}$ and an angular resolution of 0.11 (standard deviation) was achieved. Count rates as high as 2kHz were achieved with a frame rate of 15 frames/s. Higher...
Holistic RBS-PIXE data reanalysis of SBT thin film samples
International Nuclear Information System (INIS)
Reis, M.A.; Barradas, N.P.; Pascual-Izarra, C.; Chaves, P.C.; Ramos, A.R.; Alves, E.; Gonzalez-Aguilar, G.; Costa, M.E.V.; Miranda Salvado, I.M.
2007-01-01
The growth of SrBi 2 Ta 2 O 9 (SBT) films on top of Pt electrode substrates is an important issue for the fabrication of ferroelectric based memories. In a recent publication, SBT thin films grown using seeded and unseeded procedures were studied by PIXE and RBS. Difficulties and misfits found in the comparison of results from both techniques were, at that time, overcome by physical considerations. These, although not rendering interpretation impossible, left out the possibility of understanding the exact nature of the differences between the interface behavior in each case. In the present work it is shown that the reanalysis of the same data using the recently developed RBS-PIXE simultaneous and self-consistent calculation present in NDF leads to stronger conclusions on the solid state reaction occurring during the deposition stage for both types of samples. Allowing for the occurrence of solid state reactions between the deposited film and the Pt electrode even in the case of seeded samples leads to a full explanation of IBA data, this result showing that in complex systems such as this, the PIXE data are essential and must be integrated with the RBS data in an holistic analysis, in order to properly unfold the depth profile of the samples. Contrary to what is usually supposed PIXE data is therefore shown to contain hidden depth structure information
Investigation of the impact of defect models on Monte Carlo simulations of RBS/C spectra
International Nuclear Information System (INIS)
Kovac, D.; Hobler, G.
2006-01-01
We compare the impact on the RBS/C spectra of defect configurations in silicon obtained from either empirical interatomic potentials or ab initio calculations. Using the Tersoff potential as the empirical potential and the VASP code for ab initio calculations we have determined the coordinates of the split- interstitial, of the di-, tri- and four-interstitial cluster, and of the tetrahedral interstitial as well as the strain on neighboring atoms induced by the presence of these defects. Using these coordinates in binary collision RBS/C simulations we find differences in the RBS/C yields of up to 30%. The dependence of the backscattering yield on the assumed defect type is larger with the defect coordinates obtained by the empirical potential than by the ab initio calculations
International Nuclear Information System (INIS)
Pichon, L.; Beck, L.; Walter, Ph.; Moignard, B.; Guillou, T.
2010-01-01
The combination of ion beam analysis techniques is particularly fruitful for the study of cultural heritage objects. For several years, the AGLAE facility of the Louvre laboratory has been implementing these techniques with an external beam. The recent set-up permits to carry out PIXE, PIGE and RBS simultaneously on the same analyzed spot with a particle beam of approximately 20 μm diameter. A new mapping system has been developed in order to provide elemental concentration maps from the PIXE and RBS spectra. This system combines the Genie2000 spectroscopy software with a homemade software that creates maps by handling acquisition with the object position. Each pixel of each PIXE and RBS maps contains the spectrum normalised by the dose. After analysing each pixel of the PIXE maps (low and high energy X-ray spectra) with the Gupixwin peak-fitting software, quantitative elemental concentrations are obtained for the major and trace elements. This paper presents the quantitative elemental maps extracted from the PIXE spectra and the development of RBS data processing for light element distribution and thin layer characterization. Examples on rock painting and lustrous ceramics will be presented.
Blistering and exfoliation of 304 stainless steel studied by SEM and RBS
International Nuclear Information System (INIS)
Braun, M.; Emmoth, B.; Whitton, J.L.
1981-01-01
Blistering and exfoliation induced by helium irradiation have been studied in polycrystalline stainless steel with the aim of measuring flake or blister skin thicknesses for different implantation energies in the keV region. The authors present measurements of skin thicknesses determined both by direct SEM observations and RBS techniques. The results of the RBS studies show for all implantation energies used that the thickness measured in target atoms/unit area of a flake equals the calculated implantation range with an accuracy of about 10%. Conversely, the SEM measurements show that swelling gives rise to a geometrical skin thickness much greater than the corresponding implantation range. Thus from the SEM and RBS data swelling as a function of the implantation energy is obtained and the linear relative swelling is shown to be strongly dependent on the energy. In addition a comparison between the skin thickness of blisters and flakes has been made for the same material. Blisters were observed at low implantation temperatures and room temperature while exfoliation occurs at elevated temperatures. The result of this comparison is that within the experimental accuracy the flake and blister thicknesses are the same. (Auth.)
Energy Technology Data Exchange (ETDEWEB)
Kringhoj, P. [Australian National Univ., Canberra, ACT (Australia). Research School of Physical Sciences
1993-12-31
Rutherford backscattering spectrometry (RBS)/channeling and proton-induced x-ray emission (PIXE) are two well established and characterised techniques. Over the last three decades RBS/channeling measurements has been performed to extract the substitutional fraction of impurities in both elemental and compound semiconductors. However, due to the limitation of RBS, only elements heavier than the host crystal can be examined (except for a few elements, where a nuclear reaction or a resonance can be used). In silicon this limitation is acceptable, due to the low mass of Si, but in the III-V compounds (e.g. InP), the technique is limited to a few elements of hardly no technological or fundamental interest. One can overcome this by combining RBS/channeling with PIXE, where PIXE is applied to detect elements with a mass lower than the host crystal. In the present work, the lattice location of Ge in InP has been studied and compared to the group-III impurity Ga, and the group-VI impurity Se which is known to be a donor. The (RBS)/channeling technique has been used to detect not only the substitutional fraction, but also the relative population of the two sublattices. The half-width is approximately equal to the characteristic angle, {psi}{sub 1}. The channeling data obtained indicate that all three dopants are located exclusively on substitutional sites and that Ga is occuping the In position, Se theP position and that Ge is distributed equally between both sublattices. 6 refs., 1 tab., 3 figs.
Energy Technology Data Exchange (ETDEWEB)
Kringhoj, P [Australian National Univ., Canberra, ACT (Australia). Research School of Physical Sciences
1994-12-31
Rutherford backscattering spectrometry (RBS)/channeling and proton-induced x-ray emission (PIXE) are two well established and characterised techniques. Over the last three decades RBS/channeling measurements has been performed to extract the substitutional fraction of impurities in both elemental and compound semiconductors. However, due to the limitation of RBS, only elements heavier than the host crystal can be examined (except for a few elements, where a nuclear reaction or a resonance can be used). In silicon this limitation is acceptable, due to the low mass of Si, but in the III-V compounds (e.g. InP), the technique is limited to a few elements of hardly no technological or fundamental interest. One can overcome this by combining RBS/channeling with PIXE, where PIXE is applied to detect elements with a mass lower than the host crystal. In the present work, the lattice location of Ge in InP has been studied and compared to the group-III impurity Ga, and the group-VI impurity Se which is known to be a donor. The (RBS)/channeling technique has been used to detect not only the substitutional fraction, but also the relative population of the two sublattices. The half-width is approximately equal to the characteristic angle, {psi}{sub 1}. The channeling data obtained indicate that all three dopants are located exclusively on substitutional sites and that Ga is occuping the In position, Se theP position and that Ge is distributed equally between both sublattices. 6 refs., 1 tab., 3 figs.
Comparative concentration analysis of Cr and Co in FeSi2 films performed by ERDA and RBS
International Nuclear Information System (INIS)
Bohne, W.; Reinsperger, G.-U.; Roehrich, J.; Roeschert, G.; Selle, B.; Stauss, P.
2000-01-01
Thin films of β-FeSi 2 doped by Co or Cr were grown on Si substrates by molecular beam epitaxy (MBE) using three separately controlled evaporation sources. The dopant concentration was measured concurrently by heavy-ion ERDA with 129 Xe ions of 140-250 MeV, by heavy-ion RBS with 15 MeV 14 N and by standard RBS with 1.4 MeV 4 He ions. Among these techniques, the TOF-ERDA was most powerful in providing a high mass resolution and a low detection limit for Co and Cr (∼0.1 at.%). Because of the complete overlap of the dopant signals with the Fe signal the standard RBS spectra were evaluated by relying on the differences between the scattering cross-sections from the dopant atoms and Fe. This approach proved to be applicable as far as the dopants had a constant depth profile with sufficiently high concentration. For Cr concentrations exceeding the miscibility limit the RBS results deviate significantly from those of ERDA due to increasing dopant depth inhomogeneities
Depth profile of In and As in Si measured by RBS with He and C ions
Energy Technology Data Exchange (ETDEWEB)
Yang, Q.; Fang, Z. [Newcastle Univ., NSW (Australia). Dept. of Physics; Ophel, T.R. [Australian National Univ., Canberra, ACT (Australia). Dept. of Nuclear Physics
1993-12-31
The depth profile of As and In implanted into Si have been measured by RBS (Rutherford Backscattering Spectrometry) with 2 MeV He ions and 6 MeV C ions. Advantages of enhanced depth and mass resolution with C ions have been demonstrated over the conventional He RBS. More reliable information for the depth profile of In and As in Si has been obtained. 12 refs., 3 figs.
Depth profile of In and As in Si measured by RBS with He and C ions
Energy Technology Data Exchange (ETDEWEB)
Yang, Q; Fang, Z [Newcastle Univ., NSW (Australia). Dept. of Physics; Ophel, T R [Australian National Univ., Canberra, ACT (Australia). Dept. of Nuclear Physics
1994-12-31
The depth profile of As and In implanted into Si have been measured by RBS (Rutherford Backscattering Spectrometry) with 2 MeV He ions and 6 MeV C ions. Advantages of enhanced depth and mass resolution with C ions have been demonstrated over the conventional He RBS. More reliable information for the depth profile of In and As in Si has been obtained. 12 refs., 3 figs.
Directory of Open Access Journals (Sweden)
Luiz Felipe Tavares De Santana
2015-12-01
Full Text Available A presente pesquisa teve o objetivo de estudar a remoção biológica de nitrogênio amoniacal (N-NH3 e matéria orgânica biodegradável presente em lixiviado de aterro sanitário, aplicando a nitrificação por meio da via curta, operando um reator de polietileno, em bateladas sequenciais, com volumes úteis superiores a 400 L, ou seja, em escala piloto, aerado por meio de compressor de 1 cv. O experimento foi realizado no aterro sanitário em operação há onze anos, localizado no município de Camaçari - Bahia e operado pela empresa LIMPEC, responsável pelos serviços de coleta, transporte e destinação final dos resíduos sólidos urbanos e industriais não perigosos, gerados nos municípios de Camaçari e Dias D’Ávila, Bahia. O experimento foi conduzido durante 165 dias. Foram realizados: 7 (sete ciclos de tratamento utilizando razões de troca volumétrica de 10% e aerando o conteúdo do reator por 18 horas; 5 (cinco ciclos com razão de troca volumétrica de 20% e aerando o conteúdo do reator por 18 horas e, finalmente, 7 (sete ciclos com razão de troca volumétrica igual a 20% e aerando o conteúdo do reator por 24 horas. Todos os ciclos de tratamento foram operados com o conteúdo do reator a temperatura ambiente, sem correção de pH, e a concentração de oxigênio dissolvido (OD, durante a aeração, foi sempre inferior a 1,0 mg O2/L. Os melhores resultados de eficiência de remoção de poluentes de interesse foram obtidos quando o sistema foi operado com RTV iguais a 10 e 20% e tempos de aeração iguais a 18 e 24 horas respectivamente. Nessas condições operacionais, a remoção de N-NH3 variou entre 56 e 100%, correspondendo a concentrações efluentes entre 0,0 e 84,0 mg N-NH3/L, ou seja, durante 11 ciclos de tratamento o efluente atendeu à Resolução CONAMA 430/2011. O alcance do acúmulo de nitrito, avaliado por meio da razão nitrito/nitrogênio oxidado, mostrou-se estável durante todo o experimento. Ao longo
Directory of Open Access Journals (Sweden)
Daniel Pimenta Castelão
2015-09-01
Full Text Available ResumoO presente estudo teve como objetivo identificar diferentes padrões de jogo ofensivo evidenciados pelas seis seleções de futebol participantes das finais da Copa do Mundo de 2006 e da Eurocopa de 2004 e 2008. A partir da Análise Sequencial pela Técnica de Retardos foram avaliadas 647 sequências ofensivas de jogo. Foi usada a metodologia observacional no sentido de perceber as ações feitas. Recorreu-se ao software SDIS &GSEQ para a análise dos dados a partir da técnica de retardos. Para a análise estatística inferencial foi usado o teste qui-quadrado (χ2. Os resultados levam a admitir que o jogo de futebol respeita o princípio da equifinalidade, ou seja, é possível alcançar-se o topo na classificação recorrendo-se a padrões táticos claramente diferenciados.
International Nuclear Information System (INIS)
Polvorinos del Rio, A.; Castaing, J.; Aucouturier, M.
2006-01-01
Lustre ceramics, found in a workshop located in Triana (Sevilla), have been analysed to determine the composition of glazes including the metallic particle layers giving rise to the lustre effect. PIXE and RBS were used for the elemental composition and the sub-surface concentration profiles, respectively. Copper and silver at the origin of the lustre are detected by PIXE. RBS gives access to the detailed distribution of the elements in the surface layers. The simulation of RBS spectra confirms the occurrence of thin layers (less than 300 nm) containing metallic silver and/or copper. The results are compared with those obtained on other types of lustre ceramics
Inter-diffusion study of rhodium and tantalum by RBS
International Nuclear Information System (INIS)
Nuttens, V.E.; Hubert, R.L.; Bodart, F.; Lucas, S.
2005-01-01
The inter-diffusion of rhodium and tantalum has been studied with the goal of synthesizing an alloy acting as a diffusion barrier for high temperature applications. Rh/Ta sandwiched samples were annealed in vacuum at temperature ranging from 800 to 900 deg. C and from 1000 to 1075 deg. C. The diffusion profiles were obtained by RBS. They suggest the formation of two clearly different phases in each temperature range considered
Sharma, Ashish; Goyal, Vinay; Behari, Madhuri; Srivastva, Achal; Shukla, Garima; Vibha, Deepti
2015-01-01
Background: There is limited data on the prevalence of impulse control disorder and related behaviors (ICD-RBs) in Indian patients with Parkinson′s Disease (PD). In the context of potential genetic and environmental factors affecting the expression of ICD-RBs, studying other multiethnic populations may bring in-sights into the mechanisms of these disorders. Objectives: To ascertain point prevalence estimate of ICD-RBs in Indian PD patients, using the validated “Questionnaire for Impulsive-Com...
International Nuclear Information System (INIS)
Zolnai, Z.; Deak, A.; Nagy, N.; Toth, A.L.; Kotai, E.; Battistig, G.
2010-01-01
The 500 keV Xe 2+ irradiation-induced anisotropic deformation of ordered colloidal silica nanoparticulate masks is followed using 2 MeV 4 He + Rutherford Backscattering Spectrometry (RBS) with different measurement geometries and the improved data analysis capabilities of the RBS-MAST spectrum simulation code. The three-dimensional (3D) geometrical transformation from spherical to oblate ellipsoidal and polygonal shape and the decrease of the mask's hole size is described. The masking properties of the silica monolayer and the depth distribution of Xe in the underlying Si substrate vs. the irradiated Xe 2+ fluence are discussed. Field Emission Scanning Electron Microscopy (FESEM) is applied as complementary characterization tool. Our results give contribution to clarify the impact of ion-nanoparticle interactions on the potentials and limits of nanosphere lithography. We also show the capability of the conventional RBS technique to characterize laterally ordered submicron-sized three-dimensional structures.
PIXE/RBS as a tool to study cementitious materials: Application to the dynamic leaching of concrete
International Nuclear Information System (INIS)
Llorente, I.; Castellote, M.; Gonzalez-Arrabal, R.; Ynsa, M.D.; Munoz-Martin, A.; Viedma, P.G. de; Castillo, A.; Martinez, I.; Andrade, C.; Zuloaga, P.; Ordonez, M.
2009-01-01
The suitability of the application of Ion Beam Analysis (IBA) techniques such as Particle Induced X-ray Emission spectrometry (PIXE) and Rutherford Backscattering Spectrometry (RBS) to elemental depth profiling in concrete is analysed, studying hardened samples of concrete prior to and after a dynamic leaching test. A calibration of the data has been done by comparing the results obtained by IBA techniques with those obtained by Chemical and Thermogravimetric Analysis (TG/DTA). From PIXE and RBS data relevant information about the migration of minor elements, within the concrete matrix after leaching is obtained.
PIXE/RBS as a tool to study cementitious materials: Application to the dynamic leaching of concrete
Energy Technology Data Exchange (ETDEWEB)
Llorente, I., E-mail: irene@cenim.csic.e [Centro Nacional de Investigaciones Metalurgicas (CENIM-CSIC), Avda Gregorio del Amo, 8, 28040 Madrid (Spain); Castellote, M. [Instituto de Ciencias de la Construccion ' Eduardo Torroja' (IETcc-CSIC), Serrano Galvache, 4, 28033 Madrid (Spain); Gonzalez-Arrabal, R. [Parque Cientifico de Madrid, Campus de Cantoblanco, Einstein 13, 28049 Madrid (Spain); Ynsa, M.D.; Munoz-Martin, A. [Centro de Microanalisis de Materiales (CMAM), Universidad Autonoma de Madrid, Campus de Cantoblanco, 28049 Madrid (Spain); Viedma, P.G. de; Castillo, A.; Martinez, I.; Andrade, C. [Instituto de Ciencias de la Construccion ' Eduardo Torroja' (IETcc-CSIC), Serrano Galvache, 4, 28033 Madrid (Spain); Zuloaga, P.; Ordonez, M. [Empresa Nacional de Residuos Radiactivos, S.A. (ENRESA), Emilio Vargas, 7, 28043 Madrid (Spain)
2009-12-15
The suitability of the application of Ion Beam Analysis (IBA) techniques such as Particle Induced X-ray Emission spectrometry (PIXE) and Rutherford Backscattering Spectrometry (RBS) to elemental depth profiling in concrete is analysed, studying hardened samples of concrete prior to and after a dynamic leaching test. A calibration of the data has been done by comparing the results obtained by IBA techniques with those obtained by Chemical and Thermogravimetric Analysis (TG/DTA). From PIXE and RBS data relevant information about the migration of minor elements, within the concrete matrix after leaching is obtained.
RBS characterization of Al2O3 films doped with Ce and Mn
International Nuclear Information System (INIS)
Martinez-Martinez, R.; Rickards, J.; Garcia-Hipolito, M.; Trejo-Luna, R.; Martinez-Sanchez, E.; Alvarez-Fregoso, O.; Ramos-Brito, F.; Falcony, C.
2005-01-01
Rutherford backscattering (RBS) with 4 He energies from 2 to 6 MeV has been used to study the properties of thin amorphous photoluminescent Al 2 O 3 :Ce,Mn films grown by spray pyrolysis on Corning 7059 glass substrates. The source solutions were AlCl 3 , CeCl 3 and MnCl 2 dissolved in deionized water. Different molar concentrations (Ce 10%; Mn 1%, 3%, 5%, 7% and 10%) were investigated under the same deposition conditions at a substrate temperature of 300 deg. C. The RBS spectra show a homogeneous depth profile of both Ce and Mn within the films, and the measured quantities are consistent with the original solution concentrations. An important amount of Cl, which plays a significant role in luminescent properties, was detected, in both the doped and undoped samples
RBS channeling measurement of damage annealing in InAs/AlSb HEMT structures
International Nuclear Information System (INIS)
Hallén, Anders; Moschetti, Giuseppe
2014-01-01
Electrical isolation of InAs/AlSb high electron mobility transistors has been achieved by the ion implantation isolation technique. The multilayered structures are grown by molecular beam epitaxy on GaAs substrates. The optimal isolation is provided by damaging patterned areas by 100 keV Ar ions implanted at room temperature using fluence of 2 × 10 15 cm −2 , and then annealing the samples in 365 °C for 30 min. The damage build-up and annealing is studied by channeling Rutherford backscattering spectrometry (RBS) and compared to sheet resistance measurements. Only a low level of damage annealing can be seen in RBS for the post-implant annealed samples, but for Ar fluence higher than 2 × 10 14 cm −2 , a strong electrical resistivity increase can still be achieved
Energy Technology Data Exchange (ETDEWEB)
Guo, X.S.; Lanford, W.A. (Dept. of Physics, State Univ. of New York, Albany, NY (USA)); Rodbell, K.P. (IBM East Fishkill, Hopewell Junction, NY (USA))
1990-01-01
A computer program has been written to simulate the RBS spectrum from a sample consisting of many parallel three-layer stripes on a substrate (e.g. Al/Hf/Al stripes on SiO{sub 2}). The simulated RBS spectrum depends on the thickness of the different layers, the width of the stripes, the angle of the stripe side wall, the ion beam angle, the detector angle and the size and position of the ion beam on the stripe. The simulation fits experimental data well and can be used to determine diffusion in horizontal directions. It also provides an accurate way of measuring the angle of the stripe side wall. (orig.).
Analysis of obsydians and films of silicon carbide by RBS technique
International Nuclear Information System (INIS)
Franco S, F.
1998-01-01
Motivated by archaeological interest this work is presented, which consist in the characterization of obsydian samples from different mineral sites in Mexico and films of silicon carbide, undertaken by an Ion Beam Analysis: RBS (Rutherford Back Scattering). As part of an intensive investigation of obsydian in Mesoamerica by anthropologists from Mexico National Institute of Anthropology and History, 818 samples were collected from different volcanic sources in Central Mexico for the purpose of establishing a data bank of element concentrations of each source. Part of this collection was analyzed by Neutron activation analysis and most of the important elements concentrations reported. In the first part of this work, the non-destructive IBA technique, RBS are used to analyze obsydian samples. The last part is an analysis of thin films of silicon carbide as a part of a research program of the Universidad Nacional Autonoma de Mexico and ININ. The application of this technique were carried out at the IF-UNAM, and the analysis was performed at laboratories of the ININ Nuclear Centre facilities. The samples considered in this work were mounted on a sample holder designed for the purpose of exposing each sample to the alpha particles beam. This RBS analysis was carried out with an ET Tandem accelerator at the IF UNAM. The spectrometry was carried out with employing a Si(Li) detector set at 15 degrees in relation to the target normal. The mean projectile energy was 2.00 MeV, and the beam profile was about 4 mm in diameter. As results were founded elemental concentrations of a set of samples from ten different sources: Altotonga (Veracruz), Penjamo (Guanajuato), Otumba (Mexico), Zinapecuaro (MIchoacan), Ucareo (Michoacan), Tres Cabezas (Puebla), Sierra Navajas (Hidalgo), Zaragoza (Puebla), Guadalupe Victoria (Puebla) and Oyameles (Puebla). The mean values are accompanied by errors expressed as one standard devistion of the mean for each element
Application of RBS and NRA in the fabrication of carbon based devices
International Nuclear Information System (INIS)
Ila, D.; Zimmerman, R.L.; Maleki, H.; Evelyn, A.L.; Poker, D.B.
1995-06-01
We have used Nuclear Reaction Analysis (NRA) and Rutherford Backscattering Spectrometry (RBS) as well as resonant backscattering as analytical tools in fabricating carbon based drug delivery bio-implants, electrodes for batteries, and devices to entrap or filter specific toxins. Precursor is resol C 7 H 8 O 2 liquid, which converts to fully cured phenolic resin C 7 H 6 O (sp gr 1.25) on heating at 170 C. This resin further transforms with no change in shape to glassy carbon (sp gr 1.45) on heating to 1000 C. Final product consists of long ribbon-like molecules of sp2 carbon atoms aggregated locally to form subcrystalline domains arranged randomly in space. RBS and NRA were used in measuring the porosity before and after activation, in concentration profiling of stored drugs before and after leaching, in detecting low level light element impurities, and in detecting changes in the structure of the device due to fabrication
RBS analysis of electrochromic layers
Energy Technology Data Exchange (ETDEWEB)
Green, D.C.; Bell, J.M. [University of Technology, Sydney, NSW (Australia); Kenny, M.J.; Wielunski, L.S. [Commonwealth Scientific and Industrial Research Organisation (CSIRO), Lindfield, NSW (Australia). Div. of Applied Physics
1993-12-31
Tungsten oxide thin films produced by dip-coating from tungsten alkoxide solutions are of interest for their application in large area switchable windows. The application consists of a layer of electrochromic tungsten oxide (W0{sub 3}) on indium tin oxide (ITO) coated glass in contact with a complementary structure. Electrochromic devices are switchable between states of high and low transparency by the application of a small voltage. The mechanism relies on the dual injection of ions and electrons into the W0{sub 3} layer from adjacent layers in the device. Electrochromic tungsten oxide can be deposited using standard techniques (eg. sputtering and evaporation) but also using sol-gel deposition. Sol-gel processing has an advantage over conventional preparation techniques because of the simplicity of the equipment. The scaling up to large area coatings is also feasible. RBS and forward recoil has been used to obtain profiles for individual elements in the structure of electrochromic films. 3 refs., 3 figs.
RBS analysis of electrochromic layers
Energy Technology Data Exchange (ETDEWEB)
Green, D C; Bell, J M [University of Technology, Sydney, NSW (Australia); Kenny, M J; Wielunski, L S [Commonwealth Scientific and Industrial Research Organisation (CSIRO), Lindfield, NSW (Australia). Div. of Applied Physics
1994-12-31
Tungsten oxide thin films produced by dip-coating from tungsten alkoxide solutions are of interest for their application in large area switchable windows. The application consists of a layer of electrochromic tungsten oxide (W0{sub 3}) on indium tin oxide (ITO) coated glass in contact with a complementary structure. Electrochromic devices are switchable between states of high and low transparency by the application of a small voltage. The mechanism relies on the dual injection of ions and electrons into the W0{sub 3} layer from adjacent layers in the device. Electrochromic tungsten oxide can be deposited using standard techniques (eg. sputtering and evaporation) but also using sol-gel deposition. Sol-gel processing has an advantage over conventional preparation techniques because of the simplicity of the equipment. The scaling up to large area coatings is also feasible. RBS and forward recoil has been used to obtain profiles for individual elements in the structure of electrochromic films. 3 refs., 3 figs.
Directory of Open Access Journals (Sweden)
Chin M. Lee
2017-09-01
Full Text Available Gas vesicles (GVs are proteinaceous, gas-filled organelles used by some bacteria to enable upward movement into favorable air/liquid interfaces in aquatic environments. Serratia sp. ATCC39006 (S39006 was the first enterobacterium discovered to produce GVs naturally. The regulation of GV assembly in this host is complex and part of a wider regulatory network affecting various phenotypes, including antibiotic biosynthesis. To identify new regulators of GVs, a comprehensive mutant library containing 71,000 insertion mutants was generated by random transposon mutagenesis and 311 putative GV-defective mutants identified. Three of these mutants were found to have a transposon inserted in a LacI family transcription regulator gene (rbsR of the putative ribose operon. Each of these rbsR mutants was GV-defective; no GVs were visible by phase contrast microscopy (PCM or transmission electron microscopy (TEM. GV deficiency was caused by the reduction of gvpA1 and gvrA transcription (the first genes of the two contiguous operons in the GV gene locus. Our results also showed that a mutation in rbsR was highly pleiotropic; the production of two secondary metabolites (carbapenem and prodigiosin antibiotics was abolished. Interestingly, the intrinsic resistance to the carbapenem antibiotic was not affected by the rbsR mutation. In addition, the production of a siderophore, cellulase and plant virulence was reduced in the mutant, whereas it exhibited increased swimming and swarming motility. The RbsR protein was predicted to bind to regions upstream of at least 18 genes in S39006 including rbsD (the first gene of the ribose operon and gvrA. Electrophoretic mobility shift assays (EMSA confirmed that RbsR bound to DNA sequences upstream of rbsD, but not gvrA. The results of this study indicate that RbsR is a global regulator that affects the modulation of GV biogenesis, but also with complex pleiotropic physiological impacts in S39006.
Analysis of desert rose using PIXE and RBS techniques
International Nuclear Information System (INIS)
Al-Kofahi, M.M.; Hallak, A.B.; Al-Juwair, H.A.; Saafin, A.K.
1993-01-01
Particle-induced x-ray emission (PIXE) and Rutherford backscattering spectrometry (RBS) were used to analyse desert rose geological samples. Samples from the rose core and from the rose peripherals were studied. All samples were found to contain C, N, O, Na, Mg, Si, S, Cl, K, Ca, Ti, Mn, Fe and Sr. Core samples were found to contain more silicon than peripheral samples. The extra silicon in the rose core may suggest a mechanism for the formation of the rose through crystal growth on a seed of silicon. (author)
Towards truly simultaneous PIXE and RBS analysis of layered objects in cultural heritage
International Nuclear Information System (INIS)
Pascual-Izarra, Carlos; Barradas, Nuno P.; Reis, Miguel A.; Jeynes, Chris; Menu, Michel; Lavedrine, Bertrand; Ezrati, Jean Jacques; Roehrs, Stefan
2007-01-01
For a long time, RBS and PIXE techniques have been used in the field of cultural heritage. Although the complementarity of both techniques has long been acknowledged, its full potential has not been yet developed due to the lack of general purpose software tools for analysing the data from both techniques in a coherent way. In this work we provide an example of how the recent addition of PIXE to the set of techniques supported by the DataFurnace code can significantly change this situation. We present a case in which a non homogeneous sample (an oxidized metal from a photographic plate - heliography - made by Niepce in 1827) is analysed using RBS and PIXE in a straightforward and powerful way that can only be performed with a code that treats both techniques simultaneously as a part of one single and coherent analysis. The optimization capabilities of DataFurnace, allowed us to obtain the composition profiles for these samples in a very simple way
Surface segregation of chromium in rapidly solidified Al studied by RBS and SPEM
International Nuclear Information System (INIS)
Tashlykova-Bushkevich, I.I.; Amati, M.; Aleman, B.; Gregoratti, L.; Kiskinova, M.; Ryabuhin, O.V.; Shepelevich, V.G.
2013-01-01
The present study demonstrates the advances of using scanning photoelectron microscopy and imaging accomplished by RBS and AFM to investigate the surface segregation of alloying elements in RS aluminum. Depth profiling of elemental composition indicates that RS microstructure evolution is influenced by solute-nanostructured defect interactions in Al-Cr alloys. It was found that Cr 2p and 3p core level photoemission spectra exhibits foil surface impoverishment of chromium. In agreement with dope depth profiling as carried out by RBS, the revealed phenomenon can be attributed to the fact that Cr drastically reduces the concentration of vacancies compared with RS pure Al, and affects H behaviour in RS Al-Cr alloys. Obtained results indicate that the surface microstructure of the Al alloy foils at the sub-micrometer scale, as far as the high density of quenched-in vacancies is concerned, is essential to elucidate how the microstructural morphology resulting from rapid solidification affects hydrogen trapping at lattice defects. (authors)
Characterization of electroless Au, Pt and Pd contacts on CdTe and ZnTe by RBS and SIMS techniques
Energy Technology Data Exchange (ETDEWEB)
Roumie, M. E-mail: mroumie@cnrs.edu.lb; Hageali, M.; Zahraman, K.; Nsouli, B.; Younes, G
2004-06-01
Rutherford backscattering spectrometry (RBS) was applied to characterize Au, Pt and Pd contacts on II-VI semiconductor materials, CdTe and ZnTe, used as nuclear detectors. Electroless thin film depositions were prepared by changing the concentration of the reaction solution. Contrary to the deposition reaction time, it was observed that the amount of solution dilution degree had a considerable effect on increasing the thickness of the metal layer. Furthermore, PICTS electrical measurements confirmed the depth profile analysis performed by RBS and SIMS.
RBS and XPS study of TiOx layers prepared by the PVD technique .
Czech Academy of Sciences Publication Activity Database
Macková, Anna; Peřina, Vratislav; Krumeich, J.; Zemek, J.; Kolouch, A.
2004-01-01
Roč. 36, č. 8 (2004), s. 1171-1173 ISSN 0142-2421 R&D Projects: GA ČR GP102/01/D069 Institutional research plan: CEZ:AV0Z1048901 Keywords : RBS * ERDA * TiOx Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 1.209, year: 2004
Study of CdTe surface by SIMS and RBS ellipsometry
International Nuclear Information System (INIS)
Stuck, R.; Hage-Ali, M.; Grob, A.; Siffert, P.
1978-01-01
For a better understanding of the mechanisms involved in the rectification of metal-cadmium telluride contacts, the surface of bromine-methanol etched CdTe crystals by means of ellipsometry, secondary ions mass spectroscopy (SIMS) and Rutherford backscattering of charged particles (RBS) has been investigated. The results show that these surfaces are contaminated with bromine and that a tellurium surface oxide layer grows, its thickness increasing with time. This surface layer composition has been analyzed at different steps of its evolution [fr
Development and Validation of a Response Bias Scale (RBS) for the MMPI-2
Gervais, Roger O.; Ben-Porath, Yossef S.; Wygant, Dustin B.; Green, Paul
2007-01-01
This study describes the development of a Minnesota Multiphasic Personality Inventory (MMPI-2) scale designed to detect negative response bias in forensic neuropsychological or disability assessment settings. The Response Bias Scale (RBS) consists of 28 MMPI-2 items that discriminated between persons who passed or failed the Word Memory Test…
Study of crystal damage by ion implantation using micro RBS/channeling
International Nuclear Information System (INIS)
Grambole, D.; Herrmann, F.; Heera, V.; Meijer, J.
2007-01-01
The combination of microbeam implantation and in-situ micro RBS/channeling analysis in the Rossendorf nuclear microprobe facility enables crystal damage studies with high current densities not achievable in standard ion implantation experiments. Si(1 0 0) samples were implanted with 600 keV Si + ions and a fluence of 1 x 10 16 cm -2 . Using a beam spot of 200 μm x 200 μm current densities from 4 to 120 μA/cm 2 were obtained. The substrate temperature was varied between RT and 265 deg. C. The implanted regions were subsequently analysed by micro RBS/channeling with a 3 MeV He + beam having a spot size of 50 μm x 50 μm. Crystal damage up to amorphisation was observed in dependence on the substrate temperature. Above a critical temperature T C no amorphisation occurs. T C was determined for each series of samples implanted with the same ion current density j. It was found that the empirical Arrhenius relation j ∼ exp(-E a /kT C ), known from standard implantation experiments, is also valid at high current densities. The observed Arrhenius law can be derived from a model of epitaxial crystallisation stimulated by defect diffusion
Dose measurement of ion implanted silicon by RBS technique
International Nuclear Information System (INIS)
Kamawanna, Teerasak; Intarasiri, Saweat; Prapunsri, Chowunchun; Thongleurm, Chome; Maleepatra, Saenee; Singkarat, Somsorn
2003-10-01
Surface modification can be achieved by ion implantation. This study used a 1 mm thick silicon wafer as a target which was implanted with Ar+ at 80 keV. The degree of the modification depends on both the ion energy and the implanted dose. The distribution of argon in the silicon substrate and the absolute implanted dose can be measured by using Rutherford Backscattering Spectrometry (RBS). These investigations utilized a 1.7 MV Tandetron accelerator system at Chiang Mai University. The dose determination by a direct calculation is in agreement with the simulation by the SIMNRA code
On the evaluation of micromatter thin standards by RBS
International Nuclear Information System (INIS)
Ionescu, M.; Stelcer, E.; Hawas, O.; Siegele, R.; Cohen, D.; Linch, D.; Sarbutt, A.; Garton, D.
2005-01-01
Thin film standards are routinely used in PIXE and PIGE techniques for elemental analysis of particulates present in air samples, collected on Teflon filters. A number of parameters such as thickness, homogeneity and the type and amount of impurities present in the standards are crucial in order to perform high accuracy measurements. In this paper we report the use of RBS on the new STAR 2MV accelerator for characterisation of thin film standards obtained commercially. All standards were produced by MicroMatter Co. on polymer substrates, using a room temperature evaporation method. (author). 4 refs., 5 figs., 1 tab
Characterization of a SiC MIS Schottky diode as RBS particle detector
Kaufmann, I. R.; Pick, A. C.; Pereira, M. B.; Boudinov, H. I.
2018-02-01
A 4H-SiC Schottky diode was investigated as a particle detector for Rutherford Backscattering Spectroscopy (RBS) experiment. The device was fabricated on a commercial 4H-SiC epitaxial n-type layer grown onto a 4H-SiC n+ type substrate wafer doped with nitrogen. Hafnium oxide with thickness of 1 nm was deposited by Atomic Layer Deposition and 10 nm of Ni were deposited by sputtering to form the Ni/HfO2/4H-SiC MIS Schottky structure. Current-Voltage curves with variable temperature were measured to extract the real Schottky Barrier Height (0.32 V) and ideality factor values (1.15). Reverse current and Capacitance-Voltage measurements were performed on the 4H-SiC detector and compared to a commercial Si barrier detector acquired from ORTEC. RBS data for four alpha energies (1, 1.5, 2 and 2.5 MeV) were collected from an Au/Si sample using the fabricated SiC and the commercial Si detectors simultaneously. The energy resolution for the fabricated detector was estimated to be between 75 and 80 keV.
Micro-ERDA, micro-RBS and micro-PIXE techniques in the investigation of fish otoliths
International Nuclear Information System (INIS)
Huszank, R.; Simon, A.; Szilagyi, E.; Keresztessy, K.; Kovacs, I.
2009-01-01
Elemental distribution in the otolith of the fresh water fish burbot (Lota lota L.) collected in Hungary was measured with Elastic Recoil Detection Analysis (ERDA), Rutherford Backscattering Spectrometry (RBS) and as a complementary technique, Particle-Induced X-ray Emission (PIXE) with a focussed ion beam of 1.5 x 1.5 μm 2 spot size. The organic- and inorganic-rich regions of the otolith are distinguished and they are presented as hydrogen and calcium maps at depth regions of 0-70, 70-140 and 140-210 nm. The textured surface of the sample and its porosity were characterized from the effect on the RBS spectra. The oxygen and carbon PIXE elemental maps can also be used to identify the organic- and inorganic-rich regions of the otolith. The calcium map was found to be more homogeneous because the otolith structure is averaged in a larger depth. The trace elements Fe, Zn and Sr were detected only in very low concentration by micro-PIXE.
Micro-ERDA, micro-RBS and micro-PIXE techniques in the investigation of fish otoliths
Energy Technology Data Exchange (ETDEWEB)
Huszank, R. [Institute of Nuclear Research of the Hungarian Academy of Sciences, P.O. Box 51, H-4001 Debrecen (Hungary)], E-mail: huszank@atomki.hu; Simon, A. [Institute of Nuclear Research of the Hungarian Academy of Sciences, P.O. Box 51, H-4001 Debrecen (Hungary); Szilagyi, E. [KFKI Research Institute for Particle and Nuclear Physics, P.O. Box 49, H-1525 Budapest (Hungary); Keresztessy, K. [Department of Fish Culture, Institute of Environmental and Landscape Management, Szent Istvan University, Pater K.u.1, H-2103 Goedoello (Hungary); Kovacs, I. [KFKI Research Institute for Particle and Nuclear Physics, P.O. Box 49, H-1525 Budapest (Hungary)
2009-06-15
Elemental distribution in the otolith of the fresh water fish burbot (Lota lota L.) collected in Hungary was measured with Elastic Recoil Detection Analysis (ERDA), Rutherford Backscattering Spectrometry (RBS) and as a complementary technique, Particle-Induced X-ray Emission (PIXE) with a focussed ion beam of 1.5 x 1.5 {mu}m{sup 2} spot size. The organic- and inorganic-rich regions of the otolith are distinguished and they are presented as hydrogen and calcium maps at depth regions of 0-70, 70-140 and 140-210 nm. The textured surface of the sample and its porosity were characterized from the effect on the RBS spectra. The oxygen and carbon PIXE elemental maps can also be used to identify the organic- and inorganic-rich regions of the otolith. The calcium map was found to be more homogeneous because the otolith structure is averaged in a larger depth. The trace elements Fe, Zn and Sr were detected only in very low concentration by micro-PIXE.
Gervais, Roger O; Ben-Porath, Yossef S; Wygant, Dustin B; Sellbom, Martin
2010-06-01
The Response Bias Scale (RBS) has been found to be a better predictor of over-reported memory complaints than Minnesota Multiphasic Personality Inventory-2 (MMPI-2) F, Back Infrequency (Fb), Infrequency-Psychopathology (Fp), and FBS scales. The MMPI-2-Restructured Form (RF) validity scales were designed to meet or exceed the sensitivity of their MMPI-2 counterparts to symptom over-reporting. This study examined the incremental validity of MMPI-2-RF validity scales and RBS in assessing memory complaints. The MMPI-2-RF over-reporting validity scales were more strongly associated with mean Memory Complaints Inventory scores than their MMPI-2 counterparts (d = 0.22 to 0.49). RBS showed the strongest relationship with memory complaints. Regression analyses demonstrated the incremental validity of the MMPI-2-RF Infrequent Responses, Infrequent Psychopathology Responses, Infrequent Somatic Responses, and FBS-r scales relative to MMPI-2 F, Fp, and FBS in predicting memory complaints. This is consistent with the development objectives of the MMPI-2-RF validity scales as more efficient and sensitive measures of symptom over-reporting.
Filmes de polpa de banana produzidos por batelada: propriedades mecânicas e coloração
Directory of Open Access Journals (Sweden)
Milena dos Reis Martelli
2014-01-01
Full Text Available Polpa de bananas sobremaduras e impróprias ao consumo foram utilizadas como matéria-prima para a elaboração de formulações para o processamento de filmes biodegradáveis. Os filmes foram obtidos fazendo uso de uma máquina semi-industrial de laminação plástica da Mathis no modo batelada. Pequenas adições de glicerol como plastificante e de pectina como aglutinante foram avaliadas. O processamento via Mathis garantiu lâminas homogêneas e reprodutivas. O glicerol mostrou ser necessário para conferir plasticidade aos filmes. A melhor combinação entre módulo de elasticidade e máxima elongação foi a composição com 4,5% purê obtido da polpa de banana (g purê seco/100 g de solução filmogênica, 5% glicerol (g glicerol/100 g de purê seco e 0,5% pectina (g pectina/100 g de solução filmogênica. A adição de 0,5% de pectina também proporcionou maior estabilidade da coloração dos filmes.
Directory of Open Access Journals (Sweden)
Juliana Calábria de Araújo
2010-06-01
Full Text Available Bactérias anaeróbias oxidadoras de amônia (bactérias Anammox, do inglês anaerobic ammonium oxidizing bacteria foram enriquecidas em reator em batelada sequencial (RBS, a partir de lodo proveniente de um sistema convencional de lodos ativados tratando esgoto doméstico de Belo Horizonte (MG. Após três meses de cultivo, atividade Anammox foi detectada no sistema pelo consumo de quantidades estequiométricas de NO2- e NH4+. Análises de hibridação in situ fluorescente (FISH, do inglês fluorescent in situ hybridization confirmaram a presença de bactérias Anammox, provavelmente Candidatus Brocadia anammoxidans, e revelaram que estas representavam 53% do total de células (após 6 meses de cultivo. O desempenho do reator ao longo dos sete meses de operação demonstrou remoção quase que total de nitrito, baseada em concentração afluente de 61 a 95 mg N-NO2-/L. A eficiência máxima de remoção de amônia alcançada foi de 95%, a partir de concentração afluente de 55 a 82 mg N-NH4+/L.Anaerobic ammonium-oxidizing (Anammox bacteria were enriched from sludge collected at a conventional activated sludge system treating domestic wastewater of Belo Horizonte(MG, Brazil, employing a sequencing batch reactor (SBR. After three months of cultivation, Anammox activity was detected in the system by the consumption of stoichiometric amounts of NO2- and NH4+. Fluorescent in situ hybridization (FISH results revealed the presence of Anammox bacteria (probably Candidatus Brocadia anammoxidans and showed that they accounted for 53% of the total bacterial population (after 6 months of cultivation. The reactor performance during the seven months of operation showed a near perfect removal of nitrite, based on the influent NO2--N concentration of 61-95 mg/L. The maximum ammonia removal efficiency was 95% from the influent N-NH4+ concentration of 55-82 mg/L.
Evolution of Zr/Hf/Zr trilayers during annealing studied by RBS
International Nuclear Information System (INIS)
Kling, A.; Soares, J.C.
2010-01-01
The Zr/Hf system is highly interesting due its various applications, e.g. formation of amorphous ternary alloys, superconductive properties and production of gate oxide layers with high dielectric coefficients by oxidation of Zr/Hf multilayers. In this work Zr/Hf/Zr trilayers with an individual layer thickness of approximately 50 nm were deposited by electron gun evaporation on a substrate consisting of silicon covered by a micrometer thick thermal oxide layer. Samples were subjected to annealing procedures at 500 and 1200 o C in flowing air atmosphere to promote oxidation and Zr/Hf interdiffusion effects. RBS studies of the as-deposited and annealed samples were performed at the van-de-Graaff accelerator of ITN using He + and H + beams with energies between 2.0 and 2.525 MeV in order to study compositional changes induced by the heat treatment. In the case of low-temperature annealing the layer system appears, besides the oxidation process starting from the surface, to be stable. On the other hand, high-temperature annealing leads to an asymmetric Hf-diffusion into the surface and interior Zr-layer provoked by anomalous diffusion due to a phase transition in Zr accompanied by an almost complete oxidation of the layer structure Oxygen and metal depth distributions obtained by RBS in the as-deposited and treated samples are provided.
Structural analysis of erbium {delta}-doped InP by OMVPE with RBS-channeling
Energy Technology Data Exchange (ETDEWEB)
Yuhara, Junji; Takeda, Hitoshi; Matsubara, Naoki; Tabuchi, Masao; Fujiwara, Yasufumi; Morita, Kenji; Takeda, Yoshikazu [Nagoya Univ. (Japan). School of Engineering
1997-03-01
We have determined the lattice location of Er in InP {delta}-doped by OMVPE with RBS-channeling. Er concentrations along the <001> and <011> directions are same as random yields, while a significant flux peaking effect is seen for the <111> direction. These data suggest that Er atoms occupy the site equivalent to the hexahedral site in InP lattice. (author)
Analysis of biological materials by RBS and PIXE methods
International Nuclear Information System (INIS)
Latuszynski, A.; Maczka, D.; Kobzev, A. P.
2002-01-01
A problem of the exact determination of the element concentration in different substances is of essential significance, especially in medical, biological, as well as environment protection investigations. For this purpose some chemical and physical methods are used such as very sensitive and precise techniques: PIXE and RBS. The main advantage of those methods is the sensitivity of ppm level and very small sample amount necessary for carrying out the investigations. In this article the investigation results obtained by PIXE and RBS methods for the metal contents in cow milk (18 various samples were studied) as well as the heavy metal admixtures in the brain of the living domestic animals (6 cows, 6 dogs and 17 rats) are presented. The samples were prepared for the analysis in a liofilization process, then they were mixed with spectral pure graphite. The PIXE and RBS investigations were performed using a proton beam of about 2 mm diameter, intensity of about 10 nA and energy of 2.5 MeV from the Van-de-Graaff generator, FLNP, JINR, Dubna. The measurements of the characteristic spectrum were carried out by means of a Si (Li) detector with the resolution of 200 eV at the energy of 6,4 keV. Generally, in all samples of milk and brain we could identify 20 elements, among them 13 (C, N, O, P, Cl, K, Ca, Fe, Cu, Zn. Br, Rb, Sr) appeared in all of the studied samples. The difference in the concentration of the most of those elements between samples was in the range of 15 - 20 %. This indicates a good accuracy of the used methods of measurement. Especially our attention was paid to the presence of Sr, Rb and Br, practically in all the milk samples. This fact requires further investigations. Such elements as Pb, As, Ni, Co, Mn, V and Ti were found in some samples, including all samples coming from regions of a high urbanization. It is characteristic that the milk samples coming from villages located considerably far-away from cities and from communication tracks, practically
International Nuclear Information System (INIS)
Intarasiri, S.; Kamwanna, T.; Hallen, A.; Yu, L.D.; Janson, M.S.; Thongleum, C.; Possnert, G.; Singkarat, S.
2006-01-01
For ion beam synthesis of silicon carbide (SiC), a knowledge of the depth distribution of implanted carbon ions in silicon is crucial for successful development. Based on its simplicity and availability, we selected Rutherford backscattering spectrometry (RBS) as an analysis technique for this purpose. A self-developed computer program dedicated to extract depth profiles of lighter impurities in heavier matrix is established. For control, calculated results are compared with an other ion beam analysis (IBA) technique superior for studying lighter impurity in heavier substrate i.e. elastic recoil detection analysis (ERDA). The RBS was performed with a 1.7-MV Tandetron accelerator using He 2+ as the probe ions. The ERDA was performed with a 5-MV Pelletron accelerator using I 8+ as the probe ions. This work shows that the RBS-extracted data had no significant deviations from those of ERDA and simulations by SRIM2003 and SIIMPL computer codes. We also found that annealing at temperatures as high as 1000 deg. C had quite limited effect on the redistribution of carbon in silicon
Toward Ultraintense Compact RBS Pump for Recombination 3.4 nm Laser via OFI
Suckewer, S.; Ren, J.; Li, S.; Lou, Y.; Morozov, A.; Turnbull, D.; Avitzour, Y.
In our presentation we overview progress we made in developing a new ultrashort and ultraintensive laser system based on Raman backscattering (RBS) amplifier /compressor from time of 10th XRL Conference in Berlin to present time of 11th XRL Conference in Belfast. One of the main objectives of RBS laser system development is to use it for pumping of recombination X-ray laser in transition to ground state of CVI ions at 3.4 nm. Using elaborate computer code the processes of Optical Field Ionization, electron energy distribution, and recombination were calculated. It was shown that in very earlier stage of recombination, when electron energy distribution is strongly non-Maxwellian, high gain in transition from the first excited level n=2 to ground level m=1 can be generated. Adding large amount of hydrogen gas into initial gas containing carbon atoms (e.g. methane, CH4) the calculated gain has reached values up to 150-200 cm-2 Taking into account this very encouraging result, we have proceed with arrangement of experimental setup. We will present the observation of plasma channels and measurements of electron density distribution required for generation of gain at 3.4 nm.
Study of martensitic transformation in stainless steel by CEMS and RBS channeling
International Nuclear Information System (INIS)
Hayashi, N.; Sakamoto, I.; Tanoue, H.
1993-01-01
The effect of Xe ion irradiation in a single crystal of 17/13 stainless steel has been studied, using RBS channeling techniques and conversion electron Moessbauer spectroscopy (CEMS). 300 keV Xe ions were used to induce martensitic transformation in the austentic steel. A dynamic behavior of the transformation was observed as functions of the fluence and depth dependence. The martensite appears abruptly at a critical fluence, in contrast with polycrystalline 17/7 stainless steel. (orig.)
Sharma, Ashish; Goyal, Vinay; Behari, Madhuri; Srivastva, Achal; Shukla, Garima; Vibha, Deepti
2015-01-01
There is limited data on the prevalence of impulse control disorder and related behaviors (ICD-RBs) in Indian patients with Parkinson's Disease (PD). In the context of potential genetic and environmental factors affecting the expression of ICD-RBs, studying other multiethnic populations may bring in-sights into the mechanisms of these disorders. To ascertain point prevalence estimate of ICD-RBs in Indian PD patients, using the validated "Questionnaire for Impulsive-Compulsive Disorders in Parkinson's disease (QUIP)" and to examine their association with Dopamine replacement therapy (DRT). This was a hospital based observational cross-sectional study. After taking informed consent, patients and their informants (spouse, or primary caregiver) were made to complete the QUIP, and were instructed to answer questions based on behaviors that occurred anytime during PD that lasted at least four consecutive weeks. Total of 299 patients participated in the study. At least one ICD-RB was present in 128 (42.8%), at least one Impulse control disorder (ICD) was present in 74 (24.75%) and at least one Impulse control related compulsive behaviour (ICRB) was present in 93 (31.1%) patients. Punding was the most frequent (12.4%) followed by hyper sexuality (11.04%), compulsive hobbyism (9.4%), compulsive shopping (8.4%), compulsive medication use (7.7%), compulsive eating (5.35%), walkabout (4%) and pathological gambling (3.3%). ≥ 2 ICD-RBs were observed in 15.7% of patients. After multivariate analysis, younger age of onset, being unmarried were specifically associated with presence of ICD. Longer disease duration was specifically associated with presence of ICRB. Whereas smoking and higher dopamine levodopa equivalent daily doses (DA LEDD) were associated with both presence of ICD and ICRB. Higher LD LEDD was specifically associated with presence of ICD-RB. Our study revealed a relatively higher frequency of ICD-RBs, probably because of the use of screening instrument and because
Direction-dependent RBS channelling studies in ion implanted LiNbO{sub 3}
Energy Technology Data Exchange (ETDEWEB)
Wendler, E., E-mail: elke.wendler@uni-jena.de; Becker, G.; Rensberg, J.; Schmidt, E.; Wolf, S.; Wesch, W.
2016-07-15
Damage formation in ion implanted LiNbO{sub 3} was studied by Rutherford backscattering spectrometry (RBS) along various directions of the LiNbO{sub 3} crystal. From the results obtained it can be unambiguously concluded that Nb atoms being displaced during ion implantation preferably occupy the free octahedron sites of the LiNbO{sub 3} lattice structure and most likely also form Nb{sub Li} antisite defects.
Directory of Open Access Journals (Sweden)
Luana Viana Costa e Silva
2013-12-01
Full Text Available Indústrias de laticínios contêm elevada concentração de matéria orgânica que podem causar poluição. Este trabalho propôs estudar a remoção de matéria orgânica e de nutrientes de um efluente sintético de laticínio, disposto em reatores em bateladas repetidas inoculados com Aspergillus niger AN400. O sistema foi composto por reatores com diferentes configurações e, para cada tipo de montagem, variou-se o material-suporte. O estudo foi realizado em quatro ciclos de cinco dias, com retiradas diárias de alíquotas. A análise dos resultados mostrou eficiência de remoção de demanda química de oxigênio com picos de até 71,7%, concluindo-se que a tecnologia mostrou-se viável na remoção de matéria orgânica. Em relação aos nutrientes, o sistema pôde remover satisfatoriamente nitrato; contudo, para remoção de amônia, não se apresentou promissor.
Krupinski, M.; Perzanowski, M.; Zabila, Y.; Zarzycki, A.; Marszałek, M.
2017-03-01
In this paper the influence of surface topography on Rutherford backscattering spectrometry (RBS) is discussed. (Cu/Fe/Pd) multilayers with total thickness of about 10 nm were deposited by physical vapor deposition on self-organized array of SiO2 nanoparticles with the size of 50 nm and 100 nm. As a reference, the multilayered systems were also prepared on flat substrates under the same conditions. After the deposition, morphology of the systems was studied by scanning electron microscopy (SEM), while chemical analysis was performed using Rutherford backscattering spectrometry. It was found that the RBS spectra and determined compositions for flat and patterned multilayers differ. The difference is discussed by taking into account the effect of additional inelastic scattering and energy straggling occurring due to developed topography of patterned systems. Then, the multilayers were annealed in 600 °C in order to obtain FePdCu alloy. The phenomenon of solid-state dewetting resulted in the formation of isolated alloy islands on the top of SiO2 nanoparticles. The SEM and RBS analysis were repeated showing correlation between the size distribution of obtained alloy islands and broadening of peaks appearing in RBS spectra. Invited talk at 8th International Workshop on Advanced Materials Science and Nanotechnology (IWAMSN2016), 8-12 November 2016, Ha Long City, Vietnam.
Analysis of elemental composition of porcelains unearthed from Waguantan kiln site by PIXE–RBS
International Nuclear Information System (INIS)
Zhou, Z.; Zhang, K.; Xia, C.D.; Liu, M.T.; Zhu, J.J.; An, Z.; Bai, B.
2015-01-01
Highlights: •We analyzed 61 unearthed porcelain shards in Yuan Dynasty by PIXE–RBS. •An electron gun was installed to solve the electric charge accumulations. •The factor analysis was performed for the element compositions. •The “exotic group” porcelain samples unearthed were produced locally. -- Abstract: A method combining proton-induced X-ray emission spectrometry (PIXE) and Rutherford backscattering spectrometry (RBS) was used to determine the composition of 61 porcelain shards from the Yuan Dynasty (1271–1368 A.D.) unearthed from the Waguantan kiln site at Tianzhu County in Guizhou Province, China. Based on our previous experimental setup, an electron gun device with a LaB 6 crystal cathode was installed to solve the problem created when the incident proton beams generated electric charge accumulations on the surfaces of the insulating porcelain samples, which induced a large bremsstrahlung background. The use of the electron gun has largely eliminated the large bremsstrahlung background and has therefore improved the detection limits for elements, especially for trace elements, and made it possible to determine the origin of the porcelains based on the trace elements. Major and trace elemental compositions of the porcelain bodies and glazes measured by PIXE and RBS were analyzed by the factor analysis method. The factor analysis showed that a few pieces of porcelain with a style similar to the porcelain of the Longquan kiln among the unearthed porcelains from the Waguantan kiln site did not have obvious differences in elemental compositions from other remaining porcelains unearthed from the Waguantan kiln site, indicating that the pieces of unearthed porcelain with the Longquan kiln style did in fact belong to the product fired locally by imitating the model of the Longquan celadon with local raw materials. This result therefore indicated that the Longquan kiln technology that originated from the Five Dynasties (907–960 A.D.) had been
Analysis of elemental composition of porcelains unearthed from Waguantan kiln site by PIXE–RBS
Energy Technology Data Exchange (ETDEWEB)
Zhou, Z. [Key Laboratory of Radiation Physics and Technology of Ministry of Education, Institute of Nuclear Science and Technology, Sichuan University, Chengdu 610064 (China); Zhang, K. [School of History and Culture, Sichuan University, Chengdu 610064 (China); Xia, C.D.; Liu, M.T.; Zhu, J.J. [Key Laboratory of Radiation Physics and Technology of Ministry of Education, Institute of Nuclear Science and Technology, Sichuan University, Chengdu 610064 (China); An, Z., E-mail: anzhu@scu.edu.cn [Key Laboratory of Radiation Physics and Technology of Ministry of Education, Institute of Nuclear Science and Technology, Sichuan University, Chengdu 610064 (China); Bai, B., E-mail: baibin@scu.edu.cn [School of History and Culture, Sichuan University, Chengdu 610064 (China)
2015-03-01
Highlights: •We analyzed 61 unearthed porcelain shards in Yuan Dynasty by PIXE–RBS. •An electron gun was installed to solve the electric charge accumulations. •The factor analysis was performed for the element compositions. •The “exotic group” porcelain samples unearthed were produced locally. -- Abstract: A method combining proton-induced X-ray emission spectrometry (PIXE) and Rutherford backscattering spectrometry (RBS) was used to determine the composition of 61 porcelain shards from the Yuan Dynasty (1271–1368 A.D.) unearthed from the Waguantan kiln site at Tianzhu County in Guizhou Province, China. Based on our previous experimental setup, an electron gun device with a LaB{sub 6} crystal cathode was installed to solve the problem created when the incident proton beams generated electric charge accumulations on the surfaces of the insulating porcelain samples, which induced a large bremsstrahlung background. The use of the electron gun has largely eliminated the large bremsstrahlung background and has therefore improved the detection limits for elements, especially for trace elements, and made it possible to determine the origin of the porcelains based on the trace elements. Major and trace elemental compositions of the porcelain bodies and glazes measured by PIXE and RBS were analyzed by the factor analysis method. The factor analysis showed that a few pieces of porcelain with a style similar to the porcelain of the Longquan kiln among the unearthed porcelains from the Waguantan kiln site did not have obvious differences in elemental compositions from other remaining porcelains unearthed from the Waguantan kiln site, indicating that the pieces of unearthed porcelain with the Longquan kiln style did in fact belong to the product fired locally by imitating the model of the Longquan celadon with local raw materials. This result therefore indicated that the Longquan kiln technology that originated from the Five Dynasties (907–960 A.D.) had been
Determination of wear metals in engine oil by PIXE and RBS technique
Energy Technology Data Exchange (ETDEWEB)
Alkofahi, M M [Physics Dept., Yarmouk university, Irbid, (Jordan)
1995-10-01
The constituents of fresh and used engine oil were determined by PIXE and RBS techniques using 2 MeV He{sup ++} ion beams. The concentration of generated wear metals in used engine oil was measured as a function of running kilometers. The fresh oil was found to contain the elements: Si, P, S, Cl, K, Ca, and Fe. In addition to theses elements, Pb and Br were found in the used oil. Changes in the concentrations of S, Zn and Br were noticed as the running kilometers increased. 6 figs., 2 tabs.
Compositional studies at the Bone-Cartilage interface using PIXE, RBS and cSAXS techniques
International Nuclear Information System (INIS)
Kaabar, W.; Gundogdu, O.; Bradley, D.A.; Bunk, O.; Pfeiffer, F.; Pfeiffer, F.; Farquharson, M.J.; Webb, M.; Jeynes, C.
2009-01-01
Micro Proton Induced X-ray Emission (μ-PIXE) analysis has been employed herein in investigating and quantifying the distribution of a number of essential cations in two thin slices of normal and diseased human articular cartilage, the latter being affected by osteoarthritis (OA). The elemental distribution maps for Ca, P, K, S and Zn in the normal and diseased slices showed similar patterns with marked increases in elemental concentrations in the bone-cartilage interface. The S concentration was significantly lower in bone than in cartilage. Conversely, the Ca and P concentrations were higher in bone. The Ca/P ratio (2.22) of the diseased slice was determined by employing the Rutherford backscattering technique (RBS). The RBS figures of this investigation agree with values previously reported by others. Structural and organisational changes of collagen networks were investigated by coherent Small-Angle X-ray Scattering (SAXS) using beamline facilities at the Swiss Light Source (SLS) for a decalcified diseased human articular cartilage slice. The SAXS findings showed a gradual reorientation of collagen type II fibres of cartilage from parallel to the surface of the joint to normal to the bone-cartilage interface. Similar patterns of orientation were observed at the subchondral bone to bone-cartilage interface
Development of time-of-flight RBS system using multi microchannel plates
International Nuclear Information System (INIS)
Nguyen, N.V.; Abo, S.; Lohner, T.; Sawaragi, H.; Wakaya, F.; Takai, M.
2007-01-01
A new time-of-flight Rutherford backscattering spectroscopy (TOF-RBS) system with two circular microchannel plates (MCPs) installed at a distance of 140 mm from a sample holder and a scattering angle of 125 o and a 100 kV focused ion beam column having a liquid metal ion source (LMIS) of AuSiBe alloy has been assembled to obtain high counting rate and enhanced mass resolution. The possible influence of the two MCPs by logical summation of the output signals on the time resolution was investigated by measuring dedicated thin deposited metallic samples. And, the time resolution was found in the range of 1.5-2 ns
Directory of Open Access Journals (Sweden)
Ashish Sharma
2015-01-01
Full Text Available Background: There is limited data on the prevalence of impulse control disorder and related behaviors (ICD-RBs in Indian patients with Parkinson′s Disease (PD. In the context of potential genetic and environmental factors affecting the expression of ICD-RBs, studying other multiethnic populations may bring in-sights into the mechanisms of these disorders. Objectives: To ascertain point prevalence estimate of ICD-RBs in Indian PD patients, using the validated “Questionnaire for Impulsive-Compulsive Disorders in Parkinson′s disease (QUIP” and to examine their association with Dopamine replacement therapy (DRT. Materials and Methods: This was a hospital based observational cross-sectional study. After taking informed consent, patients and their informants (spouse, or primary caregiver were made to complete the QUIP, and were instructed to answer questions based on behaviors that occurred anytime during PD that lasted at least four consecutive weeks. Results: Total of 299 patients participated in the study. At least one ICD-RB was present in 128 (42.8%, at least one Impulse control disorder (ICD was present in 74 (24.75% and at least one Impulse control related compulsive behaviour (ICRB was present in 93 (31.1% patients. Punding was the most frequent (12.4% followed by hyper sexuality (11.04%, compulsive hobbyism (9.4%, compulsive shopping (8.4%, compulsive medication use (7.7%, compulsive eating (5.35%, walkabout (4% and pathological gambling (3.3%. ≥ 2 ICD-RBs were observed in 15.7% of patients. After multivariate analysis, younger age of onset, being unmarried were specifically associated with presence of ICD. Longer disease duration was specifically associated with presence of ICRB. Whereas smoking and higher dopamine levodopa equivalent daily doses (DA LEDD were associated with both presence of ICD and ICRB. Higher LD LEDD was specifically associated with presence of ICD-RB. Conclusions: Our study revealed a relatively higher
RBS analysis of ions implanted in light substrates exposed to hot plasmas laser-generated at PALS
Czech Academy of Sciences Publication Activity Database
Torrisi, L.; Gammino, S.; Picciotto, A.; Wolowski, J.; Krása, Josef; Láska, Leoš; Calcagnile, L.; Quarta, G.
2005-01-01
Roč. 160, 10-12 (2005), s. 685-695 ISSN 1042-0150. [Workshop PIBHI 2005 /2./. Giardini Naxos, 08.06.06-11.06.06] R&D Projects: GA MŠk(CZ) LC528 Institutional research plan: CEZ:AV0Z10100523 Keywords : RBS analysis * ion implantation * plasma-generated by lasers Subject RIV: BH - Optics, Masers, Lasers Impact factor: 0.353, year: 2005
Sandro de Miranda Colombo
2011-01-01
Descreve-se o desenvolvimento de um método de análise por injeção sequencial para determinação de glifosato em formulações comerciais por voltametria de onda quadrada em eletrodo de gota de mercúrio. O glifosato foi derivatizado em modo estacionário com ácido nitroso para produção de N-nitroso glifosato, que é eletroativo. Os limites de detecção (LD) e quantificação (LQ) foram 0,7 e 2,4 mg L-1 (4 e 14 µmol L-1), respectivamente. O método foi aplicado a três formulações, obtendo resultado...
Energy Technology Data Exchange (ETDEWEB)
Garcia-Gutierrez, M.; Alonso de los Rios, U.; Missana, T.; Cormenzana, J.L.; Mingarro, M.; Morejon, J.; Gil, P.
2008-08-06
The Opalinus Clay (OPA) formation in the Zurcher Weiland (Switzerland) is a potential host rock for a repository for high-level radioactive waste. Samples collected in the Mont Terri Underground Rock Laboratory (URL), where the OPA formation is located at a depth between -200 and -300 m below the surface, were used to study the radionuclide diffusion in clay materials. Classical laboratory essays and a novel experimental set-up for large-scale diffusion experiments were performed together to a novel application of the nuclear ion beam technique Rutherford Backscattering Spectrometry (RBS), to understand the transport properties of the OPA and to enhance the methodologies used for in situ diffusion experiments. Through-Diffusion and In-Diffusion conventional laboratory diffusion experiments were carried out with HTO, 36{sup C}l-, I-, 22{sup N}a, 75{sup S}e, 85{sup S}r, 233{sup U}, 137{sup C}s, 60{sup C}o and 152{sup E}u. Large-scale diffusion experiments were performed with HTO, 36{sup C}l, and 85{sup S}r, and new experiments with 60{sup C}o, 137{sup C}s and 152{sup E}u are ongoing. Diffusion experiments with RBS technique were done with Sr, Re, U and Eu. (Author) 38 refs.
Carbon buildup monitoring using RBS: Correlation with secondary electrons
International Nuclear Information System (INIS)
Aguilera, E.F.; Rosales, P.; Martinez-Quiroz, E.; Murillo, G.; Fernandez, M.C.
2006-01-01
The RBS technique is applied to solve the problem of on-line monitoring of the carbon deposited on a thin backed foil under ion bombardment. An iterative method is used to reliably extract quantities such as number of projectiles and target thickness in spite of beam energy changes and detector unstabilities. Experimental values for secondary electron yields are also deduced. Results are reported for the thickness variation of thin carbon foils bombarded with carbon ions of energies between 8.95 and 13 MeV. A linear correlation of this variation is found with both, the ion fluence at target and the number of secondary electrons emitted. The correlation exists even though a wide range of beam currents, beam energies and bombarding times was used during the experiment. The measured electron yields show evidence for a change in the emission process between the original foils and the deposited layer, possibly due to a texture change
International Nuclear Information System (INIS)
Nguyen The Nghia; Bui Van Loat; Le Hong Khiem
2011-01-01
The electrostatic Pelletron accelerator 5SDH-2 is installing at Hanoi University of Sciences. This accelerator will be the first tandem electrostatic accelerator installed in Vietnam. The schematic structure, principle of operation of the machine and its application for analysis using Rutherford Back Scattering (RBS), Particle-Induced X-ray Emission (PIXE) and Nuclear Reaction Analysis (NRA) will be presented. (author)
Copper implantation defects in MgO observed by positron beam analysis, RBS and X-TEM
International Nuclear Information System (INIS)
Huis, M.A. van; Fedorov, A.V.; Veen, A. van; Smulders, P.J.M.; Kooi, B.J.; Hosson, J.Th.M. de
2000-01-01
In this work, effects of copper ion implantation in MgO were studied. (1 0 0) MgO samples were implanted with 50 keV Cu ions and thermally annealed stepwise in air for 30 minutes at 550, 750, 1000, 1250 and 1350 K. After ion implantation and after each annealing step, the samples were analysed with positron beam analysis (PBA). Use was also made of Rutherford backscattering spectrometry/channeling (RBS-C) and cross-sectional transmission electron microscopy (X-TEM). The combination of these techniques enabled to monitor the depth resolved evolution of both created defects and the copper atom depth distribution. PBA results show that copper implantation at a dose of 10 15 ions cm -2 yields a single layer of vacancy type defects after annealing. However a copper implantation at a dose of 10 16 ions cm -2 clearly yields two layers of defects in the material after annealing, separated by an intermediate layer. In both layers nanocavities have been identified. RBS experimental results show that the implanted copper atoms diffuse into the bulk material during annealing. X-TEM and channeling results show that after annealing, the lattice of the copper nanoprecipitates is epitaxial to the MgO host lattice. Under some circumstances, copper precipitates and small voids can co-exist. Furthermore, X-TEM measurements show that the nanocavities have rectangular shapes
International Nuclear Information System (INIS)
Reis, M.A.; Alves, L.C.; Barradas, N.P.; Chaves, P.C.; Nunes, B.; Taborda, A.; Surendran, K.P.; Wu, A.; Vilarinho, P.M.; Alves, E.
2010-01-01
Thorough structural characterization of deep laying thin film, including the inference of interdiffusion profiles is frequently a complex problem. The use of RBS/PIXE holistic approaches, already shown to represent a powerful method, sometimes faces difficulties if standard experimental procedures are used. In this work, following a series of 4 He Rutherford backscattering and 1 H elastic backscattering experiments, carried out to study the influence of SrTiO 3 as a possible cladding layer between Pt/TiO 2 /SiO 2 /(1 0 0)Si substrates and MgTiO 3 films, a simple holistic RBS-PIXE is shown to be not enough for the solution of such a problem. Establishing of the Sr depth profile, was only possible after AFM, High-Resolution EDS PIXE and differential PIXE analysis were carried out. Results, problems faced and conclusions obtained are presented.
Energy Technology Data Exchange (ETDEWEB)
Mendez U, I.; Tenorio, D.; Galvan, J.L. [Instituto Nacional de Investigaciones Nucleares, A.P. 18-1027, 11801 Mexico D.F. (Mexico)
2000-07-01
This work has the objective of determining by means of the utilization of nuclear techniques (PIXE and RBS) the composition and the alloy type of diverse aztec ornaments corresponding to Post classic period, they were manufactured principally with copper and gold such as bells, beads and disks; all they belonging at 9 oblations of Templo Mayor of Tenochtitlan. It is presented here briefly the historical and archaeological antecedents of the devices as well as the analytical methods for conclude with the results obtained. (Author)
ONO structures investigated by SIMS, RBS, and NRA
International Nuclear Information System (INIS)
Iberl, F.; Ramm, P.; Lang, W.
1992-01-01
Reoxidized nitrided oxides (ONO) will be used in ULSI technology to improve the properties of thin gate dielectrics as high breakdown fields, radiation resistance, and diffusion barriers. The ONO structures analyzed in our study are fabricated in a rapid thermal processing reactor (RTP) using oxygen and ammonium ambients. Typical data for the sequential processing mode are: rapid thermal oxidation (RTO) in oxygen atmosphere at 1100degC and rapid thermal nitridation in ammonium atmosphere (RTN) at 1050degC followed by RTO at 1150degC. Due to the complexity of the growth process it is very important to verify the resulting layers with analytical methods. The whole structure is only about 250 A thick. To analyse the sequence, composition and thickness of the layers, the depth resolution of SIMS is necessary. On the other hand, for quantification, RBS and NRA can be used. When the bulk signal is suppressed by channelling, the signal of oxygen, and in special cases nitrogen, can be evaluated from the He + backscattering spectrum. For nuclear reaction analysis, the reactions of nitrogen with deuterium are used. The combination of SIMS and the accelerator techniques allow quantitative analysis and depth profiling of this structure. (orig.)
International Nuclear Information System (INIS)
Markwitz, Andreas
2000-01-01
Rutherford backscattering spectrometry (RBS) is known to be one of the techniques ideal for analysis of thin films. Elemental concentrations of matrix components and impurities can be investigated as well as depth profiles of almost each element of the periodic table. Best of all, RBS has both a high sensitivity and a high depth resolution, and is a non-destructive analysis technique that does not require specific sample preparation. Solid-state samples are mounted without preparation inside a high-vacuum analysis chamber. However, depth-related interpretation of elemental depth profiles requires the material density of the specimen and stopping power values to be taken into consideration. In many cases, these parameters can be estimated with sufficient precision. However, the assumed density can be inaccurate for depth scales in the nanometer range. For example, in the case of Ge nanoclusters in 500 nm thick SiO 2 layers, uncertainty is related to the actual position of a very thin Ge nanocluster band. Energy-dispersive X-ray emission (EDX) spectroscopy, using a high-resolution scanning transmission electron microscope (STEM) can assist in removing this uncertainty. By preparing a thin section of the specimen, EDX can be used to identify the position of the Ge nanocluster band very precisely, by correlating the Ge profile with the depth profiles of silicon and oxygen. However, extraction of the concentration profiles from STEM-EDX spectra is in general not straightforward. Therefore, a combination of the two very different analysis techniques is often the best and only successful way to extract high-resolution concentration profiles
An in-situ RBS system for measuring nuclides adsorbed at the liquid-solid interface
Energy Technology Data Exchange (ETDEWEB)
Morita, K; Yuhara, J; Ishigami, R [Nagoya Univ. (Japan). School of Engineering; and others
1997-03-01
An in-situ RBS system has been developed in which heavier nuclides adsorbed at the inner surface of a thin lighter window specimen of liquid container in order to determine the rate constants for their sorption and release at the interface. The testing of a thin silicon window of the sample assembly, in which Xe gas of one atmosphere was enclosed, against the bombardment of the probing ion beam has been performed. A desorption behavior of a lead layer adsorbed at the SiO{sub 2} layer of silicon window surface into deionized water has been measured as a preliminary experiment. (author)
Adoção sequencial de tecnologia pós-colheita aplicada à cafeicultura em Viçosa (MG
Directory of Open Access Journals (Sweden)
Matheus Wemerson Gomes Pereira
2010-06-01
Full Text Available O processo de adoção tecnológica na agricultura é de fundamental importância para o aumento da produtividade e a melhoria da qualidade dos produtos agrícolas. O objetivo deste artigo é avaliar os determinantes da adoção da tecnologia pós-colheita na cafeicultura em Viçosa (MG, no ano de 2007. Os resultados sugerem que o modelo sequencial é o mais apropriado à análise e que as variáveis associativismo, rentabilidade, treinamento, crédito, capital próprio e escolaridade são os principais determinantes na adoção de estágios mais elevados de tecnologia pós-colheita aplicada à cafeicultura. Os efeitos marginais mais importantes para adoção de maiores níveis tecnológicos são associativismo, treinamento, crédito e rentabilidade.The process of tecnology adoption in agriculture is fundamentally important for increasing productivity and improving the quality of agricultural products. The objective of this study is to evaluate the factors that determine the technological adoption of post-harvest coffee employed in Viçosa (MG in the year of 2007. The results indicate that the sequential model is more appropriate for the analysis and the most important determinants for the adoption of higher levels of post-harvest technology are association, profitability, training, education, credit, stock of capital, and years at school. The most important marginal effects for the adoption of higher levels of post-harvest technology are association, training, credit and profitability.
Escobar Galindo, R; Manninen, N K; Palacio, C; Carvalho, S
2013-07-01
Surface modification by means of wear protective and antibacterial coatings represents, nowadays, a crucial challenge in the biomaterials field in order to enhance the lifetime of bio-devices. It is possible to tailor the properties of the material by using an appropriate combination of high wear resistance (e.g., nitride or carbide coatings) and biocide agents (e.g., noble metals as silver) to fulfill its final application. This behavior is controlled at last by the outmost surface of the coating. Therefore, the analytical characterization of these new materials requires high-resolution analytical techniques able to provide information about surface and depth composition down to the nanometric level. Among these techniques are Rutherford backscattering spectrometry (RBS), glow discharge optical emission spectroscopy (GDOES), and angle resolved X-ray photoelectron spectroscopy (ARXPS). In this work, we present a comparative RBS-GDOES-ARXPS study of the surface characterization of Ag-TiCN coatings with Ag/Ti atomic ratios varying from 0 to 1.49, deposited at room temperature and 200 °C. RBS analysis allowed a precise quantification of the silver content along the coating with a non-uniform Ag depth distribution for the samples with higher Ag content. GDOES surface profiling revealed that the samples with higher Ag content as well as the samples deposited at 200 °C showed an ultrathin (1-10 nm) Ag-rich layer on the coating surface followed by a silver depletion zone (20-30 nm), being the thickness of both layers enhanced with Ag content and deposition temperature. ARXPS analysis confirmed these observations after applying general algorithm involving regularization in addition to singular value decomposition techniques to obtain the concentration depth profiles. Finally, ARXPS measurements were used to provide further information on the surface morphology of the samples obtaining an excellent agreement with SEM observations when a growth model of silver islands with
Analysis of elemental composition of porcelains unearthed from Waguantan kiln site by PIXE-RBS
Zhou, Z.; Zhang, K.; Xia, C. D.; Liu, M. T.; Zhu, J. J.; An, Z.; Bai, B.
2015-03-01
A method combining proton-induced X-ray emission spectrometry (PIXE) and Rutherford backscattering spectrometry (RBS) was used to determine the composition of 61 porcelain shards from the Yuan Dynasty (1271-1368 A.D.) unearthed from the Waguantan kiln site at Tianzhu County in Guizhou Province, China. Based on our previous experimental setup, an electron gun device with a LaB6 crystal cathode was installed to solve the problem created when the incident proton beams generated electric charge accumulations on the surfaces of the insulating porcelain samples, which induced a large bremsstrahlung background. The use of the electron gun has largely eliminated the large bremsstrahlung background and has therefore improved the detection limits for elements, especially for trace elements, and made it possible to determine the origin of the porcelains based on the trace elements. Major and trace elemental compositions of the porcelain bodies and glazes measured by PIXE and RBS were analyzed by the factor analysis method. The factor analysis showed that a few pieces of porcelain with a style similar to the porcelain of the Longquan kiln among the unearthed porcelains from the Waguantan kiln site did not have obvious differences in elemental compositions from other remaining porcelains unearthed from the Waguantan kiln site, indicating that the pieces of unearthed porcelain with the Longquan kiln style did in fact belong to the product fired locally by imitating the model of the Longquan celadon with local raw materials. This result therefore indicated that the Longquan kiln technology that originated from the Five Dynasties (907-960 A.D.) had been propagated to the Waguantan kiln site of Guizhou Province in the Yuan Dynasty.
RBS investigations of high-temperature reactions on graphite substrates
Energy Technology Data Exchange (ETDEWEB)
Eloi, C.C. [Kentucky Univ., Lexington, KY (United States). Dept. of Chemistry]|[Center for Applied Energy Research, University of Kentucky, Lexington, KY 40506 (United States); Robertson, J.D. [Kentucky Univ., Lexington, KY (United States). Dept. of Chemistry]|[Center for Applied Energy Research, University of Kentucky, Lexington, KY 40506 (United States); Majidi, V. [Kentucky Univ., Lexington, KY (United States). Dept. of Chemistry
1995-05-01
While graphite furnace atomic absorption spectrometry (GFAAS) is one of the most powerful techniques for ultratrace analysis of Pb, it is often plagued by matrix interferences. These interferences are minimized by the addition of matrix modifiers which stabilize the analyte signal through unknown mechanisms. Using RBS, the high temperature reactions of nitrate salts of Pb were studied on pyrolytically coated graphite with and without matrix modifiers. The addition of an ammonium phosphate modifier was found to stabilize Pb through the formation of a metal oxy-phosphorus compound. Moreover, the depth profiles demonstrated that the pyrolytically coated graphite was not impervious as previously thought. Pre-treatment of the surface with O{sub 2} is also known to cause a delay in the vaporization of Pb. While a surface effect had previously been postulated, the 3.04 MeV resonance {sup 16}O({alpha}, {alpha}){sup 16}O elastic scattering measurements show that it proceeds through the formation of surface bound lead-oxygen species as the number of oxygen atoms chemisorbed and the number of lead atoms, present on the surface prior to vaporization, are nearly equal. (orig.).
Lalaouna, David; Morissette, Audrey; Carrier, Marie-Claude; Massé, Eric
2015-10-01
The 87 nucleotide long DsrA sRNA has been mostly studied for its translational activation of the transcriptional regulator RpoS. However, it also represses hns mRNA, which encodes H-NS, a major regulator that affects expression of nearly 5% of Escherichia coli genes. A speculative model previously suggested that DsrA would block hns mRNA translation by binding simultaneously to start and stop codon regions of hns mRNA (coaxial model). Here, we show that DsrA efficiently blocked translation of hns mRNA by base-pairing immediately downstream of the start codon. In addition, DsrA induced hns mRNA degradation by actively recruiting the RNA degradosome complex. Data presented here led to a model of DsrA action on hns mRNA, which supports a canonical mechanism of sRNA-induced mRNA degradation by binding to the translation initiation region. Furthermore, using MS2-affinity purification coupled with RNA sequencing technology (MAPS), we also demonstrated that DsrA targets rbsD mRNA, involved in ribose utilization. Surprisingly, DsrA base pairs far downstream of rbsD start codon and induces rapid degradation of the transcript. Thus, our study enables us to draw an extended DsrA targetome. © 2015 John Wiley & Sons Ltd.
Low energy RBS-channeling measurement system with the use of a time-of-flight scattered ion detector
Energy Technology Data Exchange (ETDEWEB)
Hasegawa, Masataka; Kobayashi, Naoto; Hayashi, Nobuyuki [Electrotechnical Lab., Tsukuba, Ibaraki (Japan)
1996-07-01
We have developed a low energy Rutherford backscattering spectrometry-ion channeling measurement system for the analysis of thin films and solid surfaces with the use of several tens keV hydrogen ions and a time-of-flight particle energy spectrometer. For the detection of the scattered ions new TOF spectrometer has been developed, which consists of two micro-channel-plate detectors. The pulsing of the primary ion beam is not necessary for this type of TOF measurement, and it is possible to observe continues scattered ion beams. The dimension of whole system is very compact compared to the conventional RBS-channeling measurement system with the use of MeV He ions. The energy resolution, {delta} E/E, for 25 keV H{sup +} was 4.1%, which corresponds to the depth resolution of 4.8 nm for silicon. The depth resolution of our system is better than that of conventional RBS system with MeV helium ions and solid state detectors. We have demonstrated the ion channeling measurement by this system with 25 keV hydrogen ions. The system can be available well to the analysis of thin films and solid surfaces with the use of the ion channeling effect. The observation of the reaction between Fe and hydrogen terminated silicon surface was also demonstrated. (J.P.N.)
Cyclic voltammetry and RBS study of paint components
International Nuclear Information System (INIS)
Bowman, Lynn; Spencer, Dirk; Muntele, Claudiu; Muntele, Iulia; Ila, D.
2007-01-01
Heavy metals and metalloid ions are found in environmental matrices. The most toxic are lead, cadmium and mercury. These three heavy metals have no biological function and are toxic at all concentrations. Lead is one of the most insidious heavy metals and is introduced into the environment by many different means. It persists in both urban and rural settings, being found in paint chips, pottery, crystal and pharmaceutical and nutritional products. The analysis of heavy elements such as lead in soil is of particular importance [W.T. Sturges, R.M. Harrison, Sci. Total Environ. 44 (3) (1985) 225; M.L. Lepow, L. Bruckman, M. Gillette, S. Markowitz, R. Robino, J. Kapish, Environ. Res. 10 (3) (1975) 415; A.E. Daniels, J.R. Kominsky, P.J. Clark, J. Hazard. Mater. B 87 (2001) 117; G. Hutter, D. Moshman, J. Hazard. Mater. 40 (1995) 1]. In preparing the methods for lead detection in paint, we have used Rutherford backscattering spectrometry (RBS) in order to study the type and amount of heavy metal content in paint samples collected at various sites in the historic campus at A and M University (AAMU). We will show the results of our study with emphasis on comparison of what we learned about presence of lead in paints using our ion beam methods compared with the analysis of lead in paints using cyclic voltammetry
RBS and NRA damage analysis on PFA films bombarded with hydrogen
International Nuclear Information System (INIS)
Parada, Marco A.; Petchevist, Paulo C.D.; Minamisawa, Renato A.; Almeida, Adelaide de; Muntele, Claudiu I.; Zimmerman, Robert L.; Ila, Daryush
2005-01-01
The fluoropolymer PFA (Tetrafluoroethylene-per-fluoromethoxy ethylene) is a conventional thermoplastic used in civil engineering applications such as anti-adherent coatings and concrete additives. It is also candidate materials for radiation dosimetry with applications in medical physics. When such a polymer is exposed to ionizing radiation, it can suffers damages that depend on the type, energy, and intensity of the radiation. We present results on the damage caused by 1 MeV protons at fluences of 10 13 , 10 14 , 10 15 , and 10 16 protons/cm 2 . The energy deposited during such hydrogen bombardment breaks the polymeric chains with the release of fluorine in amounts directly proportional to the amount of deposited energy. Virgin samples were first analyzed by RBS. Subsequent damage was then profiled by monitoring the alpha emission spectrum, resulting from the nuclear reaction: 19 F(p,αγ) 16 O induced by 1.38 MeV protons on the remaining fluorine content of damaged polymer samples. (author)
RBS characterisation of SrxBa1-xNb2O6 (SBN) thin films obtained by laser deposition
International Nuclear Information System (INIS)
Pantelica, D.; Petris, M.; Negoita, F.; Dinescu, M.; Dinu, R.; Bauerle, D.; Pedarnig, J.; Bauer-Gogonea, S.; Bauer, S.
1999-01-01
Sr x Ba 1-x Nb 2 O 6 (SBN) is an attractive material for many applications such as nonvolatile ferroelectric random-access memories. SBN thin films have been grown by different techniques, such as solid source metalorganic chemical vapor deposition, liquid phase epitaxy, sol-gel synthesis and rf-sputter deposition. Pulsed laser deposition (PLD) is a relatively new growth technique which is ideally suited to the epitaxial growth of multicomponent oxides, because complex target compositions can be stoichiometrically reproduced at the substrate. Multilayer SBN/LSCO/TiN/MgO was prepared as follows: the (100) MgO substrate was glued onto a Ni holder with silver paint and the whole assembly was heated radiatively to the deposition temperatures in the range 450-800 deg. C. MgO substrates were annealed in oxygen at 1050 deg. C for 12 hours prior to the deposition of films. A UV-excimer laser (KrF, λ = 248 nm, t(FWHM) = 25 ns) operating at a repetition rate of 5 Hz was used for ablation. The laser fluence was varied between 0.8-2.6 J/cm 2 ; 4000 pulses were given for the deposition of LSCO film and 8000 pulses for the deposition of SBN film. The composition of the film was analysed using RBS. The measurements were conducted using a 7 Li ++ beam at 4.5 MeV provided by the Van de Graaff Tandem accelerator of IFIN-HH. An ordinary backscattering setup was used. The backscattered particles were detected using a passivated ion implanted silicon detector, placed at 145 angle with respect with the beam. The energy resolution for 7 Li at 4 MeV was about 30 keV. The sample surface was perpendicular to the beam direction. For the quantitative analysis of RBS spectra we used the code RUMP. A typical RBS spectrum of a SBN/LSCO/TiN/MgO sample is shown. A simulation is plotted on the same graph. The simulation curve fit well the experimental data. The profiles for different element are flat topped, indicating that the composition is constant with depth. The sharp high and low energy
International Nuclear Information System (INIS)
Han, I-H; Lee, I-S; Song, J-H; Lee, M-H; Park, J-C; Lee, G-H; Sun, X-D; Chung, S-M
2007-01-01
A thin calcium phosphate film was synthesized on both commercially pure Ti and Si wafers by electron beam evaporation of hydroxyapatite as an evaporant with simultaneous Ar ion beam bombardments. Silver was introduced into an ion-beam-assisted deposition of a calcium phosphate thin film for antimicrobial effect. The amount of incorporated silver ions was controlled by immersing calcium-phosphate-coated samples in different AgNO 3 concentrations, and Rutherford backscattering spectrometry (RBS) was employed to measure the amounts of substituted silver. The higher concentration of silver in the calcium phosphate film was more effective in reducing the bacteria of Escherichia coli ATCC 8739 and Streptococcus mutans OMZ 65 on contact with respect to controls
Energy Technology Data Exchange (ETDEWEB)
Han, I-H [Institute of Physics and Applied Physics, and Atomic-Scale Surface Science Research Center, Yonsei University, Seou1 120-749 (Korea, Republic of); Lee, I-S [Institute of Physics and Applied Physics, and Atomic-Scale Surface Science Research Center, Yonsei University, Seou1 120-749 (Korea, Republic of); Song, J-H [Advanced Analysis Center, Korea Institute of Science and Technology, Seoul 136-791 (Korea, Republic of); Lee, M-H [Department of Medical Engineering, Yonsei University, Seoul 120-752 (Korea, Republic of); Park, J-C [Department of Medical Engineering, Yonsei University, Seoul 120-752 (Korea, Republic of); Lee, G-H [Korea Institute of Machinery and Materials, Chang-Won 641-010 (Korea, Republic of); Sun, X-D [Department of Materials Science and Engineering, Tsinghua University, Beijing 100084 (China); Chung, S-M [Implantium Research Center, Seoul 135-879 (Korea, Republic of)
2007-09-15
A thin calcium phosphate film was synthesized on both commercially pure Ti and Si wafers by electron beam evaporation of hydroxyapatite as an evaporant with simultaneous Ar ion beam bombardments. Silver was introduced into an ion-beam-assisted deposition of a calcium phosphate thin film for antimicrobial effect. The amount of incorporated silver ions was controlled by immersing calcium-phosphate-coated samples in different AgNO{sub 3} concentrations, and Rutherford backscattering spectrometry (RBS) was employed to measure the amounts of substituted silver. The higher concentration of silver in the calcium phosphate film was more effective in reducing the bacteria of Escherichia coli ATCC 8739 and Streptococcus mutans OMZ 65 on contact with respect to controls.
La cobertura televisiva del fútbol en el Sur de Brasil y de España: RBS – Canal Sur
Directory of Open Access Journals (Sweden)
Joaquín M. Marín Montín
2002-01-01
Full Text Available Este artículo constituye parte de un trabajo comparativo entre Brasil y España, correspondiente al tratamiento que los medios de comunicación hacen del deporte. En él se analizan las claves que configuran el acercamiento a un mismo fenómeno sociológico, como es el fútbol, en dos realidades culturales diferentes. La programación deportiva de televisión llevada a cabo por Canal Sur en Andalucía y RBS en Rio Grande do Sul, así como la cobertura que ambas cadenas realizan en sus retransmisiones en directo del fútbol completan el análisis del presente estudio.ABSTRACTThis article is part of a comparative research between Brazil and Spain, about how the media treats the sports activities. Besides, this study analyses the keys of the same sociological phenomenon, which is football, in two different cultural realities. The broadcasting on television regarding sports events in Andalusia with Canal Sur, and Rio Grande do Sul with RBS. The live broadcasting of these channels completes the analysis of the present research.
Directory of Open Access Journals (Sweden)
Rakia Ben Salem
2016-06-01
Full Text Available Bacillus licheniformis RBS 5 was isolated from thermal spring in Tunisia. The isolate coproduce α-amylase and protease enzymes. The α-amylase activity showed an optimal activity at approximately 65°C and in wide pH interval ranging from 4 to 9. This enzyme was stable over the range of 45 to 70°C after 30 min of incubation and in the pH range of 8 to 10. Protease activity was optimal; at 80°C, pH 12. This enzyme was stable until 60°C over the pH range of 10 to 12. EDTA at concentration of 5 mM reduces slightly both activities evoking the serine alkaline protease. Cationic ions (Ca2+, Cu2+, Zn2+, and Mg 2+ have an inhibition effect on α-amylase. However, protease activity was enhanced by Ca2+, Cu2+ and Mg 2+; the other cations reduce slightly the proteolytic activity. SDS and H2O2 were found as inhibitors for both activities whereas Triton X-100 and perfume have no effect. Taken together, these traits make protease activity of B. licheniformis RBS 5 as efficient for use in detergent industry.
International Nuclear Information System (INIS)
Barradas, N.P.; Wendler, E.; Jeynes, C.; Summers, S.; Reehal, H.S.; Summers, S.
1999-01-01
Full text: Hydrogenated amorphous silicon films are deposited by CVD onto insulating (silica) substrates for the fabrication of solar cells. 1.5MeV 4 He ERD/RBS is applied to the films, and a self consistent depth profile of Si and H using the simulated annealing (SA) algorithm was obtained for each sample. The analytical procedure is described in detail, and the confidence limits of the profiles are obtained using the Markov Chain Monte Carlo method which is a natural extension of the SA algorithm. We show how the results are of great benefit to the growers
Directory of Open Access Journals (Sweden)
Maria Berenice da Costa Machado
2007-08-01
Full Text Available Para bem refletir sobre um jornal, no caso Zero Hora (ZH, de Porto Alegre, seria necessário, também, resgatar a história da sua controladora, a Rede Brasil Sul (RBS. O exercício fez emergir muitas contradições entre o código normativo do diário e a trajetória do Grupo de comunicação. Oito desses episódios trazemos para o diálogo neste estudo: o uso indiscriminado de nomes e siglas, dos espaços de expressão das opiniões, os cruzamentos do jornalismo – editorial – com a publicidade – comercial –, os desencontros de datas, a estrutura monopolística, os valores propagados, a relação com as pessoas e a parceria com a Rede Globo. Nossa hipótese é de que está na gênese da RBS (e de ZH a “vocação” para o contraditório. PALAVRAS-CHAVE: Zero Hora. Rede Brasil Sul. História. Contradições.
Silver surface enrichment controlled by simultaneous RBS for reliable PIXE analysis of ancient coins
International Nuclear Information System (INIS)
Beck, L.; Alloin, E.; Berthier, C.; Reveillon, S.; Costa, V.
2008-01-01
Evidence of silver surface enrichment of ancient silver-copper coins has been pointed out in the past years. Surface enrichment can be fortuitous or intentional. In this paper, we have investigated the cleaning procedures usually performed after excavation or in museums. We have shown that chemicals or commercial products routinely used dissolve preferentially the copper phase and consequently contribute to the silver surface enrichment. As a result, surface analyses such as PIXE or XRF can be strongly affected by this effect. By using simultaneously RBS and PIXE, it is possible to check through the silver surface enrichment and then select the reliable measurements, characteristic of the bulk composition. Results on coins recently discovered and mechanically or chemically cleaned are presented
Directory of Open Access Journals (Sweden)
A.L. Sagula
2017-12-01
Full Text Available A cama de frango gerada no processo produtivo das aves demonstra grande potencial para a obtenção de energia com o uso de biodigestores, porém é preciso que ela apresente algumas condições como separação de sólidos, para facilitar o processo. Objetivou-se neste trabalho avaliar a produção de biogás no processo de biodigestão anaeróbia da cama de frango com separação de sólidos, em diferentes diluições, com e sem utilização de 20% de reciclo (biofertilizante em sistema batelada de abastecimento. Foram utilizados 24 biodigestores batelada, com capacidade de 2L de substrato em fermentação. O equipamento utilizado para processamento da cama de frango foi uma bomba trituradora que homogeneíza e tritura a cama em partículas menores para facilitar e melhorar a eficiência na biodigestão. Para a separação da fração sólida foi utilizada uma peneira vibratória com malha de 1mm. Foram estudadas as diluições 1:8, 1:10 e 1:12 e 20% de reciclo em substituição a água. O tratamento cama de frango na diluição 1:8 foi o que apresentou maior redução de sólidos voláteis (72,76% em relação aos outros tratamentos. O tratamento com reciclo na diluição 1:8 foi o que apresentou maior produção de biogás com valor médio de 0,0328 m3, em relação aos demais tratamentos. Conclui-se que a utilização do reciclo não interfere e provoca aumento na produção de biogás.
International Nuclear Information System (INIS)
Mendez U, I.; Tenorio, D.; Galvan, J.L.
2000-01-01
This work has the objective of determining by means of the utilization of nuclear techniques (PIXE and RBS) the composition and the alloy type of diverse aztec ornaments corresponding to Post classic period, they were manufactured principally with copper and gold such as bells, beads and disks; all they belonging at 9 oblations of Templo Mayor of Tenochtitlan. It is presented here briefly the historical and archaeological antecedents of the devices as well as the analytical methods for conclude with the results obtained. (Author)
RBS and NRA damage analysis on PFA films bombarded with hydrogen
Energy Technology Data Exchange (ETDEWEB)
Parada, Marco A.; Petchevist, Paulo C.D.; Minamisawa, Renato A.; Almeida, Adelaide de [Sao Paulo Univ., SP (Brazil). Inst. de Fisica]. E-mail: dalmeida@ffclrp.usp.br; Muntele, Claudiu I.; Zimmerman, Robert L.; Ila, Daryush [A and M University, Normal, AL (United States). Center for Irradiation of Materials]. E-mail: ila@cim.aamu.edu
2005-07-01
The fluoropolymer PFA (Tetrafluoroethylene-per-fluoromethoxy ethylene) is a conventional thermoplastic used in civil engineering applications such as anti-adherent coatings and concrete additives. It is also candidate materials for radiation dosimetry with applications in medical physics. When such a polymer is exposed to ionizing radiation, it can suffers damages that depend on the type, energy, and intensity of the radiation. We present results on the damage caused by 1 MeV protons at fluences of 10{sup 13}, 10{sup 14}, 10{sup 15}, and 10{sup 16} protons/cm{sup 2}. The energy deposited during such hydrogen bombardment breaks the polymeric chains with the release of fluorine in amounts directly proportional to the amount of deposited energy. Virgin samples were first analyzed by RBS. Subsequent damage was then profiled by monitoring the alpha emission spectrum, resulting from the nuclear reaction: {sup 19}F(p,{alpha}{gamma}){sup 16}O induced by 1.38 MeV protons on the remaining fluorine content of damaged polymer samples. (author)
An RBS study of thin PLD and MOCVD strontium copper oxide layers
Energy Technology Data Exchange (ETDEWEB)
Kantor, Z. [Institute of Physics, University of Pannonia, H-8200 Veszprem (Hungary); Papadopoulou, E.L.; Aperathitis, E. [Inst. Electronic Struture and Laser, Foundation for Research and Technology - Hellas, P.O. Box 1527, Heraklion 71110 (Greece); Deschanvres, J.-L. [LMPG INP Grenoble-Minatec, BP 257, 38016 Grenoble Cedex 1 (France); Somogyi, K. [MicroVacuum Ltd., Kerekgyarto u.: 10, H-1147 Budapest (Hungary)], E-mail: karoly.somogyi@microvacuum.com; Szendro, I. [MicroVacuum Ltd., Kerekgyarto u.: 10, H-1147 Budapest (Hungary)
2008-09-30
Strontium copper oxide (SCO) has been studied as p-type transparent (VIS) conductive oxide material. Also theoretical studies suggested p-type conductivity of the SrCu{sub 2}O{sub 2} composition. SCO thin layers, with thicknesses of 30-2000 nm, were deposited on glass and silicon substrates both by pulsed laser deposition (PLD) and by MOCVD method. The as-grown layers showed high electrical resistance. Due to an annealing process, the resistivity significantly decreased and the layers showed p-type conductivity. Optical transparency measured on samples grown on glass substrates was found about or above 80%, including also thickness dependence. RBS measurements were applied for the determination of the chemical composition profile of the layers. A comparison revealed some specific differences between as-grown and annealed PLD samples. Due to the annealing, the ratio of oxide phases was changed and a vertical inhomogeneity in chemical composition was observed. Our measurements revealed also the influence of the deposition technique and of the substrate.
Directory of Open Access Journals (Sweden)
Matheus Wink
2016-10-01
Full Text Available Três configurações para operar em batelada sistemas integrados que evoluíram para Reatores Anaeróbios + Microalgas + Wetlands Construídos de Fluxo Vertical (RA + MA + WCFV foram investigadas neste trabalho, tendo as configurações as seguintes características: combinação de tanque de MA com 90L de volume útil, dotado de recirculação interna em cone de acrílico e externa com tanque de 20L, também em acrílico, sendo integrado com WCFV com tempo de detenção hidráulico (TDH de 3 dias com a macrófita Hymenachne grumosa. A configuração do sistema RAs +MA + WCFV vem em operação nos últimos 8 meses, mostrando reduções totais de N-NH4+ (com concentração inicial de 68 mg L-1 , associando 50% de redução de DQO e 70% de fósforo total. Melhorias para o controle de remoção de algas residuais devem ser feitas para aplicação do WCFV, especialmente quanto a carga volumétrica, que deverá ser com até 20 cm dia-1. Para continuidade da evolução foram considerados que devem ser pesquisados os seguintes aspectos: impossibilidade de operação do sistema em fluxo contínuo; drenagem do sistema de lodo não permite sua remoção completa nos Reatores Anaeróbios (RAs e impossibilidade de recarga simultânea dos sistemas.
RBS and NRA of cobalt oxide thin films prepared by the sol-gel process
International Nuclear Information System (INIS)
Andrade, E.; Huerta, L.; Pineda, J.C.; Zavala, E.P.; Barrera, E.; Rocha, M. F.; Vargas, C.A.
2001-01-01
This work presents a study of cobalt oxide thin films produced by the sol-gel process on aluminum and glass substrates. These films have been analyzed using two ion beam analysis (IBA) techniques: a) a standard RBS 4 He 2 MeV and b) nuclear reaction analysis (NRA) using a 1 MeV deuterium beam. The 12 C(d,p 0 ) 13 C nuclear reaction provides information that carbon is incorporated into the film structure, which could be associated to the sinterization film process. Other film measurements such as optical properties, XRD, and SEM were performed in order to complement the IBA analysis. The results show that cobalt oxide film coatings prepared by this technique have good optical properties as solar absorbers and potential uses in solar energy applications
Isaure, M. P.; Laboudigue, A.; Manceau, A.; Sarret, G.; Tiffreau, C.; Trocellier, P.
2001-07-01
Depositing dredged sediments on soils is usual but it is a hazardous practice for the local environment when these sediments are polluted by heavy metals. This chemical hazard can be assessed by determining the speciation of metals. In this study, slags highly polluted with Zn and originated from a contaminated dredged sediment were investigated. Zn speciation was studied by laterally resolved techniques such as μ-particle induced X-ray emission (μ-PIXE), μ-Rutherford backscattering spectrometry (μ-RBS), μ-extended X-ray absorption fine structure (μ-EXAFS), and bulk analyses such as powder EXAFS spectroscopy. μ-PIXE and μ-RBS results showed that high concentrations of Zn were associated with S in localised areas at the surface of the slags while moderate amounts of Zn were mainly associated with Fe in the matrix. EXAFS results allowed to identify ZnS and Zn sorbed on ferrihydrite (5Fe 2O 3·9H 2O), proxy for iron oxy-hydroxides, as the main Zn-bearing phases. The occurrence of this Zn-iron oxy-hydroxide is interpreted as a mobilisation of Zn released from ZnS oxidation.
International Nuclear Information System (INIS)
Isaure, M.P.; Laboudigue, A.; Manceau, A.; Sarret, G.; Tiffreau, C.; Trocellier, P.
2001-01-01
Depositing dredged sediments on soils is usual but it is a hazardous practice for the local environment when these sediments are polluted by heavy metals. This chemical hazard can be assessed by determining the speciation of metals. In this study, slags highly polluted with Zn and originated from a contaminated dredged sediment were investigated. Zn speciation was studied by laterally resolved techniques such as μ-particle induced X-ray emission (μ-PIXE), μ-Rutherford backscattering spectrometry (μ-RBS), μ-extended X-ray absorption fine structure (μ-EXAFS), and bulk analyses such as powder EXAFS spectroscopy. μ-PIXE and μ-RBS results showed that high concentrations of Zn were associated with S in localised areas at the surface of the slags while moderate amounts of Zn were mainly associated with Fe in the matrix. EXAFS results allowed to identify ZnS and Zn sorbed on ferrihydrite (5Fe 2 O 3 ·9H 2 O), proxy for iron oxy-hydroxides, as the main Zn-bearing phases. The occurrence of this Zn-iron oxy-hydroxide is interpreted as a mobilisation of Zn released from ZnS oxidation
RBS/channeling study of buried Ge quantum dots grown in a Si layer
International Nuclear Information System (INIS)
Fonseca, A.; Alves, E.; Barradas, N.P.; Leitao, J.P.; Sobolev, N.A.; Carmo, M.C.; Nikiforov, A.I.; Presting, H.
2006-01-01
In last decades we have been assisting to a crescent importance of low dimensional systems for the fabrication of nano- and opto-electronic devices. Ge quantum dots (QDs) are well suited for fulfilling these requirements. In this work we present and discuss Ge/Si multilayer and single layer samples grown by molecular beam epitaxy. RBS/channeling results reveal the evidence for the presence of Ge QD for the thickest (with 1 ML of SiO 2 and 0.9 nm of Ge) single layer sample. On the other hand Ge atoms are fully substitutional incorporated in the Si matrix for the thinner sample, excluding the formation of Ge QDs. Multilayer sample shows an angular deviation of the Ge curve (-0.48 o ) with respect to the Si ones, indicating the compressive strain of the films. A tetragonal distortion of (1.78 ± 0.19%) was calculated
Application of ion implantation RBS to the study of electrocatalysis
International Nuclear Information System (INIS)
Kelly, E.J.; Vallet, C.E.; White, C.W.
1990-01-01
Ir-implanted titanium near-surface alloys were prepared by ion implantation, characterized (Ir concentration/depth profiles) by Rutherford backscattering (RBS), and subsequently anodically oxidized to form electrocatalytically active Ir x Ti 1-x O 2 /Ti electrodes. The electrochemical behavior of the metallic-like Ir 4 Ti 1-x O 2 /Ti electrodes in acidic chloride, sulfate, and perchlorate solutions was investigated, and the results compared with those previously obtained with similarly prepared Ru x Ti 1-x O 2 /Ti electrodes. For both electrodes, M x Ti 1-x O 2 /Ti (M equals Ir or Ru), the Tafel slope for the Cl 2 evolution reaction is 40 mV, i.e.,δE/δlog i equals 2.303 (2RT/3F). The reaction order (n) with respect to chloride ion concentration δlogi/δlog[Cl - ] + 1, where K 9 equals 54.9 dm 3 mol -1 for Ir x Ti 1-x O 2 /Ti and K 9 equals 40 dm 3 mol -1 for Ru x Ti 1-x O 2 /Ti. A modified Volmer-Heyrovsky mechanism, one in which the role of absorbed chloride ions is taken into account, is shown to be consistent with aforementioned diagnostic parameters
International Nuclear Information System (INIS)
Bethge, K.; Meyer, J.D.; Michelmann, R.; Krauskopf, J.
1992-01-01
By means of the Rutherford backscattering analysis evidence is given of an inhomogeneous depth distribution of the elements C, O, F, Na, Mg, Al, Si, P, S, Cl, Ca, Ti, Cr, Fe, Ni in pBN (pyrolytic boron nitride) materials of crucibles. This inhomogenous distribution is observed both at the original surface and at the surface of inner cracks. In addition, the distribution of the elements is found to differ depending on the spots chosen for analysis. The RBS measurements alone do not yield information on the volume concentration of the elements. (orig.) With 2 refs [de
Study of multiple scattering effects in heavy ion RBS
Energy Technology Data Exchange (ETDEWEB)
Fang, Z.; O`Connor, D.J. [Newcastle Univ., NSW (Australia). Dept. of Physics
1996-12-31
Multiple scattering effect is normally neglected in conventional Rutherford Backscattering (RBS) analysis. The backscattered particle yield normally agrees well with the theory based on the single scattering model. However, when heavy incident ions are used such as in heavy ion Rutherford backscattering (HIRBS), or the incident ion energy is reduced, multiple scattering effect starts to play a role in the analysis. In this paper, the experimental data of 6MeV C ions backscattered from a Au target are presented. In measured time of flight spectrum a small step in front of the Au high energy edge is observed. The high energy edge of the step is about 3.4 ns ahead of the Au signal which corresponds to an energy {approx} 300 keV higher than the 135 degree single scattering energy. This value coincides with the double scattering energy of C ion undergoes two consecutive 67.5 degree scattering. Efforts made to investigate the origin of the high energy step observed lead to an Monte Carlo simulation aimed to reproduce the experimental spectrum on computer. As a large angle scattering event is a rare event, two consecutive large angle scattering is extremely hard to reproduce in a random simulation process. Thus, the simulation has not found a particle scattering into 130-140 deg with an energy higher than the single scattering energy. Obviously faster algorithms and a better physical model are necessary for a successful simulation. 16 refs., 3 figs.
Study of multiple scattering effects in heavy ion RBS
Energy Technology Data Exchange (ETDEWEB)
Fang, Z; O` Connor, D J [Newcastle Univ., NSW (Australia). Dept. of Physics
1997-12-31
Multiple scattering effect is normally neglected in conventional Rutherford Backscattering (RBS) analysis. The backscattered particle yield normally agrees well with the theory based on the single scattering model. However, when heavy incident ions are used such as in heavy ion Rutherford backscattering (HIRBS), or the incident ion energy is reduced, multiple scattering effect starts to play a role in the analysis. In this paper, the experimental data of 6MeV C ions backscattered from a Au target are presented. In measured time of flight spectrum a small step in front of the Au high energy edge is observed. The high energy edge of the step is about 3.4 ns ahead of the Au signal which corresponds to an energy {approx} 300 keV higher than the 135 degree single scattering energy. This value coincides with the double scattering energy of C ion undergoes two consecutive 67.5 degree scattering. Efforts made to investigate the origin of the high energy step observed lead to an Monte Carlo simulation aimed to reproduce the experimental spectrum on computer. As a large angle scattering event is a rare event, two consecutive large angle scattering is extremely hard to reproduce in a random simulation process. Thus, the simulation has not found a particle scattering into 130-140 deg with an energy higher than the single scattering energy. Obviously faster algorithms and a better physical model are necessary for a successful simulation. 16 refs., 3 figs.
RBS cross-section of MeV ions channeling in crystals from quantum theory
International Nuclear Information System (INIS)
Den Besten, J.L.; Jamieson, D.N.; Spizzirri, P.G.; Allen, L.J.
1999-01-01
We present an alternative approach to describing Rutherford Backscattered (RBS) angular yield scans. The Bloch wave method to formulate the cross-section is a fundamental approach originating from Schrodinger's equation. This quantum formulation is often used when describing various aspects of electron diffraction including Backscattering, EDX and TEM but has seen little application to the very short wavelength regime of MeV ions. It offers several significant advantages. Great freedom is given to crystal properties and structure in the theory allowing a fundamental insight into the channeling phenomena and hence the crystal itself. We have calculated both planar and axial channeling scans and these maps are shown to be in good agreement to their experimental counterparts. There is excellent correlation between the theoretical and experimental results for both χ min and Ψ 1/2 . Further investigation is required into the area of absorption or dechanneling. This phenomenon requires different mechanisms for electron and ion scattering differ greatly
Authenticity determination of Ag-Cu Lebanese coins using combined PIXE and RBS techniques
International Nuclear Information System (INIS)
Roumie, M; Nsouli, B; Assafiri, Y
2012-01-01
A set of silver-copper coins were investigated for their stochiometry in order to check any possible counterfeit. The studied coins are 50 Lebanese Piastres and are relatively recent, minted in 1952. They are supposed to have nominal concentration of 60 wt.% Ag and 40 wt.% Cu. In this work, it is shown the utility and capability of combining PIXE (particle induced X-ray emission) and RBS (Rutherford backscattering spectrometry) techniques to determine the elemental content and check the presence, if any, of surface layer. For this aim, 3 MeV proton beam and Al funny filter, used as x-ray absorber, were used to determine the elemental composition, based on the emission and detection of the characteristic x-rays of the corresponding elements. The first PIXE results of the supposed bulky coins showed an excess of silver composition vs. copper. In addition, the experimental protocol was checked by analyzing some other coins of known composition, such as 1-euro and 2-euro coins.
Study of ancient Islamic gilded pieces combining PIXE-RBS on external microprobe with sem images
International Nuclear Information System (INIS)
Ynsa, M.D.; Gutierrez, P.C.; Enguita, O.; Chamon, J.; Pardo, A.I.; Arroyo, M.; Barrio, J.; Gomez-Morilla, I.; Ferretti, M.; Climent-Font, A.
2008-01-01
Numerous metallic objects with very aesthetic and technological qualities have been recovered by archaeological excavations. Adequate processes of restoration and conservation treatments require the accurate determination of the elemental composition and distribution within the objects, as well as the identification of the nature and distribution of the corrosion products. Ideally the identification method should cause no alteration in the sample. In this work, different archaeological pieces with a gilded look have been characterized using simultaneously PIXE and RBS at the CMAM external microprobe in order to study the gilding metalworking done in the Iberian Peninsula during the Middle Ages. The gold layer thickness and its elemental concentrations of Ag, Au and Hg were determined by both techniques and compared with the scanning electron microscopy images obtained for some fragments of pieces. (orig.)
Directory of Open Access Journals (Sweden)
Cristiane de A. N Xavier
2010-04-01
Full Text Available Objetivou-se avaliar a adição de inóculo na biodigestão anaeróbia de dejetos de vacas leiteiras reciclados em biodigestores bateladas pela quantidade de biogás produzida, pela redução dos sólidos voláteis e pelos potenciais de produção de biogás para obtenção de parâmetros de dimensionamento. Foram utilizados 12 biodigestores bateladas de campo de 60 L, cujos substratos continham dejetos de vacas leiteiras, água e quatro adições de inóculo (0; 20; 30 e 40% v/v. Adotaram-se tempos médios de retenção hidráulica de 75 e 150 dias para os tratamentos contendo inóculo e sem inóculo, respectivamente, nos períodos intermediário, chuvoso e seco do ano. Maiores produções de biogás ocorreram com maiores temperaturas médias do ar. Maiores potenciais de produção de biogás foram obtidas com uso de 40% de inóculo, de 0,07 m³ de biogás por kg de dejetos, com a utilização rápida do biogás, a partir de quatro dias. Tempos de retenção hidráulica de 45 dias podem ser adotados, o que reduz o volume do biodigestor e custos de implantação.The aim of this work was to evaluate the inoculum addition on the anaerobic digestion of dairy cattle manure recycled in batch digesters by biogas yield, volatile solids reduction and biogas potential production to obtain design parameters. Twelve field batch digesters (60 L each filled with dairy catlle manure, water and four different inoculum additions (0, 20, 30 and 40%, v/v were used. Average times of hydraulic retention of 75 and 150 days were adopted for treatments with and without inoculum, respectively, during three periods of the year (intermediary, rainy and dry. The greatest daily biogas yields occurred in higher room temperatures (rainy period. Higher biogas potential production was obtained by using 40% of inoculum, 0.07 m³ kg-1 manure, with rapid use of biogas from the four days. Times of hydraulic retention of 45 days may be adopted, which reduces the volume of the
Directory of Open Access Journals (Sweden)
Arnaldo Sarti
2008-03-01
Full Text Available Avaliou-se o potencial de uso reator anaeróbio operado em bateladas seqüenciais com biomassa imobilizada (ASBBR, em escala piloto, no tratamento de água residuária industrial contendo elevadas concentrações de sulfato. O ASBBR, com volume total de 1.2 m³, foi preenchido com carvão mineral como meio suporte para imobilização da biomassa (leito fixo. Foram aplicadas cargas de 0,15; 0,30; 0,65; 1,30 e 1,90 kg SO4-2/ciclo (ou batelada com duração de 48 h, correspondendo, respectivamente, às concentrações de sulfato no afluente de 0,25; 0,50; 1,0; 2,0 e 3,0 gSO4-2.l-1. Utilizou-se etanol como doador de elétrons para a redução do sulfato. O reator foi operado à temperatura ambiente (29±8ºC, tendo sido obtidas eficiências médias na redução de sulfato entre 88 e 92% em 92 ciclos (275 dias. Os resultados obtidos permitem concluir que o uso de reatores ASBBR constitui-se em alternativa eficiente para a remoção de sulfatos de águas residuárias com características semelhantes às utilizadas neste trabalho.The potential use of an anaerobic sequencing batch biofilm reactor (ASBBR in pilot-scale for the treatment of a sulfate-rich industrial wastewater was evaluated. The pilot 1.2 m³ ASBBR reactor was filled with mineral coal for biomass immobilization (fixed film. The sulfate loading rates applied were 0.15; 0.30; 0.65; 1.30 and 1.90 kg SO4-2/cycle (or batch. Each cycle lasted 48 h. The influent concentrations were, respectively, 0.25; 0.50; 1.0; 2.0 and 3.0 gSO4-2.l-1. Ethanol was used as electron donor for sulfate reduction. The reactor operated at ambient temperature (29±8ºC, and the mean efficiencies of sulfate removal were in the range 88 to 92% in the 92 run cycles. The total operating period comprised 275 days. Based on the results obtained in this research, it could be concluded that the ASBBR can be an efficient alternative for the removal of sulfate from other industrial wastewaters with similar characteristics.
RBS and XPS analyses of the composite calcium phosphate coatings for biomedical applications
International Nuclear Information System (INIS)
Ide-Ektessabi, Ari; Yamaguchi, Tetsuro; Tanaka, Yoshikazu
2005-01-01
The calcium phosphate coatings on metallic implants are widely used for biomedical applications. The calcium phosphate coatings require mechanical strength, strong adhesion to the metallic implants, chemical stability and low dissolution into the human body fluid for stable functioning in the corrosive environment of the human body. In this study, a novel approach for improving the calcium phosphate coatings is utilized by adding trace metallic element into the coatings. We focused on teeth enamel, which is the hardest calcium phosphate tissue in the human body. Zn concentration increases exponentially from the interior to the surface of the enamel. As the Zn concentration increases, so the local hardness increases. Our previous studies suggest that Zn has influence on the hardness and other properties of enamel, calcium phosphate tissue. Calcium phosphate coatings doped with Zn was fabricated and characterized. The atomic composition and chemical state were investigated by using Rutherford backscattering spectroscopy (RBS) and X-ray photoelectron spectrometer (XPS), respectively. Scratch test was also carried out for measuring the adhesion of the coatings
International Nuclear Information System (INIS)
Pineda-Vargas, C.A.; Eisa, M.E.M.; Rodgers, A.L.
2009-01-01
The micro-PIXE and RBS techniques are used to investigate the matrix as well as the trace elemental composition of calcium-rich human tissues on a microscopic scale. This paper deals with the spatial distribution of trace metals in hard human tissues such as kidney stone concretions, undertaken at the nuclear microprobe (NMP) facility. Relevant information about ion beam techniques used for material characterization will be discussed. Mapping correlation between different trace metals to extract information related to micro-regions composition will be illustrated with an application using proton energies of 1.5 and 3.0 MeV and applied to a comparative study for human kidney stone concretions nucleation region analysis from two different population groups (Sudan and South Africa)
Directory of Open Access Journals (Sweden)
Marcelo Mazzola
2005-06-01
Full Text Available Neste trabalho avaliou-se o desempenho de um Reator Anaeróbio Compartimentado (RAC de duas câmaras em série, seguido de três leitos cultivados (constructed wetlands de fluxo vertical por batelada. A unidade experimental, em escala piloto, foi instalada na Faculdade de Engenharia Agrícola - UNICAMP, Campinas, SP, Brasil. O volume total do reator era de 2,3 m³ (TDH de 12 h. O efluente do RAC foi tratado em três leitos, dois cultivados com macrófitas (gêneros Typha sp. e Eleocharis sp. e um utilizado como controle (não cultivado. Os leitos, com 2,0 m³ cada um e brita #2 (24 - 35 mm como meio suporte, operaram com fluxo vertical por batelada (com tempos de reação de 24, 48, 72 e 96 h. Na avaliação do RAC, observou-se tendência de estabilização dos parâmetros pH, alcalinidade, ácidos voláteis, sólidos sedimentáveis e suspensos totais, porém a remoção de DQO revelou-se limitada (50%. Nos leitos cultivados o aumento do tempo de reação (até 72 h foi acompanhado pelo aumento de remoção de turbidez, DQO, fósforo e nitrato. O melhor desempenho de remoção de fósforo total foi obtido no leito vegetado com Typha sp para os tempos de 72 e 96 h, respectivamente, de 30 e 25%.This study evaluated the performance of vertical constructed wetlands treating effluent of anaerobic baffled reactor. The anaerobic reactor volume was 2.3 m³; it was operated with daily flow of 4.6 m³ (12 hours Hydraulic Retention Time. The reactor effluent was split into three wetlands beds, two of them cultivated with macrophytes (Typha sp. and Eleocharis sp., and one control. The wetlands were operated as a batch reactor. The medium utilized was gravel, the size ranging from 7 to 12 mm. The reaction time for each cycle (filling - reaction - drainage was 24, 48, 72, and 96 h. The anaerobic reactor achieved the following removal rates: settable solids, 93%; suspended solids, 80%; and COD 39%. The increase in reaction time (up to 72 h for the constructed
Directory of Open Access Journals (Sweden)
Luis Gimeno Latre
2000-12-01
Full Text Available Neste artigo, considera-se o problema de programação da produção a curto prazo em plantas químicas multipropósito operando em batelada, em que a produção da planta é determinada pela demanda a ser atendida. Nesta situação, a capacidade da planta não está bem definida porque depende do mix de produção. Propõe-se uma fase de planejamento que tem como objetivo a determinação do número de bateladas de cada tarefa necessárias para atender a produção, bem como a respectiva janela de tempo de processamento. Estas janelas permitem a análise do carregamento dos processadores e da factibilidade do plano, ou seja, o atendimento das datas de entrega, através de ferramentas desenvolvidas na área de Busca Orientada por Restrições. Esta análise é feita para uma atribuição fixa de tarefas a processadores introduzida pelo usuário. O sistema fornece informações para orientar o usuário na criação de diferentes cenários de atribuição. O resultado da fase de planejamento é formado por um conjunto de janelas de processamento que diminuem sensivelmente a dimensão do problema de programação da produção, como é discutido para duas abordagens: programação mista (Mixed Integer Linear Programming - MILP e Simulated Annealing.Short term scheduling in multipurpose batch chemical plants is specially complicated by the fact that plant capacity is not well defined due to the multipurpose nature of equipment units, allowing different routes. In order to reduce problem dimension, as well as allowing to analyze problem feasibility prior to spending time solving a large scheduling problem, a planning phase is proposed. At this level the objective is to determine a set of processing time windows for the batches necessary to fulfill final products' demand. The time windows allow analyzing equipment units load and plan feasibility in terms of satisfying final products due dates. To accomplish those tools from the area of Constrained
Study of new sheep bone and Zn/Ca ratio around TiAlV screw: PIXE RBS analysis
Guibert, G.; Munnik, F.; Langhoff, J. D.; Von Rechenberg, B.; Buffat, Ph. A.; Laub, D.; Faber, L.; Ducret, F.; Gerber, I.; Mikhailov, S.
2008-03-01
This study reports on in vivo particle induced X-ray emission (PIXE) measurements combined with Rutherford backscattering spectroscopy (RBS) analyses of new remodeled sheep bone formed around TiAlV screws. The implants (screws) were anodized by a modified TiMax™ process. The interface between the implant and the bone was carefully investigated. [Zn]/[Ca] in-depth composition profiles as well as Ca, Fe elemental maps were recorded. The thickness of new bone formed around the screw reached 300-400 μm. Osteon and Osteoid phases were identified in the new bone. A higher [Zn]/[Ca] ratio was observed in the new bone as compared to the mature bone. Blood vessels were observed in the bone in close contact with the screw. This study shows the potential of ion beam analysis for biological and biomedical characterization.
Study of new sheep bone and Zn/Ca ratio around TiAlV screw: PIXE-RBS analysis
International Nuclear Information System (INIS)
Guibert, G.; Munnik, F.; Langhoff, J.D.; Von Rechenberg, B.; Buffat, Ph.A.; Laub, D.; Faber, L.; Ducret, F.; Gerber, I.; Mikhailov, S.
2008-01-01
This study reports on in vivo particle induced X-ray emission (PIXE) measurements combined with Rutherford backscattering spectroscopy (RBS) analyses of new remodeled sheep bone formed around TiAlV screws. The implants (screws) were anodized by a modified TiMax TM process. The interface between the implant and the bone was carefully investigated. [Zn]/[Ca] in-depth composition profiles as well as Ca, Fe elemental maps were recorded. The thickness of new bone formed around the screw reached 300-400 μm. Osteon and Osteoid phases were identified in the new bone. A higher [Zn]/[Ca] ratio was observed in the new bone as compared to the mature bone. Blood vessels were observed in the bone in close contact with the screw. This study shows the potential of ion beam analysis for biological and biomedical characterization
Cashing in on Tar Sands. RBS, UK banks and Canada's 'blood oil'
Energy Technology Data Exchange (ETDEWEB)
Evans, M.; Howarth, C.; Kellay, A.; Laboucan, B.J.; Mercredi, M.; Minio-Paluelo, M.; Schling, H.; Smith, K.; Thomas-Muller, C.; Wood, A.
2010-03-15
Tar sands extraction in Canada is devastating Indigenous communities, wildlife and vast areas of boreal forests, as well as being many times more carbon-intensive to produce than 'conventional' oil. The higher oil prices in recent years have meant that it's become a more attractive prospect for oil companies to expand their operations in the costly process of obtaining and processing the thick bitumen into a usable form. It's estimated that the industry is looking for a capital investment of 120-220 billion USD over the next 20 years to build the new pipelines, mines, refineries and upgraders that are necessary to sustain the boom. This report looks at the role that UK banks are playing in providing the necessary capital, and how RBS (Royal Bank of Scotland), which is 84% owned by the UK public, has been the bank the most heavily involved in underwriting loans to companies engaging in tar sands extraction.
Directory of Open Access Journals (Sweden)
Luiz Fernando de Abreu Cybis
2004-09-01
Full Text Available Este trabalho tem como objetivo avaliar a eficiência e a estabilidade do RSB na remoção de nitrogênio no tratamento de esgoto doméstico com DQO baixa. O reator utilizado no experimento possui volume de trabalho de 600 L e trata 1200 L/d de esgoto bruto em três bateladas de oito horas. A partir dos dados obtidos na pesquisa, observou-se que o reator seqüencial em batelada possibilitou a remoção média de nitrogênio total igual a 88 % no tratamento de esgoto doméstico com DQO média de 257 mg/L. A remoção de DQO foi de 90 %, a média da alcalinidade total no efluente foi 72 mgCaCO3/L e o índice volumétrico de lodo médio ficou em 86 mL/g. Estes resultados indicam que é possível utilizar RSB para o tratamento de esgoto doméstico com matéria orgânica reduzida sem comprometer a qualidade do efluente, a remoção de nitrogênio e a estabilidade operacional do sistema.This work had the objective of evaluating the SBR efficiency and stability in the removal of nitrogen on the treatment of domestic sewage with low COD. The reactor used in the experiment has a working volume of 600 L, and treats 1200 L/d of raw sewage in three 8-hour cycles. From the data gathered during the research, it was realized that the SBR fostered an average removal of total nitrogen equal to 88% in the treatment of a domestic sewage with an average COD of 257 mg/L. The COD removal was 90%, the final effluent total alkalinity was 72 mgCaCO3/L, and the sludge volumetric index was 86 mL/g. The results indicate that is possible to use SBR for the treatment of domestic sewage with low organic matter without compromising the final effluent quality, the nitrogen removal ability, and the stability of the system.
RBS-study of GexSi1-x Compounds Formed by Variable Dose Ge Implantation into Si Wafers
Directory of Open Access Journals (Sweden)
Ramírez A.
2002-01-01
Full Text Available Amorphous and relaxed epitaxial GeSi films are prepared by Ge-implantation into Si(111 wafers of both 60 keV and 200 keV energetic Ge+-ions with appropriate dose, followed by post-implantation thermal annealing, comprising a single final annealing at a temperature of 900 °C. The implantation dose was varied between 10(14 and 10(17 atoms cm-2. Rutherford backscattering (RBS and channeling analysis was applied in order to explore the formation of a single crystalline Si-Ge compound layer, both prior and after the thermal treatment. The depth and the thickness of the implanted layer, as well as their molar composition and crystalline quality was determined, and it was found that a single crystalline Si-Ge alloy layer was created, with both depth and mole fraction depending on the ion energy and the ion dose.
Directory of Open Access Journals (Sweden)
Valderi D. Leite
2003-08-01
Full Text Available Em feiras livres e centrais de abastecimento são produzidas quantidades bastante significativas de resíduos sólidos, com características favoráveis ao aproveitamento integral em processo de bioestabilização anaeróbia. O processo de bioestabilização é realizado em reatores anaeróbios de batelada (RAB, com tempo de detenção de sólidos variando de 250 a 300 dias originando, como produtos finais, o biogás, com cerca de 60% de gás metano, além de composto orgânico parcialmente bioestabilizado. Neste trabalho, foram utilizados resíduos sólidos orgânicos tipicamente vegetais, advindos de centrais de abastecimento, feiras livres e lodo de esgoto sanitário. O sistema experimental utilizado era constituído basicamente por um reator anaeróbio de batelada, com capacidade unitária de 2200 litros, além de outros dispositivos complementares. O sistema experimental foi instalado e monitorado na Estação Experimental de Tratamento Biológico de Esgoto Sanitário, situada no Bairro do Tambor, na cidade de Campina Grande, Estado da Paraíba, no período de janeiro a setembro de 2001. No processo de monitoração foram realizadas caracterizações sistemáticas das frações sólidas, líquidas e gasosas. Após análise dos dados, ficou evidenciada a viabilidade desta alternativa de tratamento, restando ser investigada ainda a viabilidade econômica, quando comparada com outras alternativas tecnológicas de tratamento de resíduos sólidos orgânicos.Significant quantity of organic solid waste with favorable characteristics for integral utilization in anaerobic biostabilization is produced in free markets and supply centers. The process is conducted in anaerobic batch reactors (ABR, with detention time of solids varying from 250 to 300 days, producing biogas with about 60% of methane, besides the partially biostabilized organic compost as the final product. In this study, the organic solid waste used was typically of vegetables
Directory of Open Access Journals (Sweden)
Raquel Renan Jorge Borsari
2006-09-01
Full Text Available The aim of this study is to assess sugar cane juice and sucrose as substrates, the batch and fed batch processes and their interaction in the levan production using a complete factorial design. Zymomonas mobilis was cultivated in different sugar cane juice and sucrose concentrations in two fermentation processes at 25 °C for 20 h. A complete factorial design (2³ was used to analyze the effects of the type and concentration of the substrate, as well as the batch and fed batch processes. A complete second factorial design (2² was used to observe the importance of sugar cane juice. The results indicated that the batch process improved the levan production reaching 40.14 g/L. The addition of sugar cane juice was not statistically significant for levan formation, however sugar cane juice stimulated biomass, sorbitol and ethanol production. The best medium for levan production was 150 g/L sucrose in batch.O presente estudo avaliou caldo de cana de açúcar e sacarose como substratos e os processos batelada e batelada alimentada e suas interações na produção de levana. Zymomonas mobilis foi cultivada em diferentes concentrações de caldo de cana de açúcar e sacarose nos dois processos fermentativos a 25 °C por 20 h. Foi utilizado um delineamento fatorial completo (23 para analisar os efeitos do tipo e concentração de substratos e processos batelada e batelada alimentada. Um segundo delineamento fatorial completo (22 foi usado para confirmar a importância do caldo de cana de açúcar. Os resultados indicam que o processo batelada foi o melhor para a produção de levana, atingindo 40,14 g/L em 150 g/L de sacarose. A adição de caldo de cana de açúcar não foi estatisticamente significativa para formação de levana, porém o caldo estimulou a produção de biomassa, sorbitol e etanol.
Directory of Open Access Journals (Sweden)
Fernando Ferreira
Full Text Available Na última década multiplicaram-se as publicações e a utilização da cirurgia de controle de danos, resultando num número crescente de pacientes deixados com o abdome aberto (ou peritoneostomia. Uma das consequências nefastas do abdome aberto são as hérnias ventrais gigantes que resultam da impossibilidade de se fechar o abdome durante a internação hospitalar do paciente. Para minimizar esta sequela têm surgido na literatura diferentes tipos de abordagem. Para abordar este tópico, a reunião de revista "Telemedicina Baseada em Evidência - Cirurgia do Trauma e Emergência" (TBE-CiTE optou por não analisar sistemas comerciais de fechamento abdominal dinâmico, com exceção da terapia de pressão negativa ou vácuo. O grupo fez uma avaliação crítica dirigida de três artigos mais relevantes publicados recentemente sobre fechamento sequencial da parede abdominal (com tela ou sutura mais vácuo. Nesta avaliação foram incluídos dois estudos retrospectivos mais um estudo prospectivo. Baseados na análise crítica desses 3 estudos mais a discussão que contou com a participação de representantes de 6 Universidades e realizada via telemedicina, são feitas as seguintes recomendações: (1 a associação de terapia de pressão negativa com tração fascial constante mediada por tela ou sutura, ajustada periodicamente, parece ser uma ótima estratégia cirúrgica para o tratamento de peritoneostomias. (2 O fechamento abdominal primário dinâmico com sutura e mediada por tela parece ser mais econômico e eficiente do que deixar o paciente com uma hérnia gigante e planejar uma reconstrução complexa tardiamente. Novos estudos com grupos maiores de pacientes separados de acordo com as diferentes apresentações e doenças são necesários para definir qual o melhor método cirúrgico para o tratamento de peritoneostomias.
Evuri, Geetha Reddy; Rao, G. Srinivasa; Reddy, T. Ramasubba; Reddy, K. Srinivasa
2018-04-01
Pulse width modulation (PWM) based (a non-consistent) breaking system is used to keep the wheels from being bolted in the proposed antilock breaking system (ABS). Using this method a better hold of the street by wheels is possible and halting separations likewise diminish essentially particularly on precarious street surfaces like frosty or wet streets. The active vitality of the wheel is by and large lost amid braking as warmth because of grinding among brake cushions. This vitality can be recuperated using regenerative braking systems (RBS). In this strategy, the overabundance vitality is put away incidentally in capacitor banks before it gets changed over to warm vitality and is squandered. This framework delays the battery life by reviving the battery utilizing the put away vitality. Subsequently the mileage of the electric vehicle likewise increments as it can travel more separation in a solitary battery charge. These two techniques together help make electric vehicle vitality productive and more secure and less demanding to utilize subsequently anticipating and diminishing the quantity of mischance's.
International Nuclear Information System (INIS)
Calvo del Castillo, H.; Ruvalcaba, J.L.; Calderon, T.; Salinas Nolasco, M.F.; Mejia, L.M.; Perdigon, K.
2008-01-01
The coast of Guerrero Negro (Baja California) has been known for a long time by archaeologists for its shipwrecks. Archaeologists are recovering objects that come from sunken Spanish galleons in the colonial period, and reach the American coast in the frontier of the USA with Mexico. An enamelled metallic object was found next to the beach in Guerrero Negro. We have analysed the piece with proton induced X-ray emission (PIXE) and Rutherford backscattering (RBS) in an attempt to establish whether the object could come from one of the colonial shipwrecks and to valuate its cleaning process. Scanning electron microscopy (SEM) and energy dispersive X-ray spectrometry (EDS) have been also performed in three samples taken from the object in order to observe the heterogeneity of the material. The materials found revealed the presence of typical lead-glass enamels from with pigments such as cuprite (red), or lead-tin yellow used in colonial times. The metallic part consisted of brass. As for the cleaning process, the average efficiency considered as the weight% of chlorine removed, was of 83.4% for brass and 100% for enamels
Energy Technology Data Exchange (ETDEWEB)
Calvo del Castillo, H. [Departamento de Geologia y Geoquimica, Universidad Autonoma de Madrid (Spain); Instituto de Fisica, Universidad Nacional Autonoma de Mexico (Mexico); Centre Europeen d' Archeometrie - I.P.N.A.S., Universite de Liege, Allee du 6 Aout, 10 Bat-15, Sart Tilman, 4000-Liege 1 (Belgium)], E-mail: hcalvo@ulg.ac.be; Ruvalcaba, J.L. [Instituto de Fisica, Universidad Nacional Autonoma de Mexico (Mexico); Calderon, T. [Departamento de Geologia y Geoquimica, Universidad Autonoma de Madrid (Spain); Salinas Nolasco, M.F. [Coordinacion de Conservacion del Patrimonio Cultural, Instituto Nacional de Antropologia e Historia (Mexico); Mejia, L.M. [Direccion de Arqueologia Subacuatica, Instituto Nacional de Antropologia e Historia (Mexico); Perdigon, K. [Coordinacion de Conservacion del Patrimonio Cultural, Instituto Nacional de Antropologia e Historia (Mexico)
2008-05-15
The coast of Guerrero Negro (Baja California) has been known for a long time by archaeologists for its shipwrecks. Archaeologists are recovering objects that come from sunken Spanish galleons in the colonial period, and reach the American coast in the frontier of the USA with Mexico. An enamelled metallic object was found next to the beach in Guerrero Negro. We have analysed the piece with proton induced X-ray emission (PIXE) and Rutherford backscattering (RBS) in an attempt to establish whether the object could come from one of the colonial shipwrecks and to valuate its cleaning process. Scanning electron microscopy (SEM) and energy dispersive X-ray spectrometry (EDS) have been also performed in three samples taken from the object in order to observe the heterogeneity of the material. The materials found revealed the presence of typical lead-glass enamels from with pigments such as cuprite (red), or lead-tin yellow used in colonial times. The metallic part consisted of brass. As for the cleaning process, the average efficiency considered as the weight% of chlorine removed, was of 83.4% for brass and 100% for ename0008.
Desempeño de un reactor biológico secuencial (RBS en el tratamiento de aguas residuales domésticas
Directory of Open Access Journals (Sweden)
Carmen Cárdenas
2012-07-01
Full Text Available Título en ingles: performance of a sequencing Batch Reactor (SBR in the treatment of domestic sewage Resumen: Se estudió la remoción biológica de materia orgánica y nutrientes de un agua residual doméstica empleando un Reactor Biológico Secuencial (RBS a escala piloto. El estudio fue dividido en cuatro fases en las que se modifico la carga orgánica y la duración de las etapas anaerobia, aerobia y anoxica que conforman cada ciclo de tratamiento, considerando edades de lodo de 10 y 7,5 días. Durante las Fases I y II se operó el sistema con bajos valores de carga másica: 0,364 y 0,220 kg.DQO/Kg.SSV.dia, mientras que durante las Fases III y IV se emplearon cargas mayores: 0,665 y 0,737 kg.DQO/Kg.SSV.dia respectivamente. Los resultados obtenidos muestran que las mayores eficiencias de remoción de materia orgánica en términos de DBO se alcanzaron durante la Fases III (91% y IV (82%, con remoción de fósforo superior a 40%. En cuanto al proceso de nitrificación durante las Fases I y II se registraron tasas de 0,032 y 0,024 kg.N-NH3/kg.SSV.dia, esto debido al menor contenido de materia orgánica y a la baja relación DBO/NKT, mientras que durante las Fases III y IV estas fueron menores: 0,015 kg.N-NH3/kg.SSV.dia durante la Fase III y 0,020 kg.N-NH3/kg.SSV.dia en la Fase IV, sin embargo, fue en estas fases donde se alcanzaron los mayores niveles de desnitrificación durante la etapa anóxica, favorecido por una relación C/N adecuada, próxima de 4 kg.DBO/kg.N-NO3- y la presencia de un substrato de fácil biodegradación. Los resultados obtenidos muestran los RBS como una alternativa eficiente y viable en el tratamiento de aguas residuales domésticas Palabras clave: reactor biológico secuencial; nitrificación/desnitrificación; remoción biológica; edad de lodo. Abstract: It was studied the biological removal of organic matter and nutrients from domestic wastewater using a Sequential Biological Reactor (SBR at pilot scale. The study
Guibert, G.; Irigaray, J. L.; Moretto, Ph.; Sauvage, T.; Kemeny, J. L.; Cazenave, A.; Jallot, E.
2006-09-01
Implants used as biomaterials have to fulfill conditions of functionality, compatibility and sometimes bioactivity. There are four main families of biomaterials: metals and metal alloys, polymers, bioceramics and natural materials. Because of corrosion and friction in the human body, implants generate debris. This debris may develop toxicity, inflammation and prosthetic unsealing by osseous dissolution. Nature, size, morphology and amount of debris are the parameters influencing the tissue responses. In this paper, we characterised metallic contamination produced by knee prosthesis, composed with TiAl 6V 4 or Co-Cr-Mo alloys, into surrounding capsular tissue by depth migration, in vivo behaviour, content, size and nature of debris by PIXE (Particle Induced X-ray Emission) method associated with RBS (Rutherford Backscattering Spectroscopy). Debris distribution in the whole articulation is very heterogeneous. Debris migrates several thousand micrometers in tissues, with a characteristic decrease. Solid metallic particles of about micrometer size are found in the most polluted samples, in both alloys TiAl 6V 4 and Cr-Co-Mo. In the mean volume analysed by PIXE, the concentration mass ratios [Ti]/[V] and [Co]/[Cr] confirm the chemical stability of TiAl 6V 4 debris and show the chemical evolution of Cr-Co-Mo debris. Development of a protocol to prepare thin targets permits us to correlate PIXE and histological analysis in the same zone. The fibrous tissue (collagen fibres, fibroblasts) and macrophage cells are observed with optical microscope in polluted areas. This protocol could locate other pathologies in ppm contamination range, thanks to the great sensitivity of the PIXE method.
RBS/channeling analysis of hydrogen-implanted single crystals of FZ silicon and 6H silicon
International Nuclear Information System (INIS)
Irwin, R.B.
1984-01-01
Single crystals of FZ silicon and 6H silicon carbide were implanted with hydrogen ions (50 and 80 keV, respectively) to fluences from 2 x 10 16 H + /cm 2 to 2 x 10 18 H+/cm 2 . The implantations were carried out at three temperatures: approx.95K, 300 K, and approx.800 K. Swelling of the samples was measured by surface profilometry. RBS/channeling was used to obtain the damage profiles and to determine the amount of hydrogen retained in the lattice. The damage profiles are centered around X/sub m/ for the implants into silicon and around R/sub p/ for silicon carbide. For silicon carbide implanted at 95 K and 300 K and for silicon implanted at 95 K, the peak damage region is amorphous for fluences above 8 x 10 16 H + /cm 2 , 4 x 10 17 H + /cm 2 , and 2 x 10 17 H + /cm 2 , respectively. Silicon implanted at 300 and 800 K and silicon carbide implanted at 800 K remain crystalline up to fluences of 1 x 10 18 H + /cm 2 . The channeling damage results agree with previously reported TEM and electron diffraction data. The predictions of a simple disorder-accumulation model with a linear annealing term explains qualitatively the observed damage profiles in silicon carbide. Quantitatively, however, the model predicts faster development of the damage profiles than is observed at low fluences in both silicon and silicon carbide. For samples implanted at 300 and 800 K, the model also predicts substantially less peak disorder than is observed. The effect of the surface, the retained hydrogen, the shape of S/sub D/(X), and the need for a nonlinear annealing term may be responsible for the discrepancy
Energy Technology Data Exchange (ETDEWEB)
Guibert, G. [Laboratoire de Physique Corpusculaire de Clermont-Ferrand, IN2P3/CNRS UMR 6533, Universite Blaise Pascal, 63177 Aubiere Cedex (France)]. E-mail: geoffroy.guibert@he-arc.ch; Irigaray, J.L. [Laboratoire de Physique Corpusculaire de Clermont-Ferrand, IN2P3/CNRS UMR 6533, Universite Blaise Pascal, 63177 Aubiere Cedex (France); Moretto, Ph. [Centre d' Etudes Nucleaires de Bordeaux-Gradignan, IN2P3/CNRS UMR 5797, Le Haut Vigneau, BP 120, 33175 Gradignan Cedex (France); Sauvage, T. [Centre d' Etudes et de Recherches par Irradiation, CNRS Orleans France, 3A rue de la ferollerie, 45071 Orleans Cedex 2 (France); Kemeny, J.L. [CHU, Service d' Anatomie et de Cytologie Pathologiques, Universite d' Auvergne, 63100 Clermont-Ferrand (France); Cazenave, A. [Institut Calot, 62608 Berck sur Mer Cedex (France); Jallot, E. [Laboratoire de Physique Corpusculaire de Clermont-Ferrand, IN2P3/CNRS UMR 6533, Universite Blaise Pascal, 63177 Aubiere Cedex (France)
2006-09-15
Implants used as biomaterials have to fulfill conditions of functionality, compatibility and sometimes bioactivity. There are four main families of biomaterials: metals and metal alloys, polymers, bioceramics and natural materials. Because of corrosion and friction in the human body, implants generate debris. This debris may develop toxicity, inflammation and prosthetic unsealing by osseous dissolution. Nature, size, morphology and amount of debris are the parameters influencing the tissue responses. In this paper, we characterised metallic contamination produced by knee prosthesis, composed with TiAl{sub 6}V{sub 4} or Co-Cr-Mo alloys, into surrounding capsular tissue by depth migration, in vivo behaviour, content, size and nature of debris by PIXE (Particle Induced X-ray Emission) method associated with RBS (Rutherford Backscattering Spectroscopy). Debris distribution in the whole articulation is very heterogeneous. Debris migrates several thousand micrometers in tissues, with a characteristic decrease. Solid metallic particles of about micrometer size are found in the most polluted samples, in both alloys TiAl{sub 6}V{sub 4} and Cr-Co-Mo. In the mean volume analysed by PIXE, the concentration mass ratios [Ti]/[V] and [Co]/[Cr] confirm the chemical stability of TiAl{sub 6}V{sub 4} debris and show the chemical evolution of Cr-Co-Mo debris. Development of a protocol to prepare thin targets permits us to correlate PIXE and histological analysis in the same zone. The fibrous tissue (collagen fibres, fibroblasts) and macrophage cells are observed with optical microscope in polluted areas. This protocol could locate other pathologies in ppm contamination range, thanks to the great sensitivity of the PIXE method.
International Nuclear Information System (INIS)
Garcia-Gutierrez, M.; Alonso, U.; Missana, T.; Cormenzana, J.L.; Mingarro, M.; Morejon, J.; Gil, P.
2009-01-01
Consolidated clays are potential host rocks for deep geological repositories for high-level radioactive waste. Diffusion is the main transport process for radionuclides (RN) in these clays. Radionuclide (RN) diffusion coefficients are the most important parameters for Performance Assessment (PA) calculations of clay barriers. Different diffusion methodologies were applied at a laboratory scale to analyse the diffusion behaviour of a wide range of RN. Main aims were to understand the transport properties of different RNs in two different clays and to contribute with feasible methodologies to improve in-situ diffusion experiments, using samples of larger scale. Classical laboratory essays and a novel experimental set-up for large-scale diffusion experiments were performed, together to a novel application of the nuclear ion beam technique Rutherford Backscattering Spectrometry (RBS), for diffusion analyses at the micrometer scale. The main experimental and theoretical characteristics of the different methodologies, and their advantages and limitations are here discussed. Experiments were performed with the Opalinus and the Callovo-Oxfordian clays. Both clays are studied as potential host rock for a repository. Effective diffusion coefficients ranged between 1.10 - 10 to 1.10 - 12 m 2 /s for neutral, low sorbing cations (as Na and Sr) and anions. Apparent diffusion coefficients for strongly sorbing elements, as Cs and Co, are in the order of 1.10-13 m 2 /s; europium present the lowest diffusion coefficient (5.10 - 15 m 2 /s). The results obtained by the different approaches gave a comprehensive database of diffusion coefficients for RN with different transport behaviour within both clays. (Author) 42 refs
RBS and ion channeling studies of Ag-doped YBa2Cu3O7-δ targets and films
International Nuclear Information System (INIS)
Li Yupu; Liu, J.R.; Cui, X.T.; Chu, W.K.
1998-01-01
The location of Ag in Ag-doped YBa 2 Cu 3 O 7-δ (YBCO) films and other high-T c materials (such as Ag-doped BiSrCaCuO films and Ag-sheathed textured BiSrCaCuO wires) is a very important issue for improving high-T c materials. In this work, laser ablated and DC magnetron sputtered YBCO films on (100) LaAlO 3 and (100) SrTiO 3 were prepared from sintered Ag-YBCO composite targets (nominally containing 5 wt% Ag) and studied by Rutherford backscattering spectrometry (RBS) and ion channeling techniques using 2.0 MeV 4 He + and 7 Li + beams. We have found that the Ag-YBCO targets contain about 3 wt% Ag and most of the retained Ag atoms form some small size Ag precipitates with a typical size smaller than a few microns. We have demonstrated that in very good single crystalline YBCO films, the percentage of retained Ag in substitutional sites can be estimated by ion channeling technique. For example, we have found that about 1.2 wt% Ag atoms remain in the laser ablated Ag-doped films prepared from the Ag-YBCO target and about two-thirds of the retained Ag atoms occupy substitutional sites. The sputtered films contain less retained Ag atoms since the deposition temperature is higher and deposition time is longer than those for laser ablated films. (orig.)
Energy Technology Data Exchange (ETDEWEB)
Garcia-Gutierrez, M.; Alonso, U.; Missana, T.; Cormenzana, J.L.; Mingarro, M.; Morejon, J.; Gil, P.
2009-09-25
Consolidated clays are potential host rocks for deep geological repositories for high-level radioactive waste. Diffusion is the main transport process for radionuclides (RN) in these clays. Radionuclide (RN) diffusion coefficients are the most important parameters for Performance Assessment (PA) calculations of clay barriers. Different diffusion methodologies were applied at a laboratory scale to analyse the diffusion behaviour of a wide range of RN. Main aims were to understand the transport properties of different RNs in two different clays and to contribute with feasible methodologies to improve in-situ diffusion experiments, using samples of larger scale. Classical laboratory essays and a novel experimental set-up for large-scale diffusion experiments were performed, together to a novel application of the nuclear ion beam technique Rutherford Backscattering Spectrometry (RBS), for diffusion analyses at the micrometer scale. The main experimental and theoretical characteristics of the different methodologies, and their advantages and limitations are here discussed. Experiments were performed with the Opalinus and the Callovo-Oxfordian clays. Both clays are studied as potential host rock for a repository. Effective diffusion coefficients ranged between 1.10{sup -}10 to 1.10{sup -}12 m{sup 2}/s for neutral, low sorbing cations (as Na and Sr) and anions. Apparent diffusion coefficients for strongly sorbing elements, as Cs and Co, are in the order of 1.10-13 m{sup 2}/s; europium present the lowest diffusion coefficient (5.10{sup -}15 m{sup 2}/s). The results obtained by the different approaches gave a comprehensive database of diffusion coefficients for RN with different transport behaviour within both clays. (Author) 42 refs.
A atuação de sequências do tipo narrativo em um texto jornalístico impresso
Directory of Open Access Journals (Sweden)
Gustavo XIMENES CUNHA
2010-12-01
Full Text Available O objetivo é mostrar que a heterogeneidade composicional de um texto jornalístico não é um fenômeno discursivo simples. Adotando os postulados do Modelo de Análise Modular, evidenciamos a importância que sequências discursivas do tipo narrativo podem assumir quando um jornalista delas se vale para tentar produzir determinados efeitos. Num primeiro momento, o estudo da forma de organização sequencial permite a identificação de duas sequências narrativas. Em seguida, a combinação da forma de organização sequencial com informações de outros planos do discurso permite o estudo das marcas linguísticas das sequências, bem como das funções cotextuais e contextuais que elas desempenham em toda a reportagem estudada.
Directory of Open Access Journals (Sweden)
Kelly Rodrigues
2012-06-01
Full Text Available Um reator em batelada, aerado, com biomassa imobilizada de Aspergillus niger AN400 foi operado durante 10 ciclos de 7 dias para remover benzeno (200 mg.L-1, tolueno (200 mg.L-1 e xileno (50 mg.L-1 - BTX - e de nutrientes de meio basal. O reator era alimentado semanalmente com 4 L do meio e glicose - 1 g.L-1, na Fase I, e 0,5 g.L-1, na Fase II. Os BTX foram detectados até o quarto dia de operação, em todos os ciclos. As melhores eficiências médias de remoção foram na Fase I: 75%de matéria orgânica solúvel, 80% de ortofosfato e 77% de amônia. O reator pode ser uma alternativa viável para tratamento de águas poluídas com BTX, porém há a necessidade de estudar o comportamento do reator durante período de operação mais longo e com ciclos reacionais mais curtos, bem como da identificação dos metabólitos produzidos.A batch reactor with air and immobilized biomass of Aspergillus niger AN400 was operated during 10 cycles of 7 days to remove benzene (200 mg.L-1, toluene (200 mg.L-1, and xylene (50 mg.L-1 - BTX - and nutrients from basal medium. The reactor was weekly fed with 4 L of the medium and glucose - 1 g.L-1 (Phase I and 0.5 g.L-1 (Phase II. The BTX had been detected until the fourth day of operation in all cycles. The best efficiencies of removal had been in Phase I: 75% of soluble organic matter, 80% of orthophosphate and 77% of ammonia. The reactor can be a viable alternative for the contaminated water treatment with BTX. However it has the necessity to study behavior of the reactor during longer period of operation and with shorter reaction cycles, as well as the identification of the produced metabolites.
Skardhamar, Torbjørn; Fekjær, Silje Bringsrud; Pedersen, Willy
2016-12-01
The Stockholm Prevents Alcohol and Drug Problems (STAD) programme has been regarded as one of the most successful programmes to date, in reducing alcohol-related violence. This multi-component Responsible Beverage Service (RBS) programme was implemented in Stockholm, Sweden, and has been documented to be extremely effective in reducing alcohol-related nightlife violence. The SALUTT programme in Oslo, Norway was carefully modelled on the STAD project. We investigate whether the results from STAD were replicated in the SALUTT intervention. Using geocoded data, the level of violence in the intervention area was compared with different control areas before and after the intervention. Autoregressive moving average models (ARIMA). The SALUTT programme had no statistically significant effect on violence. However, the level of violence in the different potential control areas of Oslo fluctuated without a clear common trend. Hence, it was difficult to establish proper control areas. The results from the Swedish STAD-intervention were not replicated in Oslo. Successful interventions are not necessarily replicated in other contexts, and the current literature does not shed sufficient light on the conditions under which such interventions actually work. Moreover, more attention should be devoted to the identification of adequate control areas in future research. Copyright © 2016 Elsevier Ireland Ltd. All rights reserved.
Radiographic skeletal survey and radionuclide bone scan in Langerhans cell histiocytosis of bone
International Nuclear Information System (INIS)
Nieuwenhuyse, J.P. van; Clapuyt, P.; Malghem, J.; Everarts, P.; Melin, J.; Pauwels, S.; Brichard, B.; Ninane, J.; Vermylen, C.; Cornu, G.
1996-01-01
Background. The lack of a consensus in the literature on the imaging strategy in Langerhans cell histiocytosis (LCH) bone lesions in childhood. Objective. To evaluate the relative value of radionuclide bone scan (RBS) and radiographic skeletal survey (RSS) in the detection of LCH bone lesions, both in the initial work-up of the disease and during the follow-up period. Materials and methods. Ten children with bone lesions evaluated by means of RSS and RBS in a retrospective study (1984-1993). Results. Fifty radiologically and/or scintigraphically abnormal foci were detected: 27 anomalies in the initial work-up (12 by both RSS and RBS, 8 by RSS only and 7 by RBS only) and 23 additional anomalies during follow-up (10 by both RSS and RBS, 10 by RSS only and 3 by RBS only). RSS+/RBS- lesions (n = 18) are more frequently encountered in the skull (P = 0.038), and more frequently lack radiologic signs of osteoblastic activity (P = 0.020), than RSS+/RBS+ lesions (n = 22). RSS-/RBS+ abnormalities (n = 10) were most frequently insignificant. Conclusion. In the initial work-up both RSS and RBS should be carried out, while in the follow-up only RSS should be performed. (orig.). With 2 figs., 4 tabs
Energy Technology Data Exchange (ETDEWEB)
Orlić, Ivica; Mekterović, Darko [Department of Physics, University of Rijeka, Radmile Matejčić 2, 51000 Rijeka (Croatia); Mekterović, Igor [Faculty of Electrical Engineering and Computing, University of Zagreb (Croatia); Ivošević, Tatjana [Faculty of Engineering, University of Rijeka, Vukovarska 58, HR-51000 Rijeka (Croatia)
2015-11-15
VIBA-Lab is a computer program originally developed by the author and co-workers at the National University of Singapore (NUS) as an interactive software package for simulation of Particle Induced X-ray Emission and Rutherford Backscattering Spectra. The original program is redeveloped to a VIBA-Lab 3.0 in which the user can perform semi-quantitative analysis by comparing simulated and measured spectra as well as simulate 2D elemental maps for a given 3D sample composition. The latest version has a new and more versatile user interface. It also has the latest data set of fundamental parameters such as Coster–Kronig transition rates, fluorescence yields, mass absorption coefficients and ionization cross sections for K and L lines in a wider energy range than the original program. Our short-term plan is to introduce routine for quantitative analysis for multiple PIXE and XRF excitations. VIBA-Lab is an excellent teaching tool for students and researchers in using PIXE and RBS techniques. At the same time the program helps when planning an experiment and when optimizing experimental parameters such as incident ions, their energy, detector specifications, filters, geometry, etc. By “running” a virtual experiment the user can test various scenarios until the optimal PIXE and BS spectra are obtained and in this way save a lot of expensive machine time.
International Nuclear Information System (INIS)
Orlić, Ivica; Mekterović, Darko; Mekterović, Igor; Ivošević, Tatjana
2015-01-01
VIBA-Lab is a computer program originally developed by the author and co-workers at the National University of Singapore (NUS) as an interactive software package for simulation of Particle Induced X-ray Emission and Rutherford Backscattering Spectra. The original program is redeveloped to a VIBA-Lab 3.0 in which the user can perform semi-quantitative analysis by comparing simulated and measured spectra as well as simulate 2D elemental maps for a given 3D sample composition. The latest version has a new and more versatile user interface. It also has the latest data set of fundamental parameters such as Coster–Kronig transition rates, fluorescence yields, mass absorption coefficients and ionization cross sections for K and L lines in a wider energy range than the original program. Our short-term plan is to introduce routine for quantitative analysis for multiple PIXE and XRF excitations. VIBA-Lab is an excellent teaching tool for students and researchers in using PIXE and RBS techniques. At the same time the program helps when planning an experiment and when optimizing experimental parameters such as incident ions, their energy, detector specifications, filters, geometry, etc. By “running” a virtual experiment the user can test various scenarios until the optimal PIXE and BS spectra are obtained and in this way save a lot of expensive machine time.
Orlić, Ivica; Mekterović, Darko; Mekterović, Igor; Ivošević, Tatjana
2015-11-01
VIBA-Lab is a computer program originally developed by the author and co-workers at the National University of Singapore (NUS) as an interactive software package for simulation of Particle Induced X-ray Emission and Rutherford Backscattering Spectra. The original program is redeveloped to a VIBA-Lab 3.0 in which the user can perform semi-quantitative analysis by comparing simulated and measured spectra as well as simulate 2D elemental maps for a given 3D sample composition. The latest version has a new and more versatile user interface. It also has the latest data set of fundamental parameters such as Coster-Kronig transition rates, fluorescence yields, mass absorption coefficients and ionization cross sections for K and L lines in a wider energy range than the original program. Our short-term plan is to introduce routine for quantitative analysis for multiple PIXE and XRF excitations. VIBA-Lab is an excellent teaching tool for students and researchers in using PIXE and RBS techniques. At the same time the program helps when planning an experiment and when optimizing experimental parameters such as incident ions, their energy, detector specifications, filters, geometry, etc. By "running" a virtual experiment the user can test various scenarios until the optimal PIXE and BS spectra are obtained and in this way save a lot of expensive machine time.
International Nuclear Information System (INIS)
Mathis, F.; Moignard, B.; Pichon, L.; Dubreuil, O.; Salomon, J.
2005-01-01
AGLAE (Accelerateur Grand Louvre d'Analyses Elementaire), the IBA facility of the 'Centre de Recherche et de Restauration des Musees de France' (C2RMF) has been equipped for several years with an external micro-beam line, in order to perform ion beam analysis on materials relevant to cultural heritage. This beam line is undergoing constant improvement. Recently, a new extraction nozzle for the external beam of the accelerator has been designed in order to obtain simultaneously from the same spot: - detection of the X-ray emission by two detectors, for low and high energies; - detection of the backscattered particles for a backscattering angle between 170 and 175 deg., thanks to an annular surface barrier detector included in the nozzle; - particle current monitoring by intermittent beam deflection on a reference material included in the system. This technical development has been induced by the study of artificial patinas on archaeological copper-alloy objects and the attempt to characterize them with a 6MeV 4 He 2+ beam, an unusual beam for this type of investigation. A detailed description of the new device and some results on an application of the use of high-energy alpha beam in PIXE and RBS made on a Roman strigil are presented here
Directory of Open Access Journals (Sweden)
Yaser Taufik Syamlan
2017-06-01
Full Text Available Objectives – this research is aimed to compare those epistemological bases to the mindset of Islamic Bank and try to drive the philosophy in practical operation whether based on the Fractional Reserve Banking Sytem (RBS or 100% RBS and analyze the challenges in deploying the 100%RBS. Methods - This research will be conducted based on an extensive literature review.Results - Based on the epistemological analysis of money and the business cycle as well as the views of Islamic scholars, 100%RBS should be the best for Islamic Bank. There are four types of 100% RBS namely Pure Commodity Money, Sovereign Money, Narrow Banking, and Limited Purpose Banking. To deploy it into the economic system, another philosophical work should be done to choose one of the types and strengthen it so that the theory of 100%RBS can be implemented for the goodness of Islamic Bank. Conclusion - In Conclusions, Based on the epistemology defined by Islamic Scholars, FractRBS has more mafsadah if we compare to the maslahah. Therefore, 100% RBS should be better for the Islamic Bank.
Xylitol production by Candida parapsilosis under fed-batch culture
Directory of Open Access Journals (Sweden)
Sandra A. Furlan
2001-06-01
Full Text Available Xylitol production by Candida parapsilosis was investigated under fed-batch cultivation, using single (xylose or mixed (xylose and glucose sugars as substrates. The presence of glucose in the medium induced the production of ethanol as secondary metabolite and improved specific rates of growth, xylitol formation and substrate consumption. Fractionated supply of the feed medium at constant sugar concentration did not promote any increase on the productivity compared to the single batch cultivation.A produção de xylitol por Candida parapsilosis foi investigada em regime de batelada alimentada, usando substratos açucarados de composição simples (xilose ou composta (xilose e glicose. A presença de glicose no meio induziu a formação de etanol como metabólito secundário. A suplementação fracionada do meio de alimentação numa concentração fixa de açúcar não resultou em aumento da produtividade em relação àquela alcançada em batelada simples.
Simulator of a fail detector system for redundant sensors
International Nuclear Information System (INIS)
Assumpcao Filho, E.O.; Nakata, H.
1990-01-01
A failure detection and isolation system (FDI) simulation program has been developed for IBM-PC microcomputers. The program, based on the sequencial likelihood ratio testing method developed by A. Wald, was implemented with Monte-Carlo technique. The calculated failure detection rate was favorably compared against the wind-tunnel experimental redundant temperature sensors. (author)
DEFF Research Database (Denmark)
Gordillo, M.; Vega, H.; Trainer, A.H.
2008-01-01
Roberts syndrome/SC phocomelia (RBS) is an autosomal recessive disorder with growth retardation, craniofacial abnormalities and limb reduction. Cellular alterations in RBS include lack of cohesion at the heterochromatic regions around centromeres and the long arm of the Y chromosome, reduced growth...... and nonsense mutations associated with decreased levels of mRNA and absence of protein. We found decreased proliferation capacity in RBS cell lines associated with cell death, but not with increased cell cycle duration, which could be a factor in the development of phocomelia and cleft palate in RBS...
Morita, Akihiro; Nakahira, Kumiko; Hasegawa, Taeko; Uchida, Kaoru; Taniguchi, Yoshihito; Takeda, Shunichi; Toyoda, Atsushi; Sakaki, Yoshiyuki; Shimada, Atsuko; Takeda, Hiroyuki; Yanagihara, Itaru
2012-06-01
Roberts syndrome and SC phocomelia (RBS/SC) are genetic autosomal recessive syndromes caused by establishment of cohesion 1 homolog 2 ( ESCO 2) mutation. RBS/SC appear to have a variety of clinical features, even with the same mutation of the ESCO2 gene. Here, we established and genetically characterized a medaka model of RBS/SC by reverse genetics. The RBS/SC model was screened from a mutant medaka library produced by the Targeting Induced Local Lesions in Genomes method. The medaka mutant carrying the homozygous mutation at R80S in the conserved region of ESCO2 exhibited clinical variety (i.e. developmental arrest with craniofacial and chromosomal abnormalities and embryonic lethality) as characterized in RBS/SC. Moreover, widespread apoptosis and downregulation of some gene expression, including notch1a, were detected in the R80S mutant. The R80S mutant is the animal model for RBS/SC and a valuable resource that provides the opportunity to extend knowledge of ESCO2. Downregulation of some gene expression in the R80S mutant is an important clue explaining non-correlation between genotype and phenotype in RBS/SC. © 2012 The Authors Development, Growth & Differentiation © 2012 Japanese Society of Developmental Biologists.
Microprobe PIXE study of Ni–Ge interactions in lateral diffusion couples
Energy Technology Data Exchange (ETDEWEB)
Chilukusha, D. [Department of Physics, University of Zambia, P.O. Box 32379, Lusaka 10101 (Zambia); Pineda-Vargas, C.A. [iThemba LABS, National Research Foundation, P.O. Box 722, Somerset West 7129 (South Africa); Faculty of Health & Wellness Sciences, CPUT, Bellville (South Africa); Nemutudi, R. [iThemba LABS, National Research Foundation, P.O. Box 722, Somerset West 7129 (South Africa); Habanyama, A. [Department of Physics, Copperbelt University, P.O. Box 21692, Jambo Drive, Riverside, Kitwe 10101 (Zambia); Comrie, C.M. [iThemba LABS, National Research Foundation, P.O. Box 722, Somerset West 7129 (South Africa)
2015-11-15
Rutherford backscattering spectrometry on the nuclear microprobe (μRBS) is often used in studies of lateral diffusion couples. RBS requires that the positions of the interacting species on the periodic table are not too close in terms of atomic number and therefore do not produce excessive RBS peak overlap. In order to satisfactorily characterize systems that have atomic numbers which are close, it is necessary to find techniques which can complement μRBS. The aim of this study was to determine the extent to which particle induced X-ray emission (PIXE) could be applied in the lateral diffusion couple study of a system with relatively close atomic numbers. This was with a view that it may eventually be adopted to study systems where the atomic numbers are too close for RBS analysis. The system studied here was the Ni–Ge binary system. Since RBS is an established technique for studying lateral diffusion couples, we used it as a standard for comparison. The PIXE results showed a maximum error of 12% with reference to the RBS standard. In order to achieve the most effective use of PIXE in lateral diffusion couple studies we recommend the use of the technique in such a way as to obtain depth information and the use of relatively thick sample layers.
Wang, Mian; Liu, Xiaomei; Lu, Huizhe; Wang, Hongmei; Qin, Zhaohai
2015-01-21
A "turn-on" fluorescent and colorimetric chemosensor (RBS) for Pd(2+) has been designed and synthesized through introduction of sulfur as a ligand atom to Rhodamine B. RBS exhibits high selectivity (freedom from the interference of Hg(2+ )in particular) and sensitivity toward Pd(2+) with a detection limit as low as 2.4 nM. RBS is also a reversible sensor, and it can be made into test paper to detect Pd(2+) in pure water. Compared to the chemosensors that introduced phosphorus to Rhodamine to detect Pd(2+), RBS can be synthesized more simply and economically.
Development and process evaluation of a Web-based responsible beverage service training program.
Danaher, Brian G; Dresser, Jack; Shaw, Tracy; Severson, Herbert H; Tyler, Milagra S; Maxwell, Elisabeth D; Christiansen, Steve M
2012-09-22
Responsible beverage service (RBS) training designed to improve the appropriate service of alcohol in commercial establishments is typically delivered in workshops. Recently, Web-based RBS training programs have emerged. This report describes the formative development and subsequent design of an innovative Web-delivered RBS program, and evaluation of the impact of the program on servers' knowledge, attitudes, and self-efficacy. Formative procedures using focus groups and usability testing were used to develop a Web-based RBS training program. Professional alcohol servers (N = 112) who worked as servers and/or mangers in alcohol service settings were recruited to participate. A pre-post assessment design was used to assess changes associated with using the program. Participants who used the program showed significant improvements in their RBS knowledge, attitudes, and self-efficacy. Although the current study did not directly observe and determine impact of the intervention on server behaviors, it demonstrated that the development process incorporating input from a multidisciplinary team in conjunction with feedback from end-users resulted in creation of a Web-based RBS program that was well-received by servers and that changed relevant knowledge, attitudes, and self-efficacy. The results also help to establish a needed evidence base in support of the use of online RBS training, which has been afforded little research attention.
Yagi, Fumihiko; Takagi, Seiji; Tomita, Goji
2014-03-01
To evaluate the incidence and cause of iatrogenic retinal breaks (RBs) and postoperative retinal detachment (RD) in cases of idiopathic macular hole (MH) and epiretinal membrane (ERM). We analyzed 79 eyes with MH and 41 eyes with ERM, the relationship between the incidence of RBs and RD, and the frequency of posterior vitreous detachment (PVD) and lattice degeneration (LD). The incidence of RBs related to the operation was significantly higher in eyes with MH. The frequency of PVD was significantly higher in eyes with ERM. The frequency of LD did not differ between groups. In the MH group, the incidence of RBs related to the operation was high in eyes without PVD, but with LD. We observed four cases of RD in the MH group. The MH group had higher incidence of RBs related to the operation, especially in eyes without PVD or with LD.
Making the Case for Reusable Booster Systems: The Operations Perspective
Zapata, Edgar
2012-01-01
Presentation to the Aeronautics Space Engineering Board National Research Council Reusable Booster System: Review and Assessment Committee. Addresses: the criteria and assumptions used in the formulation of current RBS plans; the methodologies used in the current cost estimates for RBS; the modeling methodology used to frame the business case for an RBS capability including: the data used in the analysis, the models' robustness if new data become available, and the impact of unclassified government data that was previously unavailable and which will be supplied by the USAF; the technical maturity of key elements critical to RBS implementation and the ability of current technology development plans to meet technical readiness milestones.
Regenerative braking failures in battery electric vehicles and their impact on the driver.
Cocron, Peter; Neumann, Isabel; Kreußlein, Maria; Wanner, Daniel; Bierbach, Maxim; Krems, Josef F
2018-09-01
A unique feature of battery electric vehicles (BEV) is their regenerative braking system (RBS) to recapture kinetic energy in deceleration maneuvers. If such a system is triggered via gas pedal, most deceleration maneuvers can be executed by just using this pedal. This impacts the driving task as different deceleration strategies can be applied. Previous research has indicated that a RBS failure leading to a sudden reduced deceleration represents an adverse event for BEV drivers. In the present study, we investigated such a failure's impact on the driver's evaluation and behavior. We conducted an experiment on a closed-off test track using a modified BEV that could temporarily switch off the RBS. One half of the 44 participants in the study received information about an upcoming RBS failure whereas the other half did not. While 91% of the drivers receiving prior information noticed the RBS failure, only 48% recognized it in the "uniformed" group. In general, the failure and the perception of its occurrence influenced the driver's evaluation and behavior more than receiving prior information. Nevertheless, under the tested conditions, drivers kept control and were able to compensate for the RBS failure. As the participants drove quite simple maneuvers in our experiment, further studies are needed to validate our findings using more complex driving settings. Given that RBS failures could have severe consequences, appropriate information and warning strategies for drivers are necessary. Copyright © 2018 Elsevier Ltd. All rights reserved.
Annealing damage caused by implantation of group IB elements into silicon
International Nuclear Information System (INIS)
Johansen, A.; Svenningsen, B.; Chadderton, L.T.; Whitton, J.L.
1976-01-01
Transmission electron microscopy (TEM) and the Rutherford backscattering method (RBS) have been used in an investigation of the annealing of radiation damage produced in silicon by 80 keV Cu + , Ag + and Au + ions up to doses of 10 15 ions/cm 2 . Whilst the damage caused by Cu + and Ag + implantation, measured by RBS, persists following annealing sequences up to temperatures of 800 0 C, Au + -implanted samples show recovery. Furthermore, RBS indicates quite clearly that, in the case of gold, atomic diffusion to the silicon surface takes place. TEM and electron diffraction both indicate that in all three implants the anomalous 'damage' remaining in RBS spectra is due to an amorphous-polycrystalline transition. In the case of Au + implants, however, there is less inhibition of the process of recovery, quite apart from the thermal history of the sample. The importance of using another technique, especially TEM, in conjunction with RBS investigations of radiation damage in the solid state is emphasized. (author)
International Nuclear Information System (INIS)
Bamford, Samuel; Kregsamer, Peter; Fazinic, Stjepko; Jaksic, Milko; Wegrzynek, Dariusz; Chinea-Cano, Ernesto; Markowicz, Andrzej
2007-01-01
Two thin film technological materials (A/B) from the aerospace industry have been characterized for their elemental composition, for the purpose of determining their purity and trace element distribution. The results contribute to the assessment of the materials' suitability as part of a spacecraft's thermal hardware. Analysis was done using a combination of PIXE/RBS and energy dispersive X-ray fluorescence (EDXRF) analytical techniques. Samples of the materials were analyzed with PIXE/RBS system using 2 MeV proton beam from a 1 MV Tandetron accelerator and also with separate EDXRF systems employing Am-241 and Mo-secondary target as excitation sources. PIXE/RBS measurements enabled identification of the elemental composition and elucidation of the layer structure of the materials. From the PIXE/RBS results, Am-241-excited EDXRF technique was selected for quantitative determination of indium (In) and tin (Sn) by their K-X-rays, after reasonable absorption corrections. A comparison has been made of the results obtained from EDXRF and PIXE/RBS. Material A has been found to be a thin film with three layers, while material B is a thin film comprised of four layers. Thicknesses and compositions (including trace elements) of all layers have been determined. The limitation of EDXRF in the analysis of inhomogeneously distributed elements was overcome by using PIXE/RBS as an appropriate complimentary technique
Wang, Anthony C; Gemmete, Joseph J; Keegan, Catherine E; Witt, Cordelie E; Muraszko, Karin M; Than, Khoi D; Maher, Cormac O
2011-11-01
Roberts/SC phocomelia syndrome (RBS) is a rare but distinct genetic disorder with an autosomal recessive inheritance pattern. It has been associated with microcephaly, craniofacial malformation, cavernous hemangioma, encephalocele, and hydrocephalus. There are no previously reported cases of RBS with intracranial aneurysms. The authors report on a patient with a history of RBS who presented with a spontaneous posterior fossa hemorrhage. Multiple small intracranial aneurysms were noted on a preoperative CT angiogram. The patient underwent emergency craniotomy for evacuation of the hemorrhage. A postoperative angiogram confirmed the presence of multiple, distal small intracranial aneurysms.
International Nuclear Information System (INIS)
Gavarini, S.; Trocellier, P.; Matzen, G.
2004-01-01
Leaching tests have been performed on LnYSiAlO glasses (Ln = La or Ce) that are considered as potential matrices for the specific immobilization of minor actinides. Elastic recoil detection analysis (ERDA) performed on leached samples indicated a superficial hydration of LaYSiAlO glass of about 100-150 nm. This hydrated layer is (Al, Y)-enriched according to SEM-EDS analysis, suggesting the formation of hydroxide (or hydroxycarbonates) compounds including these two elements. This process leads to a very efficient passivation of the material due to the low solubility of Al and Y hydroxides (and hydroxycarbonates) species in near neutral media, even when the solution is rapidly replenished is dynamic leaching experiments. Rutherford Backscattering Spectrometry elemental mapping revealed very localized and significantly Y-enriched deposits at the surface of the sample after leaching. This could be the sign of heterogeneities already present on the pristine glass. These may be correlated with the weak solubility of yttrium (and rare earth) elements in silicate matrices (Y + Ln initial content in the glass ∼11 at.%). In the case of CeYSiAlO glass, a thin layer was formed on the solid after leaching. The simulation of the corresponding RBS spectra showed a surface (Y, Ce)-enrichment and (Al, Si)-depletion in both cases. This could be explained by the oxidation of trivalent cerium initially present in the glass structure during leaching. This might be explained by the low solubility of Ce(IV)-compounds (CeO 2 and/or Ce(OH) 4 ) in solution leading to an enrichment of this element at the glass/solution interface, to form a mixture of amorphous CeO 2 and Y(OH) 3 , as confirmed by XPS and XRD experiments
Gordillo, Miriam; Vega, Hugo; Trainer, Alison H.; Hou, Fajian; Sakai, Norio; Luque, Ricardo; Kayserili, Hülya; Basaran, Seher; Skovby, Flemming; Hennekam, Raoul C. M.; Uzielli, Maria L. Giovannucci; Schnur, Rhonda E.; Manouvrier, Sylvie; Chang, Susan; Blair, Edward; Hurst, Jane A.; Forzano, Francesca; Meins, Moritz; Simola, Kalle O. J.; Raas-Rothschild, Annick; Schultz, Roger A.; McDaniel, Lisa D.; Ozono, Keiichi; Inui, Koji; Zou, Hui; Jabs, Ethylin Wang
2008-01-01
Roberts syndrome/SC phocomelia (RBS) is an autosomal recessive disorder with growth retardation, craniofacial abnormalities and limb reduction. Cellular alterations in RBS include lack of cohesion at the heterochromatic regions around centromeres and the long arm of the Y chromosome, reduced growth
Directory of Open Access Journals (Sweden)
Marina Santos da Silva Lopes
2011-03-01
Full Text Available Foi estudada a eficiência da remoção de nitrogênio e fósforo do efluente de indústria de castanha de caju, por uso de reator aeróbio em batelada com inóculo de Aspergillus niger AN400. O reator recebeu 5 L de água residuária, acrescida de glicose, na concentração de 1 g.L-1 (Etapa I e de 5 g.L-1 (Etapa II . Cada etapa teve seis ciclos operacionais, cada um com tempo de reação total de sete dias. Os valores de pH dos efluentes na Etapa I variaram de 6,4 a 8,7 e na Etapa II , de 3,1 a 7,0. Durante a Etapa II , o reator alcançou bons resultados para remoção de nutrientes sem acúmulo de sua concentração no meio: 49% de fósforo total, 60% de ortofosfato, 79% de amônia, 78% de nitrato e 90% de nitrito, indicando que a menor liberação de nutrientes pelos micro-organismos ocorreu na presença de concentração elevada de glicose.It was studied the removal efficiency of nitrogen and phosphorus from effluent of a cashew nut industry by using an aerobic reactor operated in repetitive batch, inoculated with Aspergillus niger AN400. The reactor was fed with 5 L of wastewater, supplemented with glucose in the concentration of 1 g.L-1 (Phase I and 5 g.L-1 (Phase II . Each phase had six operational cycles, with total reaction time of seven days per cycle. The pH values of the effluents in Phase I varied from 6.4 to 8.7 and in Phase II , it varied from 3.1 to 7.0. The reactor achieved good results of removal without nutrients accumulated in the medium, during Phase II : 49% to total phosphorus, 60% to orthophosphate, 79% to ammonia, 78% to nitrate, and 90% to nitrite, indicating that the lesser release of nutrients by microorganisms occurred in the presence of higher glucose concentration.
Directory of Open Access Journals (Sweden)
Hisashi Katsuragi
2010-03-01
Full Text Available The enzymatic synthesis of capsaicin glycosides and 8-nordihydrocapsaicin glycosides was investigated using almond β-glucosidase and cyclodextrin glucanotransferase (CGTase. Capsaicin and 8-nordihydrocapsaicin were converted into their β-glucoside and β-maltooligosaccharide (amylose conjugate, i.e. β-maltoside and β-maltotrioside, by sequencial glycosylation with almond β-glucosidase and CGTase. The β-glucoside and β-maltoside of capsaicin and β-glucoside of 8-nordihydrocapsaicin showed inhibitory effects on high-fat-diet-induced elevations in body weight of mice.
Directory of Open Access Journals (Sweden)
Hisashi Katsuragi
2010-01-01
Full Text Available The enzymatic synthesis of capsaicin glycosides and 8-nordihydrocapsaicin glycosides was investigated using almond β-glucosidase and cyclodextrin glucanotransferase (CGTase. Capsaicin and 8-nordihydrocapsaicin were converted into their β-glucoside and β-maltooligosaccharide (amylose conjugate, i.e. β-maltoside and β-maltotrioside, by sequencial glycosylation with almond β-glucosidase and CGTase. The β-glucoside and β-maltoside of capsaicin and β-glucoside of 8-nordihydrocapsaicin showed inhibitory effects on high-fat-diet-induced elevations in body weight of mice.
Cohesinopathies of a feather flock together.
Directory of Open Access Journals (Sweden)
Robert V Skibbens
Full Text Available Roberts Syndrome (RBS and Cornelia de Lange Syndrome (CdLS are severe developmental maladies that present with nearly an identical suite of multi-spectrum birth defects. Not surprisingly, RBS and CdLS arise from mutations within a single pathway--here involving cohesion. Sister chromatid tethering reactions that comprise cohesion are required for high fidelity chromosome segregation, but cohesin tethers also regulate gene transcription, promote DNA repair, and impact DNA replication. Currently, RBS is thought to arise from elevated levels of apoptosis, mitotic failure, and limited progenitor cell proliferation, while CdLS is thought to arise, instead, from transcription dysregulation. Here, we review new information that implicates RBS gene mutations in altered transcription profiles. We propose that cohesin-dependent transcription dysregulation may extend to other developmental maladies; the diagnoses of which are complicated through multi-functional proteins that manifest a sliding scale of diverse and severe phenotypes. We further review evidence that cohesinopathies are more common than currently posited.
Tas, E.; Peleg, M.; Pedersen, D. U.; Matveev, V.; Pour Biazar, A.; Luria, M.
2006-12-01
The Dead Sea is an excellent natural laboratory for the investigation of Reactive Bromine Species (RBS) chemistry, due to the high RBS levels observed in this area, combined with anthropogenic air pollutants up to several ppb. The present study investigated the basic chemical mechanism of RBS at the Dead Sea using a numerical one-dimensional chemical model. Simulations were based on data obtained from comprehensive measurements performed at sites along the Dead Sea. The simulations showed that the high BrO levels measured frequently at the Dead Sea could only partially be attributed to the highly concentrated Br- present in the Dead Sea water. Furthermore, the RBS activity at the Dead Sea cannot solely be explained by a pure gas phase mechanism. This paper presents a chemical mechanism which can account for the observed chemical activity at the Dead Sea, with the addition of only two heterogeneous processes: the "Bromine Explosion" mechanism and the heterogeneous decomposition of BrONO2. Ozone frequently dropped below a threshold value of ~1 to 2 ppbv at the Dead Sea evaporation ponds, and in such cases, O3 became a limiting factor for the production of BrOx (BrO+Br). The entrainment of O3 fluxes into the evaporation ponds was found to be essential for the continuation of RBS activity, and to be the main reason for the jagged diurnal pattern of BrO observed in the Dead Sea area, and for the positive correlation observed between BrO and O3 at low O3 concentrations. The present study has shown that the heterogeneous decomposition of BrONO2 has a great potential to affect the RBS activity in areas influenced by anthropogenic emissions, mainly due to the positive correlation between the rate of this process and the levels of NO2. Further investigation of the influence of the decomposition of BrONO2 may be especially important in understanding the RBS activity at mid-latitudes.
Directory of Open Access Journals (Sweden)
E. Tas
2006-01-01
Full Text Available The Dead Sea is an excellent natural laboratory for the investigation of Reactive Bromine Species (RBS chemistry, due to the high RBS levels observed in this area, combined with anthropogenic air pollutants up to several ppb. The present study investigated the basic chemical mechanism of RBS at the Dead Sea using a numerical one-dimensional chemical model. Simulations were based on data obtained from comprehensive measurements performed at sites along the Dead Sea. The simulations showed that the high BrO levels measured frequently at the Dead Sea could only partially be attributed to the highly concentrated Br− present in the Dead Sea water. Furthermore, the RBS activity at the Dead Sea cannot solely be explained by a pure gas phase mechanism. This paper presents a chemical mechanism which can account for the observed chemical activity at the Dead Sea, with the addition of only two heterogeneous processes: the "Bromine Explosion" mechanism and the heterogeneous decomposition of BrONO2. Ozone frequently dropped below a threshold value of ~1 to 2 ppbv at the Dead Sea evaporation ponds, and in such cases, O3 became a limiting factor for the production of BrOx (BrO+Br. The entrainment of O3 fluxes into the evaporation ponds was found to be essential for the continuation of RBS activity, and to be the main reason for the jagged diurnal pattern of BrO observed in the Dead Sea area, and for the positive correlation observed between BrO and O3 at low O3 concentrations. The present study has shown that the heterogeneous decomposition of BrONO2 has a great potential to affect the RBS activity in areas influenced by anthropogenic emissions, mainly due to the positive correlation between the rate of this process and the levels of NO2. Further investigation of the influence of the decomposition of BrONO2 may be especially important in understanding the RBS activity at mid-latitudes.
77 FR 65532 - Submission for OMB Review; Comment Request
2012-10-29
... each State. RBS will collect information using various forms from the lender and the borrower. This information is vital for making prudent financial decisions. Need and Use of the Information: RBS will collect information to monitor the guaranteed loan portfolio to ensure that the lenders are adequately servicing the...
INFLUÊNCIA DA TEMPERATURA NO DESEMPENHO DE BIODIGESTORES COM ESTERCO BOVINO
Directory of Open Access Journals (Sweden)
Larissa Rodrigues de Castro
1998-04-01
Full Text Available RESUMO A presente pesquisa trata do estudo de biodigestores de batelada mantidos a diferentes temperaturas, visando analisar os níveis mais favoráveis à produção de biogás e à degradação de sólidos totais e voláteis de esterco bovino. A temperatura mais adequada obtida em laboratório (31ºC foi aplicada em um biodigestor rural modelo indiano, com 10m3 de capacidade, a fim de se verificar seu desempenho.
Planning Schools for the Future. Publication No. BM-1.
Weinberger, JoAnn
In a three-year study, Research for Better Schools (RBS) was asked by the National Institute of Education to identify, analyze, and verify definitive social changes forecast for the decades ahead, and to project their implications for schools of the future. RBS reviewed the literature to extract future planning needs relevant to educational…
Relationship of extinction to perceptual thresholds for single stimuli.
Meador, K J; Ray, P G; Day, L J; Loring, D W
2001-04-24
To demonstrate the effects of target stimulus intensity on extinction to double simultaneous stimuli. Attentional deficits contribute to extinction in patients with brain lesions, but extinction (i.e., masking) can also be produced in healthy subjects. The relationship of extinction to perceptual thresholds for single stimuli remains uncertain. Brief electrical pulses were applied simultaneously to the left and right index fingers of 16 healthy volunteers (8 young and 8 elderly adults) and 4 patients with right brain stroke (RBS). The stimulus to be perceived (i.e., target stimulus) was given at the lowest perceptual threshold to perceive any single stimulus (i.e., Minimal) and at the threshold to perceive 100% of single stimuli. The mask stimulus (i.e., stimulus given to block the target) was applied to the contralateral hand at intensities just below discomfort. Extinction was less for target stimuli at 100% than Minimal threshold for healthy subjects. Extinction of left targets was greater in patients with RBS than elderly control subjects. Left targets were extinguished less than right in healthy subjects. In contrast, the majority of left targets were extinguished in patients with RBS even when right mask intensity was reduced below right 100% threshold for single stimuli. RBS patients had less extinction for right targets despite having greater left mask - threshold difference than control subjects. In patients with RBS, right "targets" at 100% threshold extinguished left "masks" (20%) almost as frequently as left masks extinguished right targets (32%). Subtle changes in target intensity affect extinction in healthy adults. Asymmetries in mask and target intensities (relative to single-stimulus perceptual thresholds) affect extinction in RBS patients less for left targets but more for right targets as compared with control subjects.
A dedicated beam line for Rutherford backscattering analysis at IFIN-HH cyclotron
International Nuclear Information System (INIS)
Ivanov, E. A.; Dudu, D.; Plostinaru, D.; Catana, D.; Vata, I.
2003-01-01
Rutherford back-scattering technique (RBS) is an analytical tool that uses elastic scattering of 1-5 MeV charged particles for analysis of the surface and the outer few micrometers of solids. IFIN-HH RBS system consists of the U-120 Cyclotron, a dedicated beam line and a scattering chamber with sample manipulators and particle detectors. In our RBS system the samples are bombarded with 2-5 alpha particles accelerated by U-120 Cyclotron (in 3-rd subharmonic regime) while the scattered particles are detected by a surface barrier detector. The signal from the detector is processed by common nuclear electronics and the particle energy spectra are stored in a computer based multichannel analyser. The data evaluation is accomplished using standard procedures and computer codes. The necessary vacuum inside chamber is obtained with an oil-free turbo pump. The beam spot dimension on the target is 1x1 mm. The standard measurement are done at Θ = 165 angle. The samples are electrically insulated and can be rotated around a vertical axis. The advantage of the RBS technique lies in the quantitative analysis of major and minor constituents lying in the first 0.5 to 2.0 micrometers of a material. Depending on the sample structure and composition, the detection limits vary from 10 11 to 10 15 at. cm -2 for heavy and light elements, respectively. The depth distribution of constituents can be reconstructed with a depth resolution of 10-20 nm. The RBS technique is non-destructive since the erosion and the radiation degradation of the sample material by the particle impact is negligible. The most extensive use of the RBS technique is in the field of electronic and optical materials, special coatings and in the study of various physico-chemical processes on the solid surfaces. (authors)
Absence of single critical dose for the amorphization of quartz under ion irradiation
Zhang, S.; Pakarinen, O. H.; Backholm, M.; Djurabekova, F.; Nordlund, K.; Keinonen, J.; Wang, T. S.
2018-01-01
In this work, we first simulated the amorphization of crystalline quartz under 50 keV 23 Na ion irradiation with classical molecular dynamics (MD). We then used binary collision approximation algorithms to simulate the Rutherford backscattering spectrometry in channeling conditions (RBS-C) from these irradiated MD cells, and compared the RBS-C spectra with experiments. The simulated RBS-C results show an agreement with experiments in the evolution of amorphization as a function of dose, showing what appears to be (by this measure) full amorphization at about 2.2 eVṡatom-1 . We also applied other analysis methods, such as angular structure factor, Wigner-Seitz, coordination analysis and topological analysis, to analyze the structural evolution of the irradiated MD cells. The results show that the atomic-level structure of the sample keeps evolving after the RBS signal has saturated, until the dose of about 5 eVṡatom-1 . The continued evolution of the SiO2 structure makes the definition of what is, on the atomic level, an amorphized quartz ambiguous.
An Intelligent Regenerative Braking Strategy for Electric Vehicles
Directory of Open Access Journals (Sweden)
Zhibin Song
2011-09-01
Full Text Available Regenerative braking is an effective approach for electric vehicles (EVs to extend their driving range. A fuzzy-logic-based regenerative braking strategy (RBS integrated with series regenerative braking is developed in this paper to advance the level of energy-savings. From the viewpoint of securing car stability in braking operations, the braking force distribution between the front and rear wheels so as to accord with the ideal distribution curve are considered to prevent vehicles from experiencing wheel lock and slip phenomena during braking. Then, a fuzzy RBS using the driver’s braking force command, vehicle speed, battery SOC, battery temperature are designed to determine the distribution between friction braking force and regenerative braking force to improve the energy recuperation efficiency. The experimental results on an “LF620” prototype EV validated the feasibility and effectiveness of regenerative braking and showed that the proposed fuzzy RBS was endowed with good control performance. The maximum driving range of LF620 EV was improved by 25.7% compared with non-RBS conditions.
The Factor Structure of the Polish-Language Version of the Romantic Beliefs Scale
Directory of Open Access Journals (Sweden)
Katarzyna Adamczyk
2014-07-01
Full Text Available The aim of the present study was to investigate the factor structure and psychometric properties of the Polish adaptation of Romantic Beliefs Scale (RBS; Sprecher & Metts, 1989. In a sample of 414 Polish university students aged 19-25 (227 females and 187 males, the factor structure of the original English version was confirmed for the four subscales: Love Finds a Way, One and Only, Idealization, and Love at First Sight. The present study provides evidence that the 15-item version of the Polish adaptation of the (RBS possesses a factor structure and psychometric properties comparable to the English-language version of RBS. It was shown to be a reliable self-report measure for romantic beliefs within a sample of the Polish population. The development of a new Polish measure of romantic beliefs has provided further validation for the RBS, and provided evidence in support of the ideology of romanticism in various populations, and indicated the importance of differentiating between the different types of romantic beliefs.
Directory of Open Access Journals (Sweden)
Ismênia Ribeiro de Oliveira
2014-09-01
Full Text Available O objetivo deste trabalho foi avaliar o desempenho da simulação sequencial gaussiana (SSG e da simulação sequencial indicatriz (SSI na modelagem da incerteza das predições do K disponível em área de cana-de-açúcar, e comparar as simulações com o método já consagrado de krigagem ordinária (KO. Uma malha amostral com 626 pontos foi instalada em área de 200 ha, no Município de Tabapuã, em São Paulo. As simulações reproduziram a variabilidade dos dados amostrais de K disponível, enquanto a KO superestimou os baixos teores de K e subestimou os altos. O mapa de desvio-padrão obtido a partir da KO mostrou menor variação ao longo da área de estudo, quando comparado aos mapas obtidos a partir das simulações. A SSI obteve acurácia 22% superior à obtida pela SSG, na modelagem da função de distribuição condicional do K. As simulações apresentam maior eficiência que a KO para modelar incerteza na distribuição espacial do K. A SSI apresenta melhor desempenho que a SSG na estimativa dos teores de K disponível, em área de cana-de-açúcar.
Directory of Open Access Journals (Sweden)
Saulo Felipe Costa
2017-07-01
Full Text Available A década de 1990 inaugurou um conjunto de políticas públicas marcadas pela busca do aumento da eficiência governamental na geração e execução de suas ações. Às políticas orientadas para o mercado seguiram-se esforços de descentralização do processo decisório com vistas ao aprimoramento da gestão pública, onde se buscou combinar ajuste fiscal (eficiência orçamentária com mudança institucional (instituições voltadas para os resultados. Entretanto, o problema da falha sequencial das reformas administrativas, decorrente do dilema do controle, se constituiu no vetor de constrangimento para a implementação exitosa dessas concepções gerencialistas. Qual a natureza dos conflitos e a estratégia de ação dos policy-makers no interior da “coalizão reformadora”? Este trabalho, em uma tentativa de responder tal questão, apresenta uma abordagem analítica do dilema do controle baseada na teoria dos jogos. Objetivou-se com isto, apresentar uma formalização do problema da falha sequencial, via dilema do controle, como esforço analítico para o desenvolvimento de modelos formais para fenômenos decisórios na área das Ciências Sociais em geral, e da Ciência Política em particular.
Ecological correlates of relative brain size in some South African ...
African Journals Online (AJOL)
Relative brain size (size of the brain once body size effects have been removed) has been calculated for 16 species of rodent from South Africa and is shown to vary with six species having a positive RBS (that is a brain larger than expected) and 10 a negative RBS. Arboreal species such as Paraxerus cepapi and ...
Instrumentation for PIXE and RBS
International Nuclear Information System (INIS)
2000-12-01
The purpose of this document is to give an overview of instrumentation for PIXE and Rutherford backscattering analysis, including hardware and software needed to perform the analysis, including detectors, analyzers, data acquisition systems and data analysis software. It also provides some information on accelerators needed for these applications
Martiniano, Hugo Filipe de Mesquita Costa, 1978-
2013-01-01
Tese de doutoramento, Química (Química-Física), Universidade de Lisboa, Faculdade de Ciências, 2013 O método da dinâmica molecular ab initio exibe vantagens significativas para o estudo da estrutura e propriedades electrónicas de sistemas moleculares complexos. No entanto, uma das suas desvantagens é o elevado custo computacional, quando comparado com os métodos de dinâmica molecular clássicos. Um dos modos de resolver este problema é adoptar uma abordagem sequencial, na qual a dinâmica é ...
Czech Academy of Sciences Publication Activity Database
Macková, Anna; Malinský, Petr; Pupíková, Hana; Nekvindová, P.; Cajzl, J.; Švecová, B.; Oswald, Jiří; Wilhelm, R. A.; Kolitsch, A.
2014-01-01
Roč. 331, JUL (2014), s. 182-186 ISSN 0168-583X R&D Projects: GA ČR(CZ) GBP108/12/G108; GA MŠk(XE) LM2011019 Institutional support: RVO:68378271 ; RVO:61389005 Keywords : Er ion implantation * crystals * depth profiles * RBS * RBS channelling * photoluminescence Subject RIV: BG - Nuclear, Atomic and Molecular Physics, Colliders Impact factor: 1.124, year: 2014
Directory of Open Access Journals (Sweden)
Maria Magdalena Ribas Döll
2010-09-01
Full Text Available Avaliou-se a influência do bicarbonato de sódio (NaHCO3 no desempenho do reator anaeróbio batelada sequencial com biomassa imobilizada tratando vinhaça a 55 e a 35ºC. O reator foi preenchido com espuma de poliuretano e agitado a 300 rpm. A adaptação a 55ºC estendeu-se por 50 dias, tendo o reator sido alimentado com vinhaça (DQO de 0,3 a 1,0 g/L. Para a operação a 35ºC, procedeu-se inicialmente ao enriquecimento da população metanogênica, durante 21 dias, com substrato à base de etanol (2,5 gDQO/L. Posteriormente, cargas orgânicas volumétricas (COV de 0,85 a 5,70 gDQO/L.d foram aplicadas no reator a 55ºC, com suplementação de 1,2 a 0,4 gHCO3-/gDQO. A 35ºC, o reator foi submetido a COV de 2,85 a 36,0 gDQO/L.d com 0,4 a 0,2 gHCO3-/gDQO. A remoção de DQO variou de 43 a 78% a 55ºC e de 75 a 85% a 35ºC. A suplementação de alcalinidade mostrou-se essencial para a estabilidade do processo, sendo requerida em menor quantidade a 35ºC.The influence of the sodium bicarbonate (NaHCO3 on the performance of an anaerobic sequencing batch biofilm reactor treating vinasse at 55 and 35ºC was evaluated. The reactor was filled with polyurethane foam and agitated at 300 rpm. The acclimatization period at 55ºC lasted 50 days, and the reactor was fed with vinasse (COD from 0.3 to 1.0 g/L. A previous enrichment of methanogenic population was provided for the reactor operated at 35ºC, feeding it with an ethanol based substrate (2.5 gCOD/L during 21 days. Further on, organic loading rates (OLR ranging from 0.85 to 5.70 gCOD/L.d were applied to the reactor at 55ºC, supplemented with 1.2 to 0.4 gHCO3-/gCOD. At 35ºC the reactor was subjected to OLR ranging from 2.85 to 36.0 gCOD/L.d with 0.4 to 0.2 gHCO3-/gCOD. COD removal ranged from 43 to 78% at 55ºC and from 75 to 85% at 35ºC. Alkalinity supplementation was found to be essential for process stability, but the amount required was lower at 35ºC.
Directory of Open Access Journals (Sweden)
Marcelo Perencin de Arruda Ribeiro
2005-06-01
Full Text Available In this work, optimal control techniques were used to optimize the feed of reactants during the enzymatic synthesis of ampicillin in a semi-batch reactor. Simulation results showed that a semi-batch integrated reactor (with product crystallization might achieve 88% 6-APA (6-aminepenicillanic acid conversion and 92% of PGME (phenylglycine methyl ester yield, with a productivity between 3.5 and 5.5 mM min-1.A síntese enzimática de ampicilina oferece menor impacto ambiental em relação ao processo utilizado atualmente pela indústria farmacêutica. Mas seu rendimento e produtividade devem ser melhorados para tornar essa rota competitiva. Alguns estudos empíricos para otimizar a rota enzimática de síntese de antibióticos beta-lactâmicos vêm sendo realizados. Entretanto, a utilização sistemática de métodos matemáticos de otimização nesse processo não é encontrada na literatura. Neste trabalho, utilizaram-se técnicas de controle ótimo para otimizar a alimentação de reagentes na síntese enzimática de ampicilina em reator operando em batelada alimentada. Resultados simulados mostram que, em reator integrado (com precipitação dos produtos operado em batelada alimentada, conversões de 6-APA e rendimento de EMFG de 88% a 92% são factíveis, assim como produtividades entre 3,5 e 5,5 mM.min-1.
Micro-PIXE for single cell analysis
International Nuclear Information System (INIS)
Ortega, Richard
2012-01-01
The knowledge of the intracellular distribution of biological relevant metals is important to understand their mechanisms of action in cells, either for physiological, toxicological or pathological processes. However, the direct detection of trace metals in single cells is a challenging task that requires sophisticated analytical developments. The combination of micro-PIXE with RBS and STIM (Scanning Transmission Ion Microscopy) allows the quantitative determination of trace metal content within sub-cellular compartments. The application of STIM analysis provides high spatial resolution imaging (< 200 nm) and excellent mass sensitivity (< 0.1 ng). Application of the STIM-PIXE-RBS methodology is absolutely needed when organic mass loss appears during PIXE-RBS irradiation. This combination of STIM-PIXE-RBS provides fully quantitative determination of trace element content, expressed in μg/g, which is a quite unique capability for micro-PIXE compared to other micro-analytical methods such as the electron and synchrotron x-ray fluorescence. Examples of micro-PIXE studies for sub-cellular imaging of trace elements in various fields of interest will be presented: in patho-physiology of trace elements involved in neurodegenerative diseases such as Parkinson's disease, and in toxicology of metals such as cobalt. (author)
Luciano Farias de Novaes
2008-01-01
O presente trabalho teve como objetivo avaliar a influência da intensidade de agitação e tipo de impelidor, bem como a estratégia de alimentação, em reator anaeróbio operado em batelada seqüencial, escala piloto (\\'da ordem de\\' 1 \\'M POT.3\\'), com agitação mecânica e em duas configurações: uma com biomassa granulada (ASBR) e outra com biomassa imobilizada em suporte inerte de espuma de poliuretano (ASBBR), aplicadas ao tratamento de esgoto doméstico. No estudo da intensidade de agitação e t...
Silva, Isis dos Anjos
2014-01-01
Orientadora: Profa. Dra. Juliana Tófano de Campos Leite Toneli Dissertação (mestrado) - Universidade Federal do ABC, Programa de Pós-Graduação em Energia, 2014. Nesse trabalho, objetivou-se avaliar a produção de biogás durante o processo de biodigestão anaeróbia de dejetos de bovinos leiteiros, com e sem a separação de sólidos, em duas etapas: na Etapa 1, foi realizada a biodigestão em 16 biodigestores do tipo batelada, com volume útil de 2L, abastecidos com dejetos obtidos em 4 diferen...
SURFAN, a programme for surface analysis
International Nuclear Information System (INIS)
Negoita, F.; Borcan, C.; Pantelica, D.
1997-01-01
Possible alternatives to Rutherford backscattering spectrometry (RBS) method of material analysis, overcoming the poor sensitivity to light elements of RBS, are the nuclear resonant reaction analysis (NRA) and elastic recoil detection analysis (ERDA). The last one is especially useful in surface and thin film analysis. To simulate the spectra obtained with any of these methods a programme SURFAN was worked out. In comparison with the code RUMP, published by Doolittle, it allows to simply change the charge of the projectile nature, implies no limitation to the energy of incident projectiles and permits the use of any depth profile function. The basic ideas and the structure of SURFAN are presented. Its application to ERDA and RBS methods resulted in important information on the processes implied in special materials obtained by advanced technologies
Olmos, P; Acosta, A M; Schiaffino, R; Díaz, R; Alvarado, D; O'Brien, A; Muñoz, X; Arriagada, P; Claro, J C; Vega, R; Vollrath, V; Velasco, S; Emmerich, M; Maiz, A
1999-04-01
Recent studies suggest that polymorphisms associated to the aldose reductase gene could be related to early retinopathy in noninsulin dependent diabetics (NIDDM). There is also new interest on the genetic modulation of coagulation factors in relation to this complication. To look for a possible relationship between the rate of appearance of retinopathy and the genotype of (AC)n polymorphic marker associated to aldose reductase gene. A random sample of 27 NIDDM, aged 68.1 +/- 10.6 years, with a mean diabetes duration of 20.7 +/- 4.8 years and a mean glycosilated hemoglobin of 10.6 +/- 1.6%, was studied. The genotype of the (AC)n, polymorphic marker associated to the 5' end of the aldose reductase (ALR2) gene was determined by 32P-PCR plus sequenciation. Mutations of the factor XIII-A gene were studied by single stranded conformational polymorphism, sequenciation and restriction fragment length polymorphism. Four patients lacked the (AC)24 and had a higher rate of appearance of retinopathy than patients with the (AC)24 allele (0.0167 and 0.0907 score points per year respectively, p = 0.047). Both groups had similar glycosilated hemoglobin (11.7 +/- 0.2 and 10.5 +/- 1.6% respectively). Factor XIII gene mutations were not related to the rate of appearance of retinopathy. Our data suggest that the absence of the (AC)24 allele of the (AC)n polymorphic marker associated to the 5' end of the aldose reductase gene, is associated to a five fold reduction of retinopathy appearance rate.
DISTRIBUIÇÃO E FRACIONAMENTO DO FÓSFORO NOS SEDIMENTOS DOS RIOS BACANGA E ANIL NA ILHA DO MARANHÃO
MARIA DE LOURDES FERREIRA NUNES
2013-01-01
No presente estudo, foi determinado o estoque total de fósforo (TP) em sedimentos de rios Anil e Bacanga localizados na ilha do Maranhão. Além disso, com a finalidade de avaliar a labilidade de fósforo no sedimento, foi realizada a extração química sequencial de acordo com o protocolo da Comissão Europeia (normas, medidas e programa de testes). Os resultados do Rio Bacanga indicou concentrações de PT que variam de 877,91 mg kgˉ e 1466,44 mg Kgˉ, o que permite classificar estes sedim...
Beck, L.; Pichon, L.; Moignard, B.; Guillou, T.; Walter, P.
2011-12-01
For many years, ion beam analysis techniques have successfully been used to the study of cultural heritage objects. The chemical composition of work art is usually determined by PIXE, but in many cases, RBS and/or PIGE can provide useful complementary information. RBS gives information about the depth distribution and concentration in light elements, such as carbon and oxygen. In the past years, the experimental facilities at the AGLAE (Accélérateur Grand Louvre d'Analyse Élémentaire) accelerator has been progressively developed in order to apply simultaneously PIXE, PIGE and RBS under optimal conditions using an external beam. This combination is now routinely used for point analyses or mappings. In this contribution, we present several examples of applications: manufacturing technology of lustre-decorated ceramics and silver plating, control of altered or restored surfaces, and quantification of organic phase in painting and bone. The final conclusion is that the association of PIXE with RBS is very attractive for the investigation of cultural heritage objects, in particular of materials containing both mineral and organic components or possessing a multilayered structure. The first results of the production of monochromatic X-rays for radiography purposes by PIXE are also presented.
Nuclear analysis of a rare earth containing protective oxide on aluminium
Energy Technology Data Exchange (ETDEWEB)
Gorman, J.D.; Paterson, P.J.K. [Royal Melbourne Inst. of Tech., VIC (Australia); Hughes, A.E. [Commonwealth Scientific and Industrial Research Organisation (CSIRO), Melbourne, VIC (Australia). Div. of Materials Science
1996-12-31
The aim is study was to examine the thickness of the conversion coating as well as the elemental depth distribution of cerium and molybdenum using Rutherford Backscattering Spectroscopy (RBS), Scanning Electron Microscopy (SEM), Scanning Auger Electron Spectroscopy and Forward Recoil Spectroscopy (FRS). In addition, RBS has been used to examine how changes in processing conditions, particularly the treatment temperatures, influences the coating thickness and Ce distribution at each process step. SEM established that a crazed oxide structure was developed over the matrix of the alloy using the above process steps. RBS was chosen to provide elemental concentration versus depth information on these samples since it is largely insensitive to surface topography when the detector is set to high scattering angles. A other advantage of using RBS for this particular system is that the heavy elements incorporated into the coating such as Ce and Mo because of their high atomic number compared to the aluminium oxide, are well separated from aluminium and oxygen at their higher recoil energies. Forward Recoil Spectroscopy is capable of detecting hydrogen and it has been used to confirm that the coating is hydrated and to establish the hydrogen distribution within the final oxide coating on each alloy. 7 refs., 1 tab., 4 figs.
Nuclear analysis of a rare earth containing protective oxide on aluminium
Energy Technology Data Exchange (ETDEWEB)
Gorman, J D; Paterson, P J.K. [Royal Melbourne Inst. of Tech., VIC (Australia); Hughes, A E [Commonwealth Scientific and Industrial Research Organisation (CSIRO), Melbourne, VIC (Australia). Div. of Materials Science
1997-12-31
The aim is study was to examine the thickness of the conversion coating as well as the elemental depth distribution of cerium and molybdenum using Rutherford Backscattering Spectroscopy (RBS), Scanning Electron Microscopy (SEM), Scanning Auger Electron Spectroscopy and Forward Recoil Spectroscopy (FRS). In addition, RBS has been used to examine how changes in processing conditions, particularly the treatment temperatures, influences the coating thickness and Ce distribution at each process step. SEM established that a crazed oxide structure was developed over the matrix of the alloy using the above process steps. RBS was chosen to provide elemental concentration versus depth information on these samples since it is largely insensitive to surface topography when the detector is set to high scattering angles. A other advantage of using RBS for this particular system is that the heavy elements incorporated into the coating such as Ce and Mo because of their high atomic number compared to the aluminium oxide, are well separated from aluminium and oxygen at their higher recoil energies. Forward Recoil Spectroscopy is capable of detecting hydrogen and it has been used to confirm that the coating is hydrated and to establish the hydrogen distribution within the final oxide coating on each alloy. 7 refs., 1 tab., 4 figs.
International Nuclear Information System (INIS)
Beck, L.; Pichon, L.; Moignard, B.; Guillou, T.; Walter, P.
2011-01-01
For many years, ion beam analysis techniques have successfully been used to the study of cultural heritage objects. The chemical composition of work art is usually determined by PIXE, but in many cases, RBS and/or PIGE can provide useful complementary information. RBS gives information about the depth distribution and concentration in light elements, such as carbon and oxygen. In the past years, the experimental facilities at the AGLAE (Accélérateur Grand Louvre d’Analyse Élémentaire) accelerator has been progressively developed in order to apply simultaneously PIXE, PIGE and RBS under optimal conditions using an external beam. This combination is now routinely used for point analyses or mappings. In this contribution, we present several examples of applications: manufacturing technology of lustre-decorated ceramics and silver plating, control of altered or restored surfaces, and quantification of organic phase in painting and bone. The final conclusion is that the association of PIXE with RBS is very attractive for the investigation of cultural heritage objects, in particular of materials containing both mineral and organic components or possessing a multilayered structure. The first results of the production of monochromatic X-rays for radiography purposes by PIXE are also presented.
vNet Zero Energy for Radio Base Stations- Balearic Scenario
DEFF Research Database (Denmark)
Sabater, Pere; Mihovska, Albena Dimitrova; Pol, Andreu Moia
2016-01-01
The Balearic Islands have one of the best telecommunications infrastructures in Spain, with more than 1500 Radio Base Stations (RBS) covering a total surface of 4.991,66 km². This archipelago has high energy consumption, with high CO2 emissions, due to an electrical energy production system mainly...... based on coal and fossil fuels which is not an environmentally sustainable scenario. The aim of this study is to identify the processes that would reduce the energy consumption and greenhouse gas emissions, designing a target scenario featuring "zero CO2 emissions" and "100% renewable energies" in RBS....... The energy costs, CO2 emissions and data traffic data used for the study are generated by a sample of RBS from the Balearic Islands. The results are shown in terms of energy performance for a normal and net zero emissions scenarios....
Micro- and macro-structure of implantation-induced disorder in Ge
Glover, C J; Byrne, A P; Yu, K M; Foran, G J; Clerc, C; Hansen, J L; Nylandsted-Larsen, A
2000-01-01
The structure of ion implantation-induced damage in Ge substrates has been investigated with a combination of ion- and photon-based techniques including Rutherford backscattering spectrometry (RBS), perturbed angular correlation (PAC) and extended X-ray absorption fine structure (EXAFS) spectroscopy. For MeV Ge ion implantation at -196 degrees C, the dose dependence of the decrease in local atomic order, determined from EXAFS and PAC, was compared to the number of displaced atoms determined from RBS measurements. An EXAFS determined damage fraction was shown to be a better estimate of amorphous fraction than the number of displaced atoms. PAC was used to elucidate the evolution of defective configurations, and was compared to the RBS and EXAFS results. A fit to the overlap model with the overlap of two ion cascades for complete amorphization best described the experimental results. (16 refs).
Multiple scattering effects in depth resolution of elastic recoil detection
International Nuclear Information System (INIS)
Wielunski, L.S.; Harding, G.L.
1998-01-01
Elastic Recoil Detection (ERD) is used to profile hydrogen and other low mass elements in thin films at surface and interfaces in a similar way that Rutherford Backscattering Spectroscopy (RBS) is used to detect and profile heavy elements. It is often assumed that the depth resolutions of these two techniques are similar. However, in contrast to typical RBS, the depth resolution of ERD is limited substantially by multiple scattering. In experimental data analysis and/or spectra simulations of a typical RBS measurement multiple scattering effects are often ignored. Computer programs used in IBA, such as RUMP, HYPRA or RBX do not include multiple scattering effects at all. In this paper, using practical thin metal structures with films containing intentionally introduced hydrogen, we demonstrate experimental ERD depth resolution and sensitivity limitations. The effects of sample material and scattering angle are also discussed. (authors)
Laser annealing of ion implanted silicon by the aid of a Q-switched neodymium glass laser
International Nuclear Information System (INIS)
Exner, H.; Laemmel, B.; Zscherpe, G.
1984-01-01
Experimental results of laser annealing of arsenic implanted silicon are presented. Different depths of melting are obtained by varying the energy flux density of the Q-switched neodymium glass laser. The annealed samples are studied by the aid of optical microscopy, scanning electron microscopy, Rutherford backscattering spectrometry (RBS) combined with ion channeling, and of resistance measurements. Not any defect could be found by RBS and no surface structure could be determined by microscopy
Hallam, Jamile Machado
2016-01-01
O aproveitamento energético obtido pela digestão anaeróbia é uma alternativa viável para o tratamento de resíduos alimentares, no entanto requer um estrito controle operacional. A escolha da melhor condição de partida pelo cálculo da relação substrato/inóculo (S/I) em termos de Sólidos voláteis (SV) pode facilitar estabilização do processo, resultando em elevada produtividade de biogás e teor de metano. Este estudo testou 5 diferentes relações de S/I em regime de batelada a 35oC, visando a es...
Produção de biodisel : processo e caracterizações
Nivea de Lima da Silv
2010-01-01
Resumo: O biodiesel (ésteres) é um combustível que pode ser produzido a partir de óleos vegetais, gorduras animais e óleo de origem microbiana (algas, fungos e bactérias). As matérias-primas são convertidas em biodiesel por meio de uma reação química envolvendo álcool e catalisador. Esta reação é chamada de transesterificação ou etanólise, caso o álcool for o etanol. Neste trabalho, foi realizada a produção de biodiesel utilizando os seguintes sistemas: reator em batelada, processo de destila...
Styrene photocatalytic degradation reaction kinetics
Taffarel, Silvio R.; Lansarin, Marla A.; Moro, Celso C.
2011-01-01
A reação de degradação fotocatalítica do estireno foi estudada utilizando-se TiO2 P-25 (Degussa) como catalisador. Os experimentos foram realizados em um reator “slurry” em bateladas, com controle de temperatura, empregando-se uma lâmpada UV. Foram estudados os efeitos do pH, da concentração inicial de estireno, da concentração do catalisador e da adição de H2O2 sobre a velocidade da reação. Os resultados mostraram que, em 90 min, cerca de 95% da quantidade inicial da molécula foi consumida p...
International Nuclear Information System (INIS)
Hoetzel, Isidro; Cheevers, William P.
2005-01-01
The caprine arthritis-encephalitis (CAEV) and ovine maedi-visna (MVV) viruses are resistant to antibody neutralization, a feature shared with all other lentiviruses. Whether the CAEV gp135 receptor binding site(s) (RBS) in the functional surface envelope glycoprotein (Env) is protected from antibody binding, allowing the virus to resist neutralization, is not known. Two CAEV gp135 regions were identified by extrapolating a gp135 structural model that could affect binding of antibodies to the RBS: the V1 region and a short sequence analogous in position to the human immunodeficiency virus type 1 gp120 loop B postulated to be located between two major domains of CAEV gp135. Mutation of isoleucine-166 to alanine in the putative loop B of gp135 increased the affinity of soluble gp135 for the CAEV receptor(s) and goat monoclonal antibody (Mab) F7-299 which recognizes an epitope overlapping the gp135 RBS. The I166A mutation also stabilized or exposed the F7-299 epitope in anionic detergent buffers, indicating that the I166A mutation induces conformational changes and stabilizes the RBS of soluble gp135 and enhances Mab F7-299 binding. In contrast, the affinity of a V1 deletion mutant of gp135 for the receptor and Mab F7-299 and its structural stability did not differ from that of the wild-type gp135. However, both the I166A mutation and the V1 deletion of gp135 increased cell-to-cell fusion activity and binding of Mab F7-299 to the oligomeric Env. Therefore, the CAEV gp135 RBS is protected from antibody binding by mechanisms both dependent and independent of Env oligomerization which are disrupted by the V1 deletion and the I166A mutation, respectively. In addition, we found a correlation between side-chain β-branching at amino acid position 166 and binding of Mab F7-299 to oligomeric Env and cell-to-cell fusion, suggesting local secondary structure constraints in the region around isoleucine-166 as one determinant of gp135 RBS exposure and antibody binding
New layout of time resolved beam energy spectrum measurement for dragon-I
International Nuclear Information System (INIS)
Liao Shuqing; Zhang Kaizhi; Shi Jinshui
2010-01-01
A new layout of time resolved beam energy spectrum measurement is proposed for Dragon-I by a new method named RBS (rotating beams in solenoids). The basic theory of RBS and the new layout are presented and the measuring error is also discussed. The derived time resolved beam energy spectrum is discrete and is determined by measuring the beam's rotating angle and expanding width through a group of solenoids at the export of Dragon-I. (authors)
Multiple scattering effects in depth resolution of elastic recoil detection
Energy Technology Data Exchange (ETDEWEB)
Wielunski, L.S.; Harding, G.L. [Commonwealth Scientific and Industrial Research Organisation (CSIRO), Lindfield, NSW (Australia). Telecommunications and Industrial Physics; Szilagyi, E. [KFKI Research Institute for Particle and Nuclear Physics, Budapest, (Hungary)
1998-06-01
Elastic Recoil Detection (ERD) is used to profile hydrogen and other low mass elements in thin films at surface and interfaces in a similar way that Rutherford Backscattering Spectroscopy (RBS) is used to detect and profile heavy elements. It is often assumed that the depth resolutions of these two techniques are similar. However, in contrast to typical RBS, the depth resolution of ERD is limited substantially by multiple scattering. In experimental data analysis and/or spectra simulations of a typical RBS measurement multiple scattering effects are often ignored. Computer programs used in IBA, such as RUMP, HYPRA or RBX do not include multiple scattering effects at all. In this paper, using practical thin metal structures with films containing intentionally introduced hydrogen, we demonstrate experimental ERD depth resolution and sensitivity limitations. The effects of sample material and scattering angle are also discussed. (authors). 19 refs., 4 figs.
Thomas, M V; Hersom, M J; Thrift, T A; Yelich, J V
2017-01-01
The objective of this study was to examine the use of 2 byproduct supplements and conserved warm-season forage as winter feeding options for primiparous beef cows. Gestating Angus ( = 48) and Brangus ( = 24) 2-yr-old cows were stratified by BW and breed to 1 of 12 pens. Pens were randomly assigned 1 of 2 supplements, wet brewers' grains (WBG) or dried distillers' grains (DDG). Coastal bermudagrass hay or round bale silage (RBS) was fed free choice (6 pens each) and cows received WBG or DDG supplements at a daily rate of 0.05% BW (DM basis) prorated for feeding 3 d/wk. Total BW and BCS changes did not differ ( = 0.65 and = 0.93, respectively) between DDG- and WBG-supplemented cows. Total amount of forage DM offered and mean calculated daily forage DM offered did not differ ( = 0.59 and = 0.20, respectively) between supplement treatments. Estimated daily mean and total supplement DM offered was greater ( forage sources were used in an unbalanced 6 × 4 design to measure intake, digestibility, and rumen parameters in ruminally fistulated steers. Supplement did not affect forage DMI of hay ( = 0.31) or RBS ( = 0.63). Total DMI was not different ( = 0.37 and = 0.73) for hay-based and RBS-based diets, respectively. Total tract digestibility tended to be greater ( = 0.06) for DDG than for WBG in hay diets but was not different ( = 0.76) for RBS diets. Daily mean ruminal pH was greater ( = 0.03) for WBG than for DDG when supplemented to hay-based diets. In RBS diets, a supplement × hour interaction ( = 0.05) existed for ruminal pH. Daily mean ruminal ammonia N concentration was greater ( forage. High-moisture forage sources can be coupled with high-moisture byproduct supplements.
A part toolbox to tune genetic expression in Bacillus subtilis
Guiziou, Sarah; Sauveplane, Vincent; Chang, Hung-Ju; Clerté, Caroline; Declerck, Nathalie; Jules, Matthieu; Bonnet, Jerome
2016-01-01
Libraries of well-characterised components regulating gene expression levels are essential to many synthetic biology applications. While widely available for the Gram-negative model bacterium Escherichia coli, such libraries are lacking for the Gram-positive model Bacillus subtilis, a key organism for basic research and biotechnological applications. Here, we engineered a genetic toolbox comprising libraries of promoters, Ribosome Binding Sites (RBS), and protein degradation tags to precisely tune gene expression in B. subtilis. We first designed a modular Expression Operating Unit (EOU) facilitating parts assembly and modifications and providing a standard genetic context for gene circuits implementation. We then selected native, constitutive promoters of B. subtilis and efficient RBS sequences from which we engineered three promoters and three RBS sequence libraries exhibiting ∼14 000-fold dynamic range in gene expression levels. We also designed a collection of SsrA proteolysis tags of variable strength. Finally, by using fluorescence fluctuation methods coupled with two-photon microscopy, we quantified the absolute concentration of GFP in a subset of strains from the library. Our complete promoters and RBS sequences library comprising over 135 constructs enables tuning of GFP concentration over five orders of magnitude, from 0.05 to 700 μM. This toolbox of regulatory components will support many research and engineering applications in B. subtilis. PMID:27402159
Martensite transformation in antimony implanted stainless steel
International Nuclear Information System (INIS)
Johnson, E.; Littmark, U.; Johansen, A.; Christodoulides, C.
1981-01-01
The authors have used Rutherford backscattering analysis (RBS) and transmission electron microscopy (TEM) and diffraction to investigate austenitic stainless steel crystals implanted at room temperature with 80 keV Sb + ions to a fluence of 5 x 10 20 ions/m 2 , thus providing implantation with a heavy group V element. RBS channeling spectra from implanted crystals show a damage peak which approaches the height of the random level and therefore indicates a very high degree of disorder in the implanted layers. The distribution of the disorder extends to a depth 3-5 times the depth of the primary radiation damage. The Sb peaks under channeling as well as random conditions are indistinguishable, confirming that substitutionality during implantation is negligible. To establish the nature of the disorder which cannot be assessed from the RBS analysis alone, and in particular to assess whether an amorphous alloy is formed in the implanted layer as indicated from the RBS spectra, samples implanted under similar conditions were investigated in the TEM. Significant extra spots in the patterns can be ascribed to the presence of a radiation induced b.c.c. phase of martensitic origin. The result that a significant amount of martensite can be induced by antimony implantation seems to indicate that the main driving force for the transition is due to damage induced stress concentrations. (Auth.)
Comparação das habilidades auditivas e visuais em paralíticos cerebrais diplégicos
Directory of Open Access Journals (Sweden)
Dionísia Aparecida Cusin Lamônica
2014-04-01
Full Text Available Objetivo comparar o desempenho das habilidades psicolinguísticas auditivas e visuais de crianças com PC-D. Métodos participaram dez crianças com PC-D, classificados por meio da escala Gross Motor Function Measure System (GMFMS, de idade entre quatro anos e um mês a cinco anos e seis meses. A avaliação fonoaudiológica constou de entrevista com responsável, análise de prontuário e aplicação dos subtestes auditivos e visuais do Teste de Illinois de Habilidades Psicolinguísticas (ITPA. O tratamento estatístico constou de análise descritiva e aplicação do teste de Wilcoxon (nível de significância foi p≤ 0,05. Resultados os subtestes que obtiverem os menores escores foram na memória sequencial auditiva e memória sequencial visual. Na comparação entre as habilidades auditivas e visuais somente houve diferenças estatisticamente significante nos subtestes de recepção e associação. O grupo se comportou de forma heterogênea. Este estudo pretende chamar atenção para esta questão, pois se considera que estas habilidades são de extrema importância para o desenvolvimento das habilidades linguísticas e comunicativas que devem ser pensadas nos programas de reabilitação destes indivíduos. Conclusão houve diferenças estatisticamente significantes nos subtestes auditivos e visuais de recepção e associação nesta população.
Directory of Open Access Journals (Sweden)
Adriana Cristina Bordignon
2012-03-01
Full Text Available Objetivou-se caracterizar peles de tilápia-do-nilo, conservadas por congelamento e salga a seco, visando à extração de gelatina em processo batelada. Após a filetagem, as peles foram descarnadas e distribuídas em dois lotes. Um dos lotes foi congelado a -18 ºC por sete dias e o outro foi salgado e mantido a 25 ºC por sete dias. As peles foram lavadas, pesadas e pré-tratadas em solução de H2SO4 a10N (pH 3,0, na proporção de 1:6 (pele:água por uma hora a 24 ºC. Extraiu-se a gelatina em banho-maria a 50 ºC por uma hora e retirou-se uma amostra para análise do perfil molecular. O restante foi congelado a -18 ºC. Foram realizadas análises físico-químicas das peles e das gelatinas líquidas, do perfil molecular com as gelatinas e análises microbiológicas das peles. As peles congeladas e salgadas apresentaram, respectivamente, 78,13 e 76,46% de umidade; 18,16 e 19,59% de proteína bruta; 2,26 e 1,90% de extrato etéreo e 1,44 e 2,06% de cinzas. Nas gelatinas líquidas extraídas das peles congeladas e salgadas, a umidade foi de 97,68 e 96,08%, o conteúdo de proteína bruta de 3,18 e 4,12%, de extrato etéreo 0,29 e 0,18% e de cinzas de 2,31 e 3,03%, respectivamente. Os valores da força de gel e viscosidade foram maiores para a gelatina de peles salgadas (200 g e 19,02mPas em comparação à gelatina de peles conservadas pelo congelamento (12,7 g e 9,16mPas. O perfil molecular foi menor na gelatina extraída a partir de peles congeladas, portanto houve perda de β e γ-componentes, que indica grande degradação do colágeno decorrente do método de conservação.The objective was to characterize Nile tilapia skins, freeze- and dry salt dry-preserved to extract gelatins by batch processing. After filleting, the skins were separated from the meat and distributed into two lots: In one, skins were frozen for 7 days (-18 ºC; and in the other, skins were salted for seven days (25 ºC. The skins were rinsed, weighed and pretreated in
Using Rutherford Backscattering Spectroscopy to Characterize Targets for MTW
Brown, Gunnar; Stockler, Barak; Ward, Ryan; Freeman, Charlie; Padalino, Stephen; Stillman, Collin; Ivancic, Steven; Reagan, S. P.; Sangster, T. C.
2017-10-01
A study is underway to determine the composition and thickness of targets used at the Multiterawatt (MTW) laser facility at the Laboratory for Laser Energetics (LLE) using Rutherford backscattering spectroscopy (RBS). In RBS, an ion beam is incident on a sample and the scattered ions are detected with a surface barrier detector. The resulting energy spectra of the scattered ions can be analyzed to determine important parameters of the target including elemental composition and thickness. Proton, helium and deuterium beams from the 1.7 MV Pelletron accelerator at SUNY Geneseo have been used to characterize several different targets for MTW, including CH and aluminum foils of varying thickness. RBS spectra were also obtained for a cylindrical iron buried-layer target with aluminum dopant which was mounted on a silicon carbide stalk. The computer program SIMNRA is used to analyze the spectra. This work was funded in part by a Grant from the DOE through the Laboratory for Laser Energetics.
Directory of Open Access Journals (Sweden)
Zachary A. Bornholdt
2016-02-01
Full Text Available The filovirus surface glycoprotein (GP mediates viral entry into host cells. Following viral internalization into endosomes, GP is cleaved by host cysteine proteases to expose a receptor-binding site (RBS that is otherwise hidden from immune surveillance. Here, we present the crystal structure of proteolytically cleaved Ebola virus GP to a resolution of 3.3 Å. We use this structure in conjunction with functional analysis of a large panel of pseudotyped viruses bearing mutant GP proteins to map the Ebola virus GP endosomal RBS at molecular resolution. Our studies indicate that binding of GP to its endosomal receptor Niemann-Pick C1 occurs in two distinct stages: the initial electrostatic interactions are followed by specific interactions with a hydrophobic trough that is exposed on the endosomally cleaved GP1 subunit. Finally, we demonstrate that monoclonal antibodies targeting the filovirus RBS neutralize all known filovirus GPs, making this conserved pocket a promising target for the development of panfilovirus therapeutics.
Damage recovery in ZnO by post-implantation annealing
International Nuclear Information System (INIS)
Audren, A.; Hallen, A.; Linnarsson, M.K.; Possnert, G.
2010-01-01
ZnO bulk samples were implanted with 200 keV-Co ions at room temperature with two fluences, 1 x 10 16 and 8 x 10 16 cm -2 , and then annealed in air for 30 min at different temperatures up to 900 o C. After the implantation and each annealing step, the samples were analyzed by Rutherford backscattering spectrometry (RBS) in random and channeling directions to follow the evolution of the disorder profile. The RBS spectra reveal that disorder is created during implantation in proportion to the Co fluence. The thermal treatments induce a disorder recovery, which is however, not complete after annealing at 900 o C, where about 15% of the damage remains. To study the Co profile evolution during annealing, the samples were, in addition to RBS, characterized by secondary ion mass spectrometry (SIMS). The results show that Co diffusion starts at 800 o C, but also that a very different behavior is seen for Co concentrations below and above the solubility limit.
International Nuclear Information System (INIS)
Carter, G.; Elliman, R.G.
1983-01-01
Rutherford scattering and channelling of light probe ions (e.g. He + ) has been extensively used for studies of disorder production in ion implanted semiconductors. Various authors have analysed models of amorphousness accumulation and Carter and Webb have indicated the general difficulties in assessing disorder production models from RBS/channelling studies if the production modes are complex and the manner in which the technique responds to different defect structures is unspecified. For less complex disorder production modes and by making reasonable assumptions about the technique response however, some insight into the form of backscattering yield - ion implant fluence functions can be obtained as is discussed in the present communication. It thus becomes possible to infer the importance of different disorder generation processes from RBS/channelling - ion influence studies. It will also be shown how simple annealing processes modify disorder accumulation and thus again how the operation of such processes may be inferred from RBS/channelling - ion fluence measurements. (author)
Co-digestion of wheat and rye bread suspensions with source-sorted municipal biowaste.
Li, Chaoran; Mörtelmaier, Christoph; Winter, Josef; Gallert, Claudia
2015-06-01
Acidification of wheat bread (WBS), rye bread (RBS) and fresh biowaste suspensions (FBS), leading to lactate+acetate, lactate+acetate+n-buyrate, and acetate+propionate+n-butyrate, respectively, and biogas production as well as population dynamics were investigated. Co-fermentation of FBS (14 kg m(-3) d(-1) organic loading rate (OLR)) with WBS or RBS was stable up to an OLR of 22 kg m(-3) d(-1) and resulted in up to 3 times as much biogas. During co-fermentation at more than 20 kg m(-3) d(-1) OLR the total population increased more than 2-fold, but the originally low share of propionate-oxidizing bacteria significantly decreased. The proportion of methanogens also decreased. Whereas the proportion of Methanosarcinales to Methanomicrobiales in biowaste and biowaste+WBS remained constant, Methanosarcinales and in particular Methanosaeta spec. in the biowaste+RBS assay almost completely disappeared. Methanomicrobiales increased instead, indicating propionate oxidation via acetate cleavage to CO2 and hydrogen. Copyright © 2015 Elsevier Ltd. All rights reserved.
Reijme, M A; Simons, D P L; Schok, M; Ijzendoorn, L J V; Brongersma, H H; De Voigt, M J A
2002-01-01
A combination of low- and high-energy ion beam analysis techniques was used to determine the distribution of indium chloride compounds in model polymeric light-emitting diodes (p-LEDs). Parts of polymeric LEDs (polydialkoxyphenylenevinylene (OC sub 1 C sub 1 sub 0 -PPV) on indium-tin-oxide (ITO) substrates) were exposed to a HCl/Ar flow to simulate the processes occurring during conversion of precursor PPVs and acid treatment of polymers. Samples with variable exposure times as well as pristine samples were studied with Rutherford backscattering spectrometry (RBS), low energy ion scattering (LEIS), X-ray photoelectron spectroscopy (XPS) and particle induced X-ray emission (PIXE). The RBS measurements show that after HCl exposure indium is distributed throughout the OC sub 1 C sub 1 sub 0 -PPV layer. LEIS and XPS measurements indicate that the indium and chlorine are present at the outermost surface of the OC sub 1 C sub 1 sub 0 -PPV layer. PIXE measurements in combination with the RBS data demonstrate that th...
KINERJA ALGORITMA PARALEL UNTUK PENCARIAN KATA DENGAN METODE BOYER-MOORE MENGGUNAKAN PVM
Directory of Open Access Journals (Sweden)
Maria Angela Kartawidjaja
2009-01-01
Full Text Available Search process is one of important activity in data processing. Searching can take more time if conducted in the huge search space. Therefore, it is needed an efficient search technique. One technique that can be used is parallel computing. This article discusses the search process in parallel using the Boyer-Moore algorithm. Parallel scope is emulated with PVM (Parallel Virtual Machine software. From the research results, it can be concluded that the performance of parallel computing will increase the word searching compared to the computing performance for its word sequencial search consisting of one letter, and will drop to the word search consisting of two letters or more.
Extrações sequenciais de chumbo e zinco em solos de área de mineração e metalurgia de metais pesados
Kummer,Larissa; Melo,Vander de Freitas; Barros,Yara Jurema; Azevedo,Julio César Rodrigues de
2011-01-01
A extração sequencial permite obter informações mais detalhadas sobre origem, modo de ocorrência, disponibilidade biológica e físico-química, mobilização e transporte dos metais pesados em ambientes naturais. Com o objetivo de estudar as formas de Pb e Zn foram selecionados oito perfis de solos de diferentes locais dentro de área de mineração e metalurgia de Pb, no município de Adrianópolis (PR), Vale do Rio Ribeira. As amostras foram coletadas nas profundidades de 0 a 10, 10 a 20 e 20 a 40 c...
Radiation level survey of a mobile phone base station
International Nuclear Information System (INIS)
Campos, M.C.; Schaffer, S.R.
2006-01-01
Electromagnetic field (E.M.F.) evaluations were carried out in the surroundings of a roof-top mobile-phone radio-base station (R.B.S.). Four of its sector-panel antennas are installed on two parallel vertical masts, each supporting two panels in a vertical collinear-array. The geometry is such that the vertical plane containing both masts is about 10 meters distant and parallel to the backside of an educational institution. This proximity provoked great anxiety among the local community members regarding potential health hazards.1. Introduction: To keep up with the expansion of the mobile-phone services, the number of Radio-Base Stations (R.B.S.) installations is increasing tremendously in Brazil. Efficient control and radiation monitoring to assess R.B.S. compliance to existing regulations are still lacking and particularly in big cities, clearly non - compliant R.B.S. can be seen which represent potentially hazardous E.M.F. sources to the nearby population. This first survey of an irregular R.B.S. revealed significant E-field strengths outside, as well as inside a classroom of an educational building where an usually prolonged stay is necessary. These results confirm that this problem deserves further attention, moreover, if one considers that public and occupational exposure limits set by I.C.N.I.R.P. (also adopted in Brazil) are exclusively based on the immediate thermal effects of acute exposure, disregarding any potential health risk from prolonged exposure to lower level radiation. Research activities focusing on quantitative aspects of electromagnetic radiation from R.B.S., as well as on biological and adverse health effects are still at a very incipient level, urging for immediate actions to improve this scenario in our country. 2. Material, methods and results Measurements were carried out with a broadband field strength monitor, E.M.R.-300 (W and G) coupled to an isotropic E-field probe (100 khz to 3 GHz). Preliminary measurements helped locating
Photoconductivity of Selenium and Sulphur Doped a-Si:H thin Films
SHARMA, Sanjeev Kumar; GUPTA, Himanshu
2014-01-01
The accurate estimation of tree biomass is crucial for the efficient management of forest resources. In this study, we used a subsampling method for unbiased estimates of above-ground tree biomass. The method consists of 2 stages: the first stage consists of randomized branch sampling (RBS) and the second stage uses importance sampling (IS). RBS is used to select a path from the butt of an object branch to a terminal segment. IS is used for selecting a disk that produces unbiased estimates of...
Avaliação da nanofiltração e da osmose inversa na remoção de carbofurano em águas de abastecimento
Directory of Open Access Journals (Sweden)
Marcelo Zawadzki Bueno
Full Text Available RESUMO: A complexidade físico-química de micropoluentes, como os defensivos agrícolas, exige o uso de tecnologias avançadas de tratamento de água para abastecimento. O objetivo deste estudo foi avaliar a remoção de carbofurano em nível de bancada (batelada utilizando membranas comerciais de nanofiltração (NF90 - DowFilmtec (r e osmose inversa (HR - Koch Membrane Systems(r . Nos experimentos foi avaliada a influência da qualidade da matriz de alimentação (água ultrapura, bruta e pré-tratada contendo carbofurano (50 µgL-1, e da pressão de operação (8 e 15 bar para a NF90 e 15 e 30 bar para a HR. Para a NF90, com a matriz de água ultrapura, as eficiências de remoção foram inferiores (89,8%, porém o fluxo permeado foi superior (132,1 Lm-2h-1 àquelas obtidas com a matriz de água bruta (98,4% - 94,7 Lm-2h-1 e água pré-tratada (95,2% - 95,3 Lm-2h-1 para a pressão de 15 bar. Para a membrana HR, remoções relativamente superiores foram observadas para a pressão de 30 bar para as três matrizes, com a água bruta apresentando os melhores resultados (99,7% - 49,7 Lm-2h-1. Concluiu-se, portanto, que o pré-tratamento da água bruta não acarretou diferença significativa na remoção do carbofurano e não influenciou no fluxo de permeado de acordo com a metodologia adotada (baixo tempo de separação em batelada com recirculação.
Assessment of Safety Culture within the Pakistan Nuclear Regulatory Authority (PNRA)
Energy Technology Data Exchange (ETDEWEB)
Afzal, Muhammad [Pakistan Nuclear Regulatory Authority, Islamabad (Pakistan); Choi, Kwang Sik [Korea Institute of Nuclear Safety, Daejeon (Korea, Republic of)
2015-10-15
The objective of this study is to assess the SC of the Pakistan Nuclear Regulatory Authority (PNRA) by developing a performance indicator-based questionnaire. Aspects that potentially play important roles in developing perceptions of SC, including age, type of job, gender and duty hours of regulatory staff, are given due importance in this study. The study also identifies the strengths and weaknesses in the SC of the PNRA and can be used as a model study to assess the SC of other RBs. The questionnaire, developed to assess the SC of the PNRA, was in line with the PNRA's own defined attributes for SC. In the past, significant efforts have been made to ensure the safe operation of NPPs by improving designs and operating procedures; however, the nuclear accident at the Fukushima NPP in Japan in March 2011 revealed that the currently allotted hardware safety margins are not sufficient, and much work is needed to improve safety management in terms of SC. Initially, the concept of SC was introduced for operating organizations to ensure safe operation of NPPs; nonetheless, more recent investigations of nuclear events and accidents, especially Fukushima, and at Davis-Besse, in the US, have revealed that a strong focus is required to address and improve the SC of Regulatory Bodies (RBs). Strong SC is considered a vital tool for RBs to achieve their objectives and discharge their responsibilities in an effective and efficient manner. Though the relationship between the SC of RBs and that of operating organizations is not straight forward, it is believed that the former has a strong influence over the latter. The questionnaire was consistent in terms of the credible nature of its questions, and the response group covered different levels of PNRA staff, from managers to lower level staff. The results show that the PNRA staff have a very good understanding of the nature and significance of attributes of SC and are doing their best to exercise the same within the
Assessment of Safety Culture within the Pakistan Nuclear Regulatory Authority (PNRA)
International Nuclear Information System (INIS)
Afzal, Muhammad; Choi, Kwang Sik
2015-01-01
The objective of this study is to assess the SC of the Pakistan Nuclear Regulatory Authority (PNRA) by developing a performance indicator-based questionnaire. Aspects that potentially play important roles in developing perceptions of SC, including age, type of job, gender and duty hours of regulatory staff, are given due importance in this study. The study also identifies the strengths and weaknesses in the SC of the PNRA and can be used as a model study to assess the SC of other RBs. The questionnaire, developed to assess the SC of the PNRA, was in line with the PNRA's own defined attributes for SC. In the past, significant efforts have been made to ensure the safe operation of NPPs by improving designs and operating procedures; however, the nuclear accident at the Fukushima NPP in Japan in March 2011 revealed that the currently allotted hardware safety margins are not sufficient, and much work is needed to improve safety management in terms of SC. Initially, the concept of SC was introduced for operating organizations to ensure safe operation of NPPs; nonetheless, more recent investigations of nuclear events and accidents, especially Fukushima, and at Davis-Besse, in the US, have revealed that a strong focus is required to address and improve the SC of Regulatory Bodies (RBs). Strong SC is considered a vital tool for RBs to achieve their objectives and discharge their responsibilities in an effective and efficient manner. Though the relationship between the SC of RBs and that of operating organizations is not straight forward, it is believed that the former has a strong influence over the latter. The questionnaire was consistent in terms of the credible nature of its questions, and the response group covered different levels of PNRA staff, from managers to lower level staff. The results show that the PNRA staff have a very good understanding of the nature and significance of attributes of SC and are doing their best to exercise the same within the
Goh, Elaine Suk-Ying; Li, Chumei; Horsburgh, Sheri; Kasai, Yumi; Kolomietz, Elena; Morel, Chantal France
2010-02-01
Roberts syndrome (RBS) (OMIM #268300) is a rare autosomal recessive disorder characterized by tetraphocomelia (symmetrical limb reduction), craniofacial anomalies, growth retardation, mental retardation, cardiac and renal abnormalities. The syndrome is caused by mutations in the ESCO2 (establishment of cohesion 1 homolog 2) (Entrez 609353) gene, which is located at 8p21.1, and encodes a protein essential in establishing sister chromatid cohesion during S phase. SC phocomelia (SC) (OMIM #269000), has less severe symmetric limb reduction, flexion contractures of various joints, minor facial anomalies, growth retardation and occasionally, mental retardation. These two syndromes can be considered part of a spectrum, with RBS at the most severe range in which severely affected infants may be stillborn or die in the post-natal period, while individuals with SC phocomelia represent the milder end of the spectrum and typically survive to adulthood. In both presentations, karyotype investigations characteristically reveal premature centromere separation (PCS), otherwise known as heterochromatin repulsion or puffing. There is little literature about the follow-up of adults with the spectrum of RBS/SC phocomelia or their recommended management. We report on an adult presentation of RBS/SC phocomelia spectrum disorder with a history of major cardiac malformation in childhood, normal limbs on physical examination, mild facial anomalies, mild learning difficulties, and PCS. Molecular studies of ESCO2 have confirmed the diagnosis. A literature review, focussing on adult manifestations of this condition and a discussion of follow-up guidelines are presented. Copyright 2010 Wiley-Liss, Inc.
Shechner, M; Tas, E
2017-12-19
Reactive iodine and bromine species (RIS and RBS, respectively) are known for altering atmospheric chemistry and causing sharp tropospheric ozone (O 3 ) depletion in polar regions and significant O 3 reduction in the marine boundary layer (MBL). Here we use measurement-based modeling to show that, unexpectedly, both RIS and RBS can lead to enhanced O 3 formation in a polluted marine environment under volatile organic compound (VOC)-limited conditions associated with high nitrogen oxide (NO X = [NO] + [NO 2 ]) concentrations. Under these conditions, the daily average O 3 mixing ratio increased to ∼44 and ∼28% for BrO and IO mixing ratios of up to ∼6.8 and 4.7 ppt, respectively. The increase in the level of O 3 was partially induced by enhanced ClNO 3 formation for higher Br 2 and I 2 emission flux. The increase in the level of O 3 was associated with an increased mixing ratio of hydroperoxyl radical to hydroxyl radical ([HO 2 ]/[OH]) and increased [NO 2 ]/[NO] with higher levels of RBS and/or RIS. NO X -rich conditions are typical of the polluted MBL, near coastlines and ship plumes. Considering that O 3 is toxic to humans, plants, and animals and is a greenhouse gas, our findings call for adequate updating of local and regional air-quality models with the effects of activities of RBS and RIS on O 3 mixing ratios in the polluted MBL.
Structural Analysis of InxGa1−xN/GaN MQWs by Different Experimental Methods
International Nuclear Information System (INIS)
Ding Bin-Beng; Pan Feng; Fa Tao; Cheng Feng-Feng; Yao Shu-De; Feng Zhe-Chuan
2011-01-01
Structural properties of In x Ga 1−x N/GaN multi-quantum wells (MQWs) grown on sapphire by metal organic chemical vapor deposition are investigated by synchrotron radiation x-ray diffraction (SRXRD), Rutherford backscattering/channelling (RBS/C) and high-resolution transmission electron microscopy. The sample consists of eight periods of In x Ga 1−x N/GaN wells of 2.1 nm thickness and 8.5 nm thickness of GaN barrier, and the results are very close, which verifies the accuracy of the three methods. The indium content in In x Ga 1−x N/GaN MQWs by SRXRD and RBS/C is estimated, and results are in general the same. By RBS/C random spectra, the indium atomic lattice substitution rate is 94.0%, indicating that almost all indium atoms in In x Ga 1−x N/GaN MQWs are at substitution, that the indium distribution of each layer in In x Ga 1−x N/GaN MQWs is very homogeneous and that the In x Ga 1−x N/GaN MQWs have a very good crystalline quality. It is not accurate to estimate indium content in In x Ga 1−x N/GaN MQWs by photoluminescence (PL) spectra, because the result from the PL experimental method is very different from the results by the SRXRD and RBS/C experimental methods. (cross-disciplinary physics and related areas of science and technology)
Micro-PIXE for the quantitative imaging of chemical elements in single cells
International Nuclear Information System (INIS)
Ortega, R.
2013-01-01
Full text: The knowledge of the intracellular distribution of biological relevant metals is important to understand their mechanisms of action in cells, either for physiological, toxicological or pathological processes. However, the direct detection of trace metals in single cells is a challenging task that requires sophisticated analytical developments. The aim of this seminar will be to present the recent achievements in this field using micro-PIXE analysis. The combination of micro-PIXE with RBS (Rutherford Backscattering Spectrometry) and STIM (Scanning Transmission lon Microscopy) allows the quantitative determination of trace metal content within sub-cellular compartments. The application of STlM analysis will be more specifically highlighted as it provides high spatial resolution imaging (<200 nm) and excellent mass sensitivity (<0.1 ng). Application of the STIM-PIXE-RBS methodology is absolutely needed when organic mass loss appears during PIXE-RBS irradiation. This combination of STIM-PIXE-RBS provides fully quantitative determination of trace element content, expressed in μg/g, which is a quite unique capability for micro-PIXE compared to other micro-analytical methods such as the electron and synchrotron X-ray fluorescence or the techniques based on mass spectrometry. Examples of micro-PIXE studies for subcellular imaging of trace elements in the various fields of interest will be presented such as metal-based toxicology, pharmacology, and neuro degeneration [1] R. Ortega, G. Devés, A. Carmona. J. R. Soc. Interface, 6, (2009) S649-S658. (author)
Co-digestion of wheat and rye bread suspensions with source-sorted municipal biowaste
International Nuclear Information System (INIS)
Li, Chaoran; Mörtelmaier, Christoph; Winter, Josef; Gallert, Claudia
2015-01-01
Graphical abstract: Volatile fatty acid spectra of acidified WBS, RBS or FBS differ, but methanogenesis is similar. Display Omitted - Highlights: • Biogas improvement by co-digestion of wheat and rye bread. • Increased population density at high organic loading rates. • Less Pelotomaculum but increased numbers of Syntrophobacter and Smithella found in rye bread reactor. • Replacement of Methanosarcinales by acetate-oxidizers in rye bread co-digestion. • Increasing proportion of Methanomicrobiales in biowaste + rye bread reactor. - Abstract: Acidification of wheat bread (WBS), rye bread (RBS) and fresh biowaste suspensions (FBS), leading to lactate+acetate, lactate+acetate+n-buyrate, and acetate+propionate+n-butyrate, respectively, and biogas production as well as population dynamics were investigated. Co-fermentation of FBS (14 kg m −3 d −1 organic loading rate (OLR)) with WBS or RBS was stable up to an OLR of 22 kg m −3 d −1 and resulted in up to 3 times as much biogas. During co-fermentation at more than 20 kg m −3 d −1 OLR the total population increased more than 2-fold, but the originally low share of propionate-oxidizing bacteria significantly decreased. The proportion of methanogens also decreased. Whereas the proportion of Methanosarcinales to Methanomicrobiales in biowaste and biowaste+WBS remained constant, Methanosarcinales and in particular Methanosaeta spec. in the biowaste+RBS assay almost completely disappeared. Methanomicrobiales increased instead, indicating propionate oxidation via acetate cleavage to CO 2 and hydrogen
Estudo da descoloração e degradação de corantes azo mediante processo oxidativo avançado: UV/H2O2
Adailton Alves
2009-01-01
Este estudo teve como objetivo o uso de Processos Oxidativos Avançados (POA\\'s), para a descoloração e degradação dos corantes azo (Congo Red) e (Acid Yellow 42) em solução aquosa, sendo realizado em escala de bancada (processo batelada), utilizando-se reator tubular. Utililizou-se o Processo Oxidativo Avançado UV/H2O2, avaliando a influência dos seguintes fatores: concentração dos corantes, pH, temperatura, concentração do H2O2, concentração do NaCl e concentração do Na2SO4. Para a otimizaçã...
Directory of Open Access Journals (Sweden)
Fábio Coelho Sampaio
2003-12-01
Full Text Available Eleven filamentous fungi were screened for xylitol production in batch cultures. Production was generally low under the growth conditions used in this study. Penicillium crustosum presented the highest production, 0.52 g L-1 from 11.50 g L-1 of D-xylose, representing consumption of 76% of the original D-xylose.Foram avaliados onze fungos filamentosos para a produção de xilitol em batelada. A produção foi baixa nas condições de cultivo utilizadas. A máxima, 0,52 g L-1 de xilitol a partir de 11,50 g L-1 de xilose, foi obtida com Penicillium crustosum, com consumo de 76% da xilose inicial.
Simulation of batch adsorption systems; Simulacao de sistemas adsorvedores operando em batelada
Energy Technology Data Exchange (ETDEWEB)
Valerio, Cristiano C.; Neves Junior, Flavio; Stachiw, Rosalvo [Universidade Federal Tecnologica do Parana (UTFPR), Curitiba, PR (Brazil)
2008-07-01
One of the treatments used to adequate the wastewater from petroleum industry according to environmental laws, is the treatment by the adsorption process. Powdered activated carbon is the commonly used adsorber material, for this great affinity with various organic compounds. But there are alternative adsorber materials that can substitute activated carbon, with a low cost, and limited applicability. In this work, will be used the software resulting from Efli project, developed at Federal University of Technology - Parana, to compare the alternative adsorber materials (oil shale compounds and fluid catalytic cracking) efficiency to that of activated carbon. (author)
Directory of Open Access Journals (Sweden)
Cleber Daniel de Goes Maciel
2011-02-01
Full Text Available O uso de misturas de glyphosate, em tanque, para manejo de espécies de plantas daninhas de difícil controle tem sido prática comum entre os agricultores brasileiros. Desta forma, este trabalho teve como objetivo avaliar a eficácia e seletividade de misturas, em tanque, de herbicidas com glyphosate para o controle de trapoeraba (Commelina benghalensis L., erva-de-touro (Tridax procumbens L. e capim-carrapicho (Cenchrus echinatus L. na cultura da soja RR®. O experimento foi conduzido em Maracaí, São Paulo, no período de novembro de 2006 a março de 2007, utilizando-se o cultivar CD-214RR® e delineamento experimental de blocos ao acaso, com 21 tratamentos e quatro repetições. Os tratamentos foram constituídos da aplicação de: glyphosate (180; 360; 540 e 720 g ha-1; glyphosate em sequencial (180/360; 360/360 e 540/360 g ha-1; glyphosate + chlorimuron-ethyl 360+10; 540+10; 360+5/ 360+5 g ha-1; glyphosate + lactofen (360+120; 540+120; 360+60/ 360+60 g ha-1; glyphosate + cloransulam-methyl (360+30; 540+30; 360+16,9/ 360+12,9 g ha-1; glyphosate + carfentrazone (360+4 g ha-1; glyphosate + imazethapyr (360+50 g ha-1; glyphosate + imazethapyr (177,8+30 g ha-1 e testemunhas capinada e sem capina. Apesar da similaridade de produtividade de grãos entre os tratamentos com glyphosate isolado e sequencial, nas doses 540, 720 e 540/ 360 g ha-1, as misturas em tanque com chlorimuron-ethyl, cloransulam-methyl, lactofen e imazethapyr favoreceram o controle de espécies de plantas daninhas tolerantes ao glyphosate como C. benghalensis e T. procumbens.
Dopant site location in dual-implanted GaP using (111) planar channeling
International Nuclear Information System (INIS)
Parikh, N.R.; Kao, C.T.; Lee, D.R.; Muse, J.; Swanson, M.L.; Venkatasubramanian, R.; Timmons, M.
1990-01-01
Previous studies have indicated that dual implantation can efficiently introduce group IV dopant onto selected sub-lattice sites in III--V compound semiconductors, thus enhancing electrical activation. The authors have studied this phenomenon in GaP using Rutherford Backscattering Spectroscopy (RBS) to determine the lattice location of Sn atoms. The authors used single crystals of GaP (100) which had been implanted at 400 degrees C with 120 Sn + following previously implanted 69 Ga + or 31 P + . Energies were selected for equivalent projected ranges, and all species were implanted with doses of 1 x 10 15 atoms/cm 2 . Asymmetry in the angular scan of the {111} planar channel was then used to determine the sub-lattice location of the implanted Sn. RBS results indicated that for all implants Sn atoms were substituting Ga and P sites equally. However, Hall effect measurements gave p type conduction for GaP implanted with Sn alone, while those with prior implants of Ga or P resulted in n-type conduction. RBS and Hall effect results are explained by a vacancy complex model
International Nuclear Information System (INIS)
Guan, P B; Tingatinga, E A; Longalong, R E; Saguid, J
2016-01-01
During the past decades, the complexity of conventional methods to perform seismic performance assessment of buildings led to the development of more effective approaches. The rigid body spring-discrete element method (RBS-DEM) is one of these approaches and has recently been applied to the study of the behavior of reinforced concrete (RC) buildings subjected to strong earthquakes. In this paper, the governing equations of RBS-DEM planar elements subjected to lateral loads and horizontal ground motion are presented and used to replicate the hysteretic behavior of experimental RC columns. The RBS-DEM models of columns are made up of rigid components connected by systems of springs that simulate axial, shear, and bending behavior of an RC section. The parameters of springs were obtained using Response-2000 software and the hysteretic response of the models of select columns from the Pacific Earthquake Engineering Research (PEER) Structural Performance Database were computed numerically. Numerical examples show that one-component models were able to simulate the initial stiffness reasonably, while the displacement capacity of actual columns undergoing large displacements were underestimated. (paper)
Heavy ion elastic recoil detection analysis of optoelectronic and semiconductor devices
Energy Technology Data Exchange (ETDEWEB)
Dytlewski, N.; Cohen, D.D. [Australian Nuclear Science and Technology Organisation, Lucas Heights, NSW (Australia); Johnston, P.; Walker, S. [Royal Melbourne Inst. of Tech., VIC (Australia); Whitlow, H.; Hult, M. [Lund Univ. (Sweden); Oestling, M.; Zaring, C. [Royal Inst. of Tech., Stockholm (Sweden)
1993-12-31
In recent years, the use of heavy ion time-of-flight elastic recoil spectrometry (HIERDA) has been applied to analyse multi-phase, thin layer devices used in optoelectronics, semiconductors and solar power generation. HIERDA gives simultaneously, mass resolved elemental concentration vs depth profiles of the matrix constituents, and is particularly suited to the determination of light elements in a heavy matrix. The beam/target interaction process is similar to RBS, but has the difference that the recoiling target atoms are detected instead of the scattered projectile. High energy, heavy ions beams bombard the sample, ejecting recoil atoms which are detected at a forward angle of 45 deg. A time-of-flight and total energy detection system enables the ejected particle`s mass to be identified, and allows energy spectra to be obtained and interpreted in an analogous way to RBS, but with the important difference that the elemental spectra are separated, and not superimposed on a background as in RBS. Some of the measurements made with a HIERDA system on the ANTARES Tandem Accelerator at ANSTO are described. 1 refs., 4 figs.
Hyperfine and ion beam interaction studies of Sn, Te, I and Sm impurities in silicon
International Nuclear Information System (INIS)
Kemerink, G.J.
1981-01-01
In this thesis the author reports investigations on ion implanted and oven or laser annealed silicon using Moessbauer spectroscopy, Rutherford backscattering (RBS) and channeling, time differential perturbed angular correlation and the Hall-effect. Chapter 1 gives an introduction to this field of research. Chapter 2 deals with an outline of the experimental methods used throughout this work. In chapter 3 results are presented from RBS and channeling experiments on Te-implanted Si. Chapters 4 and 5 concern the results from a study of dopant dependent effects in laser annealed TeSi using 119 Sn, 125 Te and 129 I-Moessbauer spectroscopy. Chapter 6 gives the results from a study of as-implanted and oven annealed TeSi using 129 I-time differential perturbed angular correlation and 129 I-Moessbauer spectroscopy. Chapter 7 describes the results from RBS and channeling experiments on oven and laser annealed ISi. Chapter 8 deals with Hall-effect measurements on TeSi and ISi. Chapter 9 finally covers the investigations of 153 Sm-implanted diamond, Si, Ge and α-Sn using channeling and 153 Eu-Moessbauer spectroscopy. (Auth.)
Heavy ion elastic recoil detection analysis of optoelectronic and semiconductor devices
Energy Technology Data Exchange (ETDEWEB)
Dytlewski, N; Cohen, D D [Australian Nuclear Science and Technology Organisation, Lucas Heights, NSW (Australia); Johnston, P; Walker, S [Royal Melbourne Inst. of Tech., VIC (Australia); Whitlow, H; Hult, M [Lund Univ. (Sweden); Oestling, M; Zaring, C [Royal Inst. of Tech., Stockholm (Sweden)
1994-12-31
In recent years, the use of heavy ion time-of-flight elastic recoil spectrometry (HIERDA) has been applied to analyse multi-phase, thin layer devices used in optoelectronics, semiconductors and solar power generation. HIERDA gives simultaneously, mass resolved elemental concentration vs depth profiles of the matrix constituents, and is particularly suited to the determination of light elements in a heavy matrix. The beam/target interaction process is similar to RBS, but has the difference that the recoiling target atoms are detected instead of the scattered projectile. High energy, heavy ions beams bombard the sample, ejecting recoil atoms which are detected at a forward angle of 45 deg. A time-of-flight and total energy detection system enables the ejected particle`s mass to be identified, and allows energy spectra to be obtained and interpreted in an analogous way to RBS, but with the important difference that the elemental spectra are separated, and not superimposed on a background as in RBS. Some of the measurements made with a HIERDA system on the ANTARES Tandem Accelerator at ANSTO are described. 1 refs., 4 figs.
Ion backscattering and X-ray investigations of violin varnish and wood
International Nuclear Information System (INIS)
Sigurd, D.; Tove, P.A.; Petersson, S.
1980-01-01
The use of Rutherford backscattering (RBS) of ions (i.e. α-particles) and excitation of characteristic X-rays by protons, for determining the elemental composition of the top layers of violin varnish and wood is described. The amount of elements such as C, O, Si, S, Ca, Cu, Fe, Ni, Zn, Pb has been measured, on the varnished and unvarnished sides of wood samples from old instrument makers such as A. Stradivari, G. Guarneri del Gesu, Santo Serafin, C. Tononi etc. Differences in both the shape of the RBS spectra and in the presence of different elements are found and discussed. The use of X-ray excitation by ions (i.e. protons) helps in assessing the presence of the different elements. X-ray investigations can be done with instruments in air while RBS (at least in the presently used form) has to be performed in a vacuum chamber. Apart from offering an aid in determining the materials and procedures which were used in fabricating acoustically excellent instruments, the method could be of value for identifying their authenticity. (orig.)
Ion backscattering and x-ray investigations of violin varnish and wood
Arne Tove, Per; Sigurd, Dag; Petersson, Sture
1980-01-01
The use of Rutherford backscattering (RBS) of ions (i.e. α-particles) and excitation of characteristic X-rays by protons, for determining the elemental composition of the top layers of violin varnish and wood is described. The amount of elements such as C, O, Si, S, Ca, Cu, Fe, Ni, Zn, Pb has been measured, on the varnished and unvarnished sides of wood samples from old instrument makers such as A. Stradivari, G. Guarneri del Gesu, Santo Serafin, C. Tononi etc. Differences in both the shape of the RBS spectra and in the presence of different elements are found and discussed. The use of X-ray excitation by ions (i.e. protons) helps in assessing the presence of the different elements. X-ray investigations can be done with instruments in air while RBS (at least in the presently used form) has to be performed in a vacuum chamber. Apart from offering an aid in determining the materials and procedures which were used in fabricating acoustically excellent instruments, the method could be of value for identifying their authenticity.
Thermal annealing behavior of niobium-implanted {alpha}-Al{sub 2}O{sub 3} under reducing environment
Energy Technology Data Exchange (ETDEWEB)
Jianer, Zeng; Naramoto, Hiroshi; Aoki, Yasushi; Yamamoto, Shunya; Mingle, Gan; Takeshita, Hidefumi [Japan Atomic Energy Research Inst., Takasaki, Gunma (Japan). Takasaki Radiation Chemistry Research Establishment
1997-03-01
Thermal annealing behavior is studied in {alpha}-Al{sub 2}O{sub 3} implanted with {sup 93}Nb{sup +} using RBS/channeling technique and optical absorption spectrometry. The samples with <0001> and <112-bar0> orientations are implanted with 300 keV and 400 keV {sup 93}Nb{sup +} ions. Thermal annealing under reducing environment (Ar+3%H{sub 2}) is employed in the temperature range from 600 to 1000degC to explore unusual materials phase. The annealing up to 1000degC for an hour does not show any essential change in RBS/channeling spectra in two kinds of samples but the significant decrease in the visible region is observed in optical absorption spectra. After annealing at 1000degC for 10 hours, the recovery of the lattice damage is detected by RBS/channeling analysis especially in (112-bar0) sample. In the optical absorption spectra, new absorption envelope appears in the ultraviolet region. The results are related to the formation of niobium metal fine particles, and the sharp distribution is realized especially in (0001) sample. (author)
Amalia, A. R.; Suswanto, B.; Kristijanto, H.; Irawan, D.
2018-01-01
This paper discusses about the behaviour of two types of RCFT column connections with steel beams due to cyclic loads using software based on finite element method ABAQUS 6.14. This comparison involves modelling RCFT connections with rigid connection that do not allow any deformation and rotation in the joint. There are two types of model to be compared: BB and BRBS which include RCFT connections to ordinary beam without RBS (BB) and to Reduce Beam Section Beam (BRBS). The models behaviour can be discussed in this study are stress value, von misses stress pattern and rotational degree of each model. From the von misses stress pattern value, it found that the highest regions of stress occurs in vicinity of beam flange near column face for connection without RBS (BB). For earthquake resistant building, that behaviour needs to be avoided because sudden collapse often happen in that joint connection. Moreover, the connection with the presence of RBS (BRBS), the highest regions of stress occurs in reduced beam section of the beam, it means that the failure might be happen as proposed plan. The ultimate force that can be restrained by BB model (402 kN) is higher than BRBS model (257,18 kN) because of reducing of flange area. BRBS model has higher rotation angle (0,057 rad) than BB model (0,045 rad). The analysis results also observed that cyclic performances of the moment connection with RBS (BRBS) were more ductile than the connection with ordinary beam (BB).
Co-digestion of wheat and rye bread suspensions with source-sorted municipal biowaste
Energy Technology Data Exchange (ETDEWEB)
Li, Chaoran, E-mail: Chaoran.Li3@kit.edu [Karlsruhe Institute of Technology (KIT), Institute of Biology for Engineers and Biotechnology of Wastewater, Am Fasanengarten, D-76128 Karlsruhe (Germany); Mörtelmaier, Christoph, E-mail: Christoph.Moertelmaier@kit.edu [Karlsruhe Institute of Technology (KIT), Institute of Biology for Engineers and Biotechnology of Wastewater, Am Fasanengarten, D-76128 Karlsruhe (Germany); Winter, Josef, E-mail: Josef.Winter@kit.edu [Karlsruhe Institute of Technology (KIT), Institute of Biology for Engineers and Biotechnology of Wastewater, Am Fasanengarten, D-76128 Karlsruhe (Germany); Gallert, Claudia, E-mail: Claudia.Gallert@HS-Emden-Leer.de [Karlsruhe Institute of Technology (KIT), Institute of Biology for Engineers and Biotechnology of Wastewater, Am Fasanengarten, D-76128 Karlsruhe (Germany); University of Applied Science, Hochschule Emden-Leer, Faculty of Technology, Division Microbiology – Biotechnology, Constantiaplatz 4, D-26723 Emden (Germany)
2015-06-15
Graphical abstract: Volatile fatty acid spectra of acidified WBS, RBS or FBS differ, but methanogenesis is similar. Display Omitted - Highlights: • Biogas improvement by co-digestion of wheat and rye bread. • Increased population density at high organic loading rates. • Less Pelotomaculum but increased numbers of Syntrophobacter and Smithella found in rye bread reactor. • Replacement of Methanosarcinales by acetate-oxidizers in rye bread co-digestion. • Increasing proportion of Methanomicrobiales in biowaste + rye bread reactor. - Abstract: Acidification of wheat bread (WBS), rye bread (RBS) and fresh biowaste suspensions (FBS), leading to lactate+acetate, lactate+acetate+n-buyrate, and acetate+propionate+n-butyrate, respectively, and biogas production as well as population dynamics were investigated. Co-fermentation of FBS (14 kg m{sup −3} d{sup −1} organic loading rate (OLR)) with WBS or RBS was stable up to an OLR of 22 kg m{sup −3} d{sup −1} and resulted in up to 3 times as much biogas. During co-fermentation at more than 20 kg m{sup −3} d{sup −1} OLR the total population increased more than 2-fold, but the originally low share of propionate-oxidizing bacteria significantly decreased. The proportion of methanogens also decreased. Whereas the proportion of Methanosarcinales to Methanomicrobiales in biowaste and biowaste+WBS remained constant, Methanosarcinales and in particular Methanosaeta spec. in the biowaste+RBS assay almost completely disappeared. Methanomicrobiales increased instead, indicating propionate oxidation via acetate cleavage to CO{sub 2} and hydrogen.
Energy Technology Data Exchange (ETDEWEB)
Ruvalcaba S, J.L.; Monroy, M. [IFUNAM, A.P. 20-364, 01000 Mexico D.F. (Mexico)
2004-07-01
In this work, a non destructive methodology for the analysis of ancient manuscripts and books using an external beam system and the techniques Particle Induced X-ray Emission Spectroscopy (PIXE) and Rutherford Backscattering Spectrometry (RBS) is presented. This application shows the analytical features of the particle accelerator based techniques for the characterization of this kind of historical materials. This methodology was used for the analysis of inks of an European book from XVII century. This is the first study in Mexico of an ancient book using simultaneously PIXE and RBS non-vacuum techniques. (Author) 21 refs., 9 figs.
Bismuth containing III-V quaternary alloy InGaAsBi grown by MBE
International Nuclear Information System (INIS)
Feng, G.; Oe, K.; Yoshimoto, M.
2006-01-01
InGaAsBi epilayers were created on InP substrates by molecular beam epitaxy for the first time. The high crystalline quality of the InGaAsBi epilayer with smooth interface was confirmed by high resolution X-ray diffraction measurements. Up to 2.5% Bi was incorporated in the film based on Rutherford back scattering (RBS) results. The RBS channeling spectra give clear evidence that the Bi atoms were substitutionally located in the InGaAs zinc-blende lattice sites. (copyright 2006 WILEY-VCH Verlag GmbH and Co. KGaA, Weinheim) (Abstract Copyright [2006], Wiley Periodicals, Inc.)
Energy Technology Data Exchange (ETDEWEB)
Eloi, C.; Robertson, J.D.; Majidi, V. (Kentucky Univ., Lexington, KY (United States))
1993-03-01
The depth-dependent concentration profiles of nitrate salts of Pb, Cd and Ag were observed with and without the addition of (NH[sub 4])H[sub 2]PO[sub 4] chemical modifier using Rutherford backscattering spectrometry (RBS). The RBS results demonstrate that the analytes, in all the systems investigated, readily migrate ([>=]3 [mu]m) into the pyrolytic graphite coated graphite substrate at room temperature. The stabilization of Cd and Pb with the phosphate modifier is proposed to be due to the formation of a phosphate glass. Silver did not extensively interact with the phosphate modifier and was, as a result, not stabilized. (author).
International Nuclear Information System (INIS)
Eloi, C.; Robertson, J.D.; Majidi, V.
1993-01-01
The depth-dependent concentration profiles of nitrate salts of Pb, Cd and Ag were observed with and without the addition of (NH 4 )H 2 PO 4 chemical modifier using Rutherford backscattering spectrometry (RBS). The RBS results demonstrate that the analytes, in all the systems investigated, readily migrate (≥3 μm) into the pyrolytic graphite coated graphite substrate at room temperature. The stabilization of Cd and Pb with the phosphate modifier is proposed to be due to the formation of a phosphate glass. Silver did not extensively interact with the phosphate modifier and was, as a result, not stabilized. (author)
Rutherford backscattering spectrometry of thin NiCr layers
International Nuclear Information System (INIS)
Anklam, H.J.
1984-01-01
The possibilities and problems of characterizing thin films of NiCr by means of Rutherford backscattering spectrometry (RBS) are demonstrated. Thin resistor films of NiCr (10 to 30 nm thick) are deposited on SiO 2 by sputtering in air or oxygen. The electrical properties depend both on integral chemical composition of films and on local distribution of elements. The determination of composition (Ni-Cr ratio, oxygen content) and of depth profiles of elements by the aid of RBS is described. For solving special analytical problems different substrates as amorphous SiO 2 , Si monocrystals, and glassy carbon are used
Ion Implantation in III-V Compound Semiconductors
1984-09-01
340 keV H + -0 Ga P O UES-723-292 !:• (H o>ray *P-K X - rayO Ga-K X -ray iii! RBS * ..I -iO.. 0 10I to1. 01 • .0 -. I0 1 LI =i, O I 0 01 0.J 10...Identity by blo ," pume) Ion Implantation, GaAs, Hall effect, electrical resistivity, Rutherford Backscattering (RBS), channeling, Proton induced x -ray...Mebility (jH) upon Aiinealing Temperature (TA) for 1 X 101 /cm• Dose Samples of GaAs:Mg with Three Different Capping Methods 33 p 14 Dependence of Surface
Simultaneous Analysis of Multiple Elements by Combined Ion-Beam Methods
International Nuclear Information System (INIS)
Jiang, Weilin; Weber, William J.; Thevuthasan, Theva; Shutthanandan, Shuttha; J. L. Duggan and I.L. Morgan
2001-01-01
Rutherford backscattering spectrometry (RBS) and nuclear reaction analysis (NRA) in channeling geometry have been combined to study the accumulation and recovery of Au2+-induced disorder on both sublattices in 6H-SiC. Conventional He+ RBS/channeling is used to analyze the Ga disorder and Au profiles in Au2+-implanted GaN and the disorder on both the Sr and Ti sublattices in Au2+-implanted SrTiO3. Results on the disorder accumulation in these materials, disorder recovery in 6H-SiC, as well as the mobility of Au implants in GaN are presented and discussed
Non-destructive study of ancient documents and books by means of ion beams
International Nuclear Information System (INIS)
Ruvalcaba S, J.L.; Monroy, M.
2004-01-01
In this work, a non destructive methodology for the analysis of ancient manuscripts and books using an external beam system and the techniques Particle Induced X-ray Emission Spectroscopy (PIXE) and Rutherford Backscattering Spectrometry (RBS) is presented. This application shows the analytical features of the particle accelerator based techniques for the characterization of this kind of historical materials. This methodology was used for the analysis of inks of an European book from XVII century. This is the first study in Mexico of an ancient book using simultaneously PIXE and RBS non-vacuum techniques. (Author) 21 refs., 9 figs
Directory of Open Access Journals (Sweden)
Renata Santos Souza
2009-09-01
Full Text Available Na Amazônia o cromo é empregado principalmente na indústria de couro e de madeira, sendo responsável por vários problemas de saúde porque é tóxico para os seres vivos. A remoção de cromo de efluentes industriais é feita por meio de diversos processos como a adsorção. Este trabalho mostra os resultados da adsorção de Cr(VI por carvão ativado granular comercial (CAG como adsorvente de soluções diluídas empregando um sistema de adsorção batelada com controle de pH. Os grupos funcionais da superfície do CAG foram determinados pelo método de Boehm. Além disso, o efeito do pH na adsorção de Cr(VI, o equilíbrio e a cinética de adsorção foram estudados nas condições experimentais (pH = 6, MA = 6g, tempo de adsorção 90min.. Na superfície do CAG, os grupos carboxílicos foram determinados em maior concentração (MAS=0,43 mmol/gCAG, estes, presentes em concentrações elevadas aumentam a adsorção do metal, principalmente em valores de pH ácidos. A capacidade de adsorção é dependente do pH da solução, devido a sua influência nas propriedades de superfície do CAG e nas diferentes formas iônicas das soluções de Cr(VI. Os dados de equilíbrio da adsorção foram ajustados satisfatoriamente pela isoterma de Langmuir (R²=0,988, tipo favorável. A partir da cinética de adsorção a 5mg/L e 20mg/L, os resultados obtidos foram compatíveis com o valor limite preconizado na legislação nacional (Res. nº 357/05. Portanto, para o sistema experimental utilizando CAG foi eficiente na remoção de Cr(VI a partir de correntes líquidas contendo baixas concentrações do metal.In Amazonia, chromium is mainly used in the leather and wood industries. It is responsible for many health problems, because of its toxicity. These industries remove chromium waste by various processes, such as adsorption. This work shows the results of Cr(VI adsorption by commercial granular activated carbon (GAC as adsorbent from diluted
International Nuclear Information System (INIS)
Rahman, A.M.A.; Narusawa, T.
2008-01-01
We have studied the interface stability of the Ti(overlayer)/ZnO(substrate) system. Ti thin film was grown on the Zn face of single crystal ZnO(0 0 0 1) substrate by the vacuum deposition technique. The Ti film thickness was typically 16 nm. Then the samples were annealed in air at 300 and 400 deg. C for 15 min, respectively. The deposition and annealing effects on the interface structure were investigated with Rutherford backscattering and channeling spectroscopy using 2 MeV He + ion beam. After Ti deposition the minimum yield from the ZnO substrate increased from 2% to 7%. This suggests severe damage caused by deposition, i.e. the interface reaction between Ti and ZnO (even at room temperature). A significant amount of Zn (approximately 6.4 x 10 16 atoms/cm 2 ) moved onto the surface after post-annealing at 400 deg. C. Since Ti has a stronger tendency to react with O than Zn, it is expected that Ti reacts with substrate oxygen leaving behind free Zn atoms, which can easily migrate onto the surface. We discuss how the Ti/ZnO interface reaction in detail, and seek to find another good metallic contact for ZnO devices, which are attracting much attention recently for practical applications as well as scientific aspects
International Nuclear Information System (INIS)
Takemoto, Shinya; Kataoka, Hiromi; Mimura, Mikio; Shibamoto, Yuta; Ayakawa, Shiho; Nagai, Aiko; Hayashi, Akihiro; Ogino, Hiroyuki; Baba, Fumiya; Yanagi, Takeshi; Sugie, Chikao
2012-01-01
Radiation proctitis after intensity-modulated radiation therapy (IMRT) differs from that seen after pelvic irradiation in that this adverse event is a result of high-dose radiation to a very small area in the rectum. We evaluated the results of treatment for hemorrhagic proctitis after IMRT for prostate cancer. Between November 2004 and February 2010, 403 patients with prostate cancer were treated with IMRT at 2 institutions. Among these patients, 64 patients who developed late rectal bleeding were evaluated. Forty patients had received IMRT using a linear accelerator and 24 by tomotherapy. Their median age was 72 years. Each patient was assessed clinically and/or endoscopically. Depending on the severity, steroid suppositories or enemas were administered up to twice daily and Argon plasma coagulation (APC) was performed up to 3 times. Response to treatment was evaluated using the Rectal Bleeding Score (RBS), which is the sum of Frequency Score (graded from 1 to 3 by frequency of bleeding) and Amount Score (graded from 1 to 3 by amount of bleeding). Stoppage of bleeding over 3 months was scored as RBS 1. The median follow-up period for treatment of rectal bleeding was 35 months (range, 12–69 months). Grade of bleeding was 1 in 31 patients, 2 in 26, and 3 in 7. Nineteen of 45 patients (42%) observed without treatment showed improvement and bleeding stopped in 17 (38%), although mean RBS did not change significantly. Eighteen of 29 patients (62%) treated with steroid suppositories or enemas showed improvement (mean RBS, from 4.1 ± 1.0 to 3.0 ± 1.8, p = 0.003) and bleeding stopped in 9 (31%). One patient treated with steroid enema 0.5-2 times a day for 12 months developed septic shock and died of multiple organ failure. All 12 patients treated with APC showed improvement (mean RBS, 4.7 ± 1.2 to 2.3 ± 1.4, p < 0.001) and bleeding stopped in 5 (42%). After adequate periods of observation, steroid suppositories/enemas are expected to be effective. However, short
Radiation effects in ion implanted β-Ga_2O_3
International Nuclear Information System (INIS)
Wendler, E.; Treiber, E.; Baldauf, J.; Wolf, S.; Ronning, C.; Kuramata, A.
2015-01-01
Ion implantation induced effects are studied in β-Ga_2O_3 at room temperature. The main technique applied is Rutherford backscattering spectrometry in channelling configuration (RBS) using He ions. Additionally, selected samples were investigated by optical spectroscopy and transmission electron microscopy (TEM). For the implanted P, Ar or Sn ions clear damage peaks are visible in the RBS spectra. The concentration of displaced lattice atoms in the maximum of the distribution (as deduced from the channelling spectra) increases almost continuously up to a saturation value of about 90% with increasing ion fluence. Once this level is reached in the maximum of the distribution, during further implantation a broadening of the distribution occurs with the concentration remaining at this level. RBS measurements performed with different energy of the analysing He ions reveal that the damage produced is characterized by randomly distributed lattice atoms. This indicates point defects, point defect complexes or amorphous zones. As the channelling spectra of the implanted layers do not reach the random level, complete amorphisation can be excluded. Furthermore, the applied optical techniques do not exhibit significant changes in comparison to the signal measured for the unimplanted sample even though these studies were performed for the highest ion fluences implanted. Cross sectional TEM confirms this result. The diffraction pattern shows clear spots as for the unimplanted material and extended defects are almost not visible. The β-Ga_2O_3 layers ion implanted at room temperature contain mainly point defects the strong influence of which on the dechannelling of the He ions in the RBS analysis is not yet understood. (authors)
Irsch, Kristina; Gramatikov, Boris I.; Wu, Yi-Kai; Guyton, David L.
2014-06-01
Amblyopia ("lazy eye") is a major public health problem, caused by misalignment of the eyes (strabismus) or defocus. If detected early in childhood, there is an excellent response to therapy, yet most children are detected too late to be treated effectively. Commercially available vision screening devices that test for amblyopia's primary causes can detect strabismus only indirectly and inaccurately via assessment of the positions of external light reflections from the cornea, but they cannot detect the anatomical feature of the eyes where fixation actually occurs (the fovea). Our laboratory has been developing technology to detect true foveal fixation, by exploiting the birefringence of the uniquely arranged Henle fibers delineating the fovea using retinal birefringence scanning (RBS), and we recently described a polarization-modulated approach to RBS that enables entirely direct and reliable detection of true foveal fixation, with greatly enhanced signal-to-noise ratio and essentially independent of corneal birefringence (a confounding variable with all polarization-sensitive ophthalmic technology). Here, we describe the design and operation of a new pediatric vision screener that employs polarization-modulated, RBS-based strabismus detection and bull's eye focus detection with an improved target system, and demonstrate the feasibility of this new approach.
International Nuclear Information System (INIS)
Kamwanna, T.; Junphong, P.; Yu, L.D.; Singkarat, S.; Intarasiri, S.; Suwannakachorn, D.
2015-01-01
A comprehensive ion beam analysis centre unique in the ASEAN (Association of Southeast Asian Nations) region has been established at Chiang Mai University, Thailand. The centre is equipped with a 1.7 MV Tandetron tandem accelerator and a 300 kV medium energy ion beam accelerator for ion beam analysis. The Tandetron accelerator employs two ion sources, a duoplasmatron ion source and a sputter ion source, capable of producing ion beams of both light species (hydrogen and helium) and heavy species. The beamline is currently able to perform ion beam analysis techniques, such as Rutherford backscattering spectrometry (RBS), RBS/channelling, elastic backscattering (EBS), particle induced x ray emission (PIXE) and ionoluminescence (IL) with the assistance of commercial and self-developed software. The medium energy ion accelerator features an ns pulsed beam so that time of flight (ToF) RBS analysis using medium energy ion beams is available for detailed analysis of materials. Ion beam analysis experiments and applications have been vigorously developed for the real time characterization of various materials. Examples are presented and qualities of the ion beam analysis techniques are discussed. (author)
Irsch, Kristina; Gramatikov, Boris I; Wu, Yi-Kai; Guyton, David L
2014-06-01
Amblyopia ("lazy eye") is a major public health problem, caused by misalignment of the eyes (strabismus) or defocus. If detected early in childhood, there is an excellent response to therapy, yet most children are detected too late to be treated effectively. Commercially available vision screening devices that test for amblyopia's primary causes can detect strabismus only indirectly and inaccurately via assessment of the positions of external light reflections from the cornea, but they cannot detect the anatomical feature of the eyes where fixation actually occurs (the fovea). Our laboratory has been developing technology to detect true foveal fixation, by exploiting the birefringence of the uniquely arranged Henle fibers delineating the fovea using retinal birefringence scanning (RBS), and we recently described a polarization-modulated approach to RBS that enables entirely direct and reliable detection of true foveal fixation, with greatly enhanced signal-to-noise ratio and essentially independent of corneal birefringence (a confounding variable with all polarization-sensitive ophthalmic technology). Here, we describe the design and operation of a new pediatric vision screener that employs polarization-modulated, RBS-based strabismus detection and bull's eye focus detection with an improved target system, and demonstrate the feasibility of this new approach.
Energy Technology Data Exchange (ETDEWEB)
Deves, Guillaume [Laboratoire de chimie nucleaire analytique et bioenvironnementale, UMR 5084, CNRS-Universite de Bordeaux 1, BP 120 Chemin du solarium, F33175 Gradignan cedex (France)]. E-mail: deves@cenbg.in2p3.fr; Cohen-Bouhacina, Touria [Centre de Physique Moleculaire Optique et Hertzienne, Universite de Bordeaux 1, 351, cours de la Liberation, F33405 Talence cedex (France); Ortega, Richard [Laboratoire de chimie nucleaire analytique et bioenvironnementale, UMR 5084, CNRS-Universite de Bordeaux 1, BP 120 Chemin du solarium, F33175 Gradignan cedex (France)
2004-10-08
We used the nuclear microprobe techniques, micro-PIXE (particle-induced X-ray emission), micro-RBS (Rutherford backscattering spectrometry) and scanning transmission ion microscopy (STIM) in order to perform the characterization of trace element content and spatial distribution within biological samples (dehydrated cultured cells, tissues). The normalization of PIXE results was usually expressed in terms of sample dry mass as determined by micro-RBS recorded simultaneously to micro-PIXE. However, the main limit of RBS mass measurement is the sample mass loss occurring during irradiation and which could be up to 30% of the initial sample mass. We present here a new methodology for PIXE normalization and quantitative analysis of trace element within biological samples based on dry mass measurement performed by mean of STIM. The validation of STIM cell mass measurements was obtained in comparison with AFM sample thickness measurements. Results indicated the reliability of STIM mass measurement performed on biological samples and suggested that STIM should be performed for PIXE normalization. Further information deriving from direct confrontation of AFM and STIM analysis could as well be obtained, like in situ measurements of cell specific gravity within cells compartment (nucleolus and cytoplasm)
First-time observation of Mastro Giorgio masterpieces by means of non-destructive techniques
Padeletti, G.; Ingo, G. M.; Bouquillon, A.; Pages-Camagna, S.; Aucouturier, M.; Roehrs, S.; Fermo, P.
2006-06-01
For the first time some excellent pieces belonging to the majolica production of the great master Giorgio Andreoli from Gubbio (Central Italy) have been characterized from a chemical and structural point of view with the aim to identify the composition of both pigments and lustres. A series of particle-induced X-ray emission (PIXE), Rutherford backscattering spectrometry (RBS) and Raman analyses have been performed on some plates coming from Museo del Palazzo dei Consoli (Gubbio) and several French museums (Louvre, Musée National de la Céramique, Musée National de la Renaissance) lustred by Giorgio Andreoli and decorated by famous majolica painters such as Francesco Xanto Avelli. The three techniques are complementary and useful in the investigation of art objects since they are non-destructive. Furthermore, the low detection limits allow the identification of all elements and compounds present, and RBS allows concentration profiling, too. It is worth noticing that the examined objects are characterized by the presence of both gold and ruby-red lustres, a peculiarity of Mastro Giorgio’s technique. The measurements by PIXE and RBS have been carried out on the AGLAE accelerator at C2RMF, Louvre Palace.
International Nuclear Information System (INIS)
Kiss, A.Z.; Simon, A.; Elekes, Z.; Ditroi, F.; Meszaros, S.; Beke, D.L.; Langer, G.A.; Daroczy, L.
2002-01-01
A study of the intermixing of the elements in amorphous Si-Ge multilayers have been carried out using Rutherford backscattering Spectrometry (RBS) technique. Interdiffusion coefficient was determined by measuring the intensity of the first Ge peak (having best depth resolution) in the RBS spectrum as a function of annealing time. The oxygen content of the multilayer was measured by the resonance elastic scattering method in co-operation with Dubna. A cross comparison of multilayered films were performed between the laboratories in Debrecen, Dubna, Albany and Dhaka. An essay to determine the nitrogen content of CVD diamond by the deuteron induced gamma ray emission method has been done. (author)
International Nuclear Information System (INIS)
Salomon, J.; Dran, J.-C.; Guillou, T.; Moignard, B.; Pichon, L.; Walter, P.; Mathis, F.
2008-01-01
The application of IBA to cultural heritage mostly relies on the use of PIXE because of its high sensitivity and its ease of implementation at atmospheric pressure. The need for depth information not easily available with this technique has conducted to associate RBS also in external beam mode. We have progressively developed a set-up that permits such a combination of techniques either simultaneously or sequentially. The set-up is currently further improved to permit NRA measurement (depth profiles of light elements) in addition to PIXE and RBS. The coupling of all these techniques provides a wealth of information on cultural heritage objects, not easily attainable with any other single method
ORF Alignment: NC_005027 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available nsport ... protein rbsD [Pirellula sp.] ... Length = 135 ... Query: 1 ... MKRTRLLNSELSYEISRIGHTASIT...LCDAGLPIPSGVKRIDLAIEEGYPTFLRTLDAILS 60 ... MKRTRLLNSELSYEISRIGHTASITLCDAGL...PIPSGVKRIDLAIEEGYPTFLRTLDAILS Sbjct: 1 ... MKRTRLLNSELSYEISRIGHTASITLCDAGLPIPSGVKRIDLAIEEGYPTFLRTLDAILS 60 ... Qu
International Nuclear Information System (INIS)
Figueiredo, A.M.R. de.
1987-01-01
Rare earth determinations in surface and well waters from Morro do Ferro was studied using chemical preconcentration methods of the group and plasma emission spectroscopy excited by direct current are - DCP. A method that combines retention in alumina is HF medium with ion exchange for the preconcentration of the group was developed in semi micro scale. DCP determination, in the sequencial mode by using mixed standards containing, Y, La, Ce, Nd, Pr, Sm, Eu, Ga, Tb, Dy, Er, Yb and Al, principal concentrate componentes was studied by analysis of the profile of each spectral line. Principal cations, anions, ph and Eh were determined. Semi-micro techniques were developed for anions preconcentration and for determination of sulphate, phosphate and carbonate. (M.J.C.) [pt
Inspection of Emergency Arrangements
International Nuclear Information System (INIS)
2013-01-01
The Working Group on Inspection Practices (WGIP) was tasked by the NEA CNRA to examine and evaluate the extent to which emergency arrangements are inspected and to identify areas of importance for the development of good inspection practices. WGIP members shared their approaches to the inspection of emergency arrangements by the use of questionnaires, which were developed from the requirements set out in IAEA Safety Standards. Detailed responses to the questionnaires from WGIP member countries have been compiled and are presented in the appendix to this report. The following commendable practices have been drawn from the completed questionnaires and views provided by WGIP members: - RBs and their Inspectors have sufficient knowledge and information regarding operator's arrangements for the preparedness and response to nuclear emergencies, to enable authoritative advice to be given to the national coordinating authority, where necessary. - Inspectors check that the operator's response to a nuclear emergency is adequately integrated with relevant response organisations. - Inspectors pay attention to consider the integration of the operator's response to safety and security threats. - The efficiency of international relations is checked in depth during some exercises (e.g. early warning, assistance and technical information), especially for near-border facilities that could lead to an emergency response abroad. - RB inspection programmes consider the adequacy of arrangements for emergency preparedness and response to multi-unit accidents. - RBs assess the adequacy of arrangements to respond to accidents in other countries. - The RB's role is adequately documented and communicated to all agencies taking part in the response to a nuclear or radiological emergency. - Inspectors check that threat assessments for NPPs have been undertaken in accordance with national requirements and that up-to-date assessments have been used as the basis for developing emergency plans for
Directory of Open Access Journals (Sweden)
Dilcemara C. Zenatti
2009-12-01
Full Text Available A ocorrência de compostos nitrogenados em água residuária de abatedouro de tilápia acima dos limites legais, tem causado sérios problemas de poluição em corpos d'água receptores. O processo biológico para remoção dessas substâncias comumente encontradas sob a forma de nitrogênio amoniacal, é conhecido como nitrificação. Objetivou-se, com o presente trabalho, estudar o efeito do tempo de reação (TR e da aeração na eficiência da remoção de nitrogênio amoniacal e na conversão do nitrogênio amoniacal a nitrato, de água residuária de abate de tilápia em um reator em batelada sequencial com biofilme. O experimento foi executado usando-se dois TR(6 e 12 h e dois níveis de vazão de ar (3 e 6 L min-1; avaliaram-se quatro tratamentos a partir da combinação dessas variáveis configuradas em um planejamento experimental do tipo factorial 2², sendo: T1 (QAr = 3 L min-1 e TR = 6 h; T2 (QAr = 6 L min-1 e TR = 6 h, T3 (QAr = 3 L min-1 e TR = 12 h e T4 (QAr = 6 L min-1 e TR = 12 h, e quatro repetições para cada tratamento. Os resultados mais significativos foram para o tratamento T4, com o qual se obteve média de eficiência para conversão de amônio a nitrato e remoção de nitrogênio amoniacal de 57,27 ± 27,05% e 81,90 ± 3,80%, respectivamente.The occurrence of composts of nitrogen above the legal limits has been causing serious pollution problems in water receptor bodies. The biological process for removal of these substances commonly found in the ammoniacal nitrogen form is known as nitrification. The present study had as its objective the evaluation of the effects of the reaction time (TR and of the aeration on the removal efficiency of the ammoniacal nitrogen and on the conversion of the ammoniacal nitrogen to nitrate in a nitrification process of the tilapia slaughterhouse effluent in sequential batch reactor with biofilm. The experiment was performed using two reaction times (6 and 12 h and two levels of air flow
Directory of Open Access Journals (Sweden)
M.E.F. Neto
2009-06-01
Full Text Available O experimento foi instalado em área de plantio comercial de soja Roundup Ready®, na região do Pontal do Paranapanema, no município de Euclides da Cunha Paulista-SP, localizada a 20º 43' 11'' S e 50º 10' 20'' W, com uma altitude de 270 m. A fase experimental foi conduzida de dezembro de 2006 a abril de 2007, sob sistema plantio direto, com uma temperatura média de 25 ºC e índice pluviométrico de 800 mm. O solo da área experimental apresenta classe textural franco-argilo arenosa. Objetivou-se com este trabalho avaliar a eficácia e seletividade de glyphosate na formulação Roundup Transorb®, associado aos herbicidas diclosulam, cloransulam-methyl, flumioxazina e S-metolachlor em duas modalidades de aplicação: única, com associação do glyphosate aos herbicidas; e uma sequencial apenas com glyphosate aos 15 DAA, no manejo das plantas daninhas trapoeraba (Commelina benghalensis e corda-de-viola (Ipomoea triloba durante o cultivo da soja. O experimento foi instalado no delineamento de blocos ao acaso, com 12 tratamentos e quatro repetições. Os tratamentos foram distribuídos em arranjo fatorial acrescido de duas testemunhas: sem capina manual e com capina manual. O arranjo fatorial 2 x 5 contemplou duas condições de aplicação dos herbicidas (única e sequencial e cinco herbicidas (glyphosate, glyphosate + diclosulam, glyphosate + cloransulam-methyl, glyphosate + flumioxazin e glyphosate + S-metolachlor. Nas condições de produtos, épocas de aplicação e doses, os resultados mostraram que o herbicida glyphosate aplicado em dose única ou sequencial e suas combinações com diclosulam e cloransulam-methyl na primeira aplicação não promovem fitointoxicação nas plantas de soja. A combinação com flumioxazin e S-metolachlor promoveu atraso no crescimento das plantas e no fechamento da cultura, em razão do efeito na altura dos indivíduos e comprimento dos ramos. No tratamento com o S-metolachlor, isso pode ser explicado
International Nuclear Information System (INIS)
Jin, Hui; Gui, Rijun; Sun, Jie; Wang, Yanfeng
2016-01-01
Probe-donor integrated nanocomposites were developed from conjugating silica-coated Mn"2"+:ZnS quantum dots (QDs) with MoS_2 QDs and photosensitive nitric oxide (NO) donors (Fe_4S_3(NO)_7"−, RBS). Under excitation with near-infrared (NIR) light at 808 nm, the Mn"2"+:ZnS@SiO_2/MoS_2-RBS nanocomposites showed the dual-emissive two-photon excited photoluminescence (TPEPL) that induced RBS photolysis to release NO in situ. NO caused TPEPL quenching of Mn"2"+:ZnS QDs, but it produced almost no impact on the TPEPL of MoS_2 QDs. Hence, the nanocomposites were developed as a novel QDs-based ratiometric TPEPL probe for real-time detection of NO release in situ. The ratiometric TPEPL intensity is nearly linear (R"2 = 0.9901) with NO concentration in the range of 0.01∼0.8 μM, which corresponds to the range of NO release time (0∼15 min). The detection limit was calculated to be approximately 4 nM of NO. Experimental results confirmed that this novel ratiometric TPEPL probe possessed high selectivity and sensitivity for the detection of NO against potential competitors, and especially showed high detection performance for NIR-light triggered NO release in tumor intracellular microenvironments. These results would promote the development of versatile probe-donor integrated systems, also providing a facile and efficient strategy to real-time detect the highly controllable drug release in situ, especially in physiological microenvironments. - Highlights: • Mn"2"+:ZnS@SiO_2/MoS_2-RBS nanocomposites were developed as a novel ratiometric two-photon excited fluorescence probe. • This probe could conduct real-time detection of nitric oxide release in situ. • High feasibility of this probe was confirmed in tumor intracellular microenvironments.
Li, Zheng-Quan; Ma, Hao; Mao, Yu-Ding; Feng, Tao
2014-02-01
Using long-term observation data of acid rain at Lin'an Regional Background Station (Lin'an RBS), this paper studied the interannual and monthly variations of acid rain, the reasons for the variations, and the relationships between acid rain and meteorological factors. The results showed that interannual variation of acid rain at Lin'an RBS had a general increasing trend in which there were two obvious intensifying processes and two distinct weakening processes, during the period ranging from 1985 to 2012. In last two decades, the monthly variation of acid rain at Lin'an RBS indicated that rain acidity and frequency of severe acid rain were increasing but the frequency of weak acid rain was decreasing when moving towards bilateral side months of July. Acid rain occurrence was affected by rainfall intensity, wind speed and wind direction. High frequency of severe acid rain and low frequency of weak acid rain were on days with drizzle, but high frequency of weak acid rain and low frequency of severe acid rain occurred on rainstorm days. With wind speed upgrading, the frequency of acid rain and the proportion of severe acid rain were declining, the pH value of precipitation was reducing too. Another character is that daily dominant wind direction of weak acid rain majorly converged in S-W section ,however that of severe acid rain was more likely distributed in N-E section. The monthly variation of acid rain at Lin'an RBS was mainly attributed to precipitation variation, the increasing and decreasing of monthly incoming wind from SSE-WSW and NWN-ENE sections of wind direction. The interannual variation of acid rain could be due to the effects of energy consumption raising and significant green policies conducted in Zhejiang, Jiangsu and Shanghai.
Xu, Baoshan; Sowa, Nenja; Cardenas, Maria E; Gerton, Jennifer L
2015-03-15
Cohesinopathies are human genetic disorders that include Cornelia de Lange syndrome (CdLS) and Roberts syndrome (RBS) and are characterized by defects in limb and craniofacial development as well as mental retardation. The developmental phenotypes of CdLS and other cohesinopathies suggest that mutations in the structure and regulation of the cohesin complex during embryogenesis interfere with gene regulation. In a previous project, we showed that RBS was associated with highly fragmented nucleoli and defects in both ribosome biogenesis and protein translation. l-leucine stimulation of the mTOR pathway partially rescued translation in human RBS cells and development in zebrafish models of RBS. In this study, we investigate protein translation in zebrafish models of CdLS. Our results show that phosphorylation of RPS6 as well as 4E-binding protein 1 (4EBP1) was reduced in nipbla/b, rad21 and smc3-morphant embryos, a pattern indicating reduced translation. Moreover, protein biosynthesis and rRNA production were decreased in the cohesin morphant embryo cells. l-leucine partly rescued protein synthesis and rRNA production in the cohesin morphants and partially restored phosphorylation of RPS6 and 4EBP1. Concomitantly, l-leucine treatment partially improved cohesinopathy embryo development including the formation of craniofacial cartilage. Interestingly, we observed that alpha-ketoisocaproate (α-KIC), which is a keto derivative of leucine, also partially rescued the development of rad21 and nipbla/b morphants by boosting mTOR-dependent translation. In summary, our results suggest that cohesinopathies are caused in part by defective protein synthesis, and stimulation of the mTOR pathway through l-leucine or its metabolite α-KIC can partially rescue development in zebrafish models for CdLS. © The Author 2014. Published by Oxford University Press.
International Nuclear Information System (INIS)
Ming Xianbing; Lu Fei; Liu Hanping; Chen Ming; Wang Lei
2009-01-01
Planar optical waveguides were formed in ZnO crystal by Tm + and O + ion implantation. The distributions of Tm + in as-implanted and annealed ZnO samples were investigated by the RBS technique. A shift of the Tm + peak towards the sample surface and out diffusion were observed after thermal treatment and subsequent O + ion implantation. Waveguide formation was determined after O + implantation in Tm + -implanted ZnO crystal. By using the prism-coupling method two guided modes were detected. The refractive index profile in the implanted waveguide was reconstructed according to the SRIM and RCM simulation. The RBS/channelling measurements show that the lattice structure of ZnO did not suffer detectable damage after O + implantation.
Russell body apical periodontitis: an unusual case report.
Dos Santos, Jean Nunes; Ramos, Eduardo Antônio Gonçalves; Gurgel, Clarissa Araújo Silva; Barros, Adna Conceição; de Freitas, André Carlos; Crusoé-Rebello, Iêda Maria
2008-12-01
Russell bodies (RBs) changes in chronic apical lesions have rarely been reported in the literature. We describe a case of a periapical lesion abundantly and extensively composed of RB. Microscopic examination showed accumulation of plasma cells containing globular, spherical, polygonal, and eosinophilic structures against fibrous connective tissue. Initial diagnostic considerations based on a smaller magnification included hypersecretory plasmocytoma, although there was no evidence of infiltrative growth, mitotic activity, nuclear atypia, or cellular pleomorphism. Then, a panel of immunohistochemical markers was applied and the cells showed positivity with both kappa and lambda chains demonstrating their polyclonal origin. The extensive accumulation of RBs involving the periapical region represents an unreported and significant histologic change, as it was mimicking a malignant neoplasm.
Directory of Open Access Journals (Sweden)
Eva Yovita Dwi Utami
2015-04-01
Full Text Available The increasing number of customers and the need for reliable communication require the availability of coverage, sufficient capacity and good quality of mobile communications networks. New BTS implementation is required to cover a wider area with good network quality. However, it often requires high cost and long time to get permission from the government and local residents. Swap and Modernization Project is a project that swap the previous 3G equipment using BTS 3900 Huawei with Ericsson RBS 6000 and modernize the 2G RBS 2000 to RBS 6000 and then carry out parameter settings to optimize the network. In this paper, we report the results of mobile network performance after Swap and Modernization projects had been done in terms of the signal strength improvements, which are showed by Rx Level, RSCP and CDD Dump parameters. The study was conducted in PT XL Axiata Northern Areas of Central Java with D5 cluster as a sample. The results show improvement of Rx Level that increased by 89.93 %, and RSCP value increased by 58.36 %. The swap and modernization of the BTS and parameter settings are able to improve CDD Dump parameters. These improvements are able to expand the coverage area of cluster D5 sites.
Directory of Open Access Journals (Sweden)
Takemoto Shinya
2012-06-01
Full Text Available Abstract Background Radiation proctitis after intensity-modulated radiation therapy (IMRT differs from that seen after pelvic irradiation in that this adverse event is a result of high-dose radiation to a very small area in the rectum. We evaluated the results of treatment for hemorrhagic proctitis after IMRT for prostate cancer. Methods Between November 2004 and February 2010, 403 patients with prostate cancer were treated with IMRT at 2 institutions. Among these patients, 64 patients who developed late rectal bleeding were evaluated. Forty patients had received IMRT using a linear accelerator and 24 by tomotherapy. Their median age was 72 years. Each patient was assessed clinically and/or endoscopically. Depending on the severity, steroid suppositories or enemas were administered up to twice daily and Argon plasma coagulation (APC was performed up to 3 times. Response to treatment was evaluated using the Rectal Bleeding Score (RBS, which is the sum of Frequency Score (graded from 1 to 3 by frequency of bleeding and Amount Score (graded from 1 to 3 by amount of bleeding. Stoppage of bleeding over 3 months was scored as RBS 1. Results The median follow-up period for treatment of rectal bleeding was 35 months (range, 12–69 months. Grade of bleeding was 1 in 31 patients, 2 in 26, and 3 in 7. Nineteen of 45 patients (42% observed without treatment showed improvement and bleeding stopped in 17 (38%, although mean RBS did not change significantly. Eighteen of 29 patients (62% treated with steroid suppositories or enemas showed improvement (mean RBS, from 4.1 ± 1.0 to 3.0 ± 1.8, p = 0.003 and bleeding stopped in 9 (31%. One patient treated with steroid enema 0.5-2 times a day for 12 months developed septic shock and died of multiple organ failure. All 12 patients treated with APC showed improvement (mean RBS, 4.7 ± 1.2 to 2.3 ± 1.4, p Conclusions After adequate periods of observation, steroid suppositories
77 FR 59888 - Notice of Request for Revision of a Currently Approved Information Collection
2012-10-01
... announces the Rural Business-Cooperative Service's (RBS) intention to request an extension for a currently... small businesses for the purchase of renewable energy systems and the implementation of energy...
Análise de política como metodologia em estudo do transporte escolar rural
Directory of Open Access Journals (Sweden)
Calinca Jordânia Pergher
2017-09-01
Full Text Available O texto apresenta o marco teórico-metodológico de análise de políticas públicas que fundamentou uma pesquisa sobre a política do transporte escolar rural no Rio Grande do Sul. São explicitadas diversas noções, conceitos e abordagens, mas a ênfase recai sobre a abordagem cognitiva, de linha francesa, e sobre a análise sequencial de políticas, suas características e o modo como foram combinadas na pesquisa. São narradas rotas percorridas na reconstrução analítica da política, nas fases de emergência do problema, colocação na agenda, formulação e adoção do programa e implementação.
Analytical simulation of RBS spectra of nanowire samples
Energy Technology Data Exchange (ETDEWEB)
Barradas, Nuno P., E-mail: nunoni@ctn.ist.utl.pt [Centro de Ciências e Tecnologias Nucleares, Instituto Superior Técnico, Universidade de Lisboa, E.N. 10 ao km 139,7, 2695-066 Bobadela LRS (Portugal); García Núñez, C. [Laboratorio de Electrónica y Semiconductores, Departamento de Física Aplicada, Universidad Autónoma de Madrid, 28049 Madrid (Spain); Redondo-Cubero, A. [Laboratorio de Electrónica y Semiconductores, Departamento de Física Aplicada, Universidad Autónoma de Madrid, 28049 Madrid (Spain); Centro de Micro-Análisis de Materiales, Universidad Autónoma de Madrid, 28049 Madrid (Spain); Shen, G.; Kung, P. [Department of Electrical and Computer Engineering, The University of Alabama, AL 35487 (United States); Pau, J.L. [Laboratorio de Electrónica y Semiconductores, Departamento de Física Aplicada, Universidad Autónoma de Madrid, 28049 Madrid (Spain)
2016-03-15
Almost all, if not all, general purpose codes for analysis of Ion Beam Analysis data have been originally developed to handle laterally homogeneous samples only. This is the case of RUMP, NDF, SIMNRA, and even of the Monte Carlo code Corteo. General-purpose codes usually include only limited support for lateral inhomogeneity. In this work, we show analytical simulations of samples that consist of a layer of parallel oriented nanowires on a substrate, using a model implemented in NDF. We apply the code to real samples, made of vertical ZnO nanowires on a sapphire substrate. Two configurations of the nanowires were studied: 40 nm diameter, 4.1 μm height, 3.5% surface coverage; and 55 nm diameter, 1.1 μm height, 42% surface coverage. We discuss the accuracy and limits of applicability of the analysis.
7 CFR 2003.26 - Functional organization of RBS.
2010-01-01
... business plans for new cooperatives. It provides research, analysis, and technical assistance to rural... way that empowers communities. It develops methods for working with rural business intermediaries to... BUSINESS-COOPERATIVE SERVICE, RURAL UTILITIES SERVICE, AND FARM SERVICE AGENCY, DEPARTMENT OF AGRICULTURE...
Directory of Open Access Journals (Sweden)
Camila Lucia Etges
2012-12-01
Full Text Available OBJETIVOS: verificar os achados da triagem imitanciométrica e dos testes da avaliação simplificada de processamento auditivo em escolares. MÉTODO: participaram da pesquisa alunos de 1ª a 4ª séries, de sete a dez anos de idade, de uma escola de ensino público de Porto Alegre. Foram avaliados 130 escolares na triagem imitanciométrica, que foi constituída por timpanometria e pesquisa do reflexo acústico ipsilateral e avaliação simplificada do processamento auditivo, incluindo testes de localização sonora, memória sequencial para sons verbais e memória sequencial para sons não verbais. RESULTADOS: na triagem imitanciométrica 43,08% dos escolares passaram, tendo a curva tipo A como mais frequente. O reflexo acústico em 4000 Hz teve percentual de presença inferior comparado com os demais. Passaram nos testes da avaliação simplificada do processamento auditivo 76,15% das crianças. Além disso, foi observado que o teste no qual os escolares obtiveram pior desempenho foi o de memória sequencial para sons verbais. Falharam na triagem imitanciométrica e na avaliação simplificada de processamento auditivo 12,3% dos escolares. CONCLUSÃO: a curva timpanométrica tipo A foi a mais frequente na população estudada. Na avaliação simplificada do processamento auditivo a maioria dos sujeitos passou, tendo maior frequência de acertos no teste de localização sonora. Não houve associação estatística entre o resultado da triagem imitanciométrica e o resultado da avaliação simplificada de processamento auditivo.PURPOSE: to check acoustic immittance screening findings and results of the simplified evaluation of auditory processing in school children. METHOD: the subjects under this study were students from the 1st to the 4th grade, with ages ranging from seven to ten year-old, from a public school in Porto Alegre. 130 students were evaluated in the immitance screening, which consisted of a tympanometry and an ipsilateral
IBA of iridescent Art Nouveau glass - comparative studies
International Nuclear Information System (INIS)
Maeder, M.; Jembrih-Simbuerger, D.; Neelmeijer, C.; Schreiner, Manfred
2005-01-01
Simultaneous PIXE, PIGE, and RBS in air were employed to characterise the surface structure of iridescent Art Nouveau glass artefacts produced around 1900 by Tiffany, USA and Loetz, Austria. Using PIXE and PIGE, the chemical composition of the bulk glass and the overlays was determined in a non-destructive manner. Furthermore, the combination of PIXE and RBS enabled the layer structure of the analysed glasses (bulk, overlays, and iridescent layers) and the thicknesses of the thin layers in the near-surface domain to be determined. The measurement and evaluation procedure is demonstrated on blue iridescent glass fragments of Tiffany and Loetz by way of example. The initial results showing similarities but also differences in the layered glass structure of Tiffany and Loetz objects are presented
Energy Technology Data Exchange (ETDEWEB)
Zucchiatti, A., E-mail: alessandro.zucchiatti@uam.es [Centro de Micro Análisis de Materiales, Universidad Autónoma de Madrid, C/ Faraday 3, Madrid (Spain); Climent-Font, A. [Centro de Micro Análisis de Materiales, Universidad Autónoma de Madrid, C/ Faraday 3, Madrid (Spain); Departamento de Física Aplicada, Universidad Autónoma de Madrid, Avda. Francisco Tomás y Valiente 7, 28049 Madrid (Spain); Gómez-Tejedor, J. García [Museo Nacional Centro de Arte Reina Sofia, Departamento de Restauración, Calle Santa Isabel, 52, 28012 Madrid (Spain); Martina, S. [Centro de Micro Análisis de Materiales, Universidad Autónoma de Madrid, C/ Faraday 3, Madrid (Spain); Universitá degli Studi di Torino, Turin (Italy); Muro García, C.; Gimeno, E.; Hernández, P.; Canelo, N. [Museo Nacional Centro de Arte Reina Sofia, Departamento de Restauración, Calle Santa Isabel, 52, 28012 Madrid (Spain)
2015-11-15
We have examined by PIXE (and by RBS in parallel) about 180 samples of commercial painting and drawing media including pencils, pastels, waxes, inks, paints and paper. Given the high PIXE sensitivity we produced X-ray spectra at low collected charges and currents, operating in good conservation conditions. For drawing media containing inorganic components or a unique marker element, we have defined colouring agent fingerprints which correspond, when applicable, to the composition declared by the manufacturer. For thin layers, the ratios of areal densities of elements are close to those expected given the declared composition, which is promising from the perspective of compiling the database. The quantitative PIXE and RBS analysis of part of the set of samples is provided.
Energy Technology Data Exchange (ETDEWEB)
Martin, J.W.; Russell, G.J. [New South Wales Univ., Kensington, NSW (Australia). School of Physics; Cohen, D.D.; Evans, P.J. [Australian Nuclear Science and Technology Organisation, Lucas Heights, NSW (Australia)
1993-12-31
Using a metal-vapor vacuum arc ion source, several as-grown, large single crystal YBa{sub 2}Cu{sub 3}O{sub 7-{delta}} were implanted with a dose of 1x10{sup 17} zinc, nickel and iron ions. After implantation the crystal was subjected to two anneal cycles that has allowed to examine crystal structure, superconducting transitions and composition, through X-ray diffraction, rutherford backscattering spectroscopy (RBS) and AC susceptibility measurements respectively. Although RBS discriminates strongly against light elements, such as oxygen, the use of resonant reaction {sup 16}O ({alpha}, {alpha}){sup 16}O at 3.4 MeV was beneficial, as its cross section is nearly 23 times that of the rutherford cross section. 4 figs.
Energy Technology Data Exchange (ETDEWEB)
Martin, J W; Russell, G J [New South Wales Univ., Kensington, NSW (Australia). School of Physics; Cohen, D D; Evans, P J [Australian Nuclear Science and Technology Organisation, Lucas Heights, NSW (Australia)
1994-12-31
Using a metal-vapor vacuum arc ion source, several as-grown, large single crystal YBa{sub 2}Cu{sub 3}O{sub 7-{delta}} were implanted with a dose of 1x10{sup 17} zinc, nickel and iron ions. After implantation the crystal was subjected to two anneal cycles that has allowed to examine crystal structure, superconducting transitions and composition, through X-ray diffraction, rutherford backscattering spectroscopy (RBS) and AC susceptibility measurements respectively. Although RBS discriminates strongly against light elements, such as oxygen, the use of resonant reaction {sup 16}O ({alpha}, {alpha}){sup 16}O at 3.4 MeV was beneficial, as its cross section is nearly 23 times that of the rutherford cross section. 4 figs.
International Nuclear Information System (INIS)
Redondo-Cubero, A.; Vinnichenko, M.; Muecklich, A.; Kolitsch, A.; Krause, M.; Munoz, E.; Gago, R.
2011-01-01
The effect of the substrate temperature on the sublattice ordering in ZnO layers grown by reactive pulsed magnetron sputtering on sapphire has been investigated by different techniques. The improvement of the crystal quality and heteroepitaxial growth at relatively low temperatures (550 deg. C) is verified by x-ray diffraction, high-resolution transmission electron microscopy, Rutherford backscattering spectrometry in channeling mode (RBS/C), and Raman spectroscopy. Sublattice-resolved analysis by resonant RBS/C and Raman spectroscopy reveals that the progressive transition to the single crystal phase is accomplished in a faster way for Zn- than for O-sublattice. This behavior is attributed to the preferential annealing of defects in the Zn sublattice at low temperatures when compared to those of the O sublattice.
Self-consistent depth profiling and imaging of GaN-based transistors using ion microbeams
Energy Technology Data Exchange (ETDEWEB)
Redondo-Cubero, A., E-mail: andres.redondo@uam.es [IPFN, Instituto Superior Técnico, Campus Tecnológico e Nuclear, Universidade de Lisboa, 2686-953 Bobadela (Portugal); Departamento de Física Aplicada y Centro de Micro-Análisis de Materiales, Universidad Autónoma de Madrid, 28049 Madrid (Spain); Corregidor, V. [IPFN, Instituto Superior Técnico, Campus Tecnológico e Nuclear, Universidade de Lisboa, 2686-953 Bobadela (Portugal); Vázquez, L. [Instituto de Ciencia de Materiales de Madrid, Consejo Superior de Investigaciones Científicas, 28049 Madrid (Spain); Alves, L.C. [C2TN, Instituto Superior Técnico, Campus Tecnológico e Nuclear, Universidade de Lisboa, 2686-953 Bobadela (Portugal)
2015-04-01
Using an ion microprobe, a comprehensive lateral and in-depth characterization of a single GaN-based high electron mobility transistor is carried out by means of Rutherford backscattering spectrometry (RBS) in combination with particle induced X-ray emission (PIXE). Elemental distribution was obtained for every individual section of the device (wafer, gate and source contact), identifying the basic constituents of the transistor (including the detection of the passivant layer) and checking its homogeneity. A self-consistent analysis of each individual regions of the transistor was carried out with a simultaneous fit of RBS and PIXE spectra with two different beam conditions. Following this approach, the quantification of the atomic content and the layer thicknesses was successfully achieved overcoming the mass-depth ambiguity of certain elements.
Quantitative SIMS analysis of SiGe composition with low energy O2+ beams
International Nuclear Information System (INIS)
Jiang, Z.X.; Kim, K.; Lerma, J.; Corbett, A.; Sieloff, D.; Kottke, M.; Gregory, R.; Schauer, S.
2006-01-01
This work explored quantitative analyses of SiGe films on either Si bulk or SOI wafers with low energy SIMS by assuming a constant ratio between the secondary ion yields of Si + and Ge + inside SiGe films. SiGe samples with Ge contents ranging from 15 to 65% have been analyzed with a 1 keV O 2 + beam at normal incidence. For comparison, the samples were also analyzed with RBS and/or AES. The Ge content as measured with SIMS, based on a single SiGe/Si or SiGe/SOI standard, exhibited good agreement with the corresponding RBS and AES data. It was concluded that SIMS was capable of providing accurate characterization of the SiGe composition with the Ge content up to 65%
Effects of high-energy (MeV) ion implantation of polyester films
International Nuclear Information System (INIS)
Ueno, Keiji; Matsumoto, Yasuyo; Nishimiya, Nobuyuki; Noshiro, Mitsuru; Satou, Mamoru
1991-01-01
The effects of high-energy ion beam irradiation on polyester (PET) films using a 3 MeV tandem-type ion beam accelerator were studied. O, Ni, Pt, and Au as ion species were irradiated at 10 14 -10 15 ions/cm 2 on 50 μm thick PET films. Physical properties and molecular structure changes were studied by the surface resistivity measurements and RBS. The surface resistivity decreases with an increase in irradiation dose. At 10 15 ions/cm 2 irradiation, the surface resistivity is 10 8 Ω/□. According to RBS and XPS analyses, some carbon and oxygen atoms in the PET are replaced by implanted ions and the -C=O bonds are destroyed easily by the ion beam. (orig.)
2010-10-04
... Corrective Actions,'' and Table 13.3-17, ``Shift Staffing and Augmentation Capabilities,'' of the RBS... proposed action will not have a significant effect on the quality of the human environment. Accordingly...
Ion beam analysis of golden threads from Romanian medieval textiles
International Nuclear Information System (INIS)
Balta, Z.I.; Csedreki, L.; Furu, E.; Cretu, I.; Huszánk, R.; Lupu, M.; Török, Z.; Kertész, Z.; Szikszai, Z.
2015-01-01
In this study, metal threads from Romanian religious embroideries and precious velvet brocades dated from 15th to 18th century were analyzed by using IBA methods (PIXE and RBS) which, in comparison to the traditional analytical techniques (XRF, EDS), allowed the detection of their structures and accurate identification of the trace elements (detection limits of few tens of ppm). PIXE results confirmed that both types of the metal threads studied – wires and strips – have layered structures being made of fine silver, refined by cupellation, and gilded most probably with pure gold, and not of Au–Ag alloy, or gilded Ag–Cu alloy or Au–Ag–Cu alloy, as resulted from the previously performed SEM-EDS analysis. Trace elements of historical interest like lead, mercury and bismuth have been also possible to be detected by PIXE. The resulting elemental maps allowed us to identify the areas from which the metal thread structure and quantitative composition could be accurately determined. RBS measurements revealed that the gilding layer is separated from the silver bulk by an interface layer resulting through atomic diffusion of silver into the gold, which lead to the conclusion that the methods used for gilding were probably either the diffusion bonding or the fire gilding. The gilding layers thicknesses were estimated by PIXE with the GUPIX software and also determined from RBS measurements
Quantitative analysis of chemical elements in single cells using nuclear microprobe and nano-probe
International Nuclear Information System (INIS)
Deves, Guillaume
2010-01-01
The study of the role of trace elements at cellular level requires the use of state-of-the-art analytical tools that could achieve enough sensitivity and spatial resolution. We developed a new methodology for the accurate quantification of chemical element distribution in single cells based on a combination of ion beam analysis techniques STIM, PIXE and RBS. The quantification procedure relies on the development of a STIM data analysis software (Paparamborde). Validity of this methodology and limits are discussed here. The method allows the quantification of trace elements (μg/g) with a 19.8 % uncertainty in cellular compartments with mass below 0.1 ng. The main limit of the method lies in the poor number of samples that can be analyzed, due to long irradiation times required and limited access to ion beam analysis facilities. This is the reason why we developed a database for cellular chemical composition capitalization (BDC4). BDC4 has been designed in order to use cellular chemical composition as a tracer for biological activities and is expected to provide in the future reference chemical compositions for any cellular type or compartment. Application of the STIM-PIXE-RBS methodology to the study of nuclear toxicology of cobalt compounds is presented here showing that STIM analysis is absolutely needed when organic mass loss appears during PIXE-RBS irradiation. (author)
International Nuclear Information System (INIS)
Chadderton, L.T.; Johnson, E.
1977-01-01
Despite continuing improvements in applications of the analytical method of Rutherford backscattering (RBS) to solid state physics it is recognized that more complete information can be obtained if other techniques - for example transmission electron microscopy (TEM) - are employed simultaneously. Experiments are described in which a combined RBS and TEM study of the annealing of nickel, rendered amorphous by implantation of 20 keV dysprosium ions is supplemented with a completely new technique - total current spectroscopy (TCS). In TCS low energy electrons (0-15 eV) are used to probe the damaged nickel. Observations have been made during annealing of both the reappearance of the bulk band structure of the metal and of a 'surface peak' which is highly sensitive to the recovery process. Changes in the height of the surface peak reveal three sharp annealing stages, the first two being preceded by reverse annealing which correlates well with RBS and TEM results. The first annealing stage - following the amorphous to crystalline transition - may be associated with electronic effects in the vicinity of the Curie point. Changes in the position of the surface peak allow one to trace the diffusion of dysprosium to the surface. Quantum mechanical resonances at the damage/crystal interface have also been followed throughout annealing. The initially amorphous layer (approximately 2.2nm) increases in thickness slightly during recovery. (Auth.)
Ion beam analysis of golden threads from Romanian medieval textiles
Energy Technology Data Exchange (ETDEWEB)
Balta, Z.I., E-mail: balta_z_i@yahoo.com [National History Museum of Romania, Calea Victoriei 12, Sector 3, Bucharest (Romania); Csedreki, L.; Furu, E. [Institute for Nuclear Research, Hungarian Academy of Sciences, H-4001 Debrecen, P.O. Box 51 (Hungary); Cretu, I. [National Art Museum of Romania, Calea Victoriei 49-53, Sector 1, Bucharest (Romania); Huszánk, R. [Institute for Nuclear Research, Hungarian Academy of Sciences, H-4001 Debrecen, P.O. Box 51 (Hungary); Lupu, M. [National Art Museum of Romania, Calea Victoriei 49-53, Sector 1, Bucharest (Romania); Török, Z.; Kertész, Z.; Szikszai, Z. [Institute for Nuclear Research, Hungarian Academy of Sciences, H-4001 Debrecen, P.O. Box 51 (Hungary)
2015-04-01
In this study, metal threads from Romanian religious embroideries and precious velvet brocades dated from 15th to 18th century were analyzed by using IBA methods (PIXE and RBS) which, in comparison to the traditional analytical techniques (XRF, EDS), allowed the detection of their structures and accurate identification of the trace elements (detection limits of few tens of ppm). PIXE results confirmed that both types of the metal threads studied – wires and strips – have layered structures being made of fine silver, refined by cupellation, and gilded most probably with pure gold, and not of Au–Ag alloy, or gilded Ag–Cu alloy or Au–Ag–Cu alloy, as resulted from the previously performed SEM-EDS analysis. Trace elements of historical interest like lead, mercury and bismuth have been also possible to be detected by PIXE. The resulting elemental maps allowed us to identify the areas from which the metal thread structure and quantitative composition could be accurately determined. RBS measurements revealed that the gilding layer is separated from the silver bulk by an interface layer resulting through atomic diffusion of silver into the gold, which lead to the conclusion that the methods used for gilding were probably either the diffusion bonding or the fire gilding. The gilding layers thicknesses were estimated by PIXE with the GUPIX software and also determined from RBS measurements.
Energy Technology Data Exchange (ETDEWEB)
Jin, Hui [Shandong Sino-Japanese Center for Collaborative Research of Carbon Nanomaterials, Collaborative Innovation Center for Marine Biomass Fiber Materials and Textiles, College of Chemistry and Chemical Engineering, Laboratory of Fiber Materials and Modern Textile, The Growing Base for State Key Laboratory, Qingdao University, Shandong 266071 (China); Gui, Rijun, E-mail: guirijun@qdu.edu.cn [Shandong Sino-Japanese Center for Collaborative Research of Carbon Nanomaterials, Collaborative Innovation Center for Marine Biomass Fiber Materials and Textiles, College of Chemistry and Chemical Engineering, Laboratory of Fiber Materials and Modern Textile, The Growing Base for State Key Laboratory, Qingdao University, Shandong 266071 (China); Sun, Jie; Wang, Yanfeng [Institute of Materia Medica, Shandong Academy of Medical Sciences, Jinan 250062 (China)
2016-05-30
Probe-donor integrated nanocomposites were developed from conjugating silica-coated Mn{sup 2+}:ZnS quantum dots (QDs) with MoS{sub 2} QDs and photosensitive nitric oxide (NO) donors (Fe{sub 4}S{sub 3}(NO){sub 7}{sup −}, RBS). Under excitation with near-infrared (NIR) light at 808 nm, the Mn{sup 2+}:ZnS@SiO{sub 2}/MoS{sub 2}-RBS nanocomposites showed the dual-emissive two-photon excited photoluminescence (TPEPL) that induced RBS photolysis to release NO in situ. NO caused TPEPL quenching of Mn{sup 2+}:ZnS QDs, but it produced almost no impact on the TPEPL of MoS{sub 2} QDs. Hence, the nanocomposites were developed as a novel QDs-based ratiometric TPEPL probe for real-time detection of NO release in situ. The ratiometric TPEPL intensity is nearly linear (R{sup 2} = 0.9901) with NO concentration in the range of 0.01∼0.8 μM, which corresponds to the range of NO release time (0∼15 min). The detection limit was calculated to be approximately 4 nM of NO. Experimental results confirmed that this novel ratiometric TPEPL probe possessed high selectivity and sensitivity for the detection of NO against potential competitors, and especially showed high detection performance for NIR-light triggered NO release in tumor intracellular microenvironments. These results would promote the development of versatile probe-donor integrated systems, also providing a facile and efficient strategy to real-time detect the highly controllable drug release in situ, especially in physiological microenvironments. - Highlights: • Mn{sup 2+}:ZnS@SiO{sub 2}/MoS{sub 2}-RBS nanocomposites were developed as a novel ratiometric two-photon excited fluorescence probe. • This probe could conduct real-time detection of nitric oxide release in situ. • High feasibility of this probe was confirmed in tumor intracellular microenvironments.
An overview on development of safety culture of regulatory body in Korea
International Nuclear Information System (INIS)
Yoon, Myunghyun; Choi, Young Sung; Yi, Kyungjoo
2015-01-01
Fukushima accident revealed not only licensees but also regulatory bodies' (RBs) establishment of robust safety culture (SC) is crucial to implement effective safety regulation. Result of the IAEA IRRS held in 2011 required regulatory body in Korea to make improvement measure for the enhancement of safety culture of regulatory body (SCRB). Compared to works done to assess SC focused on working organizations of nuclear industry, not enough attention has been paid to assess the RBs. To achieve this goal, long-term comprehensive drive plan has to be made. The IAEA is putting great effort to establish and enhance SC in RBs. OECD/NEA CNRA is planning to produce Green Booklet on SCRB for regulatory guidance. SCRB is an organization's culture, RBs ultimately has to possess in order to assure secure use of nuclear energy. An organization's culture emerges from, and is manifested in, the interplay of its members' emotion, cognition, attitudes, behaviors and interaction patterns. As a result of this mechanism, organizational structures and culture influence individual's attitude and behavior when entered into a situation. Each organization has its strengths and weakness in SC. Safety culture defective components of the Fukushima accident was analyzed by JNES in 2012. According to the casual factors indicated in the investigation report, Nuclear Regulatory Organizations (NROs) of Korea also had weakness of the SCRB in terms of questioning attitude, continuous learning, issue identification and resolution and safety leadership. It doesn't have to be same but necessary for both NSSC and KINS to be consistent in building SC traits to carry out a coherent policy with synergy effect. NROs should communicated and convey consistent message to the stakeholders. Not limited to development of SCRB itself, influence of SCRB on licensee's SC is recommended for further study. Also, what behaviors are expected to make positive effects and whether they can
Complex damage distribution behaviour in cobalt implanted rutile TiO2 (1 1 0) lattice
Joshi, Shalik Ram; Padmanabhan, B.; Chanda, Anupama; Ojha, Sunil; Kanjilal, D.; Varma, Shikha
2017-11-01
The present work investigates the radiation damage, amorphization and structural modifications that are produced by ion-solid interactions in TiO2 crystals during 200 keV Cobalt ion implantation. RBS/C and GIXRD have been utilized to evaluate the damage in the host lattice as a function of ion fluence. Multiple scattering formalism has been applied to extract the depth dependent damage distributions in TiO2(1 1 0). The results have been compared with the MC simulations performed using SRIM-2013. RBS/C results delineate a buried amorphous layer at a low fluence. Surprisingly, ion induced dynamic activation produces a recovery in this damage at higher fluences. This improvement interestingly occurs only in deep regions (60-300 nm) where a systematic lowering in damage with fluence is observed. Formation of Co-Ti-O phases and generation of stress in TiO2 lattice can also be responsible for this improvement in deep regions. In contrast, surface region (0-60 nm) indicates a gradual increase in damage with fluence. Such a switch in the damage behavior creates a cross point in damage profiles at 60 nm. Surface region is a sink of vacancies whereas deep layers are interstitial rich. However, these regions are far separated from each other resulting in an intermediate (100-150 nm) region with a significant dip (valley) in damage which can be characterized by enhanced recombination of point defects. The damage profiles thus indicate a very complex behavior. MC simulations, however, present very different results. They depict a damage profile that extends to a depth of only 150 nm, which is only about half of the damage- width observed here via RBS/C. Moreover, MC simulations do not indicate presence of any valley like structure in the damage profile. The complex nature of damage distribution observed here via RBS/C may be related to the high ionic nature of the chemical bonds in the TiO2 lattice.
An overview on development of safety culture of regulatory body in Korea
Energy Technology Data Exchange (ETDEWEB)
Yoon, Myunghyun; Choi, Young Sung; Yi, Kyungjoo [Korea Institute of Nuclear Safety, Daejeon (Korea, Republic of)
2015-10-15
Fukushima accident revealed not only licensees but also regulatory bodies' (RBs) establishment of robust safety culture (SC) is crucial to implement effective safety regulation. Result of the IAEA IRRS held in 2011 required regulatory body in Korea to make improvement measure for the enhancement of safety culture of regulatory body (SCRB). Compared to works done to assess SC focused on working organizations of nuclear industry, not enough attention has been paid to assess the RBs. To achieve this goal, long-term comprehensive drive plan has to be made. The IAEA is putting great effort to establish and enhance SC in RBs. OECD/NEA CNRA is planning to produce Green Booklet on SCRB for regulatory guidance. SCRB is an organization's culture, RBs ultimately has to possess in order to assure secure use of nuclear energy. An organization's culture emerges from, and is manifested in, the interplay of its members' emotion, cognition, attitudes, behaviors and interaction patterns. As a result of this mechanism, organizational structures and culture influence individual's attitude and behavior when entered into a situation. Each organization has its strengths and weakness in SC. Safety culture defective components of the Fukushima accident was analyzed by JNES in 2012. According to the casual factors indicated in the investigation report, Nuclear Regulatory Organizations (NROs) of Korea also had weakness of the SCRB in terms of questioning attitude, continuous learning, issue identification and resolution and safety leadership. It doesn't have to be same but necessary for both NSSC and KINS to be consistent in building SC traits to carry out a coherent policy with synergy effect. NROs should communicated and convey consistent message to the stakeholders. Not limited to development of SCRB itself, influence of SCRB on licensee's SC is recommended for further study. Also, what behaviors are expected to make positive effects and whether they can
Directory of Open Access Journals (Sweden)
Caroline Mariana de Aguiar
2011-10-01
Full Text Available O presente trabalho teve como objetivo a avaliação da cinética de produção de enzimas celulases pelo fungo Aspergillus niger e da cinética de desativação das celulases. Foi utilizado bagaço de cana-de-açúcar pré-tratado como fonte de carbono na fermentação para a produção do complexo celulásico e também como substrato da hidrólise enzimática. A. niger foi cultivado em três bateladas, cada uma contendo 10, 50 e 100 g L-1 de bagaço pré-tratado com NaOH 4% (m v-1. A cinética da produção das celulases foi obtida determinando-se a atividade enzimática das amostras coletadas ao longo do tempo. As variações do pH também foram determinadas. A deativação enzimática foi avaliada determinando-se periodicamente a atividade das amostras armazenadas nas condições de resfriamento (4°C e de congelamento (-18ºC. Conclui-se que o A. niger produz celulases quando cultivado em meio de cultivo contendo bagaço de cana-de-açúcar pré-tratado e que o tempo ideal para coleta do caldo enzimático foi de aproximadamente sete dias, com produtividade máxima de 0,0013 U mL-1∙h para a batelada com 10 g L-1 e 0,0018 U mL-1∙h para as bateladas com 50 e 100 g L-1. O complexo celulásico não sofre desativação se armazenado à temperatura de -18°C por 43 dias, mas perde cerca de 40% da sua atividade após 48h se armazenado a 4°C.This work aimed to evaluate the kinetic for the cellulase production by Aspergillus niger and the deactivation kinetic of the cellulase enzymes. Cellulase were produced in three different batches using NaOH 4% (w v-1 pre-treated sugarcane bagasse as the carbon source in the fermentation broth. The amount of the bagasse in each batch was 10, 50 and 100 g L-1. The kinetic of the cellulase production was accomplished by periodically determining the cellulasic activity of the fermentation broth using pre-treated bagasse as the hydrolysis substrate. Changes in the pH also were determined. The cellulase
Advanced characterization of materials using swift ion beams
Energy Technology Data Exchange (ETDEWEB)
Tabacniks, Manfredo H. [Universidade de Sao Paulo (USP), SP (Brazil)
2011-07-01
Swift ion beams are powerful non destructive tools for material analysis especially thin films. In spite of their high energy, usually several MeV/u, little energy is deposited by the ion on the sample. Energetic ions also use to stop far away (or outside) the inspected volume, hence producing negligible damage to the sample. Ion beam methods provide quantitative trace element analysis of any atomic element (and some isotopes) in a sample and are able to yield elemental depth profiles with spatial resolution of the order of 10mm. Relying on nuclear properties of the atoms, these methods are insensitive to the chemical environment of the element, consequently not limited by matrix effects. Ion beam methods are multielemental, can handle insulating materials, are quick (an analysis usually takes less than 15 minutes), and need little (if any) sample preparation. Ion beams are also sensitive to surface roughness and sample porosity and can be used to quickly inspect these properties in a sample. The Laboratory for Ion Beam Analysis of the University of Sao Paulo, LAMFI, is a multi-user facility dedicated to provide Ion Beam Methods like PIXE, RBS, FRS and NRA techniques for the analysis of materials and thin films. Operating since 1994, LAMFI is being used mostly by many researchers from within and outside USP, most of them non specialists in ion beam methods, but in need of ion beam analysis to carry out their research. At LAMFI, during the last 9 years, more than 50% of the accelerator time was dedicated to analysis, usually PIXE or RBS. 21% was down time and about 14% of the time was used for the development of ion beam methods which includes the use of RBS for roughness characterization exploring the shading of the beam by structures on the surface and by modeling the RBS spectrum as the product of a normalized RBS spectrum and a height density distribution function of the surface. Single element thick target PIXE analysis is being developed to obtain the thin
Advanced characterization of materials using swift ion beams
International Nuclear Information System (INIS)
Tabacniks, Manfredo H.
2011-01-01
Swift ion beams are powerful non destructive tools for material analysis especially thin films. In spite of their high energy, usually several MeV/u, little energy is deposited by the ion on the sample. Energetic ions also use to stop far away (or outside) the inspected volume, hence producing negligible damage to the sample. Ion beam methods provide quantitative trace element analysis of any atomic element (and some isotopes) in a sample and are able to yield elemental depth profiles with spatial resolution of the order of 10mm. Relying on nuclear properties of the atoms, these methods are insensitive to the chemical environment of the element, consequently not limited by matrix effects. Ion beam methods are multielemental, can handle insulating materials, are quick (an analysis usually takes less than 15 minutes), and need little (if any) sample preparation. Ion beams are also sensitive to surface roughness and sample porosity and can be used to quickly inspect these properties in a sample. The Laboratory for Ion Beam Analysis of the University of Sao Paulo, LAMFI, is a multi-user facility dedicated to provide Ion Beam Methods like PIXE, RBS, FRS and NRA techniques for the analysis of materials and thin films. Operating since 1994, LAMFI is being used mostly by many researchers from within and outside USP, most of them non specialists in ion beam methods, but in need of ion beam analysis to carry out their research. At LAMFI, during the last 9 years, more than 50% of the accelerator time was dedicated to analysis, usually PIXE or RBS. 21% was down time and about 14% of the time was used for the development of ion beam methods which includes the use of RBS for roughness characterization exploring the shading of the beam by structures on the surface and by modeling the RBS spectrum as the product of a normalized RBS spectrum and a height density distribution function of the surface. Single element thick target PIXE analysis is being developed to obtain the thin
Dorsett, Dale
2006-01-01
The sister chromatid cohesion apparatus mediates physical pairing of duplicated chromosomes. This pairing is essential for appropriate distribution of chromosomes into the daughter cells upon cell division. Recent evidence shows that the cohesion apparatus, which is a significant structural component of chromosomes during interphase, also affects gene expression and development. The Cornelia de Lange (CdLS) and Roberts/SC phocomelia (RBS/SC) genetic syndromes in humans are caused by mutations affecting components of the cohesion apparatus. Studies in Drosophila suggest that effects on gene expression are most likely responsible for developmental alterations in CdLS. Effects on chromatid cohesion are apparent in RBS/SC syndrome, but data from yeast and Drosophila point to the likelihood that changes in expression of genes located in heterochromatin could contribute to the developmental deficits. PMID:16819604
Passivation of cobalt nanocluster assembled thin films with hydrogen
DEFF Research Database (Denmark)
Romero, C.P.; Volodin, A.; Di Vece, M.
2012-01-01
The effect of hydrogen passivation on bare and Pd capped cobalt nanocluster assembled thin films was studied with Rutherford backscattering spectrometry (RBS) and magnetic force microscopy (MFM) after exposure to ambient conditions. The nanoclusters are produced in a laser vaporization cluster...... source in which the helium carrier gas was mixed with hydrogen. RBS revealed that oxidation of the Co nanoclusters is considerably reduced by the presence of hydrogen during cluster formation. The capping did not modify the influence of the passivation. The hydrogen passivation method is especially...... effective in cases when capping of the films is not desirable, for example for magnetic studies. Clear differences in the magnetic domain structures between hydrogen passivated and non-passivated Co nanocluster films were demonstrated by MFM and are attributed to a difference in inter-cluster magnetic...
Distribution and characterization of iron in implanted silicon carbide
International Nuclear Information System (INIS)
Bentley, J.; Romana, L.J.; Horton, L.L.; McHargue, C.J.
1991-01-01
Analytical electron microscopy (AEM) and Rutherford backscattering spectroscopy-ion channeling (RBS-C) have been used to characterize single crystal α-silicon carbide implanted at room temperature with 160 keV 57 Fe ions to fluences of 1, 3, and 6 x 10 16 ions/cm 2 . Best correlations among AEM, RBS, and TRIM calculations were obtained assuming a density of the amorphized implanted regions equal to that of crystalline SiC. No iron-rich precipitates or clusters were detected by AEM. Inspection of the electron energy loss fine structure for iron in the implanted specimens suggests that the iron is not metallically-bonded, supporting conclusions from earlier conversion electron Moessbauer spectroscopy (CEMS) studies. In-situ annealing surprisingly resulted in crystallization at 600 degrees C with some redistribution of the implanted iron
Industrial oriented research at Ljubljana Tandetron Facility
International Nuclear Information System (INIS)
Pelicon, P.; Simcic, J.; Razpet, A.; Budnar, M.
2001-01-01
Full text: Galvanization is the cheapest and the most frequently used industrial coating technique. The diagnostics of usually thick deposited layers is rather time consuming and expensive, when surface layers have to be removed to obtain depth concentration profiles. Proton- impact RBS exhibits both large range and sufficient depth resolution for efficient and cost-effective depth profiling. Several galvanic coatings, composed of Sn/Cu/Ni/Graphite layers were analyzed by current-normalized RBS. 3 MeV protons were used to enable detection range of up to 25 micrometers. SIMNRA code was used to analyze the spectra. The depth concentration profiles obtained enable the control of annealing to obtain proper concentration mixing at the interfaces. In this way, the melting point of the upper layer for contact welding and wear hardness could be optimized. (author)
Sub-monolayer growth of Ag on flat and nanorippled SiO{sub 2} surfaces
Energy Technology Data Exchange (ETDEWEB)
Bhatnagar, Mukul; Ranjan, Mukesh; Mukherjee, Subroto [FCIPT, Institute for Plasma Research, Gandhinagar 382428, Gujarat (India); Nirma University, Ahmedabad 382481, Gujarat (India); Jolley, Kenny; Smith, Roger [Department of Mathematical Sciences, Loughborough University, Leicestershire LE11 3TU (United Kingdom)
2016-05-30
In-situ Rutherford Backscattering Spectrometry (RBS) and Molecular Dynamics (MD) simulations have been used to investigate the growth dynamics of silver on a flat and the rippled silica surface. The calculated sticking coefficient of silver over a range of incidence angles shows a similar behaviour to the experimental results for an average surface binding energy of a silver adatom of 0.2 eV. This value was used to parameterise the MD model of the cumulative deposition of silver in order to understand the growth mechanisms. Both the model and the RBS results show marginal difference between the atomic concentration of silver on the flat and the rippled silica surface, for the same growth conditions. For oblique incidence, cluster growth occurs mainly on the leading edge of the rippled structure.
Structural characterization of Mn implanted AlInN
Energy Technology Data Exchange (ETDEWEB)
Majid, Abdul; Ali, Akbar [Advance Materials Physics Laboratory, Quaid-i-Azam University, Islamabad (Pakistan); Zhu, J J; Wang, Y T [State Key Laboratory on Integrated Optoelectronics, Institute of Semiconductor, Chinese Academy of Sciences, Beijing 100083 (China)], E-mail: abdulmajid40@yahoo.com, E-mail: akbar@qau.edu.pk
2008-06-07
AlInN/GaN thin films were implanted with Mn ions and subsequently annealed isochronically at 750 and 850 deg. C. X-ray diffraction and Rutherford backscattering spectroscopy (RBS) techniques were employed to study the microstructural properties of the implanted/annealed samples. The effect of annealing on implantation-induced strain in thin films has been studied in detail. The strain was found to increase with dose until it reached a saturation value and after that it started decreasing with a further increase in the dose. RBS measurements indicated the atomic diffusion of In, Al, Ga and Mn in implanted samples. The in- and out-diffusion of atoms has been observed after annealing at 750 deg. C and 850 deg. C, respectively. Strong decomposition of the samples took place when annealed at 850 deg. C.
Structural characterization of Mn implanted AlInN
International Nuclear Information System (INIS)
Majid, Abdul; Ali, Akbar; Zhu, J J; Wang, Y T
2008-01-01
AlInN/GaN thin films were implanted with Mn ions and subsequently annealed isochronically at 750 and 850 deg. C. X-ray diffraction and Rutherford backscattering spectroscopy (RBS) techniques were employed to study the microstructural properties of the implanted/annealed samples. The effect of annealing on implantation-induced strain in thin films has been studied in detail. The strain was found to increase with dose until it reached a saturation value and after that it started decreasing with a further increase in the dose. RBS measurements indicated the atomic diffusion of In, Al, Ga and Mn in implanted samples. The in- and out-diffusion of atoms has been observed after annealing at 750 deg. C and 850 deg. C, respectively. Strong decomposition of the samples took place when annealed at 850 deg. C
Classificação de Muscidae (Diptera: uma proposta através da análise cladístical
Directory of Open Access Journals (Sweden)
Cláudio José Barros de Carvalho
1989-01-01
Full Text Available A cladistic analysis for 27 muscid genera is given, running the PAUP program (SWOFFORD, 1985. The 35 characters used in this study are polarized based on three outgroups of related families. A cladogram showing hypothetical phylogenetic relationships among genera and a discussion of the characters enable to propose a sequencial phylogenetic classification of Muscidae at tribal level. The following seven subfamilies and eight tribes are included: Achanthipterinae; Atherigoninae; Muscinae, with Muscini and Stomoxiini; Azeliinae, with Azeliini and Reinwardtiini; Phaoniinae; Mydaeinae, with Graphomyiini and Mydaeini and Coenosiinae, with Coenosiini and Limnophorini. Helina Robineau-Desvoidy, 1830 has not a defined position in the obtained cladogram to the considered levels. The neotropical species of Phaonia (aut. must be separated in a new genus. The proposed classification is compared with contemporaneous classifications. The greatest congruence is found with that of SKIDMORE (1985.
Avaliação quimiométrica da distribuição de metais pesados em composto de lixo urbano domiciliar
Directory of Open Access Journals (Sweden)
Egreja Filho Fernando Barboza
1999-01-01
Full Text Available The main obstacle to the use of compost from urban waste in agriculture is the presence of heavy metals. Once in the soil, their effect is accumulative and they may contaminate crops and water. The present study reports the evaluation of the chemical distributions of Cu, Pb, Mn and Zn in three different sized fractions (unsieved, < 1,18mm and > 1,18mm of compost, by means of a sequencial extraction procedure and a chemometric analysis of the total content of all metals in each fraction. The pattern recognition methods showed significant differences in total heavy metal contents for the different fractions. The finest one was the most contaminated. Meanwhile, this fraction presented lower amounts of metals in avaliable forms. This behavior can be attributed to the presence of metal particles in their elemental states in this fraction.
Recovery of Bacillus sphaericus spores by flocculation/sedimentation and flotation
Directory of Open Access Journals (Sweden)
Christine Lamenha Luna
2005-06-01
Full Text Available The aim of this work was use flocculation/sedimentation and flotation for recovery of spores of the Bacillus sphaericus. Microorganism was produced batchwise using culture medium based skimmed milk, corn steep liquor and mineral salts. The best results of flocculation were obtained using CaCl2.2H2O, FeCl3.6H2O, Al2(SO43 and tannin as flocculating agents, with optimal flocculation concentrations of 1,500, 3,000, 2,000 and 1,700ppm, respectively. Flocculent suspensions were characterized based on floc diameter and density. Settling tests were performed in batch at different concentrations of the cellular suspensions and revealed high recovery of the solids in suspension in all cases. Flotation tests were accomplished using a mechanical agitated flotation cell and the process was favoured by the increase of the system agitation and for the presence of a cationic collector.O trabalho aborda a recuperação de esporos da bactéria Bacillus sphaericus por floculação/sedimentação e flotação. O microrganismo foi produzido em batelada, utilizando-se meio de cultivo à base de leite desnatado, milhocina e sais minerais. Os melhores resultados de floculação foram obtidos com os floculantes CaCl2.2H2O, FeCl3.6H2O, Al2(SO43 e tanino, com concentrações ótimas de 1.500, 3.000, 2.000 e 1.700ppm, respectivamente. Os sistemas floculentos foram caracterizados através da determinação da densidade e do diâmetro médio dos flocos. Testes de sedimentação em batelada a diferentes concentrações das suspensões celulares revelaram elevados índices de recuperação dos sólidos em suspensão em todos os casos. Os ensaios de flotação foram realizados em célula de flotação mecânica, e o processo foi favorecido pelo aumento da agitação do sistema e pela presença de um coletor catiônico.
Spectroscopy in catalysis : an introduction
Niemantsverdriet, J.W.
2000-01-01
Spectroscopy in Catalysis describes the most important modern analytical techniques used to investigate catalytic surfaces. These include electron spectroscopy (XPS, UPS, AES, EELS), ion spectroscopy (SIMS, SNMS, RBS, LEIS), vibrational spectroscopy (infrared, Raman, EELS), temperature-programmed
Ion beam analysis of Cu(In,Ga)Se{sub 2} thin film solar cells
Energy Technology Data Exchange (ETDEWEB)
Karydas, A.G. [International Atomic Energy Agency (IAEA), IAEA Laboratories, Nuclear Science and Instrumentation Laboratory, A-2444 Seibersdorf (Austria); Institute of Nuclear and Particle Physics, NCSR “Demokritos”, 153 10 Aghia Paraskevi, Athens Greece (Greece); Streeck, C. [Physikalisch-Technische Bundesanstalt (PTB), Abbestr. 2-12, 10587 Berlin (Germany); Radovic, I. Bogdanovic [Ruđer Bošković Institute (RBI), Zagreb (Croatia); Kaufmann, C.; Rissom, T. [Helmholtz-Zentrum Berlin für Materialien und Energie GmbH (HZB), Hahn-Meitner-Platz 1, 14109 Berlin (Germany); Beckhoff, B. [Physikalisch-Technische Bundesanstalt (PTB), Abbestr. 2-12, 10587 Berlin (Germany); Jaksic, M. [Ruđer Bošković Institute (RBI), Zagreb (Croatia); Barradas, N.P. [Centro de Ciências e Tecnologias Nucleares, Instituto Superior Técnico, Universidade de Lisboa, E. N. 10, Apartado 21, 2686-953 Sacavém (Portugal)
2015-11-30
Graphical abstract: - Highlights: • Elemental depth profiles for various CIGS thin films were quantitatively determined. • Pure absorbers, complete cell and bilayer solar cells were prepared and analyzed. • Synergistic PIXE and RBS analysis of thin solar cells using alpha beam particles. • High energy alpha beam resolved completely the Indium depth profile. • Synchrotron based Reference Free GIXRF quantitative analysis validated IBA results. - Abstract: The present work investigates the potential of ion beam analysis (IBA) techniques such as the Rutherford backscattering spectrometry (RBS) and particle induced X-ray emission (PIXE) using helium ions to provide quantitative in-depth elemental analysis of various types of Cu(In,Ga)Se{sub 2} thin films. These films with a thickness of about 2 μm are used as absorber layers in photovoltaic devices with continuously increasing the performance of this technology. The preparation process generally aims to obtain an in-depth gradient of In and Ga concentrations that optimizes the optoelectronic and electrical properties of the solar cell. The measurements were performed at directly accessible single or double layered CIGS absorbers and at buried absorbers in completed thin film solar cells. The IBA data were analyzed simultaneously in order to derive best fitted profiles that match all experimental RBS and PIXE spectra. For some samples elemental profiles deduced form synchrotron based, reference free grazing incidence X-ray fluorescence analysis were compared with the IBA results and an overall good agreement was observed within quoted uncertainties.
Damage accumulation in MgO irradiated with MeV Au ions at elevated temperatures
Energy Technology Data Exchange (ETDEWEB)
Bachiller-Perea, Diana, E-mail: dianabachillerperea@gmail.com [Centre de Sciences Nucléaires et de Sciences de la Matière (CSNSM), Univ. Paris-Sud, CNRS-IN2P3, Université Paris-Saclay, 91405, Orsay Cedex (France); Centro de Micro-Análisis de Materiales, Universidad Autónoma de Madrid, C/Faraday 3, 28049, Madrid (Spain); Dpto. de Física Aplicada, Universidad Autónoma de Madrid, Ciudad Universitaria de Cantoblanco, 28049, Madrid (Spain); Debelle, Aurélien, E-mail: aurelien.debelle@u-psud.fr [Centre de Sciences Nucléaires et de Sciences de la Matière (CSNSM), Univ. Paris-Sud, CNRS-IN2P3, Université Paris-Saclay, 91405, Orsay Cedex (France); Thomé, Lionel [Centre de Sciences Nucléaires et de Sciences de la Matière (CSNSM), Univ. Paris-Sud, CNRS-IN2P3, Université Paris-Saclay, 91405, Orsay Cedex (France); Behar, Moni [Instituto de Física, Universidade Federal do Rio Grande do Sul, C.P. 15051, 91501-970, Porto Alegre, RS (Brazil)
2016-09-15
The damage accumulation process in MgO single crystals under medium-energy heavy ion irradiation (1.2 MeV Au) at fluences up to 4 × 10{sup 14} cm{sup −2} has been studied at three different temperatures: 573, 773, and 1073 K. Disorder depth profiles have been determined through the use of the Rutherford backscattering spectrometry in channeling configuration (RBS/C). The analysis of the RBS/C data reveals two steps in the MgO damage process, irrespective of the temperature. However, we find that for increasing irradiation temperature, the damage level decreases and the fluence at which the second step takes place increases. A shift of the damage peak at increasing fluence is observed for the three temperatures, although the position of the peak depends on the temperature. These results can be explained by an enhanced defect mobility which facilitates defect migration and may favor defect annealing. X-ray diffraction reciprocal space maps confirm the results obtained with the RBS/C technique. - Highlights: • High-temperature MeV-ion irradiated MgO exhibits a two-step damage process. • The occurrence of the second step is delayed with increasing temperature. • The damage level decreases with increasing temperature. • A shift of the damage peak is observed with increasing fluence. • A high defect mobility at high temperatures in MgO is clearly evidenced.
Merksi Läti konkurendi juht läheb altkäemaksu andmise eest vangi / Silvia Kruusmaa
Kruusmaa, Silvia
2008-01-01
Läti rahvusraamatukogu ehitusega seotud ehitusettevõtte RBS Skalsi juhatuse liige Andris Treijs mõisteti altkäemaksu andmise eest vangi. Raamatukogu ehitusest on korruptsiooni tõttu kõrvale tõrjutud ka Merko Ehituse tütarfirma Merks
Nuclear microscopy in medical research. Investigations into degenerative diseases
Energy Technology Data Exchange (ETDEWEB)
Makjanic, J; Thong, P; Watt, F [National University of Singapore (Singapore). Dept. of Physics
1997-03-01
The high energy (1-4MeV) focused ion beam (nuclear microbeam) has found uses in many scientific disciplines through a wide variety of ion beam based techniques. Of the many techniques available, the powerful combination of Particle Induced X-Ray Emission (PIXE), Rutherford Backscattering Spectrometry (RBS), and Scanning Transmission Ion Microscopy (STIM) is proving to be extremely useful, particularly in the characterisation and elemental analysis of thin specimens. In this paper we briefly review these ion beam techniques, as well as the hardware required for their application. Finally, we describe the application of the PIXE, RBS and STIM techniques in conjunction with a scanning focused 2MeV proton microbeam (nuclear microscopy). The examples chosen to illustrate the potential of nuclear microscopy are recent investigations into the degenerative diseases atherosclerosis (coronary heart disease), Parkinson`s disease and Alzheimer`s disease. (author)
Exploring advantages of 4He-PIXE analysis for layered objects in cultural heritage
International Nuclear Information System (INIS)
Roehrs, S.; Calligaro, T.; Mathis, F.; Ortega-Feliu, I.; Salomon, J.; Walter, P.
2006-01-01
In the field of cultural heritage 4 He particle beams are often used to perform RBS analysis. In most cases the simultaneously produced X-rays are not considered for PIXE analysis. This paper aims to explore the potentials of 4 He induced X-ray emission (α-PIXE) using 4, 5 and 6 MeV 4 He beams and to compare its performance with that of conventional PIXE with 3 MeV protons. The α-PIXE and α-RBS spectra were collected at the same time in a vacuum chamber. The X-ray yields produced by 6 MeV 4 He beam for K-lines were found to be superior to those of protons for atomic numbers below 25. An additional advantage of α-PIXE is the lower bremsstrahlung background which leads to an improved peak to noise ratio for certain elements
Radiation-damage recovery in undoped and oxidized Li doped Mg O crystals implanted with lithium ions
Energy Technology Data Exchange (ETDEWEB)
Alves, E. E-mail: ealves@itn.pt; Silva, R.C. da; Pinto, J.V.; Monteiro, T.; Savoini, B.; Caceres, D.; Gonzalez, R.; Chen, Y
2003-05-01
Undoped MgO and oxidized Li-doped MgO single crystals were implanted with 1 x 10{sup 17} Li{sup +}/cm{sup 2} at 175 keV. The Rutherford backscattering spectrometry (RBS)/channeling data obtained after implantation shows that damage was produced throughout the entire range of the implanted ions. Optical absorption measurements indicate that after implantation the most intense band occurs at {approx}5.0 eV, which has been associated with anion vacancies. After annealing at 450 K the intensity of the oxygen-vacancy band decreases monotonically with temperature and completely disappears at 950 K. A broad extinction band centered at {approx}2.14 eV associated with lithium precipitates emerges gradually and anneals out at 1250 K. RBS/channeling shows that recovery of the implantation damage is completed after annealing the oxidized samples at 1250 K.
Heavy ion time-of-flight ERDA of high dose metal implanted germanium
Energy Technology Data Exchange (ETDEWEB)
Dytlewski, N.; Evans, P.J.; Noorman, J.T. [Australian Nuclear Science and Technology Organisation, Lucas Heights, NSW (Australia); Wielunski, L.S. [Commonwealth Scientific and Industrial Research Organisation (CSIRO), Lindfield, NSW (Australia). Div. of Applied Physics; Bunder, J. [New South Wales Univ., Wollongong, NSW (Australia). Wollongong Univ. Coll
1996-12-31
With the thick Ge substrates used in ion implantation, RBS can have difficulty in resolving the mass-depth ambiguities when analysing materials composed of mixtures of elements with nearly equal masses. Additional, and complimentary techniques are thus required. This paper reports the use of heavy ion time-of-flight elastic recoil detection analysis (ToF- ERDA), and conventional RBS in the analysis of Ge(100) implanted with high dose Ti and Cu ions from a MEWA ion source . Heavy ion ToF ERDA has been used to resolve, and profile the implanted transition metal species, and also to study any oxygen incorporation into the sample resulting from the implantation, or subsequential reactions with air or moisture. This work is part of a study on high dose metal ion implantation of medium atomic weight semiconductor materials. 13 refs., 6 figs.
Heavy ion time-of-flight ERDA of high dose metal implanted germanium
Energy Technology Data Exchange (ETDEWEB)
Dytlewski, N; Evans, P J; Noorman, J T [Australian Nuclear Science and Technology Organisation, Lucas Heights, NSW (Australia); Wielunski, L S [Commonwealth Scientific and Industrial Research Organisation (CSIRO), Lindfield, NSW (Australia). Div. of Applied Physics; Bunder, J [New South Wales Univ., Wollongong, NSW (Australia). Wollongong Univ. Coll
1997-12-31
With the thick Ge substrates used in ion implantation, RBS can have difficulty in resolving the mass-depth ambiguities when analysing materials composed of mixtures of elements with nearly equal masses. Additional, and complimentary techniques are thus required. This paper reports the use of heavy ion time-of-flight elastic recoil detection analysis (ToF- ERDA), and conventional RBS in the analysis of Ge(100) implanted with high dose Ti and Cu ions from a MEWA ion source . Heavy ion ToF ERDA has been used to resolve, and profile the implanted transition metal species, and also to study any oxygen incorporation into the sample resulting from the implantation, or subsequential reactions with air or moisture. This work is part of a study on high dose metal ion implantation of medium atomic weight semiconductor materials. 13 refs., 6 figs.
Bovine Blood Constituents as Fat Replacers in Ham Pâté
Directory of Open Access Journals (Sweden)
Fabiana Ribeiro Viana
2004-01-01
Full Text Available Some tests were carried out in this work with the aim of evaluating a partial replacement of fat in the raw batter of ham pâté by using bovine blood constituents, such as globin (GL, plasma (PL or 1:1 globin and plasma (GP. Plasma was separated from red cells by blood centrifugation, and globin was extracted by the carboxymethylcellulose method. The salt-soluble protein content (SSP and the binding properties including water holding capacity (WHC and raw batter stability (RBS were estimated. The results indicated that among the 3 treatments studied, the use of globin showed to be a little more advantageous for the quality of the raw batter of ham pâté, since its incorporation as fat replacer led to an increase in RBS but no change of SSP was observed.
Energy Technology Data Exchange (ETDEWEB)
Kubota, K; Imura, T; Iwami, M; Hiraki, A [Osaka Univ., Suita (Japan). Dept. of Electrical Engineering; Satou, M [Government Industrial Research Inst., Osaka, Ikeda (Japan); Fujimoto, F [Tokyo Univ. (Japan). Coll. of General Education; Hamakawa, Y [Osaka Univ., Toyonaka (Japan). Faculty of Engineering Science; Minomura, S [Tokyo Univ. (Japan). Inst. for Solid State Physics; Tanaka, K [Electrotechnical Lab., Tanashi, Tokyo (Japan)
1980-01-01
Rutherford backscattering spectrometry (RBS) was applied to the characterization of amorphous silicon films prepared by glow discharge in silane, tetrode- and diode-sputterings of silicon target in ambient argon or hydrogen diluted by argon. This method was able to detect at least 5 at.% hydrogen atoms in amorphous silicon through the change of stopping power. Hydrogen content in films made by glow discharge at the substrate temperature 25/sup 0/C to 300/sup 0/C and at 2 torr of silane gas varied from 50% to 20%. A strong trend was found for oxygen to dissolve into films: Films produced by diode sputtering in argon gas with higher pressure than 3 x 10/sup -2/ torr absorbed oxygen. The potential and fitness of the RBS method for the characterization of amorphous silicon films are emphasized and demonstrated.
International Nuclear Information System (INIS)
Kamwanna, T.; Pasaja, N.; Yu, L.D.; Vilaithong, T.; Anders, A.; Singkarat, S.
2008-01-01
Amorphous carbon (a-C) films were deposited on Si(1 0 0) wafers by a filtered cathodic vacuum arc (FCVA) plasma source. A negative electrical bias was applied to the silicon substrate in order to control the incident energy of carbon ions. Effects of the electrical bias on the a-C/Si interface characteristics were investigated by using standard Rutherford backscattering spectrometry (RBS) in the channeling mode with 2.1-MeV He 2+ ions. The shape of the Si surface peaks of the RBS/channeling spectra reflects the degree of interface disorder due to atomic displacement from the bulk position of the Si crystal. Details of the analysis method developed are described. It was found that the width of the a-C/Si interface increases linearly with the substrate bias voltage but not the thickness of the a-C film.
An ASEAN Ion Beam Analysis Center at Chiang Mai University, Thailand
International Nuclear Information System (INIS)
Tippawan, U.; Kamwann, T.; Yu, L.D.; Intarasiri, S.; Puttaraksa, N.; Unai, S.; Thongleurm, C.; Singkarat, S.
2014-01-01
To contribute to the development of nuclear science and technology in Thailand, a comprehensive ion beam analysis center unique in the ASEAN region has recently been established at Chiang Mai University, Thailand. The center is equipped with a 1.7-MV Tandetron tandem accelerator with an ion beam analysis beam line. The beam line is currently capable of performing ion beam analysis techniques such as Rutherford Backscattering Spectrometry (RBS), RBS/channeling, Elastic BackScattering (EBS), Particle Induced X-ray Emission (PIXE) and Ionoluminescence (IL) with assistance of commercial and in-house-developed softwares. Micro ion beam for MeV-ion mapping using programmable aperture or capillary focusing techniques is being developed. Ion beam analysis experiments and applications have been vigorously developed, especially for novel materials analysis focused on archeological, gemological and biological materials besides other conventional materials.
External-RBS, PIXE and NRA analysis for ancient swords
Energy Technology Data Exchange (ETDEWEB)
Santos, Hellen C., E-mail: hellencsa@gmail.com; Added, Nemitala; Silva, Tiago F.; Rodrigues, C.L.
2015-02-15
Elemental composition of the steel of two ancient swords (Japanese and Damascus from a private collection) was characterized using in air IBA techniques. Our results contribute for the understanding the processes of manufacturing (hammering and quenching) and surface treatments applied in these swords. The Particle Induced X-ray Emission (PIXE) measurements along the Damascus blade allowed to identify and to trace a superficial concentration profile for the elements such Cr, Mn, Fe, Ni, Cu, Zn and As, while results for the Japanese blade showed only the presence of iron. The carbon content on the surface was also investigated using a resonant region in the Elastic Backscattering Spectrometry (EBS) measurements and the results have shown a slightly difference between the surfaces under investigation. In order to investigate the nitrogen content on surface, that could explain the hardening process, we used Nuclear Reaction Analysis (NRA) and the results shown that nitrogen content was under our detection limit for the technique (0.3% in mass). The measurements of PIXE, NRA and EBS were taken using the external beam setup installed at Lamfi – São Paulo/Brazil, the latter being successfully implemented for the first time in this facility.
External-RBS, PIXE and NRA analysis for ancient swords
Santos, Hellen C.; Added, Nemitala; Silva, Tiago F.; Rodrigues, C. L.
2015-02-01
Elemental composition of the steel of two ancient swords (Japanese and Damascus from a private collection) was characterized using in air IBA techniques. Our results contribute for the understanding the processes of manufacturing (hammering and quenching) and surface treatments applied in these swords. The Particle Induced X-ray Emission (PIXE) measurements along the Damascus blade allowed to identify and to trace a superficial concentration profile for the elements such Cr, Mn, Fe, Ni, Cu, Zn and As, while results for the Japanese blade showed only the presence of iron. The carbon content on the surface was also investigated using a resonant region in the Elastic Backscattering Spectrometry (EBS) measurements and the results have shown a slightly difference between the surfaces under investigation. In order to investigate the nitrogen content on surface, that could explain the hardening process, we used Nuclear Reaction Analysis (NRA) and the results shown that nitrogen content was under our detection limit for the technique (0.3% in mass). The measurements of PIXE, NRA and EBS were taken using the external beam setup installed at Lamfi - São Paulo/Brazil, the latter being successfully implemented for the first time in this facility.
External-RBS, PIXE and NRA analysis for ancient swords
International Nuclear Information System (INIS)
Santos, Hellen C.; Added, Nemitala; Silva, Tiago F.; Rodrigues, C.L.
2015-01-01
Elemental composition of the steel of two ancient swords (Japanese and Damascus from a private collection) was characterized using in air IBA techniques. Our results contribute for the understanding the processes of manufacturing (hammering and quenching) and surface treatments applied in these swords. The Particle Induced X-ray Emission (PIXE) measurements along the Damascus blade allowed to identify and to trace a superficial concentration profile for the elements such Cr, Mn, Fe, Ni, Cu, Zn and As, while results for the Japanese blade showed only the presence of iron. The carbon content on the surface was also investigated using a resonant region in the Elastic Backscattering Spectrometry (EBS) measurements and the results have shown a slightly difference between the surfaces under investigation. In order to investigate the nitrogen content on surface, that could explain the hardening process, we used Nuclear Reaction Analysis (NRA) and the results shown that nitrogen content was under our detection limit for the technique (0.3% in mass). The measurements of PIXE, NRA and EBS were taken using the external beam setup installed at Lamfi – São Paulo/Brazil, the latter being successfully implemented for the first time in this facility
Scania RBS brake system; Das Bremssystem EBS von Scania
Energy Technology Data Exchange (ETDEWEB)
Winterhagen, J.
1996-09-01
Scania claims to be the first producer of industrial vehicles to market an electronic braking system (EBS) combined with disc brakes for all axles. The new braking systems for long-distance trailers were presented for the first time at the IAA, Hanover, in September 1996. (orig.) [Deutsch] Scania ist nach eigenen Angaben der erste Lkw-Hersteller, der eine elektronisch geregelte Bremsanlage (EBS) in Kombination mit Scheibenbremsen an allen Achsen auf den Markt bringt. Der Oeffentlichkeit stellt Scania das neue Bremssystem fuer die Fernverkehrs-Zugmaschinen der Baureihe 4 zum ersten Mal auf der IAA in Hannover im September 1996 vor. (orig.)
Controle de plantas daninhas na cultura de soja resistente ao glyphosate
Directory of Open Access Journals (Sweden)
Núbia Maria Correia
2010-01-01
Full Text Available O objetivo da pesquisa foi avaliar o controle de plantas daninhas em área cultivada com soja resistente ao herbicida glyphosate, sem a utilização de práticas complementares de manejo de plantas daninhas. Foram desenvolvidos experimentos, em condições de campo, nos anos agrícolas 2005/2006 e 2006/2007 em Jaboticabal (SP. Foram avaliadas duas cultivares de soja resistentes ao glyphosate (CD 214 RR e M-SOY 8008 RR, oito tratamentos de herbicidas (glyphosate, em aplicação única, nas doses de 0,48; 0,72; 0,96 e 1,20 kg ha-1 de equivalente ácido, associadas ou não a aplicação sequencial na dose de 0,48 kg ha-1, além de duas testemunhas, uma capinada e outra mantida infestada. As cultivares de soja influenciaram na infestação das espécies de plantas daninhas na área. Sem a aplicação de glyphosate, houve o predomínio de X. strumarium na área, desfavorecendo a ocorrência de outras espécies. Quando utilizado glyphosate, independentemente da dose, a infestação contabilizada aos 35 e 40 dias após a primeira aplicação, no primeiro e segundo ano, respectivamente, foi baixa. O controle de plantas daninhas na cultura da soja transgênica é diretamente influenciado pela dose de glyphosate, havendo controle satisfatório com a aplicação única de 0,96 kg ha-1 ou a sequencial de 0,48 + 0,48 kg ha-1 de glyphosate. Em situação de menor infestação (2006/2007, a aplicação única de 0,48 kg ha-1 de glyphosate é suficiente para o controle das plantas daninhas. As cultivares de soja transgênica CD 214 RR e M-SOY 8008 RR influenciam diferencialmente a dinâmica das espécies de plantas daninhas, sendo o controle químico mais efetivo na situação de cultivo de M-SOY 8008 RR, em que houve menor diversidade e desenvolvimento das plantas daninhas.
Directory of Open Access Journals (Sweden)
Oscar S. Silva Filho
2010-04-01
Full Text Available Neste artigo um problema sequencial de planejamento agregado da produção é formulado como um modelo de otimização sequencial do tipo Linear-Quadrático Gaussiano (LQG com restrições probabilísticas nas variáveis de estado e controle. Este problema está baseado em um modelo clássico desenvolvido por Holt, Modigliani, Muth e Simon, e conhecido na literatura como modelo HMMS. Como ideia central do trabalho busca-se estender o modelo original HMMS de modo que ele possa levar em conta restrições de chance nas variáveis de decisão e também uma representação do tipo ARMA como modelo de flutuação de demanda. Essencialmente, o artigo examina as principais características que permitem transformar o modelo HMMS para um padrão LQG com restrições de chances. Além disso, duas heurísticas subótimas muito simples são apresentadas como estratégias de resolução para este tipo de problema. Por fim, um exemplo ilustrativo de como gerar planos de produção agregados via o modelo proposto, é apresentado.A single product, multi-period, aggregate production planning problem is formulated as a Linear-Quadratic Gaussian (LQG optimal control problem with probabilistic constraints on state and control variables. This stochastic problem is based on a classical model developed by Holt, Modigliani, Muth and Simon, and known in the literature as HMMS model. The central idea is to extend the original HMMS model in order to take into account both chance-constraints on the decision variables and an ARMA forecasting model to represent the fluctuation of demand. Essentially, the paper discusses the main features that allow transforming the problem into a chance constrained LQG pattern. In addition, two sub-optimal techniques for solving this kind of problem are briefly described. At last, an illustrative example of how to provide aggregate production plans from the proposed problem is presented.
5373 Volume 11 No. 6 October 2011 TRUST, CELL PHONES ...
African Journals Online (AJOL)
Khanjan Mehta
2011-10-06
Oct 6, 2011 ... entrepreneurship, social networks and cell phones that is crucial for the establishment ... relationships to each other and to individuals and organizations related to their area of ..... www.rurdev.usda.gov/RBS/pub/cir1sec3.pdf.
Study of Ag and PE interface after plasma treatment
Czech Academy of Sciences Publication Activity Database
Macková, Anna; Malinský, Petr; Bočan, Jiří; Švorčík, V.; Pavlík, J.; Strýhal, Z.; Sajdl, P.
2008-01-01
Roč. 5, č. 4 (2008), s. 964-967 ISSN 1610-1634 R&D Projects: GA MŠk(CZ) LC06041 Institutional research plan: CEZ:AV0Z10480505 Keywords : metal/polymer interfacerface * metallized polymers * RBS Subject RIV: JJ - Other Materials
75 FR 63846 - Meeting of the Task Force on Community Preventive Services
2010-10-18
... Product Distribution to Improve Health Behaviors; Responsible Beverage Service (RBS) Training to Decrease..., environmental, population, and healthcare system interventions in public health and health promotion. During... Prevention. Agenda items are subject to change as priorities dictate. Meeting Accessibility: This meeting is...
2010-01-20
... DEPARTMENT OF AGRICULTURE Rural Business-Cooperative Service Notice of a Public Meeting on Administration of the Business and Industry Guaranteed Loan Program AGENCY: Rural Business-Cooperative Service, USDA. ACTION: Notice of public meeting. SUMMARY: The Rural Business-Cooperative Service (RBS), an...
Field experiments were conducted to evaluate the effects of soil solarization or cover cropping on bell pepper (Capsicum annuum) and lima bean (Phaseolus lunatus, L.) rhizosphere microorganisms. In Experiment I, flat surface solarization (FSS), raised bed solarization (RBS), cowpea (Vigna unguiculat...
Ku, Hye-Jin; Park, Myeong Soo; Lee, Ju-Hoon
2015-01-01
A 2.1-kb plasmid was previously isolated from Weissella cibaria KLC140 in kimchi and cloned into pUC19 along with the slpA and gfp genes, resulting in an 8.6-kb pKWCSLGFP construct for use as a novel surface display vector. To reduce the size of the vector, the minimal replicon of pKW2124 was determined. The pKW2124 plasmid contains a putative origin of replication (ori), a potential ribosomal binding site (RBS), and the repA gene encoding a plasmid replication protein. To conduct the minimal replicon experiment, four different PCR products (MR1, ori+RBS+repA; MR2, RBS+repA; MR2’, repA; MR3, fragment of repA) were obtained and cloned into pUC19 (pKUCm1, pKUCm2, pKUCm2’, and pKUCm3, respectively) containing the chloramphenicol acetyltransferase (CAT) gene. These constructed vectors were electroporated into W. confusa ATCC 10881 with different transformation efficiencies of 1.5 × 105 CFU/μg, 1.3 × 101 CFU/μg, and no transformation, respectively, suggesting that the putative ori, RBS, and repA gene are essential for optimum plasmid replication. Subsequent segregational plasmid stability testing of pKUCm1 and pKUCm2 showed that the vector pKUCm1 is highly stable up to 100 generations but pKUCm2 was completely lost after 60 generations, suggesting that the putative ori may be important for plasmid stability in the host strain. In addition, a host range test of pKUCm1 revealed that it has a broad host range spectrum including Weissella, Lactococcus, Leuconostoc, and even Lactobacillus. To verify the application of pKUCm1, the β-galactosidase gene and its promoter region from W. cibaria KSD1 were cloned in the vector, resulting in pKUGal. Expression of the β-galactosidase gene was confirmed using blue-white screening after IPTG induction. The small and stable pKUGal vector will be useful for gene transfer, expression, and manipulation in the Weissella genome and in other lactic acid bacteria. PMID:25691882
Thin Film Materials and Devices for Resistive Temperature Sensing Applications
2015-05-21
Rutherford backscattering spectroscopy (RBS), Raman spectroscopy, scanning electron microscopy (SEM), TEM, and atomic force microscopy (AFM) did...composition and structure by real time spectroscopic ellipsometry," Physica Status Solidi A, vol. 205, pp. 892-895, 2008. [92] H. Fujiwara, J. Koh , P. I
Optical, electrical and thermoelectric power studies of Al–Sb thin film ...
Indian Academy of Sciences (India)
Unknown
(Al–Sb), with a energy gap of 1⋅62 eV, is potentially a high efficiency solar material ... The RBS analysis was carried out at the Institute of. Physics, Bhubaneswar, to .... under a minor research project grant of UGC. References. Agrawal A ...
Ecological correlates of relative brain size in some South African ...
African Journals Online (AJOL)
1992-07-02
Jul 2, 1992 ... species of rodent from South Africa and is shown to vary with six species having a positive RBS (that is a ... Arboreal species such as Paraxerus cepapi and ... large brains can be linked to the complex behavioural patterns ...
Directory of Open Access Journals (Sweden)
Orlando J. Cicilioni, Jr, MD, FACS
2013-10-01
Conclusions: When presented with possible RBS, surgeons must rule out cellulitis, culture for acid-fast bacilli such as mycobacterium species, and then determine the best course of treatment. Patient counseling regarding potential household sources of infection is warranted to minimize postoperative infection risk.
Degradation effects ad Si-depth profiling in photoresists using ion beam analysis
International Nuclear Information System (INIS)
Ijzendoorn, L.J. van; Schellekens, J.P.W.
1989-01-01
The reaction of silicon-containing vapour with a photoresist layer, as used in dry developable lithographic processes, was studied with Rutherford backscattering spectrometry (RBS). Degradation of the polymer layer was observed, but the total amount of incorporated Si was found to be constant during the measurement. Si-depth profiles were found to be independent of dose and in agreement with profiles obtained with secondary ion mass spectrometry (SIMS). The detection of hydrogen by elastic recoil detection (ERD) was used to study the degradation in detail. The decrease in hydrogen countrate from a layer of polystyrene on Si in combination with the shift of the Si-substrate edge in the corresponding RBS spectra was used for a model description. Only one degradation cross-section for hydrogen and one for carbon, both independent of beam current and dose, were required for a successful fit of the experimental data. (orig.)
Structural disorder in sapphire induced by 90.3 MeV xenon ions
International Nuclear Information System (INIS)
Kabir, A.; Meftah, A.; Stoquert, J.P.; Toulemonde, M.; Monnet, I.; Izerrouken, M.
2010-01-01
In our previous work , we have evidenced, using RBS-C, two effects in the aluminium sublattice of sapphire irradiated with 90.3 MeV xenon ions: a partial disorder creation that saturates at ∼40% followed above a threshold fluence by a highly disordered layer appearing behind the surface. In this work, by RBS-C analysis of the oxygen sublattice, we have observed only one regime of partial disorder creation that saturates at ∼60% in tracks of cross-section double of that found for the aluminium sublattice. Complementary analysis by X-ray diffraction shows that the lattice strain increases with the fluence until a maximum is reached about 7.5 x 10 12 ions/cm 2 . For higher fluences, strain decreases first indicating a little stress relaxation in the material and tends afterwards, to remain constant. This stress relaxation is found to be related to the aluminium sublattice high disorder.
Chemical bath deposition of indium sulphide thin films: preparation and characterization
Energy Technology Data Exchange (ETDEWEB)
Lokhande, C.D.; Ennaoui, A.; Patil, P.S.; Giersig, M.; Diesner, K.; Muller, M.; Tributsch, H. [Hahn-Meitner-Institut Berlin GmbH (Germany). Bereich Physikalische Chemie
1999-02-26
Indium sulphide (In{sub 2}S{sub 3}) thin films have been successfully deposited on different substrates under varying deposition conditions using chemical bath deposition technique. The deposition mechanism of In{sub 2}S{sub 3} thin films from thioacetamide deposition bath has been proposed. Films have been characterized with respect to their crystalline structure, composition, optical and electrical properties by means of X-ray diffraction, TEM, EDAX, optical absorption, TRMC (time resolved microwave conductivity) and RBS. Films on glass substrates were amorphous and on FTO (flourine doped tin oxide coated) glass substrates were polycrystalline (element of phase). The optical band gap of In{sub 2}S{sub 3} thin film was estimated to be 2.75 eV. The as-deposited films were photoactive as evidenced by TRMC studies. The presence of oxygen in the film was detected by RBS analysis. (orig.) 27 refs.
International Nuclear Information System (INIS)
Romero-Davila, E.; Miranda, J.
2004-01-01
Particle induced X-ray emission (PIXE) and Rutherford backscattering spectrometry (RBS) were used to determine the concentrations of trace elements in samples of 12 tomato puree brands sold in the Mexican market. While RBS offered information about the main elements present in the matrix, PIXE gave results on trace elements. As a whole, data for 17 elements (C, N, O, Na, Mg, S, Cl, K, Ca, Ti, V, Cr, Mn, Fe, Ni, Cu, and Zn) were obtained. To evaluate the results, a comparison with brands from USA, Japan, Colombia, and Chile was carried out, using tomato purees produced following the domestic technology recipe. Additionally, the results were considered in the light of the Codex Alimentarius and the Mexican standard. It was found that all of the brands fall within the limits established by these standards, being of the same order of magnitude as the foreign brands. (author)
Sensory characteristics and consumer liking of sausages with 10% fat and added rye or wheat bran
DEFF Research Database (Denmark)
Jakobsen, Louise Margrethe Arildsen; Vuholm, Stine; Aaslyng, Margit Dall
2014-01-01
and added rye or wheat bran. Sensory descriptive attributes (odor, appearance, texture, and flavor) of rye bran sausage (RBS) and wheat bran sausage (WBS) were evaluated by a trained sensory panel (n = 9). A sausage with wheat flour (WFS) and two commercial 20% (20%S) and 10% (10%S) (w/w) fat sausages were......Improving the nutritional profile of sausages through the addition of dietary fiber might affect appetite, sensory characteristics, and liking differently depending on the fiber source. This study investigates the sensory characteristics and consumer acceptance of sausages with 10% (w/w) fat...... also included. Liking was investigated in consumer tests with two Danish target groups (49 children aged between six and nine and 24 parents). RBS and WBS were similar with regard to their sensory descriptive attributes, but the structure of these sausages was coarser and the color was more brown than...
Au-nanoparticles grafted on plasma treated PE
International Nuclear Information System (INIS)
Svorcik, V.; Chaloupka, A.; Rezanka, P.; Slepicka, P.; Kolska, Z.; Kasalkova, N.; Hubacek, T.; Siegel, J.
2010-01-01
Polyethylene (PE) surface was treated with Ar plasma. Activated surface was grafted from methanol solution of 1,2-ethanedithiol. Then the sample was immersed into freshly prepared colloid solution of Au-nanoparticles. Finally Au layer was sputtered on the samples. Properties of the modified PE were studied using various methods: AFM, EPR, RBS and nanoindentation. It was shown that the plasma treatment results in degradation of polymer chain (AFM) and creation of free radicals by EPR. After grafting with dithiol, the concentration of free radicals declines. The presence of Au and S in the surface layer after the coating with Au-nanoparticles was proved by RBS. Plasma treatment changes PE surface morphology and increases surface roughness, too. Another significant change in surface morphology and roughness was observed after deposition of Au-nanoparticles. Nanoindentation measurements show that the grafting with Au-nanoparticles increases adhesion of subsequently sputtered Au layer.
Directory of Open Access Journals (Sweden)
Valderi Duarte Leite
1999-08-01
Full Text Available RESUMO O processo de digestão anaeróbia pode ser aplicado para bioestabilizar uma grande variedade de substratos. Neste trabalho, empregou-se o processo de digestão anaeróbia à fração orgânica putrescível dos resíduos sólidos urbanos, tomando-se como parâmetros avaliativos os sólidos totais e os sólidos totais voláteis. O trabalho foi realizado em quatro reatores anaeróbios de batelada, com capacidade unitária de 50 L e a análise dos seus dados mostra que é possível se empregar o processo de digestão anaeróbia a esse tipo de substrato que, além de bioestabilizar a matéria orgânica putrescível, produz gás metano, que pode ser utilizado como fonte alternativa de energia para fins domésticos e industriais.
Schüle, Birgitt; Oviedo, Angelica; Johnston, Kathreen; Pai, Shashidhar; Francke, Uta
2005-12-01
The rare, autosomal recessive Roberts syndrome (RBS) is characterized by tetraphocomelia, profound growth deficiency of prenatal onset, craniofacial anomalies, microcephaly, and mental deficiency. SC phocomelia (SC) has a milder phenotype, with a lesser degree of limb reduction and with survival to adulthood. Since heterochromatin repulsion (HR) is characteristic for both disorders and is not complemented in somatic-cell hybrids, it has been hypothesized that the disorders are allelic. Recently, mutations in ESCO2 (establishment of cohesion 1 homolog 2) on 8p21.1 have been reported in RBS. To determine whether ESCO2 mutations are also responsible for SC, we studied three families with SC and two families in which variable degrees of limb and craniofacial abnormalities, detected by fetal ultrasound, led to pregnancy terminations. All cases were positive for HR. We identified seven novel mutations in exons 3-8 of ESCO2. In two families, affected individuals were homozygous--for a 5-nucleotide deletion in one family and a splice-site mutation in the other. In three nonconsanguineous families, probands were compound heterozygous for a single-nucleotide insertion or deletion, a nonsense mutation, or a splice-site mutation. Abnormal splice products were characterized at the RNA level. Since only protein-truncating mutations were identified, regardless of clinical severity, we conclude that genotype does not predict phenotype. Having established that RBS and SC are caused by mutations in the same gene, we delineated the clinical phenotype of the tetraphocomelia spectrum that is associated with HR and ESCO2 mutations and differentiated it from other types of phocomelia that are negative for HR.
Wilkat, M; Herdoiza, E; Forsbach-Birk, V; Walther, P; Essig, A
2014-08-01
Chlamydia (C.) abortus is a widely spread pathogen among ruminants that can be transmitted to women during pregnancy leading to severe systemic infection with consecutive abortion. As a member of the Chlamydiaceae, C. abortus shares the characteristic feature of an obligate intracellular biphasic developmental cycle with two morphological forms including elementary bodies (EBs) and reticulate bodies (RBs). In contrast to other chlamydial species, C. abortus ultrastructure has not been investigated yet. To do so, samples were fixed by high-pressure freezing and processed by different electron microscopic methods. Freeze-substituted samples were analysed by transmission electron microscopy, scanning transmission electron microscopical tomography and immuno-electron microscopy, and freeze-fractured samples were analysed by cryo-scanning electron microscopy. Here, we present three ultrastructural features of C. abortus that have not been reported up to now. Firstly, the morphological evidence that C. abortus is equipped with the type three secretion system. Secondly, the accumulation and even coating of whole inclusion bodies by membrane complexes consisting of multiple closely adjacent membranes which seems to be a C. abortus specific feature. Thirdly, the formation of small vesicles in the periplasmic space of RBs in the second half of the developmental cycle. Concerning the time point of their formation and the fact that they harbour chlamydial components, these vesicles might be morphological correlates of an intermediate step during the process of redifferentiation of RBs into EBs. As this feature has also been shown for C. trachomatis and C. pneumoniae, it might be a common characteristic of the family of Chlamydiaceae.
75 FR 11836 - Bioenergy Program for Advanced Biofuels
2010-03-12
... Biofuels AGENCY: Rural Business-Cooperative Service (RBS), USDA. ACTION: Notice of Contract for Proposal... Year 2009 for the Bioenergy Program for Advanced Biofuels under criteria established in the prior NOCP... Bioenergy Program for Advanced Biofuels. In response to the previously published NOCP, approximately $14.5...
Degradation effects and Si-depth profiling in photoresists using ion beam analysis
IJzendoorn, van L.J.; Schellekens, J.P.W.
1989-01-01
The reaction of silicon-containing vapour with a photoresist layer, as used in dry developable lithographic processes, was studied with Rutherford backscattering spectrometry (RBS). Degradation of the polymer layer was observed, but the total amount of incorporated Si was found to be constant during
75 FR 50983 - Submission for OMB Review; Comment Request
2010-08-18
... creation projects such as business start- up costs, business expansion, community development, and business... number. Rural Business-Cooperative Service Title: Rural Economic Development Loan and Grant Program. OMB... program. Rural Business Service (RBS) mission is to improve the quality of life in rural America by...
78 FR 67099 - Submission for OMB Review; Comment Request
2013-11-08
..., business expansion, community development, and business incubator projects. Need and Use of the Information... it displays a currently valid OMB control number. Rural Business--Cooperative Service Title: Rural.... 940(c)) that established a loan and grant program. Rural Business Service (RBS) mission is to improve...
Ultrafast Approximation for Phylogenetic Bootstrap
Bui Quang Minh, [No Value; Nguyen, Thi; von Haeseler, Arndt
Nonparametric bootstrap has been a widely used tool in phylogenetic analysis to assess the clade support of phylogenetic trees. However, with the rapidly growing amount of data, this task remains a computational bottleneck. Recently, approximation methods such as the RAxML rapid bootstrap (RBS) and
Rakhmatov, Eradzh
2017-01-01
This report gives a short description of the projects I have been involved in during my stay as a Non Member State Summer Student at the European Organization for Nuclear Research (CERN). All my work took place within ISOLDE collaboration, in the EN-STI-RBS section.
DEFF Research Database (Denmark)
Vega, H; Trainer, A H; Gordillo, M
2010-01-01
Roberts syndrome (RBS) and SC phocomelia are caused by mutations in ESCO2, which codes for an acetyltransferase involved in the regulation of sister chromatid cohesion. Of 26 mutations described to date, only one missense mutation has been reported and all others are predicted to be truncating...
Vega, H.; Trainer, A.H.; Gordillo, M.; Crosier, M.; Kayserili, H.; Skovby, F.; Uzielli, M.L.G.; Schnur, R.E.; Manouvrier, S.; Blair, E.; Hurst, J.A.; Forzano, F.; Meins, M.; Simola, K.O.J.; Raas-Rothschild, A; Hennekam, R.C.M.; Jabs, E.W.
2010-01-01
Background Roberts syndrome (RBS) and SC phocomelia are caused by mutations in ESCO2, which codes for an acetyltransferase involved in the regulation of sister chromatid cohesion. Of 26 mutations described to date, only one missense mutation has been reported and all others are predicted to be
Directory of Open Access Journals (Sweden)
Rubneide Barreto Silva Gallo
2018-01-01
Trial registration: NCT01389128. [Gallo RBS, Santana LS, Marcolin AC, Duarte G, Quintana SM (2018 Sequential application of non-pharmacological interventions reduces the severity of labour pain, delays use of pharmacological analgesia, and improves some obstetric outcomes: a randomised trial. Journal of Physiotherapy 64: 33–40
77 FR 75969 - Submission for OMB Review; Comment Request
2012-12-26
... Development Act, as amended. The purpose of the program is to improve, develop, or finance businesses..., electronic, mechanical, or other technological collection techniques or other forms of information technology... it displays a currently valid OMB control number. Rural Business Service (RBS) Title: 7 CFR 4279-A...
Some peculiarity of element analysis using charged particle beams
International Nuclear Information System (INIS)
Kobzev, A.P.; Abu-Alazm, S.M.; Helal, A.I.; Zahran, N.F.
2002-01-01
Multilayer structures, SiC -layers at Si substrate, have been analyzed by RBS, NR, ERD and PIXE methods using the charged particle beams from EG-5 Van de Graaff accelerator of JINR. The depth profiles of the based deposited layers were obtained for the multilayer structures
Randomized branch sampling to estimatefruit production in Pecan trees cv. ‘Barton’
Directory of Open Access Journals (Sweden)
Filemom Manoel Mokochinski
Full Text Available ABSTRACT: Sampling techniques to quantify the production of fruits are still very scarce and create a gap in crop development research. This study was conducted in a rural property in the county of Cachoeira do Sul - RS to estimate the efficiency of randomized branch sampling (RBS in quantifying the production of pecan fruit at three different ages (5,7 and 10 years. Two selection techniques were tested: the probability proportional to the diameter (PPD and the uniform probability (UP techniques, which were performed on nine trees, three from each age and randomly chosen. The RBS underestimated fruit production for all ages, and its main drawback was the high sampling error (125.17% - PPD and 111.04% - UP. The UP was regarded as more efficient than the PPD, though both techniques estimated similar production and similar experimental errors. In conclusion, we reported that branch sampling was inaccurate for this case study, requiring new studies to produce estimates with smaller sampling error.
Diffusion and aggregation of implanted Ag and Au in a lithia--alumina--silica glass
International Nuclear Information System (INIS)
Arnold, G.W.; Borders, J.A.
1975-01-01
Optical extinction and Rutherford backscattering (RBS) techniques were employed to obtain information on the size and spatial distribution of Au- and Ag-colloids in implanted (Au + , Ag + ) lithia-alumina-silica glass. The formation of metallic aggregates (colloids), necessary for preparation of a glass-ceramic surface layer, proceeds readily with annealing temperature for Au-implanted samples but not for Ag-implanted material. The optical and RBS spectra show that the particle size and spatial distribution in as-implanted samples are sensitive to sample temperature and ion-beam heating effects, while these parameters for Au-implanted samples are relatively insensitive to temperature and beam current. It is suggested that this behavior is related to differences in the dissolution energies of Ag and Au aggregates. A two-peaked spatial distribution for Ag implanted at room temperature at a dose rate of approximately 1 μA/cm 2 is observed which may result from the trapping of Ag in the compacted damage region of the glass during implantation. (auth)
Silicide formation by Ar/sup +/ ion bombardment of Pd/Si
Energy Technology Data Exchange (ETDEWEB)
Lee, R Y; Whang, C N; Kim, H K; Smith, R J
1988-08-01
Palladium films, 45 nm thick, evaporated on to Si(111) were irradiated to various doses with 78 keV Ar/sup +/ ions to promote silicide formation. Rutherford backscattering spectroscopy (RBS) shows that intermixing has occurred across the Pd/Si interface at room temperature. The mixing behaviour is increased with dose which coincides well with the theoretical model of cascade mixing. The absence of deep RBS tails for palladium and the small area of this for silicon spectra indicate that short-range mixing occurs. From the calculated damage profiles computed with TRIM code, the dominant diffusion species is found to be silicon atoms in the Pd/Si system. It is also found that the initial compound formed by Ar/sup +/ irradiation is Pd/sub 2/Si which increases with dose. At a dose of 1 x 10/sup 16/ Ar/sup +/ cm/sup -2/, a 48 nm thickness of Pd/sub 2/Si was formed by ion-beam mixing at room temperature.
Diffusion and aggrigation of implanted Ag and Au in a lithia-alumina-silica glass
International Nuclear Information System (INIS)
Arnold, G.W.; Borders, J.A.
1976-01-01
Optical extinction and Rutherford backscattering (RBS) techniques have been employed to obtain information on the size and spatial distribution of Au and Ag colloids in implanted (Au + ,Ag + )lithia-alumina-silica glass. The formation of metallic aggregates (colloids), necessary for preparation of a glass-ceramic surface layer, proceeds readily with annealing temperature for Au-implanted samples but not for Ag-implanted material. The optical and RBS spectra show that the particle size and spatial distribution in Ag-implanted samples are sensitive to sample temperature and ion-beam heating effects, while these parameters for Au-implanted samples are relatively insensitive to temperature and beam current. It is suggested that this behaviour is related to differences in the dissolution energies of Ag and Au aggregates. A two-peaked spatial distribution for Ag implanted at room temperature at a dose rate of approximately 1 μA cm -2 is observed which may result from the trappings of Ag in the ion displacement damage region of the glass during implantation. (author)
Round robin analyses of hydrogen isotope thin films standards
Energy Technology Data Exchange (ETDEWEB)
Banks, J.C. E-mail: jcbanks@sandia.gov; Browning, J.F.; Wampler, W.R.; Doyle, B.L.; LaDuca, C.A.; Tesmer, J.R.; Wetteland, C.J.; Wang, Y.Q
2004-06-01
Hydrogen isotope thin film standards have been manufactured at Sandia National Laboratories for use by the materials characterization community. Several considerations were taken into account during the manufacture of the ErHD standards, with accuracy and stability being the most important. The standards were fabricated by e-beam deposition of Er onto a Mo substrate and the film stoichiometrically loaded with hydrogen and deuterium. To determine the loading accuracy of the standards two random samples were measured by thermal desorption mass spectrometry and atomic absorption spectrometry techniques with a stated combined accuracy of {approx}1.6% (1{sigma}). All the standards were then measured by high energy RBS/ERD and RBS/NRA with the accuracy of the techniques {approx}5% (1{sigma}). The standards were then distributed to the IBA materials characterization community for analysis. This paper will discuss the suitability of the standards for use by the IBA community and compare measurement results to highlight the accuracy of the techniques used.
The effects of automated scatter feeders on captive grizzly bear activity budgets.
Andrews, Nathan L P; Ha, James C
2014-01-01
Although captive bears are popular zoo attractions, they are known to exhibit high levels of repetitive behaviors (RBs). These behaviors have also made them particularly popular subjects for welfare research. To date, most research on ursid welfare has focused on various feeding methods that seek to increase time spent searching for, extracting, or consuming food. Prior research indicates an average of a 50% reduction in RBs when attempts are successful and, roughly, a 50% success rate across studies. This research focused on decreasing time spent in an RB while increasing the time spent active by increasing time spent searching for, extracting, and consuming food. The utility of timed, automated scatter feeders was examined for use with captive grizzly bears (Ursis arctos horribilis). Findings include a significant decrease in time spent in RB and a significant increase in time spent active while the feeders were in use. Further, the bears exhibited a wider range of behaviors and a greater use of their enclosure.
Implementation of ionoluminescence in the AGLAE scanning external microprobe
International Nuclear Information System (INIS)
Pichon, L.; Calligaro, T.; Gonzalez, V.; Lemasson, Q.; Moignard, B.; Pacheco, C.
2015-01-01
The scope of this work is to present the implementation of an IBIL imaging system in the scanning external microprobe of the AGLAE facility so as to correlate luminescence and composition maps provided by PIXE, RBS and PIGE. The challenging integration of the optical spectrometer, due to incompatibility of acquisition timings and data formats with the other IBA channels has motivated the development of a specific acquisition system. This article details the IBIL setup and explains the technical solutions retained for the coupling of IBIL with IBA techniques in order to produce fast and large IBIL-IBA maps. The IBIL maps stored in the same format as the PIXE, RBS and PIGE ones can be visualised and compared using the dedicated AGLAEmap program or the PyMCA processing package. An example of such a coupled mapping on Mesoamerican jade is presented to emphasise the interest of performing simultaneously IBA and IBIL large mappings
Effect of Ion Irradiation in Cadmium Niobate Pyrochlores
International Nuclear Information System (INIS)
Jiang, Weilin; Weber, William J.; Thevuthasan, Suntharampillai; Boatner, Lynn A.
2003-01-01
Irradiation experiments have been performed for cadmium niobate pyrochlore (CdNb2O) single crystals at both 150 and 300 K using 1.0 MeV Au ions over fluences ranging from 0.01 to 0.10 ions/nm. In-situ 3.0 MeV He Rutherford backscattering spectrometry along the -axial channeling direction (RBS/C) has been applied to study the damage states ranging from small defect concentrations to a fully amorphous state. Results show that the crystal can be readily amorphized under the irradiation conditions. Room-temperature recovery of the defects produced at 150 K has been observed, while the defects produced at 300 K are thermally stable at room temperature. Results also indicate that the RBS/C analysis used in this study induced negligible damage in the near-surface regime. In addition, irradiation at and below room temperature using He and C3 ions leads to surface exfoliation at the corresponding damage peaks
Oxide growth on aluminium alloys in the presence of ammonium fluoborate
International Nuclear Information System (INIS)
Oliver, J.; Paterson, P.; Flavell, T.; Biddle, G.
1996-01-01
The aim of this study as to determine the mechanisms involved in using ammonium fluoborate as a reducing atmosphere when preheating a high magnesium content aluminium alloy. Rutherford Backscattering (RBS) has been the major technique used in the analysis of samples, it revealed significant reduction in both the diffusion of magnesium to the surface and the calculated oxide thickness in the presence of NH 4 BF 4 . At temperatures above 500 deg C in air, SEM images revealed depressions and voids due to incipient melting at various stages, around the grain boundaries. Grain boundaries effectively acted as pipes aiding the diffusion of magnesium to the surface. These results have been verified through compositional analysis with both RBS and auger electron spectroscopy (AES). Results from NH 4 BF 4 atmosphere preheat conditions showed significant improvements. It was verified experimentally that above 500 deg C , AA5182 alloys undergo incipient melting at the grain boundaries with magnesium diffusing through to the surface. 5 refs., 1 fig
Ion beam induced luminescence from diamond using an MeV ion microprobe
Energy Technology Data Exchange (ETDEWEB)
Bettiol, A.A.; Jamieson, D. N.; Prawer, S.; Allen, M.G. [Melbourne Univ., Parkville, VIC (Australia). School of Physics
1993-12-31
Analysis of the luminescence induced by a MeV ion beam offers the potential to provide useful information about the chemical properties of atoms in crystals to complement the information provided by more traditional Ion Beam Analysis (IBA) such as Rutherford Backscattering Spectrometry (RBS), ion channeling and Particle Induced X-ray Emission (PIXE). Furthermore, the large penetration depth of the MeV ion beam offers several advantages over the relatively shallow penetration of keV electrons typically employed in cathodoluminescence. An Ion Beam Induced Luminescence (IBIL) detection system was developed for the Melbourne microprobe that allows the spatial mapping of the luminescence signal along with the signals from RBS and PIXE. Homoepitaxial diamond growth has been studied and remarkable shifts in the characteristic blue luminescence of diamond towards the green were observed in the overgrowth. This has been tentatively identified as being due to transition metal inclusions in the epitaxial layers. 8 refs., 2 refs.
Elevated transition temperature in Ge doped VO2 thin films
Krammer, Anna; Magrez, Arnaud; Vitale, Wolfgang A.; Mocny, Piotr; Jeanneret, Patrick; Guibert, Edouard; Whitlow, Harry J.; Ionescu, Adrian M.; Schüler, Andreas
2017-07-01
Thermochromic GexV1-xO2+y thin films have been deposited on Si (100) substrates by means of reactive magnetron sputtering. The films were then characterized by Rutherford backscattering spectrometry (RBS), four-point probe electrical resistivity measurements, X-ray diffraction, and atomic force microscopy. From the temperature dependent resistivity measurements, the effect of Ge doping on the semiconductor-to-metal phase transition in vanadium oxide thin films was investigated. The transition temperature was shown to increase significantly upon Ge doping (˜95 °C), while the hysteresis width and resistivity contrast gradually decreased. The precise Ge concentration and the film thickness have been determined by RBS. The crystallinity of phase-pure VO2 monoclinic films was confirmed by XRD. These findings make the use of vanadium dioxide thin films in solar and electronic device applications—where higher critical temperatures than 68 °C of pristine VO2 are needed—a viable and promising solution.
Ion beam induced luminescence from diamond using an MeV ion microprobe
Energy Technology Data Exchange (ETDEWEB)
Bettiol, A A; Jamieson, D N; Prawer, S; Allen, M G [Melbourne Univ., Parkville, VIC (Australia). School of Physics
1994-12-31
Analysis of the luminescence induced by a MeV ion beam offers the potential to provide useful information about the chemical properties of atoms in crystals to complement the information provided by more traditional Ion Beam Analysis (IBA) such as Rutherford Backscattering Spectrometry (RBS), ion channeling and Particle Induced X-ray Emission (PIXE). Furthermore, the large penetration depth of the MeV ion beam offers several advantages over the relatively shallow penetration of keV electrons typically employed in cathodoluminescence. An Ion Beam Induced Luminescence (IBIL) detection system was developed for the Melbourne microprobe that allows the spatial mapping of the luminescence signal along with the signals from RBS and PIXE. Homoepitaxial diamond growth has been studied and remarkable shifts in the characteristic blue luminescence of diamond towards the green were observed in the overgrowth. This has been tentatively identified as being due to transition metal inclusions in the epitaxial layers. 8 refs., 2 refs.
Characterisation of magnetron sputtered SmCo5 thin films
International Nuclear Information System (INIS)
Wang, Y.; Sood, D.K.; Kothari
1999-01-01
SmCo 5 thin films were deposited using DC magnetron sputtering on single crystal silicon substrate with chromium and SiO 2 top layers. Deposition was carried out at three different substrate temperatures: room temperature, 400 deg C and 600 deg C. Films were characterised by using Rutherford Backscattering Spectroscopy (RBS), X-ray Diffraction (XRD), Secondary Ion Mass Spectrometry (SIMS) and SQUID magnetometer. RBS analysis indicated that the films have excellent stoichiometry with the Sm to Co ratio of 1:5. This analysis also showed that the films deposited or annealed at high temperatures (≥600 deg C) indicated significant inter-diffusion at the interface between the barrier layer and the film. Oxygen was found to be the major impurity in the films. XRD data indicated that the films formed 1:5 and 2:17 phases under different deposition conditions. The preliminary studies of these films using magnetic force microscopy revealed the presence of magnetic domains
International Nuclear Information System (INIS)
Zhou, S.J.; Orlic, I.; Sanchez, J.L.; Watt, F.
1999-01-01
The software package VIBA-lab1, which incorporates PIXE and RBS energy spectra simulation has now been extended to include the simulation of elemental maps from 3D structures. VIBA-lab1 allows the user to define a wide variety of experimental parameters, e.g. energy and species of incident ions, excitation and detection geometry, etc. When the relevant experimental parameters as well as target composition are defined, the program can then simulate the corresponding PIXE and RBS spectra. VIBA-LAB2 has been written with applications in nuclear microscopy in mind. A set of drag-and-drop tools has been incorporated to allow the user to define a three-dimensional sample object of mixed elemental composition. PIXE energy spectra simulations are then carried out on pixel-by-pixel basis and the corresponding intensity distributions or elemental maps can be computed. Several simulated intensity distributions for some 3D objects are demonstrated, and simulations obtained from a simple IC are compared with experimental results
Direct synthesis of ultrathin SOI structure by extremely low-energy oxygen implantation
Energy Technology Data Exchange (ETDEWEB)
Hoshino, Yasushi, E-mail: yhoshino@kanagawa-u.ac.jp; Yachida, Gosuke; Inoue, Kodai; Toyohara, Taiga; Nakata, Jyoji [Department of mathematics and physics, Kanagawa University, 2946, Tsuchiya, Hiratsuka, Kanagawa 259-1293 (Japan)
2016-06-15
We performed extremely low-energy {sup 16}O{sup +} implantation at 10 keV (R{sub p} ∼ 25 nm) followed by annealing aiming at directly synthesizing an ultrathin Si layer separated by a buried SiO{sub 2} layer in Si(001) substrates, and then investigated feasible condition of recrystallization and stabilization of the superficial Si and the buried oxide layer by significantly low temperature annealing. The elemental compositions were analyzed by Rutherford backscattering (RBS) and secondary ion mass spectroscopy (SIMS). The crystallinity of the superficial Si layer was quantitatively confirmed by ananlyzing RBS-channeling spectra. Cross-sectional morphologies and atomic configurations were observed by transmission electron microscope (TEM). As a result, we succeeded in directly synthesizing an ultrathin single-crystalline silicon layer with ≤20 nm thick separated by a thin buried stoichiometric SiO{sub 2} layer with ≤20 nm thick formed by extremely low-energy {sup 16}O{sup +} implantation followed by surprisingly low temperature annealing at 1050{sup ∘} C.
Epitaxial integration of CoFe2O4 thin films on Si (001) surfaces using TiN buffer layers
Prieto, Pilar; Marco, José F.; Prieto, José E.; Ruiz-Gomez, Sandra; Perez, Lucas; del Real, Rafael P.; Vázquez, Manuel; de la Figuera, Juan
2018-04-01
Epitaxial cobalt ferrite thin films with strong in-plane magnetic anisotropy have been grown on Si (001) substrates using a TiN buffer layer. The epitaxial films have been grown by ion beam sputtering using either metallic, CoFe2, or ceramic, CoFe2O4, targets. X-ray diffraction (XRD) and Rutherford spectrometry (RBS) in random and channeling configuration have been used to determine the epitaxial relationship CoFe2O4 [100]/TiN [100]/Si [100]. Mössbauer spectroscopy, in combination with XRD and RBS, has been used to determine the composition and structure of the cobalt ferrite thin films. The TiN buffer layer induces a compressive strain in the cobalt ferrite thin films giving rise to an in-plane magnetic anisotropy. The degree of in-plane anisotropy depends on the lattice mismatch between CoFe2O4 and TiN, which is larger for CoFe2O4 thin films grown on the reactive sputtering process with ceramic targets.
Gao, K Y; Grosshans, I; Hipp, W; Stritzker, B
2002-01-01
The semiconducting ZnS nanocrystallites were synthesized by sequential high dose ion implantation of Zn and S in thermally grown SiO sub 2 on Si(1 0 0) and subsequent rapid thermal annealing (RTA). Some samples were pre-implanted with Ar ions in order to investigate the influence of radiation induced damage on the formation of ZnS nanocrystallites. The crystal structure of the ZnS crystallites, their size distribution and the concentration depth profile were analyzed by X-ray diffraction (XRD), Rutherford backscattering spectroscopy (RBS) and cross-sectional transmission-electron-microscopy (XTEM). The XRD results indicate, that the phase transition from cubic zinc blende to hexagonal wurtzite structure of ZnS nanocrystallites begins at temperatures below 1000 degree sign C. The RBS results show a clear redistribution of Zn and S after RTA annealing. The concentration of Zn is seriously reduced due to strong diffusion towards deeper regions and the surface, while Ar pre-implantation partially suppressed the c...
Energy Technology Data Exchange (ETDEWEB)
Torrecilha, Jefferson Koyaishi
2014-07-01
The Peruibe Black mud is used in therapeutic treatments such as psoriasis, peripheral dermatitis, acne and seborrhoea, as well as in the treatment of myalgia, arthritis, rheumatism and non-articular processes. Likewise other medicinal clays, it may not be free from possible adverse health effects due to possible hazardous minerals leading to respiratory system occurrences and other effects, caused by the presence of toxic elements. Once used for therapeutic purposes, any given material should be fully characterized and thus samples of Peruibe black mud were analyzed to determine physical and chemical properties: moisture content, organic matter and loss on ignition; pH, particle size, cation exchange capacity and swelling index. The elemental composition was determined by Neutron Activation Analysis, Atomic Absorption Graphite Furnace and X-ray fluorescence; the mineralogical composition was determined by X-ray diffraction. Another tool widely used to evaluate the behavior of trace elements, in various environmental matrices, is the sequential extraction. Thus, a sequential extraction procedure was applied to fractionate the mud in specific geochemical forms and verify how and how much of the elements may be contained in it. Considering the several sequential extraction procedures, BCR-701 method (Community Bureau of Reference) was used since it is considered the most reproducible among them. A simple extraction with an artificial sweat was, also, applied in order to verify which components are potentially available for absorption by the patient skin during the topical treatment. The results indicated that the mud is basically composed by a silty-clay material, rich in organic matter and with good cation exchange capacity. There were no significant variations in mineralogy and elemental composition of both, in natura and mature mud forms. The analysis by sequential extraction and by simple extraction indicated that the elements possibly available in larger quantities to be absorbed by the skin during treatment are Ca, Mg, Mn and Na. (author)
A análise por injeção sequencial (SIA: vinte anos em uma perspectiva brasileira
Directory of Open Access Journals (Sweden)
Allan Cezar Vieira dos Santos
2010-01-01
Full Text Available The year of 2010 marks the 20th anniversary of the development of Sequential Injection Analysis (SIA by Ruzicka and Marshall. Considered the second generation of the flow injection methods, this article briefly describes the history, the basic principles of the technique and reviews all papers developed by Brazilian scientists aiming the divulgation of this automation technique in Analytical Chemistry.
Potências animadas do traço: fixidez e animação da caricatura no humor gráfico
Directory of Open Access Journals (Sweden)
Benjamim Picado
2012-06-01
Full Text Available Este artigo pretende examinar certos aspectos das relações entre o desenho e a representação de ações, a partir de um exame sobre tirinhas diárias. Estamos especialmente preocupados com a complementaridade entre os traços estilísticos da caricatura e a questão da compreensão sobre a animação potencial de sua apresentação plástica. Trabalhada a partir do sentido de mudança e de expressividade de seus motivos, a representação fisionômica na caricatura cumpre funções preparatórias para os regimes de significação narrativa na arte sequencial. Numa tal perspectiva, a morfologia dos caracteres do humor gráfico seria mais bem explanada se sua graça cômica fosse considerada como parte do problema geral de um estilo “lacunar” ou “expressivo” da caricatura.
Batch and continuous extraction of bromelain enzyme by reversed micelles
Directory of Open Access Journals (Sweden)
Ana Maria Frattini Fileti
2009-10-01
Full Text Available The main aim of this study was to optimize the conditions for bromelain extraction by reversed micelles from pineapple juice (Ananas comosus. The purification was carried out in batch extraction and a micro-column with pulsed caps for continuous extraction. The cationic micellar solution was made of BDBAC as a surfactant, isooctane as a solvent and hexanol as a co-solvent. For the batch process, a purification factor of 3 times at the best values of surfactant agent, co-solvent and salt concentrations, pH of the back and forward extractions were, 100 mM, 10% v/v, 1 M, 3.5 and 8, respectively. For the continuous operation, independent variables optimal point was determined: ratio between light phase flow rate and total flow rate equal to 0.67 and 1 second for the time interval between the pulses. This optimal point led to a productivity of 1.29 mL/min and a purification factor of 4.96.Este trabalho teve como objetivo principal otimizar as condições para extração da bromelina do suco do abacaxi (Ananas comosus por micelas reversas. A purificação foi feita usando o processo de extração em batelada e contínuo, este último em uma micro-coluna de campânulas pulsantes. A solução micelar catiônica foi preparada com o surfactante BDBAC, i-octano como solvente e hexanol como co-solvente. Na extração em batelada encontrou-se um fator de purificação de 3 vezes, e seus melhores valores de concentração do agente surfactante, co-solvente e sal, de pH da re-extração e extração, foram respectivamente iguais a: 100 mM, 10% v/v, 1 M, 3,5 e 8. Para a operação contínua, as variáveis independentes ótimas foram: 0,67 para a razão entre as taxas de fluxos da fase leve e a total e 1 s para o intervalo de tempo entre pulsos das campânulas. Este ponto ótimo leva a uma produtividade de 1,29 mL/min e a um fator de purificação igual a 4,96.
Evaluation of incubated defatted rubber seed meal with sheep rumen liquor for Pangasius diet
Directory of Open Access Journals (Sweden)
Muhammad Agus Suprayudi
2015-10-01
Full Text Available ABSTRACT The research evaluated the use of rubber seed meal (Hevea brasiliensis; RBS incubated with sheep rumen liquor as a subtitution of soybean meal in catfish Pangasionodon sp. diet. The fish was cultured for 40 days and fed with the experimental diet containing RBS at five different diet compositions regarding to soybean meal substitution level, i.e. 0% (control, 12%, 23%, 34%, and 44%. Feeding was done three times a day to satiation. No significant different was found on fish-protein retention and survival rate in all treatments. Based on the study result, the use of rubber-seed meal (Hevea brasiliensis; RBS incubated with sheep rumen liquor could substitute soybean meal in catfish Pangasionodon sp. diet. Keywords: Hevea brasiliensis, Pangasionodon sp., catfish, sheep rumen liquor, rubber seed meal ABSTRAK Penelitian ini mengevaluasi penggunaan tepung bungkil biji karet (Hevea brasiliensis; TBBK yang diinkubasi dengan cairan rumen domba sebagai pengganti tepung bungkil kedelai pada pakan ikan patin Pangasionodon sp. Pemeliharaan ikan dilakukan selama 40 hari dengan pemberian lima komposisi pakan berbeda sesuai tingkat substitusi tepung bungkil kedelai oleh tepung bungkil karet. TBBK yang ditambahkan untuk mengganti bungkil kedelai adalah sebesar 0%, 12%, 23%, 34% dan 44%. Pemberian pakan dilakukan selama tiga kali sehari secara at satiation. Tidak ditemukan perbedaan signifikan (P>0,05 pada nilai retensi protein dalam tubuh dan kelangsungan hidup ikan uji pada semua perlakuan. Berdasarkan hasil penelitian, dapat disimpulkan bahwa tepung bungkil biji karet yang diinkubasi dengan cairan rumen domba dapat digunakan sebagai pengganti bungkil kedelai pada pakan ikan patin Pangasionodon sp. Kata kunci: Hevea brasiliensis, Pangasionodon sp., patin, rumen domba, tepung biji karet
International Nuclear Information System (INIS)
Mathis, F.; Salomon, J.; Aucouturier, M.; Trocellier, P.
2006-01-01
Recently a new thematic of research -- intentional patinas on antic copper-base objects -- lead the AGLAE (Accelerateur Grand Louvre pour l'Analyse Elementaire) team of the C2RMF (Centre de Recherche et de Restauration des Musees de France) to improve its methods of analyzing thin surface layers both in their elemental composition and in-depth elemental distribution. A new beam extraction set-up containing a particle detector has been developed in order to use a 6 MeV alpha beam both in PIXE and RBS mode and to monitor precisely the ion dose received by the sample. Both RBS and ionization cross sections were assessed in order to make sure that the analysis can be quantitative. This set up allows great progresses in the understanding of both nature and structure of this very particular oxide layer obtained in the antiquity by chemical treatment on copper alloys, containing gold and/or silver and presenting very interesting properties of color and stability.Besides the non destructive properties of the IBA in external beam mode, this method of analyzing allows the study of samples in interaction with its environment. This was used to study the high temperature oxidation of Cu-Sn alloys using a furnace developed in order to heat a sample and analyze it in RBS mode at the same time. This new way of studying the growth of oxide layers permits to understand the oxidation mechanism of this system and to propose an experimental model for the identification of oxide layers due to an exposition to a high temperature, model needed for a long time by curators in charge of the study and the conservation of archaeological bronzes
Gonzalez, Mariana; Miglioranza, Karina S B; Grondona, Sebastían I; Silva Barni, Maria Florencia; Martinez, Daniel E; Peña, Aránzazu
2013-04-01
This study is aimed at analyzing the occurrence and transport of organochlorine pesticides (OCPs), polychlorinated biphenyls (PCBs) and polybrominated diphenyl ethers (PBDEs) in the Quequén Grande river basin, as representative of a catchment under diffuse pollution sources. Pollutant levels in soils, river bottom sediments (RBS), streamwater (Sw), suspended particle materials (SPMs), macrophytes and muscle of silverside were determined by GC-ECD. Soil K(d) values for the current-used insecticides, endosulfans and cypermethrin, were established. Total levels (ng g(-1) dry weight) in soil ranged between 0.07–0.9 for OCPs, 0.03–0.37 for PCBs and 0.01–0.05 for PBDEs. Endosulfan insecticide (α- + b- + sulfate metabolite) represented up to 72.5% of OCPs. The low soil retention for α-endosulfan (K(d): 77) and endosulfan sulfate (K(d): 100) allows their transport to Sw, SPM and RBS. Levels of endosulfan in Sw in some cases exceeded the value postulated by international guidelines for aquatic biota protection (3 ng L(-1)). PCB and PBDE pollution was related to harbour, dumping sites and pile tire burning. Tri and hexa PCB congeners predominated in all matrices and exceeded the quality guideline value of 0.04 ng L(-1) in Sw. Considering levels in silverside muscle, none of the oral reference doses were exceeded, however, PCBs accounted for 18.6% of the total daily allowed ingest for a 70 kg individual. Although the levels of PCBs and OCPs in soil and RBS were low and did not go beyond quality guidelines, these compounds could still represent a risk to aquatic biota and humanbeings, and thus actions towards preventing this situation should be undertaken.
International Nuclear Information System (INIS)
Bois, L.; Chassagneux, F.; Parola, S.; Bessueille, F.; Battie, Y.; Destouches, N.; Boukenter, A.; Moncoffre, N.; Toulhoat, N.
2009-01-01
Elaboration of mesostructured silica films with a triblock copolymer polyethylene oxide-polypropylene oxide-polyethylene oxide, (PEO-PPO-PEO) and controlled growth of silver nanoparticles in the mesostructure are described. The films are characterized using UV-visible optical absorption spectroscopy, TEM, AFM, SEM, X-ray diffraction (XRD) and Rutherford backscattering spectrometry (RBS). Organized arrays of spherical silver nanoparticles with diameter between 5 and 8 nm have been obtained by NaBH 4 reduction. The size and the repartition of silver nanoparticles are controlled by the film mesostructure. The localization of silver nanoparticles exclusively in the upper-side part of the silica-block copolymer film is evidenced by RBS experiment. On the other hand, by using a thermal method, 40 nm long silver sticks can be obtained, by diffusion and coalescence of spherical particles in the silica-block copolymer layer. In this case, migration of silver particles toward the glass substrate-film interface is shown by the RBS experiment. - Graphical abstract: Growth of silver nanoparticles in a mesostructured block copolymer F127-silica film is performed either by a chemical route involving NaBH 4 reduction or by a thermal method. An array of spherical silver nanoparticles with 10 nm diameter on the upper-side of the mesostructured film or silver sticks long of 40 nm with a preferential orientation are obtained according to the method used. a: TEM image of the Fag5SiNB sample illustrating the silver nanoparticles array obtained by the chemical process; b: HR-TEM image of the Fag20Sid2 sample illustrating the silver nanosticks obtained by the thermal process.
Wang, Jing; Cui, Xun; Yang, Le; Zhang, Zhe; Lv, Liping; Wang, Haoyuan; Zhao, Zhenmin; Guan, Ningzi; Dong, Lichun; Chen, Rachel
2017-07-01
Artificial control of bio-functions through regulating gene expression is one of the most important and attractive technologies to build novel living systems that are useful in the areas of chemical synthesis, nanotechnology, pharmacology, cell biology. Here, we present a novel real-time control system of gene regulation that includes an enhancement element by introducing duplex DNA aptamers upstream promoter and a repression element by introducing a RNA aptamer upstream ribosome binding site. With the presence of ligands corresponding to the DNA aptamers, the expression of the target gene can be potentially enhanced at the transcriptional level by strengthening the recognition capability of RNAP to the recognition region and speeding up the separation efficiency of the unwinding region due to the induced DNA bubble around the thrombin-bound aptamers; while with the presence of RNA aptamer ligand, the gene expression can be repressed at the translational level by weakening the recognition capability of ribosome to RBS due to the shielding of RBS by the formed aptamer-ligand complex upstream RBS. The effectiveness and potential utility of the developed gene regulation system were demonstrated by regulating the expression of ecaA gene in the cell-free systems. The realistic metabolic engineering application of the system has also tested by regulating the expression of mgtC gene and thrombin cDNA in Escherichia coli JD1021 for controlling metabolic flux and improving thrombin production, verifying that the real-time control system of gene regulation is able to realize the dynamic regulation of gene expression with potential applications in bacterial physiology studies and metabolic engineering. Copyright © 2017. Published by Elsevier Inc.
RBS and SEM analysis of the nickel-fullerene hybrid systems
Czech Academy of Sciences Publication Activity Database
Vacík, Jiří; Naramoto, J.; Narumi, K.; Yamanoto, S.; Abe, J.
2003-01-01
Roč. 206, - (2003), s. 395-398 ISSN 0168-583X Institutional research plan: CEZ:AV0Z1048901 Keywords : nicke-fullerene hybrid Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 1.041, year: 2003
RBS and XRD analysis of silicon doped titanium diboride films
International Nuclear Information System (INIS)
Mollica, S.; Sood, D.K.; Ghantasala, M.K.; Kothari, R.
1999-01-01
Titanium diboride is a newly developed material suitable for protective coatings. Its high temperature oxidation resistance at temperatures of 700 deg C and beyond is limited due to its poor oxidative behaviour. This paper presents a novel approach to improving the coatings' oxidative characteristics at temperatures of 700 deg C by doping with silicon. Titanium diboride films were deposited onto Si(100) wafer substrates using a DC magnetron sputtering system. Films were deposited in two different compositions, one at pure TiB 2 and the other with 20 % Si doping. These samples were vacuum annealed at 700 deg C at 1x10 -6 Torr to investigate the anaerobic behaviour of the material at elevated temperatures and to ensure that they were crystalline. Samples were then oxidised in air at 700 deg C to investigate their oxidation resistance. Annealing the films at 700 deg C in air results in the oxidation of the film as titanium and boron form TiO 2 and B 2 O 3 . Annealing is seen to produce only minor changes in the films. There is some silicon diffusion from the substrate at elevated temperatures, which is related to the porous nature of the deposited film and the high temperature heat treatments. However, silicon doped films showed relatively less oxidation characteristics after annealing in air compared with the pure TiB 2 samples
Characterisation of annealed Fe/Ag bilayers by RBS and XRD
Energy Technology Data Exchange (ETDEWEB)
Tunyogi, A., E-mail: tunyogi@rmki.kfki.h [KFKI Research Institute for Particle and Nuclear Physics, H-1525 Budapest, P.O. Box 49 (Hungary); Tancziko, F.; Bogdan, Cs. [KFKI Research Institute for Particle and Nuclear Physics, H-1525 Budapest, P.O. Box 49 (Hungary); Horvath, Z.E. [Research Institute for Technical Physics and Materials Science, H-1525 Budapest, P.O. Box 49 (Hungary); Szilagyi, E. [KFKI Research Institute for Particle and Nuclear Physics, H-1525 Budapest, P.O. Box 49 (Hungary)
2010-06-15
Recently Fe/Ag thin films have been intensively investigated due to their special magnetic properties. To study the stability of the Fe-Ag interfaces very long time experiments are necessary at room temperature. To enhance the processes which take place at interfaces, high temperature annealing can be used. A detailed annealing experiment was carried out on Si-covered Fe/Ag (Ag grown on Fe) and Ag/Fe (Fe grown on Ag) polycrystalline bilayers, which were deposited on Si(1 1 1) substrates by MBE method. Heat treatments of various duration and temperature were applied in UHV conditions. Rutherford backscattering spectrometry and X-ray diffractometry were used to determine the effects of the heat treatments. In case of Fe/Ag samples, formation of iron-silicide phases was observed between the Fe layer and Si substrate, and the silver and the silicon capping layer were also completely mixed with each other. In case of the Ag/Fe samples the silver moved to the sample surface through the iron layers, while iron shifted to the substrate and mixed with silicon.
Computer simulation of RBS spectra from samples with surface roughness
Czech Academy of Sciences Publication Activity Database
Malinský, Petr; Hnatowicz, Vladimír; Macková, Anna
2016-01-01
Roč. 371, MAR (2016), s. 101-105 ISSN 0168-583X. [22nd International conference on Ion Beam Analysis (IBA). Opatija, 14.06.2015-19.06.2015] R&D Projects: GA MŠk(CZ) LM2011019; GA ČR GA15-01602S Institutional support: RVO:61389005 Keywords : computer simulation * Rutherford backscattering * surface roughness Subject RIV: BG - Nuclear, Atomic and Molecular Physics, Colliders Impact factor: 1.109, year: 2016
Scherer, Michael; Romano, Eduardo; Caldwell, Susan; Taylor, Eileen
2018-02-17
Driving under the influence (DUI) citations are still a serious concern among drivers aged 16-20 years and have been shown to be related to increased risk of fatal and nonfatal crashes. A battery of laws and policies has been enacted to address this concern. Though numerous studies have evaluated these policies, there is still a need for comprehensive policy evaluations that take into account a variety of contextual factors. Previous effort by this research team examined the impact of 20 minimum legal drinking age-21 laws in the state of California, as they impacted alcohol-related crash rates among drivers under 21 years of age while at the same time accounting for alcohol and gas taxes, unemployment rates, sex distribution among drivers, and sobriety checkpoints. The current research seeks to expand this evaluation to the county level (San Diego County). More specifically, we evaluate the impact of measures subject to county control such as retail beverage service (RBS) laws and social host (SH) laws, as well as media coverage, city employment, alcohol outlet density, number of sworn officers, alcohol consumption, and taxation policies, to determine the most effective point of intervention for communities seeking to reduce underage DUI citations. Annual DUI citation data (2000 to 2013), RBS and SH policies, and city-wide demographic, economic, and environmental information were collected and applied to each of the 20 cities in San Diego County, California. A structural equation model was fit to estimate the relative contribution of the variables of interest to DUI citation rates. Alcohol consumption and alcohol outlet density both demonstrated a significant increase in DUI rates, whereas RBS laws, SH laws, alcohol tax rates, media clusters, gas tax rates, and unemployment rates demonstrated significant decreases in DUI rates. At the county level, although RBS laws, SH laws, and media efforts were found to contribute to a significant reduction in DUI rates, the
Atomic mixing effects on high fluence Ge implantation into Si at 40 keV
International Nuclear Information System (INIS)
Gras-Marti, A.; Jimenez-Rodriguez, J.J.; Peon-Fernandez, J.; Rodriguez-Vidal, M.; Tognetti, N.P.; Carter, G.; Nobes, M.J.; Armour, D.G.
1982-01-01
Ion implanted profiles of 40 keV Ge + into Si at fluences ranging from approx. equal to 10 15 ions/cm 2 up to saturation have been measured using the RBS technique. The profiles compare well with the predictions of an analytical model encompasing sputter erosion plus atomic relocation. (orig.)
Responsible Hospitality. Prevention Updates
Colthurst, Tom
2004-01-01
Responsible Hospitality (RH)--also called Responsible Beverage Service (RBS)--encompasses a variety of strategies for reducing risks associated with the sale and service of alcoholic beverages. RH programs have three goals: (1) to prevent illegal alcohol service to minors; (2) to reduce the likelihood of drinkers becoming intoxicated; and (3) to…
India mainstreams medicinal plants | CRDI - Centre de recherches ...
International Development Research Centre (IDRC) Digital Library (Canada)
The program is partly sponsored by IDRC's Medicinal and Aromatic Plants Program in Asia (MAPPA). IDRC has supported medicinal plant research in the region since 1992. Improving quality control. R.B.S. Rawat, CEO of India's National Medicinal Plants Board, said people in Chhattisgarh and other states stand to benefit ...
Directory of Open Access Journals (Sweden)
Paulo Cerqueira dos Santos
2011-01-01
Full Text Available O objetivo do trabalho foi determinar o tamanho adequado de amostra para estimar o volume de fustes de espécies florestais de uma população de árvores a serem cortadas no sistema de manejo florestal da empresa Cikel Brasil Verde Madeiras - Pará. Utilizaram-se as metodologias da amostragem sistemática e do estimador geoestatístico da krigagem ordinária com simulação sequencial, respectivamente para a escolha das amostras e estimação dos volumes dos fustes das árvores. Os resultados mostraram que os métodos podem ser utilizados no cálculo dos volumes de fustes de árvores. Entretanto, o método da krigagem apresenta um efeito de suavização, tendo como conseqüência uma subestimação dos volumes calculados. Neste caso, um fator de correção foi aplicado para minimizar o efeito da suavização. A simulação sequencial indicativa apresentou resultados mais precisos em relação à krigagem, uma vez que tal método apresentou algumas vantagens, tal como a não exigência de amostras com distribuições normais e ausência de efeito de suavização, característico dos métodos de interpolação.The objective of this study was to determine the appropriate size sample to estimate the stem volumes stems of tree species from a population of trees to be cut in the forest management system of the timber company Cikel Brasil Verde Madeiras - Pará State, Brazil. The methodologies of systematic sampling and geostatistical kriging with sequential simulation were used, respectively, for the choice of samples and estimation of stem volumes of trees. The results showed that the methods can be used to calculate the stem volumes of trees. However, the kriging method has a smoothing effect, which resulted in an underestimation of the volumes. In such case, a correction factor was applied to minimize the effect of smoothing. The sequential simulation indicative presented more accurate results compared to kriging, since this method has certain
Electrical properties of epitaxially grown VOx thin films
Rata, A.D.; Chezan, A.R; Presura, C.N.; Hibma, T
2003-01-01
High quality VOx thin films on MgO(100) substrates were prepared and studied from the structural and electronic point of view. Epitaxial growth was confirmed by RHEED and XRD techniques. The oxygen content of VOx thin films as a function of oxygen flux was determined using RBS. The upper and lower
The study of an aluminium-alloy distributed ion pump
International Nuclear Information System (INIS)
Liu, Y.C.; Lin, W.J.; Chen, J.R.; National Tsinghua Univ., Hsinchu, Taiwan
1990-01-01
A distribution ion pump with aluminum chamber, aluminum anodes and titanium cathodes has been studied. It was observed from AES and RBS analyses that a titanium layer with oxygen and nitrogen atoms (with a ratio T i /N + 0 ≅ 0.7) was deposited on the surface of the aluminum anode. (author)
African Journals Online (AJOL)
UDS-CAPTURED
examines the extent of women farmers' access to credit from Rural Banks (RBs) in the Upper East. Region of Ghana. .... In this regard, anybody who does not attempt to get credit from formal, semi-formal/endogenous or ... District and the Builsa Community Rural Bank with its headquarters at Sandema in the Builsa. District.
Au implantation into various types of silicate glasses
Czech Academy of Sciences Publication Activity Database
Malinský, Petr; Macková, Anna; Bočan, Jiří; Švecová, B.; Nekvindová, P.
2009-01-01
Roč. 267, - (2009), s. 1575-1578 ISSN 0168-583X R&D Projects: GA MŠk(CZ) LC06041 Institutional research plan: CEZ:AV0Z10480505 Keywords : Au+ ion implantation * Glass es * RBS Depth profiling Subject RIV: BG - Nuclear, Atomic and Molecular Physics, Colliders Impact factor: 1.156, year: 2009
Collaboration for the design of an irradiation line in the Tandetron area
International Nuclear Information System (INIS)
Quezada G, A.
2006-01-01
Presently work is sought to contribute in the design of a new line for the Tandetron accelerator that allows the application of other analytical techniques as its are: Rutherford backscattering analysis (RBS), elastic setback scattering analysis (ERDA) elastic scattering toward ahead (EFA) and materials modification by means of the particle beams application. (Author)
Use of an ultra-high resolution magnetic spectrograph for materials research
Boerma, DO; Arnoldbik, WM; Wolfswinkel, W; Balogh, AG; Walter, G
1997-01-01
A brief description is given of a magnetic spectrograph for RBS and ERD analysis with MeV beams, delivered by a Tandem accelerator. With a number of examples of thin layer analysis it is shown that the spectrograph is uniquely suited for the measurement of concentration depth profiles up to a depth
Wygant, Dustin B.; Sellbom, Martin; Gervais, Roger O.; Ben-Porath, Yossef S.; Stafford, Kathleen P.; Freeman, David B.; Heilbronner, Robert L.
2010-01-01
The present study extends the validation of the Minnesota Multiphasic Personality Inventory-2 (MMPI-2) and the Minnesota Multiphasic Personality Inventory-2 Restructured Form (MMPI-2-RF) Response Bias Scale (RBS; R. O. Gervais, Y. S. Ben-Porath, D. B. Wygant, & P. Green, 2007) in separate forensic samples composed of disability claimants and…
SwissProt search result: AK068266 [KOME
Lifescience Database Archive (English)
Full Text Available AK068266 J013149A10 (P16881) Ribulose bisphosphate carboxylase small chains, chloro...plast precursor (EC 4.1.1.39) (RuBisCO small subunits) [Contains: Ribulose bisphosphate carboxylase small chain P1; Ribulos...e bisphosphate carboxylase small chain P2; Ribulose bispho RBS_EUGGR 1e-32 ...
SwissProt search result: AK068555 [KOME
Lifescience Database Archive (English)
Full Text Available AK068555 J013156H12 (P16881) Ribulose bisphosphate carboxylase small chains, chloro...plast precursor (EC 4.1.1.39) (RuBisCO small subunits) [Contains: Ribulose bisphosphate carboxylase small chain P1; Ribulos...e bisphosphate carboxylase small chain P2; Ribulose bispho RBS_EUGGR 6e-34 ...
SwissProt search result: AK070257 [KOME
Lifescience Database Archive (English)
Full Text Available AK070257 J023042N11 (P16881) Ribulose bisphosphate carboxylase small chains, chloro...plast precursor (EC 4.1.1.39) (RuBisCO small subunits) [Contains: Ribulose bisphosphate carboxylase small chain P1; Ribulos...e bisphosphate carboxylase small chain P2; Ribulose bispho RBS_EUGGR 5e-33 ...
SwissProt search result: AK061611 [KOME
Lifescience Database Archive (English)
Full Text Available AK061611 001-032-F07 (P16881) Ribulose bisphosphate carboxylase small chains, chlor...oplast precursor (EC 4.1.1.39) (RuBisCO small subunits) [Contains: Ribulose bisphosphate carboxylase small chain P1; Ribulos...e bisphosphate carboxylase small chain P2; Ribulose bispho RBS_EUGGR 4e-33 ...
SwissProt search result: AK099574 [KOME
Lifescience Database Archive (English)
Full Text Available AK099574 J013036G21 (P16881) Ribulose bisphosphate carboxylase small chains, chloro...plast precursor (EC 4.1.1.39) (RuBisCO small subunits) [Contains: Ribulose bisphosphate carboxylase small chain P1; Ribulos...e bisphosphate carboxylase small chain P2; Ribulose bispho RBS_EUGGR 8e-34 ...
SwissProt search result: AK121444 [KOME
Lifescience Database Archive (English)
Full Text Available AK121444 J023141B14 (P16881) Ribulose bisphosphate carboxylase small chains, chloro...plast precursor (EC 4.1.1.39) (RuBisCO small subunits) [Contains: Ribulose bisphosphate carboxylase small chain P1; Ribulos...e bisphosphate carboxylase small chain P2; Ribulose bispho RBS_EUGGR 6e-33 ...
SwissProt search result: AK119219 [KOME
Lifescience Database Archive (English)
Full Text Available AK119219 001-046-F11 (P16881) Ribulose bisphosphate carboxylase small chains, chlor...oplast precursor (EC 4.1.1.39) (RuBisCO small subunits) [Contains: Ribulose bisphosphate carboxylase small chain P1; Ribulos...e bisphosphate carboxylase small chain P2; Ribulose bispho RBS_EUGGR 4e-33 ...
SwissProt search result: AK059909 [KOME
Lifescience Database Archive (English)
Full Text Available AK059909 006-209-C06 (P16881) Ribulose bisphosphate carboxylase small chains, chlor...oplast precursor (EC 4.1.1.39) (RuBisCO small subunits) [Contains: Ribulose bisphosphate carboxylase small chain P1; Ribulos...e bisphosphate carboxylase small chain P2; Ribulose bispho RBS_EUGGR 2e-33 ...
Ion beam analyses of particulate matter in exhaust gas of a ship diesel engine
Energy Technology Data Exchange (ETDEWEB)
Furuyama, Yuichi, E-mail: furuyama@maritime.kobe-u.ac.jp [Graduate School of Maritime Sciences, Kobe University, Fukae-Minami-Machi, Higashinada-Ku, Kobe 658-0022 (Japan); Fujita, Hirotsugu; Taniike, Akira; Kitamura, Akira [Graduate School of Maritime Sciences, Kobe University, Fukae-Minami-Machi, Higashinada-Ku, Kobe 658-0022 (Japan)
2011-12-15
There is an urgent need to reduce emission of the particulate matter (PM) in the exhaust gas from ship diesel engines causing various health hazards and serious environmental pollution. Usually the heavy fuel oil (HFO) for ships is of low quality, and contains various kinds of impurities. Therefore, the emission of PM along with exhaust gas from ship diesel engines is one of the most serious environmental issues. However, the PM fundamental properties are not well known. Therefore, it is important to perform elemental analysis of the PM. The HFO contains sulfur with a relatively high concentration of a few percent. It is important to make quantitative measurements of sulfur in the PM, because this element is poisonous for the human body. In the present work, PM samples were collected from exhaust gas of a test engine, and RBS and PIXE analyses were applied successfully to quantitative analysis of the PM samples. The RBS analysis enabled quantitative analysis of sulfur and carbon in the collected PM, while heavier elements such as vanadium and iron were analyzed quantitatively with the PIXE analysis. It has been found that the concentration ratio of sulfur to carbon was between 0.007 and 0.012, and did not strongly depend on the output power of the engine. The S/C ratio is approximately equal to the original composition of the HFO used in the present work, 0.01. From the known conversion ratio 0.015 of sulfur in the HFO to sulfates, the conversion ratio of carbon in the HFO to the PM is found to be 0.01-0.02 by the RBS measurements. On the other hand, the PIXE analysis revealed a vanadium enrichment of one order of magnitude in the PM.
How frequent are cardiovascular risk factors in lawyers
International Nuclear Information System (INIS)
Ali, J.; Gul, A.M.; Irfan, M.; Querishi, M.S.; Faheem, M.; Khan, S.B.; Shah, S.F.A.; Hifizullah, M.
2012-01-01
Objective: The aim of this study was to know the frequency of CVD risk factors in lawyers of Peshawar. Methodology: Data for this study was derived from Peshawar Heart study (PHS). PHS is big trial which is being conducted by Cardiology Department Lady Reading Hospital, Peshawar to determine various cardiovascular risk factors in various occupational groups of Peshawar. Results: A total of 252 lawyers from district Peshawar were recruited in PHS. Male were 249(98.6%) while 03(1.2%) were female. Mean age was 41.37+-9.93 years (range 25 to 79 years). Mean duration of practicing was 13.09 +-10.95 years. Mean duration of regular exercise was 17.02 +- 29.30 minutes and 84 (33.3%) were doing regular exercise and 168(66.7%) were not performing exercise. Out of 252 lawyers 57(22.6%) were cigarette smokers, 12(4.6%) were 2 naswar addicts. Mean BMI was 27.86 +- 4.1 Kg/m and 64.3 %(162) had their BMI 2=27 kg/m. Mean cholesterol was 182.38+-28.70 mg/dl and 42.5 %(107) had their cholesterol =180 mg/dl. Mean RBS of lawyers was 113.78 +- 48.74 mg/dl and 16.7 %( 42) had their RBS of =140 mg/dl. Mean systolic blood pressure and mean diastolic blood pressure were 134.09 +- 19.05 mmHg and 87.66 +- 11.71 mmHg respectively and 38.5%(97) had their systolic =140 mmHg and 58.7(148) had their diastolic blood pressure = 90 mmHg respectively. Out 252 lawyers 24.6%(62) had positive family history of (CAD). Conclusion: Most of the lawyers were obese, indulged in tobacco use, had their RBS and total cholesterol elevated, as well as high systolic and diastolic blood pressure. (author)
International Nuclear Information System (INIS)
Alonso, U.; Missana, T.; Garcia-Gutierrez, M.; Patelli, A.; Rigato, V.
2005-01-01
Full text of publication follows: The long-term quantitative analysis of the migration behaviour of the relevant radionuclides (RN) within the geological barrier of a radioactive waste repository requires, amongst other data, the introduction of reliable transport parameters, as diffusion coefficients. Since the determination of diffusion coefficients within crystalline rocks is complex and requires long experimental times even for non-sorbing radionuclides, the data available in the literature are very scarce. The nuclear ion beam technique RBS (Rutherford Backscattering Spectrometry) that is successfully used to determine diffusion profiles in thin film science is here examined as possible suitable technique to determine the diffusion coefficients of different RN within granite. As first step, the technique sensitivity and limitations to analyse diffusion coefficients in granite samples is evaluated, considering that the technique is especially sensitive to heavy elements. The required experimental conditions in terms of experimental times, concentration and methodology of analysis are discussed. The diffusants were selected accounting the RBS sensitivity but also trying to cover different behaviours of critical RN and a wide range of possible oxidation states. In particular, Cs(I) was chosen as representative fission product, while as relevant actinides or homologues, the diffusion of Th(IV), U(IV) and Eu (III) was studied. The diffusion of these above-mentioned cations is compared to the diffusion of Re, and I as representative of anionic species. The methodology allowed evaluating diffusion coefficients in the granite samples and, for most of the elements, the values obtained are in agreement with the values found in the literature. The diffusion coefficients calculated ranged from 10 -13 to 10 -16 m 2 /s. It is remarkable that the RBS technique is especially promising to determine diffusion coefficients of high-sorbing RN and it is applicable to a wide range
Gomes, Marcelo Pedrosa; Maccario, Sophie; Lucotte, Marc; Labrecque, Michel; Juneau, Philippe
2015-12-15
Phosphate (PO4(3-)) fertilization is a common practice in agricultural fields also targets for glyphosate application. Due to their chemical similarities, PO4(3-) and glyphosate compete for soil adsorbing sites, with PO4(3-) fertilization increasing glyphosate bioavailability in the soil solution. After PO4(3-) fertilization, its concentration will be elevated in the soil solution and both PO4(3-) and glyphosate will be readily available for runoff into aquatic ecosystems. In this context, man-made riparian buffer strips (RBS) at the interface of agricultural lands and waterways can be used as a green technology to mitigate water contamination. The plants used in RBS form a barrier to agricultural wastes that can limit runoff, and the ability of these plants to take up these compounds through their roots plays an important role in RBS efficacy. However, the implications of PO4(3-) for glyphosate uptake by roots are not yet clearly demonstrated. Here, we addressed this problem by hydroponically cultivating willow plants in nutrient solutions amended with glyphosate and different concentrations of PO4(3-), assuring full availability of both chemicals to the roots. Using a phosphate carrier inhibitor (phosphonophormic acid-PFA), we found that part of the glyphosate uptake is mediated by PO4(3-) transporters. We observed, however, that PO4(3-) increased glyphosate uptake by roots, an effect that was related to increased root cell membrane stability. Our results indicate that PO4(3-) has an important role in glyphosate physiological effects. Under agricultural conditions, PO4(3-) fertilization can amplify glyphosate efficiency by increasing its uptake by the roots of undesired plants. On the other hand, since simultaneous phosphate and glyphosate runoffs are common, non-target species found near agricultural fields can be affected. Copyright © 2015. Published by Elsevier B.V.
Directory of Open Access Journals (Sweden)
Maud Dumoux
Full Text Available The obligate intracellular bacterium Chlamydia exists as two distinct forms. Elementary bodies (EBs are infectious and extra-cellular, whereas reticulate bodies (RBs replicate within a specialized intracellular compartment termed an 'inclusion'. Alternative persistent intra-cellular forms can be induced in culture by diverse stimuli such as IFNγ or adenosine/EHNA. They do not grow or divide but revive upon withdrawal of the stimulus and are implicated in several widespread human diseases through ill-defined in vivo mechanisms. β-Lactam antibiotics have also been claimed to induce persistence in vitro. The present report shows that upon penicillin G (pG treatment, inclusions grow as fast as those in infected control cells. After removal of pG, Chlamydia do not revert to RBs. These effects are independent of host cell type, serovar, biovar and species of Chlamydia. Time-course experiments demonstrated that only RBs were susceptible to pG. pG-treated bacteria lost their control over host cell apoptotic pathways and no longer expressed pre-16S rRNA, in contrast to persistent bacteria induced with adenosine/EHNA. Confocal and live-video microscopy showed that bacteria within the inclusion fused with lysosomal compartments in pG-treated cells. That leads to recruitment of cathepsin D as early as 3 h post pG treatment, an event preceding bacterial death by several hours. These data demonstrate that pG treatment of cultured cells infected with Chlamydia results in the degradation of the bacteria. In addition we show that pG is significantly more efficient than doxycycline at preventing genital inflammatory lesions in C. muridarum-C57Bl/6 infected mice. These in vivo results support the physiological relevance of our findings and their potential therapeutic applications.
Quevedo Lopez, Manuel Angel
Hafnium and Zirconium based gate dielectrics are considered potential candidates to replace SiO2 or SiON as the gate dielectric in CMOS processing. Furthermore, the addition of nitrogen into this pseudo-binary alloy has been shown to improve their thermal stability, electrical properties, and reduce dopant penetration. Because CMOS processing requires high temperature anneals (up to 1050°C), it is important to understand the diffusion properties of any metal associated with the gate dielectric in silicon at these temperatures. In addition, dopant penetration from the doped polysilicon gate into the Si channel at these temperatures must also be studied. Impurity outdiffusion (Hf, Zr) from the dielectric, or dopant (B, As, P) penetration through the dielectric into the channel region would likely result in deleterious effects upon the carrier mobility. In this dissertation extensive thermal stability studies of alternate gate dielectric candidates ZrSixOy and HfSixO y are presented. Dopant penetration studies from doped-polysilicon through HfSixOy and HfSixOyNz are also presented. Rutherford Backscattering Spectroscopy (RBS), Heavy Ion RBS (HI-RBS), X-ray Photoelectron Spectroscopy (XPS), High Resolution Transmission Electron Microscopy (HR-TEM), and Time of Flight and Dynamic Secondary Ion Mass Spectroscopy (ToF-SIMS, D-SIMS) methods were used to characterize these materials. The dopant diffusivity is calculated by modeling of the dopant profiles in the Si substrate. In this disseration is reported that Hf silicate films are more stable than Zr silicate films, from the metal interdiffusion point of view. On the other hand, dopant (B, As, and P) penetration is observed for HfSixO y films. However, the addition of nitrogen to the Hf - Si - O systems improves the dopant penetration properties of the resulting HfSi xOyNz films.
Investigation of fish otoliths by combined ion beam analysis
International Nuclear Information System (INIS)
Huszank, R.; Simon, A.; Keresztessy, K.
2008-01-01
Complete text of publication follows. This work was implemented within the framework of the Hungarian Ion beam Physics Platform (http://hipp.atomki.hu/). Otoliths are small structures, 'the ear stones' of a fish, and are used to detect acceleration and orientation. They are composed of a combination of protein matrix and calcium carbonate (CaCO 3 ) forming aragonite micro crystals. They have an annually deposited layered conformation with a microstructure corresponding to the seasonal and daily increments. Trace elements, such as Sr, Zn, Fe etc., are also incorporated into the otolith from the environment and the nutrition. The elemental distribution of the otolith of fresh water fish burbot (Lota lota L.) collected in Hungary was measured with Elastic Recoil Detection Analysis (ERDA), Rutherford backscattering spectrometry (RBS) and Particle Induced X-ray Emission (PIXE) at the Nuclear Microprobe Facility of HAS ATOMKI. The spatial 3D structure of the otolith could be observed with a sub-micrometer resolution. It is confirmed that the aragonite micro-crystals are covered by an organic layer and there are some protein rich regions in the otolith, too. By applying the RBSMAST code developed for RBS on macroscopic structure, it was proven that the orientation of the needle shaped aragonite crystals is considerably different at adjacent locations in the otolith. The organic and inorganic component of the otolith could be set apart in the depth selective hydrogen and calcium maps derived by micro- ERDA and micro-RBS. Similar structural analysis could be done near the surface by combining the C, O and Ca elemental maps determined by micro-PIXE measurements. It was observed that the trace metal Zn is bound to the protein component. Acknowledgements This work was partially supported by the Hungarian OTKA Grant No. T046238 and the EU cofunded Economic Competitiveness Operative Programme (GVOP-3.2.1.-2004-04-0402/3.0)
Interaction mechanisms of europium and nickel with calcite
International Nuclear Information System (INIS)
Sabau, Andrea
2015-01-01
In the context of the safety assessment of an underground repository for nuclear waste, sorption reactions are one of the main processes to take into account to predict the migration of the radionuclides which might be transferred from the waste canisters to underground waters over geological time scales. Sorption of aqueous species on minerals can include adsorption processes, surface (co)-precipitation, and even incorporation in the bulk of the material, which can lead to the irreversibility of some sorption reactions. This work is focused on two elements: Eu(III) as an analogue of trivalent actinides and Ni(II) as activation product. Calcite was chosen as adsorbent due to its presence in Callovian-Oxfordian clay rocks. Our study combines batch experiments with spectroscopic techniques (TRLFS, RBS and SEM-EDXS) to elucidate the mechanisms occurring at Eu(III)/Ni(II) calcite interface. To obtain a better understanding on the systems, before starting sorption experiments, aqueous chemistry of Eu(III) and Ni(II) was carefully investigated. Macroscopic results showed a strong retention of Eu(III) on calcite, no matter the initial concentration, contact time and CO 2 partial pressure. Ni(II) was also readily sorbed by calcite, but the retention was influenced by contact time and concentration. Time-dependent sorption experiments showed a marked and slow increase of retention upon a long time range (up to 4 months).Desorption results indicated a partly reversible sorption for Ni(II). TRLFS highlighted the influence of initial concentration and contact time on the interaction of Eu(III) with calcite. With the help of RBS and SEM-EDXS, it enabled to discriminate between different mechanisms like surface precipitation, inner-sphere complexation and incorporation. RBS showed incorporation of Eu(III) into calcite up to 250 nm, contrary to Ni(II) which was located at the surface. (author) [fr
Bornholdt, Zachary A; Ndungo, Esther; Fusco, Marnie L; Bale, Shridhar; Flyak, Andrew I; Crowe, James E; Chandran, Kartik; Saphire, Erica Ollmann
2016-02-23
The filovirus surface glycoprotein (GP) mediates viral entry into host cells. Following viral internalization into endosomes, GP is cleaved by host cysteine proteases to expose a receptor-binding site (RBS) that is otherwise hidden from immune surveillance. Here, we present the crystal structure of proteolytically cleaved Ebola virus GP to a resolution of 3.3 Å. We use this structure in conjunction with functional analysis of a large panel of pseudotyped viruses bearing mutant GP proteins to map the Ebola virus GP endosomal RBS at molecular resolution. Our studies indicate that binding of GP to its endosomal receptor Niemann-Pick C1 occurs in two distinct stages: the initial electrostatic interactions are followed by specific interactions with a hydrophobic trough that is exposed on the endosomally cleaved GP1 subunit. Finally, we demonstrate that monoclonal antibodies targeting the filovirus RBS neutralize all known filovirus GPs, making this conserved pocket a promising target for the development of panfilovirus therapeutics. Ebola virus uses its glycoprotein (GP) to enter new host cells. During entry, GP must be cleaved by human enzymes in order for receptor binding to occur. Here, we provide the crystal structure of the cleaved form of Ebola virus GP. We demonstrate that cleavage exposes a site at the top of GP and that this site binds the critical domain C of the receptor, termed Niemann-Pick C1 (NPC1). We perform mutagenesis to find parts of the site essential for binding NPC1 and map distinct roles for an upper, charged crest and lower, hydrophobic trough in cleaved GP. We find that this 3-dimensional site is conserved across the filovirus family and that antibody directed against this site is able to bind cleaved GP from every filovirus tested and neutralize viruses bearing those GPs. Copyright © 2016 Bornholdt et al.
Composition and structural analysis of Sm-Co thin films on (100)Si
International Nuclear Information System (INIS)
Ghantasala, M.; Sood, D.K.; Mohan, S.
1998-01-01
Full text: The necessity of integration of magnetics with silicon processing technology became essential with the advent of Micro Electromechanical Systems (MEMS). The need to control the crystalline and magnetic properties of the magnetic thin films on silicon substrates has been the primary motivation for this work. The major objective of this work is to prepare the stoichiometric and crystalline SmCo 5 thin films with good magnetic properties on single crystal silicon substrate. We have prepared the SmCo think films on single crystal (100) silicon substrates using DC magnetron sputtering. Films have been prepared in pure argon as the sputter media at two different pressures 2 x 10 -2 torr and 2 x 10 3 torr with the substrates kept at room temperature, 500 and 700 deg C separately. These films have been characterised using RBS, XRD and SEM. RBS analysis showed that the films are nearly stoichiometric (1:4.9) and have significant amounts of oxygen as impurity. But XRD studies indicated that the as deposited films (at all substrate temperatures) are yet to form the crystalline structure. Some of the films have been subjected to rapid thermal annealing at two different temperatures at 800 and 1000 deg C for 30 secs in an effort to crystallise the films. RBS analysis of these films indicated that the room temperature and post annealed films at 1000 deg C resulted in considerable interdiffusion characteristics, whereas the high temperature deposited (500 and 700 deg C) and annealed films showed relatively very stable characteristics with minimal diffusion between the film and the substrate. XRD and SEM analysis of the films is in progress. The detailed results of these investigations will be presented
Interface reactions between Pd thin films and SiC by thermal annealing and SHI irradiation
Energy Technology Data Exchange (ETDEWEB)
Njoroge, E.G., E-mail: eric.njoroge@up.ac.za [Department of Physics, University of Pretoria, Pretoria (South Africa); Theron, C.C. [Department of Physics, University of Pretoria, Pretoria (South Africa); Skuratov, V.A. [Joint Institute for Nuclear Research, Dubna (Russian Federation); Wamwangi, D. [School of Physics, University of Witwatersrand, Johannesburg (South Africa); Hlatshwayo, T.T. [Department of Physics, University of Pretoria, Pretoria (South Africa); Comrie, C.M. [MRD, iThemba LABS, P.O. Box 722, Somerset West 7129 (South Africa); Malherbe, J.B. [Department of Physics, University of Pretoria, Pretoria (South Africa)
2016-03-15
The solid-state reactions between Pd thin films and 6H-SiC substrates induced by thermal annealing, room temperature swift heavy ion (SHI) irradiation and high temperature SHI irradiation have been investigated by in situ and real-time Rutherford backscattering spectrometry (RBS) and Grazing incidence X-ray diffraction (GIXRD). At room temperature, no silicides were detected to have formed in the Pd/SiC samples. Two reaction growth zones were observed in the samples annealed in situ and analysed by real time RBS. The initial reaction growth region led to formation of Pd{sub 3}Si or (Pd{sub 2}Si + Pd{sub 4}Si) as the initial phase(s) to form at a temperature of about 450 °C. Thereafter, the reaction zone did not change until a temperature of 640 °C was attained where Pd{sub 2}Si was observed to form in the reaction zone. Kinetic analysis of the initial reaction indicates very fast reaction rates of about 1.55 × 10{sup 15} at cm{sup −2}/s and the Pd silicide formed grew linear with time. SHI irradiation of the Pd/SiC samples was performed by 167 MeV Xe{sup 26+} ions at room temperature at high fluences of 1.07 × 10{sup 14} and 4 × 10{sup 14} ions/cm{sup 2} and at 400 °C at lower fluences of 5 × 10{sup 13} ions/cm{sup 2}. The Pd/SiC interface was analysed by RBS and no SHI induced diffusion was observed for room temperature irradiations. The sample irradiated at 400 °C, SHI induced diffusion was observed to occur accompanied with the formation of Pd{sub 4}Si, Pd{sub 9}Si{sub 2} and Pd{sub 5}Si phases which were identified by GIXRD analysis.
SINP MSU accelerator facility and applied research
International Nuclear Information System (INIS)
Chechenin, N.G.; Ishkhanov, B.S.; Kulikauskas, V.S.; Novikov, L.S.; Pokhil, G.P.; Romanovskii, E.A.; Shvedunov, V.I.; Spasskii, A.V.
2004-01-01
Full text: SINP accelerator facility includes 120 cm cyclotron, electrostatic generator with the upper voltage 3.0 MeV, electrostatic generator with the upper voltage 2.5 MeV, Cocroft -Walton generator with the upper voltage 500 keV, 150 keV accelerator for solid microparticles. A new generation of electron beam accelerators has been developed during the last decade. The SINP accelerator facility will be shortly described in the report. A wide range of basic research in nuclear and atomic physics, physics of ion-beam interactions with condensed matter is currently carried out. SINP activity in the applied research is concentrated in the following areas of materials science: - Materials diagnostics with the Rutherford backscattering techniques (RBS) and channeling of ions (RBS/C). A large number of surface ad-layers and multilayer systems for advanced micro- and nano-electronic technology have been investigated. A selected series of examples will be illustrated. - Concentration depth profiles of hydrogen by the elastic recoils detection techniques (ERD). Primarily, the hydrogen depth profiles in perspective materials for thermonuclear reactors have been investigated. - Lattice site locations of hydrogen by a combination of ERD and channeling techniques. This is a new technique which was successfully applied for investigation of hydrogen and hydrogen-defect complexes in silicon for the smart-cut technology. - Light element diagnostics by RBS and nuclear backscattering techniques (NBS). The technique is illustrated by applications for nitrogen concentration profiling in steels. Nitrogen take-up and release, nitrides precipitate formation will be illustrated. - New medium energy ion scattering (MEIS) facility and applications. Ultra-high vacuum and superior energy resolution electrostatic toroidal analyzer is designed to be applied for characterization of composition and structure of several upper atomic layers of materials
Directory of Open Access Journals (Sweden)
Tshidi Tsibane
Full Text Available Most monoclonal antibodies (mAbs to the influenza A virus hemagglutinin (HA head domain exhibit very limited breadth of inhibitory activity due to antigenic drift in field strains. However, mAb 1F1, isolated from a 1918 influenza pandemic survivor, inhibits select human H1 viruses (1918, 1943, 1947, and 1977 isolates. The crystal structure of 1F1 in complex with the 1918 HA shows that 1F1 contacts residues that are classically defined as belonging to three distinct antigenic sites, Sa, Sb and Ca(2. The 1F1 heavy chain also reaches into the receptor binding site (RBS and interacts with residues that contact sialoglycan receptors and determine HA receptor specificity. The 1F1 epitope is remarkably similar to the previously described murine HC63 H3 epitope, despite significant sequence differences between H1 and H3 HAs. Both antibodies potently inhibit receptor binding, but only HC63 can block the pH-induced conformational changes in HA that drive membrane fusion. Contacts within the RBS suggested that 1F1 may be sensitive to changes that alter HA receptor binding activity. Affinity assays confirmed that sequence changes that switch the HA to avian receptor specificity affect binding of 1F1 and a mAb possessing a closely related heavy chain, 1I20. To characterize 1F1 cross-reactivity, additional escape mutant selection and site-directed mutagenesis were performed. Residues 190 and 227 in the 1F1 epitope were found to be critical for 1F1 reactivity towards 1918, 1943 and 1977 HAs, as well as for 1I20 reactivity towards the 1918 HA. Therefore, 1F1 heavy-chain interactions with conserved RBS residues likely contribute to its ability to inhibit divergent HAs.
Liu, Qiaoli; Zhou, Junping; Yang, Taowei; Zhang, Xian; Xu, Meijuan; Rao, Zhiming
2018-03-01
Whole-cell catalysis with co-expression of two or more enzymes in a single host as a simple low-cost biosynthesis method has been widely studied and applied but hardly with regulation of multi-enzyme expression. Here we developed an efficient whole-cell catalyst for biosynthesis of L-phenylglycine (L-Phg) from benzoylformic acid through co-expression of leucine dehydrogenase from Bacillus cereus (BcLeuDH) and NAD + -dependent mutant formate dehydrogenase from Candida boidinii (CbFDH A10C ) in Escherichia coli with tunable multi-enzyme-coordinate expression system. By co-expressing one to four copies of CbFDH A10C and optimization of the RBS sequence of BcLeuDH in the expression system, the ratio of BcLeuDH to CbFDH in E. coli BL21/pETDuet-rbs 4 leudh-3fdh A10C was finally regulated to 2:1, which was the optimal one determined by enzyme-catalyzed synthesis. The catalyst activity of E. coli BL21/pETDuet-rbs 4 leudh-3fdh A10C was 28.4 mg L -1 min -1 g -1 dry cell weight for L-Phg production using whole-cell transformation, it's was 3.7 times higher than that of engineered E. coli without enzyme expression regulation. Under optimum conditions (pH 8.0 and 35 °C), 60 g L -1 benzoylformic acid was completely converted to pure chiral L-Phg in 4.5 h with 10 g L -1 dry cells and 50.4 g L -1 ammonium formate, and with enantiomeric excess > 99.9%. This multi-enzyme-coordinate expression system strategy significantly improved L-Phg productivity and demonstrated a novel low-cost method for enantiopure L-Phg production.
International Nuclear Information System (INIS)
Gargiulo, S.; Gramanzini, M.; Anzilotti, S.; Salvatore, M.; Coda, A.R.D.; Panico, M.; Zannetti, A.; Vicidomini, C.; Quarantelli, M.; Pappata, S.; Greco, A.; Brunetti, A.; Vinciguerra, A.; Pignataro, G.; Dolle, F.; Annunziato, L.
2016-01-01
To evaluate the feasibility and sensitivity of 18 F-DPA-714 for the study of microglial activation in the brain and spinal cord of transgenic SOD1 G93A mice using high-resolution PET/CT and to evaluate the Iba1 and TSPO expression with immunohistochemistry. Nine symptomatic SOD1 G93A mice (aged 117 ± 12.7 days, clinical score range 1 - 4) and five WT SOD1 control mice (aged 108 ± 28.5 days) underwent 18 F-DPA-714 PET/CT. SUV ratios were calculated by normalizing the cerebellar (rCRB), brainstem (rBS), motor cortex (rMCX) and cervical spinal cord (rCSC) activities to that of the frontal association cortex. Two WT SOD1 and six symptomatic SOD1 G93A mice were studied by immunohistochemistry. In the symptomatic SOD1 G93A mice, rCRB, rBS and rCSC were increased as compared to the values in WT SOD1 mice, with a statistically significantly difference in rBS (2.340 ± 0.784 vs 1.576 ± 0.287, p = 0.014). Immunofluorescence studies showed that TSPO expression was increased in the trigeminal, facial, ambiguus and hypoglossal nuclei, as well as in the spinal cord, of symptomatic SOD1 G93A mice and was colocalized with increased Iba1 staining. Increased 18 F-DPA-714 uptake can be detected with high-resolution PET/CT in the brainstem of transgenic SOD1 G93A mice, a region known to be a site of degeneration and increased microglial activation in amyotrophic lateral sclerosis, in agreement with increased TSPO expression in the brainstem nuclei shown by immunostaining. Therefore, 18 F-DPA-714 PET/CT might be a suitable tool to evaluate microglial activation in the SOD1 G93A mouse model. (orig.)
Oxide growth on aluminium alloys in the presence of ammonium fluoborate
Energy Technology Data Exchange (ETDEWEB)
Oliver, J; Paterson, P; Flavell, T [Royal Melbourne Inst. of Tech., VIC (Australia); Biddle, G [Alcoa Rolled Products (Australia)
1997-12-31
The aim of this study as to determine the mechanisms involved in using ammonium fluoborate as a reducing atmosphere when preheating a high magnesium content aluminium alloy. Rutherford Backscattering (RBS) has been the major technique used in the analysis of samples, it revealed significant reduction in both the diffusion of magnesium to the surface and the calculated oxide thickness in the presence of NH{sub 4}BF{sub 4}. At temperatures above 500 deg C in air, SEM images revealed depressions and voids due to incipient melting at various stages, around the grain boundaries. Grain boundaries effectively acted as pipes aiding the diffusion of magnesium to the surface. These results have been verified through compositional analysis with both RBS and auger electron spectroscopy (AES). Results from NH{sub 4}BF{sub 4} atmosphere preheat conditions showed significant improvements. It was verified experimentally that above 500 deg C , AA5182 alloys undergo incipient melting at the grain boundaries with magnesium diffusing through to the surface. 5 refs., 1 fig.
Impurities and Electronic Property Variations of Natural MoS 2 Crystal Surfaces
Addou, Rafik; McDonnell, Stephen; Barrera, Diego; Guo, Zaibing; Azcatl, Angelica; Wang, Jian; Zhu, Hui; Hinkle, Christopher L.; Quevedo-Lopez, Manuel; Alshareef, Husam N.; Colombo, Luigi; Hsu, Julia W P; Wallace, Robert M.
2015-01-01
Room temperature X-ray photoelectron spectroscopy (XPS), inductively coupled plasma mass spectrometry (ICPMS), high resolution Rutherford backscattering spectrometry (HR-RBS), Kelvin probe method, and scanning tunneling microscopy (STM) are employed to study the properties of a freshly exfoliated surface of geological MoS2 crystals. Our findings reveal that the semiconductor 2H-MoS2 exhibits both n- and p-type behavior, and the work function as measured by the Kelvin probe is found to vary from 4.4 to 5.3 eV. The presence of impurities in parts-per-million (ppm) and a surface defect density of up to 8% of the total area could explain the variation of the Fermi level position. High resolution RBS data also show a large variation in the MoSx composition (1.8 < x < 2.05) at the surface. Thus, the variation in the conductivity, the work function, and stoichiometry across small areas of MoS2 will have to be controlled during crystal growth in order to provide high quality uniform materials for future device fabrication. © 2015 American Chemical Society.
Electrical and structural characterization of as-grown and annealed hydrothermal bulk ZnO
International Nuclear Information System (INIS)
Kassier, G. H.; Hayes, M.; Auret, F. D.; Mamor, M.; Bouziane, K.
2007-01-01
Hall effect measurements in the range 20-370 K on as-grown and annealed hydrothermal bulk ZnO have been performed. The bulk conductivity in the highly resistive as-grown sample was found to decrease and then increase after annealing at 550 deg. C and 930 deg. C, respectively. The conduction in the as-grown material is attributed to a deep donor which is replaced by a much shallower donor after annealing at 930 deg. C. Annealing at both temperatures also produced strong surface conduction effects. Nondegenerate low-mobility surface conduction dominated the electrical properties of the sample annealed at 550 deg. C, while a degenerate surface channel was formed after annealing at 930 deg. C. In addition, Rutherford backscattering and channeling spectrometry (RBS/C) was used to assess the effect of annealing on the crystalline quality of the samples. RBS/C measurements reveal that annealing at 930 deg. C leads to significant improvement of the crystalline quality of the material, while annealing at 550 deg. C results in the segregation of a nonchanneling impurity at the surface
International Nuclear Information System (INIS)
Prakash, Jai; Tripathi, Jalaj; Tripathi, A; Kumar, P; Asokan, K; Avasthi, D K; Rigato, V; Pivin, J C; Chae, Keun Hwa; Gautam, Sanjeev
2011-01-01
We report on synthesis of spherical Au nanoparticles at the surface and embedded in carbonaceous matrix by 150 keV Ar ion irradiation of thin Au film on polyethyleneterepthlate (PET). The pristine and irradiated samples are characterized by Rutherford backscattering spectrometry (RBS), atomic force microscopy, scanning electron microscopy and transmission electron microscopy (TEM) techniques. RBS spectra reveal the sputtering of Au film and interface mixing, increasing with increasing fluence. Surface morphology shows that at the fluence of 5 x 10 15 ions cm -2 , dewetting of thin Au film begins and partially connected nanostructures are formed whereas, at the higher fluence of 5 x 10 16 ions cm -2 , isolated spherical Au nanoparticles (45 ± 20 nm) are formed at the surface. Cross-sectional TEM observations also evidence the Au nanoparticles at the surface and mixed metal-polymer region indicating the formation of nanocomposites with small Au nanoparticles. The results are explained by the crater formation, sputtering followed by dewetting of the thin Au film and interdiffusion at the interface, through molten zones due to thermal spike induced by Ar ions.
Directory of Open Access Journals (Sweden)
Petra van der Lelij
2010-01-01
Full Text Available Fanconi anemia (FA is a recessively inherited disease characterized by multiple symptoms including growth retardation, skeletal abnormalities, and bone marrow failure. The FA diagnosis is complicated due to the fact that the clinical manifestations are both diverse and variable. A chromosomal breakage test using a DNA cross-linking agent, in which cells from an FA patient typically exhibit an extraordinarily sensitive response, has been considered the gold standard for the ultimate diagnosis of FA. In the majority of FA patients the test results are unambiguous, although in some cases the presence of hematopoietic mosaicism may complicate interpretation of the data. However, some diagnostic overlap with other syndromes has previously been noted in cases with Nijmegen breakage syndrome. Here we present results showing that misdiagnosis may also occur with patients suffering from two of the three currently known cohesinopathies, that is, Roberts syndrome (RBS and Warsaw breakage syndrome (WABS. This complication may be avoided by scoring metaphase chromosomes—in addition to chromosomal breakage—for spontaneously occurring premature centromere division, which is characteristic for RBS and WABS, but not for FA.
The Effect of Ag and Ag+N Ion Implantation on Cell Attachment Properties
International Nuclear Information System (INIS)
Urkac, Emel Sokullu; Oztarhan, Ahmet; Gurhan, Ismet Deliloglu; Iz, Sultan Gulce; Tihminlioglu, Funda; Oks, Efim; Nikolaev, Alexey; Ila, Daryush
2009-01-01
Implanted biomedical prosthetic devices are intended to perform safely, reliably and effectively in the human body thus the materials used for orthopedic devices should have good biocompatibility. Ultra High Molecular Weight Poly Ethylene (UHMWPE) has been commonly used for total hip joint replacement because of its very good properties. In this work, UHMWPE samples were Ag and Ag+N ion implanted by using the Metal-Vapor Vacuum Arc (MEVVA) ion implantation technique. Samples were implanted with a fluency of 1017 ion/cm2 and extraction voltage of 30 kV. Rutherford Backscattering Spectrometry (RBS) was used for surface studies. RBS showed the presence of Ag and N on the surface. Cell attachment properties investigated with model cell lines (L929 mouse fibroblasts) to demonstrate that the effect of Ag and Ag+N ion implantation can favorably influence the surface of UHMWPE for biomedical applications. Scanning electron microscopy (SEM) was used to demonstrate the cell attachment on the surface. Study has shown that Ag+N ion implantation represents more effective cell attachment properties on the UHMWPE surfaces.
Synthesis and analysis of gold nanoclusters on silicon substrates by ion beams
International Nuclear Information System (INIS)
Sood, D.K.; Venkatachalam, D.K.; Bhargava, S.K.; Evans, P.J.
2005-01-01
To facilitate the growth of silica nanowires on silicon substrates, two different seeding techniques: 1) ion implantation and 2) chemical deposition of as-synthesised gold colloids have been compared for the formation of catalysing gold nanoclusters. The prepared substrates of both types were analysed using Rutherford backscattering spectrometry at ANSTO to determine the amount of gold and its depth distribution. The topography of the substrates deposited with chemically synthesised gold nanoparticles were studied under SEM. The preliminary ion beam (RBS) analysis has shown ion implantation as a novel technique for seeding Au nanoclusters on silicon substrates facilitating growth of nanowires. This method holds a great potential for using any metal across the periodic table that can act as catalysing seed nanoclusters for nanowire growth. The use of chemical deposition as a seeding technique to deposit as-synthesised gold nanoparticles requires further investigations. RBS results show significant difference in the depth distribution of the gold nanoparticles on silicon substrates seeded by two different techniques. (author). 6 refs., 4 figs
Oxide growth on aluminium alloys in the presence of ammonium fluoborate
Energy Technology Data Exchange (ETDEWEB)
Oliver, J.; Paterson, P.; Flavell, T. [Royal Melbourne Inst. of Tech., VIC (Australia); Biddle, G. [Alcoa Rolled Products (Australia)
1996-12-31
The aim of this study as to determine the mechanisms involved in using ammonium fluoborate as a reducing atmosphere when preheating a high magnesium content aluminium alloy. Rutherford Backscattering (RBS) has been the major technique used in the analysis of samples, it revealed significant reduction in both the diffusion of magnesium to the surface and the calculated oxide thickness in the presence of NH{sub 4}BF{sub 4}. At temperatures above 500 deg C in air, SEM images revealed depressions and voids due to incipient melting at various stages, around the grain boundaries. Grain boundaries effectively acted as pipes aiding the diffusion of magnesium to the surface. These results have been verified through compositional analysis with both RBS and auger electron spectroscopy (AES). Results from NH{sub 4}BF{sub 4} atmosphere preheat conditions showed significant improvements. It was verified experimentally that above 500 deg C , AA5182 alloys undergo incipient melting at the grain boundaries with magnesium diffusing through to the surface. 5 refs., 1 fig.
Phase formation and texture of thin nickel germanides on Ge(001) and Ge(111)
Energy Technology Data Exchange (ETDEWEB)
De Schutter, B., E-mail: deschutter.bob@ugent.be; Detavernier, C. [Department of Solid-State Sciences, Ghent University, Krijgslaan 281/S1, 9000 Ghent (Belgium); Van Stiphout, K.; Santos, N. M.; Vantomme, A. [Instituut voor Kern- en Stralingsfysica, KU Leuven, Celestijnenlaan 200 D, B-3001 Leuven (Belgium); Bladt, E.; Bals, S. [Electron Microscopy for Materials Research (EMAT), University of Antwerp, Groenenborgerlaan 171, B-2020 Antwerp (Belgium); Jordan-Sweet, J.; Lavoie, C. [IBM T.J. Watson Research Center, Yorktown Heights, New York 10598 (United States); Comrie, C. M. [Department of Physics, University of Cape Town, Rondebosch 7700 (South Africa)
2016-04-07
We studied the solid-phase reaction between a thin Ni film and a single crystal Ge(001) or Ge(111) substrate during a ramp anneal. The phase formation sequence was determined using in situ X-ray diffraction and in situ Rutherford backscattering spectrometry (RBS), while the nature and the texture of the phases were studied using X-ray pole figures and transmission electron microscopy. The phase sequence is characterized by the formation of a single transient phase before NiGe forms as the final and stable phase. X-ray pole figures were used to unambiguously identify the transient phase as the ϵ-phase, a non-stoichiometric Ni-rich germanide with a hexagonal crystal structure that can exist for Ge concentrations between 34% and 48% and which forms with a different epitaxial texture on both substrate orientations. The complementary information gained from both RBS and X-ray pole figure measurements revealed a simultaneous growth of both the ϵ-phase and NiGe over a small temperature window on both substrate orientations.
Influence of culture media on the physical and chemical properties of Ag-TiCN coatings
Carvalho, I.; Escobar Galindo, R.; Henriques, M.; Palacio, C.; Carvalho, S.
2014-08-01
The aim of this study was to verify the possible physical and chemical changes that may occur on the surface of Ag-TiCN coatings after exposure to the culture media used in microbiological and cytotoxic assays, respectively tryptic soy broth (TSB) and Dulbecco's modified eagle's medium (DMEM). After sample immersion for 24 h in the media, analyses were performed by glow discharge optical emission spectroscopy discharge radiation (GDOES), Rutherford backscattering spectroscopy (RBS) and x-ray photoelectron spectroscopy (XPS). The results of GDOES profile, RBS and XPS spectra, of samples immersed in TSB, demonstrated the formation of a thin layer of carbon, oxygen and nitrogen that could be due to the presence of proteins in TSB. After 24 h of immersion in DMEM, the results showed the formation of a thin layer of calcium phosphates on the surface, since the coatings displayed a highly oxidized surface in which calcium and phosphorus were detected. All these results suggested that the formation of a layer on the coating surface prevented the release of silver ions in concentrations that allow antibacterial activity.
Ortega-Feliu, I.; Ager, F. J.; Roldán, C.; Ferretti, M.; Juanes, D.; Scrivano, S.; Respaldiza, M. A.; Ferrazza, L.; Traver, I.; Grilli, M. L.
2017-09-01
This work presents a detailed study of a series of silver plates gilded via electroplating techniques in which the characteristics of the coating gold layers are investigated as a function of the electroplating variables (voltage, time, anode surface and temperature). Some reference samples were coated by radio frequency sputtering in order to compare gold layer homogeneity and effective density. Surface analysis was performed by means of atomic and nuclear techniques (SEM-EDX, EDXRF, PIXE and RBS) to obtain information about thickness, homogeneity, effective density, profile concentration of the gold layers and Au-Ag diffusion profiles. The gold layer thickness obtained by PIXE and EDXRF is consistent with the thickness obtained by means of RBS depth profiling. Electroplated gold mass thickness increases with electroplating time, anode area and voltage. However, electrodeposited samples present rough interfaces and gold layer effective densities lower than the nominal density of Au (19.3 g/cm3), whereas sputtering produces uniform layers with nominal density. These analyses provide valuable information to historians and curators and can help the restoration process of gold-plated silver objects.
Impurities and Electronic Property Variations of Natural MoS 2 Crystal Surfaces
Addou, Rafik
2015-09-22
Room temperature X-ray photoelectron spectroscopy (XPS), inductively coupled plasma mass spectrometry (ICPMS), high resolution Rutherford backscattering spectrometry (HR-RBS), Kelvin probe method, and scanning tunneling microscopy (STM) are employed to study the properties of a freshly exfoliated surface of geological MoS2 crystals. Our findings reveal that the semiconductor 2H-MoS2 exhibits both n- and p-type behavior, and the work function as measured by the Kelvin probe is found to vary from 4.4 to 5.3 eV. The presence of impurities in parts-per-million (ppm) and a surface defect density of up to 8% of the total area could explain the variation of the Fermi level position. High resolution RBS data also show a large variation in the MoSx composition (1.8 < x < 2.05) at the surface. Thus, the variation in the conductivity, the work function, and stoichiometry across small areas of MoS2 will have to be controlled during crystal growth in order to provide high quality uniform materials for future device fabrication. © 2015 American Chemical Society.
International Nuclear Information System (INIS)
Lin Chenglu; Hemment, P.L.F.; Li Jinhua; Zou Shichang
1994-01-01
Aluminium films with a thickness of 7000 A (containing 0.85% copper) were deposited on silicon substrates. 400 keV N 2 + or 350 keV N + ions were implanted into the aluminium films or at the interface between the aluminium and silicon, respectively. Automatic spreading resistance (ASR), Fourier transform infrared spectroscopy (FTIR) and Rutherford backscattering (RBS) and channelling were used to characterize the formation of aluminium nitride and the depth distribution of the Cu impurity in the aluminium films after ion implantation and post-annealing. The formation of a stoichiometric AlN layer with high resistance was evident from ASR, RBS analysis and FTIR measurements by the presence of the absorption band at 650 cm -1 . When the implanted nitrogen is near the interface between the aluminium and silicon, a multilayer structure can be obtained, which consists of aluminium, aluminium nitride and the silicon substrate. Cu, which is a background impurity in the deposited aluminium films, segregated into the synthesised aluminium nitride during high dose nitrogen ion implantation. This is due to irradiation-induced segregation during ion implantation. (orig.)
Growth of GaSb1-xBix by molecular beam epitaxy
DEFF Research Database (Denmark)
Song, Yuxin; Wang, Shumin; Roy, Ivy Saha
2012-01-01
Molecular beam epitaxy for GaSb1-xBix is investigated in this article. The growth window for incorporation of Bi in GaSb was found. Strategies of avoiding formation of Bi droplets and enhancing Bi incorporation were studied. The Bi incorporation was confirmed by SIMS and RBS measurements. The Bi ......As substrates were compared and no apparent difference for Bi incorporation was found.......Molecular beam epitaxy for GaSb1-xBix is investigated in this article. The growth window for incorporation of Bi in GaSb was found. Strategies of avoiding formation of Bi droplets and enhancing Bi incorporation were studied. The Bi incorporation was confirmed by SIMS and RBS measurements. The Bi...... concentration in the samples was found to increase with increasing growth temperature and Bi flux. The position of GaSb1-xBix layer peak in XRD rocking curves is found to be correlated to Bi composition. Surface and structural properties of the samples were also investigated. Samples grown on GaSb and Ga...
Lattice damage induced by Tb-implanted AlN crystalline films
International Nuclear Information System (INIS)
Lu Fei; Hu Hui; Rizzi, A.
2002-01-01
AlN films with thickness from 100 to 1000 nm were grown on SiC substrate by MBE. AlN crystalline films were doped by implantation with 160 keV Tb ions to fluences of 5x10 14 , 1.5x10 15 , 3x10 15 and 6x10 15 ions/cm 2 , respectively. The damage profiles in AlN films induced by Tb implantation were investigated using RBS/channeling technique. A procedure developed by Feldman and Rodgers was used to extract damage profile by considering the dechanneling mechanism of multiple. The comparison of the extracted profile with TRIM prediction shows a significant difference in the shape and in the position of damage profile. The damage profile in AlN film is similar as Tb distribution. The RBS/channeling of Tb-implanted AlN film before and after 950 deg. C annealing treatments show a good consistency, which indicate that high temperature annealing cannot result in a significant change in both crystal damage and in Tb distribution
Sorção e mobilidade do lítio em solos de áreas de disposição final de resíduos sólidos urbanos
Directory of Open Access Journals (Sweden)
Luiz Fernando Coutinho de Oliveira
2013-06-01
Full Text Available Um dos grandes problemas da atualidade é a disposição inadequada dos resíduos sólidos urbanos no solo, e seus efeitos recaem, principalmente, na contaminação das águas e do solo. Este trabalho objetivou o estudo da sorção e da mobilidade do Lítio nos solos das áreas de disposição de resíduos sólidos urbanos dos municípios de Lavras, Campo Belo e Pouso Alegre, MG. A partir dos ensaios de sorção em batelada e mobilidade do Li em colunas de solo, ajustaram-se os parâmetros das isotermas de Freundlich e da equação de transporte de solutos no solo. Pelos resultados obtidos verificou-se que, dentre os solos avaliados, o do município de Lavras foi o que apresentou a maior mobilidade do Li seguido dos solos de Pouso Alegre e Campo Belo, sendo, portanto, mais vulnerável à contaminação das águas subterrâneas.
Encapsulamento do Dióxido de Titânio (TiO2 pela Técnica de Polimerização em Emulsão
Directory of Open Access Journals (Sweden)
Oliveira Adriano M.
2002-01-01
Full Text Available Este trabalho apresenta uma metodologia de encapsulamento do TiO2 pela técnica de polimerização em emulsão. O pigmento foi previamente modificado por um titanato em heptano. O titanato usado foi o tri-isoestearato iso-propoxi de titânio, que reage com os grupos hidroxilas da superfície do TiO2. O pigmento modificado foi encapsulado por metacrilato de metila (MMA, usando persulfato de amônio como iniciador e dodecil sulfato de sódio (SDS como emulsificante. A reação de encapsulamento foi conduzida em um reator de vidro encamisado, utilizando dois processos de polimerização diferentes: batelada e semi-contínuo. A caracterização do pigmento modificado foi feita pela técnica de Infravermelho com Transformada de Fourier (FTIR. Os rendimentos das reações de modificação e de encapsulamento foram determinados pela técnica de Análise Termogravimétrica (TGA.
Czech Academy of Sciences Publication Activity Database
Mikšová, Romana; Macková, Anna; Malinský, Petr
2017-01-01
Roč. 406, SEP (2017), s. 179-184 ISSN 0168-583X R&D Projects: GA MŠk LM2015056; GA ČR GA15-01602S Institutional support: RVO:61389005 Keywords : energy -loss measurement * SOI material * RBS-channelling Subject RIV: BG - Nuclear , Atomic and Molecular Physics, Colliders OBOR OECD: Nuclear physics Impact factor: 1.109, year: 2016
Studies of PMMA sintering foils with and without coating by magnetron sputtering Pd
Czech Academy of Sciences Publication Activity Database
Cutroneo, Mariapompea; Macková, Anna; Torrisi, L.; Vad, K.; Csik, A.; Ando, L.; Švecová, B.
2017-01-01
Roč. 406, SEP (2017), s. 42-47 ISSN 0168-583X R&D Projects: GA MŠk LM2015056; GA ČR(CZ) GBP108/12/G108 Institutional support: RVO:61389005 Keywords : opaque PMMA * beads * RBS Subject RIV: BG - Nuclear, Atomic and Molecular Physics, Colliders OBOR OECD: Nuclear physics Impact factor: 1.109, year: 2016
Pramana – Journal of Physics | Indian Academy of Sciences
Indian Academy of Sciences (India)
The folded tandem ion accelerator (FOTIA) project at BARC has been commissioned. The analysed carbon beams of 40 nA(3+) and 25 nA(4+), at terminal voltage of 2.5 MV with N2 + CO2 as insulating gas, were obtained. The beams were characterized by performing the Rutherford back scattering (RBS) on gold, tin and ...
International Nuclear Information System (INIS)
Mendez, U.; Tenorio C, D.; Ruvalcaba, J.L.; Lopez, J.A.
2005-01-01
The main objective of this investigation was to determine the composition and microstructure of 13 metallic devices by means of the nuclear techniques of PIXE, RBS and conventional; which were elaborated starting from copper and gold, and they were in the offering of a tarasc personage located in the 'Matamoros' porch in Uruapan, Michoacan, Mexico. (Author)
A study of the degradation of polymers irradiated by Cn+ and On+ 9.6 MeV heavy ions
Czech Academy of Sciences Publication Activity Database
Mikšová, Romana; Macková, Anna; Malinský, Petr; Slepička, P.; Švorčík, V.
2015-01-01
Roč. 122, DEC (2015), s. 110-121 ISSN 0141-3910 R&D Projects: GA MŠk LM2011019; GA ČR GA15-01602S Institutional support: RVO:61389005 Keywords : energy loss * heavy ions * polymers * RBS/ERDA methods * AFM method Subject RIV: BG - Nuclear, Atomic and Molecular Physics, Colliders Impact factor: 3.120, year: 2015
Characterisation of PEEK, PET and PI implanted with 80 keV Fe+ ions to high fluencies
Czech Academy of Sciences Publication Activity Database
Macková, Anna; Malinský, Petr; Mikšová, Romana; Hnatowicz, Vladimír; Khaibullin, R. I.; Slepička, P.; Švorčík, V.
2014-01-01
Roč. 331, JUL (2014), s. 176-181 ISSN 0168-583X R&D Projects: GA ČR GA106/09/0125; GA MŠk(XE) LM2011019 Institutional support: RVO:61389005 Keywords : Fe ion implantation * polymers * depth profiles * RBS * TEM * UV Vis Subject RIV: BG - Nuclear, Atomic and Molecular Physics, Colliders Impact factor: 1.124, year: 2014
Study of oxide facing at silicone detectors of ionization detectors
International Nuclear Information System (INIS)
Kopestansky, J.; Tykva, R.
1999-01-01
Formation of oxide facing on silicone in discrete phases of technological preparation of detectors and interaction of gold (aluminium) steamed with SiO x layer were studied. The homogeneity of Au and Si) x layers and interface Au-SiO x and SiO x -Si were examined. The methods SIMS, and partially XPS, AES and RBS were used
Comparison of estimated and experimental subaqueous seed transport.
Scott Markwith; David Leigh
2011-01-01
We compare the estimates from the relative bed stability (RBS) equation that indicates incipient bed movement, and the inertial settling (âImpactâ) law and Wu and Wang (2006) settling velocity equations that indicate suspended particle movement, to flume and settling velocity observations to confirm the utility of the equations for subaqueous hydrochory analyses, and...
Lattice location of helium in uranium dioxide single crystals
Energy Technology Data Exchange (ETDEWEB)
Garrido, F.; Nowicki, L. E-mail: lech.nowicki@fuw.edu.pl; Sattonnay, G.; Sauvage, T.; Thome, L
2004-06-01
Lattice location of {sup 3}He atoms implanted into UO{sub 2} single crystals was performed by means of the channeling technique combined with nuclear reaction analysis (NRA) and Rutherford backscattering spectrometry (RBS). The {sup 3}He(d,p){sup 4}He reaction was used. The experimental angular scans show that helium atoms occupy octahedral interstitial positions.
Characterisation of Ni+ implanted PEEK, PET and PI
Czech Academy of Sciences Publication Activity Database
Macková, Anna; Bočan, Jiří; Khaibulline, R.; Valeev, V. F.; Slepička, P.; Sajdl, P.; Švorčík, V.
2009-01-01
Roč. 267, - (2009), s. 1549-1552 ISSN 0168-583X R&D Projects: GA MŠk(CZ) LC06041; GA AV ČR(CZ) KJB100480601 Institutional research plan: CEZ:AV0Z10480505 Keywords : Ion implantation * Polymers * TRIDYN * RBS * XPS * Depth profiles Subject RIV: BG - Nuclear, Atomic and Molecular Physics, Colliders Impact factor: 1.156, year: 2009
Conference on instrumental activation analysis IAA 92
International Nuclear Information System (INIS)
Frana, J.; Obrusnik, I.
1992-05-01
The publication contains 26 abstracts primarily concerned with neutron activation analysis, although other analytical techniques based on X-ray fluorescence analysis, PIXE, PIGE, RBS are also included. Some contributions deal with aspects of quality practice and assurance in radioanalytical laboratories, with marketing of instrumental neutron activation analysis services, with hard- and software aspects of radiation detection, etc. (Z.S.)
Elastic recoil detection analysis (ERDA) in hydrogenated samples for TNSA laser irradiation
Czech Academy of Sciences Publication Activity Database
Torrisi, L.; Cutroneo, Mariapompea
2016-01-01
Roč. 48, č. 1 (2016), s. 10-16 ISSN 0142-2421 R&D Projects: GA MŠk(CZ) LM2011019; GA ČR(CZ) GBP108/12/G108 Institutional support: RVO:61389005 Keywords : ERDA * RBS * TNSA * hydrogen and deuterium * proton acceleration Subject RIV: BG - Nuclear, Atomic and Molecular Physics, Colliders Impact factor: 1.132, year: 2016
Thickness and composition of ultrathin SiO2 layers on Si
International Nuclear Information System (INIS)
Marel, C. van der; Verheijen, M.A.; Tamminga, Y.; Pijnenburg, R.H.W.; Tombros, N.; Cubaynes, F.
2004-01-01
Ultrathin SiO 2 layers are of importance for the semiconductor industry. One of the techniques that can be used to determine the chemical composition and thickness of this type of layers is x-ray photoelectron spectroscopy (XPS). As shown by Seah and Spencer [Surf. Interface Anal. 33, 640 (2002)], it is not trivial to characterize this type of layer by means of XPS in a reliable way. We have investigated a series of ultrathin layers of SiO 2 on Si (in the range from 0.3 to 3 nm) using XPS. The samples were also analyzed by means of transmission electron microscopy (TEM), Rutherford backscattering (RBS), and ellipsometry. The thickness of the SiO 2 layers (d) was determined from the XPS results using three different approaches: the 'standard' equation (Seah and Spencer) for d, an overlayer-substrate model calculation, and the QUASES-Tougaard [Surf. Interface Anal. 26, 249 (1998), QUASES-Tougaard: Software package for Quantitative Analysis of Surfaces by Electron Spectroscopy, version 4.4 (2000); http://www.quases.com] method. Good agreement was obtained between the results of XPS analyses using the 'standard' equation, the overlayer-substrate model calculation, and RBS results. The QUASES-Tougaard results were approximately 62% above the other XPS results. The optical values for the thickness were always slightly higher than the thickness according to XPS or RBS. Using the model calculation, these (relatively small) deviations from the optical results could be explained as being a consequence of surface contaminations with hydrocarbons. For a thickness above 2.5 nm, the TEM results were in good agreement with the results obtained from the other techniques (apart from QUASES-Tougaard). Below 2.5 nm, significant deviations were found between RBS, XPS, and optical data on the one hand and TEM results on the other hand; the deviations became larger as the thickness of the SiO 2 decreased. This effect may be related to interface states of oxygen, which have been
Irradiation performance of experimental fast reactor 'JOYO' MK-1 driver fuel assemblies
International Nuclear Information System (INIS)
Itaki, Toshiyuki; Kono, Keiichi; Tachi, Hirokatsu; Yamanouchi, Sadamu; Yuhara, Shunichi; Shibahara, Itaru
1985-01-01
The experimental fast reactor ''JOYO'' completed it's breeder core (MK-I) operation in January 1982. The MK-I driver fuel assemblies were removed from the core sequencially in order of burnup increase and have been under postirradiation examination (PIE). The PIE has almost been completed for 30 assemblies including the highest burnup assemblies of 48,000 MWD/MTM. It has been confirmed that all fuel assemblies have exhibited satisfactory performance without detrimental assembly deformation or without any indications of fuel pin breach. The irradiation conditions of the MK-I core were somewhat more moderate than those conditions envisioned for prototypic reactor. However the results of the examination revealed the typical irradiation behavior of LMFBR fuels, although such characteristics were benign as compared with those anticipated in high burnup fuels. Systematic performance data have been accumulated through the fuel fabrication, irradiation and postirradiation examination processes. Based on these data, the MK-I fuel designing and fabrication techniques were totally confirmed. This technical experience and the associated insight into irradiation behavior have established a milestone to the next step of fast reactor fuel development. (author)
Influence of static magnetic fields on S. cerevisae biomass growth
Directory of Open Access Journals (Sweden)
João B. Muniz
2007-05-01
Full Text Available Biomass growth of Saccharomyces cerevisiae DAUFPE-1012 was studied in eight batch fermentations exposed to steady magnetic fields (SMF running at 23ºC (± 1ºC, for 24 h in a double cylindrical tube reactor with synchronic agitation. For every batch, one tube was exposed to 220mT flow intensity SMF, produced by NdFeB rod magnets attached diametrically opposed (N to S magnets on one tube. In the other tube, without magnets, the fermentation occurred in the same conditions. The biomass growth in culture (yeast extract + glucose 2% was monitored by spectrometry to obtain the absorbance and later, the corresponding cell dry weight. The culture glucose concentration was monitored every two hours so as the pH, which was maintained between 4 and 5. As a result, the biomass (g/L increment was 2.5 times greater in magnetized cultures (n=8 as compared with SMF non-exposed cultures (n=8. The differential (SMF-control biomass growth rate (135% was slightly higher than the glucose consumption rate (130 % leading to increased biomass production of the magnetized cells.O crescimento da biomassa da Saccharomyces cerevisiae DAUFPE-1012 foi estudado em oito bateladas de fermentação, cada uma exposta aos campos magnéticos contínuos (CMC, à 23ºC (± 1ºC, durante um período de 24 horas em um reator duplo com agitação sincrônica. Em cada batelada,um tubo foi exposto ao CMC, com 220mT de intensidade de fluxo, produzidos por imãs de NdFeB fixados diametralmente opostos (N para S em um tubo do reator de fermentação. Em outro tubo, sem imãs, a fermentação ocorreu nas mesmas condições. O crescimento da biomassa nas culturas (extrato de fermento + glicose 2% foi monitorado através de espectrometria e correlacionado ao peso seco de levedura. A concentração de glicose nas culturas foi monitorada a cada duas horas e o pH foi mantido entre 4 e 5. Como resultado, a biomassa (g/L aumentou 2,5 vezes nas culturas magnetizadas (n=8 quando comparadas com as
Simulation of RBS spectra with known 3D sample surface roughness
Czech Academy of Sciences Publication Activity Database
Malinský, Petr; Siegel, J.; Hnatowicz, Vladimír; Macková, Anna; Švorčík, V.
2017-01-01
Roč. 406, SEP (2017), s. 99-103 ISSN 0168-583X R&D Projects: GA MŠk LM2015056; GA ČR(CZ) GBP108/12/G108 Institutional support: RVO:61389005 Keywords : computer simulation * surface roughness * AFM Subject RIV: BG - Nuclear, Atomic and Molecular Physics, Colliders OBOR OECD: Nuclear physics Impact factor: 1.109, year: 2016
2012-06-01
and free transportation if they ordered full truckloads of pasta , and sales representatives earned larger salaries and commissions based on the...Requirements Based Load Plan IUID Item Unique Identification JDDOC Joint Deployment And Distribution Operations Center JIT Just In Time JITD Just...Information System RBS Readiness Based Sparing RFID Radio Frequency Identification SCM Supply Chain Management SLCM Submarine Launched Cruise Missile
Characterization of thin films and surfaces by ion-beam analytical techniques
International Nuclear Information System (INIS)
Pelicon, P.; Budnar, M.; Zorko, B.; Razpet, A.
1999-01-01
The optimization of Rutherford Backscattering Spectroscopy (RBS) and Elastic Recoil Detection Analysis (ERDA) at the tandetron facility of J. Stefan Inst.e is reported. The most recent applications of these techniques for the analysis of thin films and surfaces are presented. The construction of the isotope - resolved Time-Of-Flight ERDA telescope for depth profiling of light elements is reviewed.(author)
Preparation and characterization of tempered tungsten layers on single crystalline silicon
International Nuclear Information System (INIS)
Nitzsche, K.; Knedlik, C.; Tippmann, H.; Spiess, L.; Harman, R.; Vanek, O.; Tvarozek, V.
1984-01-01
Tungsten layers have been deposited on single crystalline silicon by sputtering and characterized by measurements of the sheet resistance by a linear four point method and the van der Pauw method. The influence of tempering under argon on the resistance has been studied. By means of the RBS spectroscopy it was found that the increase in the specific resistance is caused by interdiffusion
Chemistry of plasma-polymerized vinyltriethoxysilane controlled by deposition conditions
Czech Academy of Sciences Publication Activity Database
Čech, V.; Zemek, Josef; Peřina, Vratislav
2008-01-01
Roč. 5, č. 8 (2008), s. 745-752 ISSN 1612-8850 Grant - others:GAČR(CZ) GA104/06/0437 Institutional research plan: CEZ:AV0Z10100521; CEZ:AV0Z10480505 Keywords : ESCA/XPS * FTIR * plasma-enhanced chemical vapor deposition (PECVD) * Rutherford back-scattering (RBS) * thin films Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 2.921, year: 2008
Study of Ag and PE interface after plasma treatment
Czech Academy of Sciences Publication Activity Database
Macková, Anna; Malinský, Petr; Bočan, Jiří; Švorčík, V.; Pavlík, J.; Strýhal, Z.; Sajdl, P.
2008-01-01
Roč. 5, č. 4 (2008), s. 964-967 ISSN 1862-6351. [9th International workshop on plasma based ion implantation and deposition. Leipzig, 02.09.2007-06.09.2007] R&D Projects: GA MŠk(CZ) LC06041 Institutional research plan: CEZ:AV0Z10480505 Keywords : RBS and AFM study * metal-polymer interface * plasma treatment Subject RIV: JJ - Other Materials
Czech Academy of Sciences Publication Activity Database
Němcová, A.; Kuběna, Ivo; Šmíd, Miroslav; Habazaki, H.; Skeldon, P.; Thompson, G.
2016-01-01
Roč. 20, č. 4 (2016), s. 1155-1165 ISSN 1432-8488 R&D Projects: GA MŠk(CZ) ED1.1.00/02.0068 Institutional support: RVO:68081723 Keywords : magnesium * anodizing * anodic film * TEM * RBS Subject RIV: JK - Corrosion ; Surface Treatment of Materials Impact factor: 2.316, year: 2016 http://link.springer.com/article/10.1007/s10008-015-2864-1
Elemental concentration distribution in human fingernails – A 3D study
International Nuclear Information System (INIS)
Pineda-Vargas, C.A.; Mars, J.A.; Gihwala, D.
2012-01-01
The verification of pathologies has normally been based on analysis of blood (serum and plasma), and physiological tissue. Recently, nails and in particular human fingernails have become an important medium for pathological studies, especially those of environmental origin. The analytical technique of PIXE has been used extensively in the analysis of industrial samples and human tissue specimens. The application of the analytical technique to nails has been mainly to bulk samples. In this study we use micro-PIXE and -RBS, as both complementary and supplementary, to determine the elemental concentration distribution of human fingernails of individuals. We report on the 3D quantitative elemental concentration distributions (QECDs) of various elements that include C, N and O as major elements (10–20%), P, S, Cl, K and Ca as minor elements (1–10%) and Fe, Mn, Zn, Ti, Na, Mg, Cu, Ni, Cr, Rb, Br, Sr and Se as trace elements (less than 1%). For PIXE and RBS the specimens were bombarded with a 3 MeV proton beam. To ascertain any correlations in the quantitative elemental concentration distributions, a linear traverse analysis was performed across the width of the nail. Elemental distribution correlations were also obtained.
Directory of Open Access Journals (Sweden)
María de los Ángeles López
2014-01-01
Full Text Available Las infraestructuras tecnológicas dinámicas, entre ellas la computación en nube, representan una nueva alternativa de tecnología de información disponible para administrar las ac- tividades de las organizaciones, en particular en aquellas que hacen un uso intensivo de la información, como las entidades financieras. Al analizar la utilización de estas arquitecturas es fundamental considerar los nuevos riesgos a los que se expo- nen los entes; esto permite desarrollar estrategias de gestión destinadas a identificarlos, evaluarlos y buscar el modo de minimizar sus efectos. En este sentido son útiles herramientas como la risk breakdown structure (RBS, una estructura de je- rarquización de fuentes de riesgos que simplifica y sistematiza el análisis. En este trabajo se pretende diseñar una RBS para la identificación y descripción jerárquica de las fuentes de ries- gos vinculados a la implementación de la computación en nube en entidades financieras, basándose en la normativa del Banco Central de la República Argentina.
Determination of surface oxide compositions on Alloy 600 using Rutherford backscattering
International Nuclear Information System (INIS)
Hanson, A.L.; Kraner, H.W.
1984-01-01
The surface composition of oxides formed on Alloy 600 under conditions similar to those in the primary side of PWR heat exchangers has been studied as a function of potential using Rutherford backscattering and proton inelastic scattering. Electropolished samples of Alloy 600 were exposed at several potentials to a solution of 0.18M H 3 BO 3 (2000ppm B) with 0.21mM LiOH (1.5ppm Li) at 300 0 C for 450 hours. The potentials relative to an internal hydrogen electrode ranged from -.09 to 750 mV. RBS analysis showed little or no oxide formation on samples exposed at 0 mV. Above 0 mV oxide layers formed whose thicknesses increased with potential. In addition the RBS showed a significantly enhanced concentration of aluminum and silicon in oxide. Both the oxygen and the sum of the aluminum and silicon content appeared to maintain a fixed surface concentration independent of the oxide thickness. Boron and lithium concentrations were analyzed with proton inelastic scattering. No lithium was detected in any sample. The boron concentration was found to follow the thickness of the oxide
Determination of surface oxide compositions on Alloy 600 using Rutherford backscattering
International Nuclear Information System (INIS)
Hanson, A.L.; Isaacs, H.S.; Kraner, H.W.
1984-01-01
The surface composition of oxides formed on Alloy 600 under conditions similar to those in the primary side of PWR heat exchangers has been studied as a function of potential using Rutherford backscattering and proton inelastic scattering. Electropolished samples of Alloy 600 were exposed at several potentials to a solution of 0.18M H 3 BO 3 (2000 ppM B) with 0.28M LiOH (1.4 ppM Li) at 300 0 C for 450 hours. The potentials relative to an internal hydrogen electrode ranged from -.09 to 750 mV. RBS analysis showed little or no oxide formation on samples exposed at 0 mV. Above 0 mV oxide layers formed whose thicknesses increased with potential. In addition the RBS showed a significantly enhanced concentration of aluminum and silicon in oxide. Both the oxygen and the sum of the aluminum and silicon content appeared to maintain a fixed surface concentration independent of the oxide thickness. Boron and lithium concentration were analyzed with proton inelastic scattering. No lithium was found in any sample. The boron concentration was found to follow the thickness of the oxide
Search for superconductivity in ion-implanted Pb-Ge films
International Nuclear Information System (INIS)
Zawislak, F.C.; Bernas, H.; Mendoza-Zelis, L.; Travers, A.; Chaumont, J.; Dumoulin, L.
1980-01-01
We have studied the dose and the temperature dependence of the resistivity in thin coevaporated films (500-600 A) of Pbsub(0.3) Gesub(0.7) and Pbsub(0.7) Gesub(0.3) implanted at 6K with up to 2x10 15 Ge/cm 2 of 90 and 140 keV. The composition and uniformity of the films were controlled via in situ Rutherford backscattering (RBS) measurements, as functions of the implanted dose and the annealing temperature. The following results were obtained: a) a sharp Tsub(c) very close to the Tsub(c) of pure Pb was measured for the Pbsub(0.7) Gesub(0.3) film and no change in Tsub(c) was observed as a function of dose; b) for the Pbsub(0.3)Gesub(0.7) film the Tsub(c) decreased from about 6.8K before implantation to about 3.5 K after implantation of 2x10 15 ions/cm 2 ; c) the RBS spectra revealed that the alloy homogeneity was larger implantation at 6 K than before implantation and that precipitation for Pb occured during annealing
Growth and surface characterization of sputter-deposited molybdenum oxide thin films
Energy Technology Data Exchange (ETDEWEB)
Ramana, Chintalapalle V.; Atuchin, Victor V.; Kesler, V. G.; Kochubey, V. A.; Pokrovsky, L. D.; Shutthanandan, V.; Becker, U.; Ewing, Rodney C.
2007-04-15
Molybdenum oxide thin films were produced by magnetron sputtering using a molybdenum (Mo) target. The sputtering was performed in a reactive atmosphere of argon-oxygen gas mixture under varying conditions of substrate temperature (Ts) and oxygen partial pressure (pO2). The effect of Ts and pO2 on the growth and microstructure of molybdenum oxide films was examined in detail using reflection high-energy electron diffraction (RHEED), Rutherford backscattering spectrometry (RBS), energy dispersive X-ray spectrometry (EDS), X-ray photoelectron spectroscopy (XPS), and scanning electron microscopy (SEM) measurements. The analyses indicate that the effect of Ts and pO2 on the microstructure and phase of the grown molybdenum oxide thin films is remarkable. RHEED and RBS results indicate that the films grown at 445 *C under 62.3% O2 pressure were stoichiometric and polycrystalline MoO3. Films grown at lower pO2 were nonstoichiometric MoOx films with the presence of secondary phase. The microstructure of the grown Mo oxide films is discussed and conditions were optimized to produce phase pure, stoichiometric, and highly textured polycrystalline MoO3 films.
In-situ real time measurements of net erosion rates of copper during hydrogen plasma exposure
Kesler, Leigh; Wright, Graham; Peterson, Ethan; Whyte, Dennis
2013-10-01
In order to properly understand the dynamics of net erosion/deposition in fusion reactors, such as tokamaks, a diagnostic measuring the real time rates of net erosion/deposition during plasma exposure is necessary. The DIONISOS experiment produces real time measurements of net erosion/deposition by using Rutherford backscattering spectroscopy (RBS) ion beam analysis simultaneously with plasma exposure from a helicon plasma source. This in-situ method improves on ex-situ weight loss measurements by allowing measurement of possible synergistic effects of high ion implantation rates and net erosion rate and by giving a real time response to changes in plasma parameters. Previous work has validated this new technique for measuring copper (Cu) erosion from helium (He) plasma ion bombardment. This technique is now extended to measure copper erosion due to deuterium and hydrogen plasma ion exposure. Targets used were a 1.5 μm Cu layer on an aluminum substrate. Cu layer thickness is tracked in real time using 1.2 MeV proton RBS. Measured erosion rates will be compared to results from literature and He erosion rates. Supported by US DoE award DE-SC00-02060.
International Nuclear Information System (INIS)
Misra, E.; Wang, Y.; Theodore, N.D.; Alford, T.L.
2004-01-01
The thermal stability and the diffusion barrier properties of DC reactively sputtered tantalum oxynitride (Ta-O-N) thin films, between silver (Ag) and silicon (Si) p + n diodes were investigated. Both materials characterization (X-ray diffraction analysis, Rutherford backscattering spectrometry (RBS), Auger depth profiling) and electrical measurements (reverse-biased junction leakage current-density) were used to evaluate diffusion barrier properties of the thin films. The leakage current density of p + n diodes with the barrier (Ta-O-N) was approximately four orders of magnitude lower than those without barriers after a 30 min, 400 deg. C back contact anneal. The Ta-O-N barriers were stable up to 500 deg. C, 30 min anneals. However, this was not the case for the 600 deg. C anneal. RBS spectra and cross-sectional transmission electron microscopy of as-deposited and vacuum annealed samples of Ag/barrier (Ta-O-N)/Si indicate the absence of any interfacial interaction between the barrier and substrate (silicon). The failure of the Ta-O-N barriers has been attributed to thermally induced stresses, which cause the thin film to crack at elevated temperatures
Formation of iron disilicide on amorphous silicon
Erlesand, U.; Östling, M.; Bodén, K.
1991-11-01
Thin films of iron disilicide, β-FeSi 2 were formed on both amorphous silicon and on crystalline silicon. The β-phase is reported to be semiconducting with a direct band-gap of about 0.85-0.89 eV. This phase is known to form via a nucleation-controlled growth process on crystalline silicon and as a consequence a rather rough silicon/silicide interface is usually formed. In order to improve the interface a bilayer structure of amorphous silicon and iron was sequentially deposited on Czochralski silicon in an e-gun evaporation system. Secondary ion mass spectrometry profiling (SIMS) and scanning electron micrographs revealed an improvement of the interface sharpness. Rutherford backscattering spectrometry (RBS) and X-ray diffractiometry showed β-FeSi 2 formation already at 525°C. It was also observed that the silicide growth was diffusion-controlled, similar to what has been reported for example in the formation of NiSi 2 for the reaction of nickel on amorphous silicon. The kinetics of the FeSi 2 formation in the temperature range 525-625°C was studied by RBS and the activation energy was found to be 1.5 ± 0.1 eV.
Paneta, V.; Fluch, U.; Petersson, P.; Ott, S.; Primetzhofer, D.
2017-08-01
Zirconium-oxide based metal-organic frameworks (MOFs) were grown on p-type Si wafers. A modified linker molecule containing iodine was introduced by post synthetic exchange (PSE). Samples have been studied using Rutherford Backscattering Spectrometry (RBS) and Particle Induced X-ray Emission (PIXE) techniques, employing the 5 MV 15SDH-2 Pelletron Tandem accelerator at the Ångström laboratory. The degree of post synthetic uptake of the iodine-containing linker has been investigated with both a broad beam and a focused beam of carbon and alpha particles targeting different kind of MOF crystals which were of ∼1-10 μm in size, depending on the linker used. Iodine concentrations in MOF crystallites were also measured by Nuclear Magnetic Resonance Spectroscopy (NMR) and are compared to the RBS results. In parallel to the ion beam studies, samples were investigated by Scanning Electron Microscopy (SEM) to quantify possible crystallite clustering, develop optimum sample preparation routines and to characterize the potential ion beam induced sample damage and its dependence on different parameters. Based on these results the reliability and accuracy of ion beam data is assessed.
Energy Technology Data Exchange (ETDEWEB)
Sawa, Kazuhiro; Yoshimuta, Shigeharu; Tobita, Tsutomu; Sato, Masashi [Japan Atomic Energy Research Inst., Oarai, Ibaraki (Japan). Oarai Research Establishment
1997-05-01
The High Temperature Engineering Test Reactor (HTTR) uses coated particles as fuel. During normal operation, short-lived noble gases are mainly released by diffusion from fuel particles with defects in their coating layers (i.e., failed particle). Since noble gases do not plate out on the inner surfaces of primary cooling system, their activities in primary coolant reflect fuel failure fraction in the core. An evaluation method was developed to predict failure fraction of coated fuel particles during normal operation of the HTTR. The method predicts core-average and hot plenum regionwise failure fractions based on the fractional releases, (R/B)s, of noble gases. The (R/B)s are calculated by fission gas concentration measurements in the primary cooling system of the HTTR. Recent fabrication data show that through-coatings failure fraction is extremely low. Then, fractional release from matrix contamination uranium, which is background for accurate evaluation of the fuel failure fraction, should be precisely predicted. This report describes an evaluation method of fuel failure fraction from measurements in the HTTR together with a fission gas release model from fuel compact containing failed particles and matrix contamination uranium. (author)
Bacillus anthracis genome organization in light of whole transcriptome sequencing
Energy Technology Data Exchange (ETDEWEB)
Martin, Jeffrey; Zhu, Wenhan; Passalacqua, Karla D.; Bergman, Nicholas; Borodovsky, Mark
2010-03-22
Emerging knowledge of whole prokaryotic transcriptomes could validate a number of theoretical concepts introduced in the early days of genomics. What are the rules connecting gene expression levels with sequence determinants such as quantitative scores of promoters and terminators? Are translation efficiency measures, e.g. codon adaptation index and RBS score related to gene expression? We used the whole transcriptome shotgun sequencing of a bacterial pathogen Bacillus anthracis to assess correlation of gene expression level with promoter, terminator and RBS scores, codon adaptation index, as well as with a new measure of gene translational efficiency, average translation speed. We compared computational predictions of operon topologies with the transcript borders inferred from RNA-Seq reads. Transcriptome mapping may also improve existing gene annotation. Upon assessment of accuracy of current annotation of protein-coding genes in the B. anthracis genome we have shown that the transcriptome data indicate existence of more than a hundred genes missing in the annotation though predicted by an ab initio gene finder. Interestingly, we observed that many pseudogenes possess not only a sequence with detectable coding potential but also promoters that maintain transcriptional activity.
Study of low energy Si5- and Cs- implantation induced amorphization effects in Si(1 0 0)
International Nuclear Information System (INIS)
Lenka, H P; Joseph, B; Kuiri, P K; Sahu, G; Mahapatra, D P; Mishra, P; Ghose, D
2008-01-01
The damage growth and surface modifications in Si(1 0 0), induced by 25 keV Si 5 - cluster ions, as a function of fluence, φ, has been studied using atomic force microscopy (AFM) and channelling Rutherford backscattering spectrometry (RBS/C). RBS/C results indicate a nonlinear growth in damage from which it has been possible to get a threshold fluence, φ 0 , for amorphization as 2.5 x 10 13 ions cm -2 . For φ below φ 0 , a growth in damage as well as surface roughness has been observed. At a φ of 1 x 10 14 ions cm -2 , damage saturation coupled with a much reduced surface roughness has been found. In this case a power spectrum analysis of AFM data showed a significant drop in spectral density, as compared with the same obtained for a fluence, φ 0 . This drop, together with damage saturation, can be correlated with a transition to a stress relaxed amorphous phase. Irradiation with similar mass Cs - ions, at the same energy and fluence, has been found to result in a reduced accumulation of defects in the near surface region leading to reduced surface features.
International Nuclear Information System (INIS)
Fernandez-Garrido, S.; Pereiro, J.; Munoz, E.; Calleja, E.; Redondo-Cubero, A.; Gago, R.; Bertram, F.; Christen, J.; Luna, E.; Trampert, A.
2008-01-01
Indium incorporation into wurtzite (0001)-oriented In x Al y Ga 1-x-y N layers grown by plasma-assisted molecular beam epitaxy was studied as a function of the growth temperature (565-635 deg. C) and the AlN mole fraction (0.01< y<0.27). The layer stoichiometry was determined by Rutherford backscattering spectrometry (RBS). RBS shows that indium incorporation decreased continuously with increasing growth temperature due to thermally enhanced dissociation of In-N bonds and for increasing AlN mole fractions. High resolution x-ray diffraction and transmission electron microscopy (TEM) measurements did not show evidence of phase separation. The mosaicity of the quaternary layers was found to be mainly determined by the growth temperature and independent on alloy composition within the range studied. However, depending on the AlN mole fraction, nanometer-sized composition fluctuations were detected by TEM. Photoluminescence spectra showed a single broad emission at room temperature, with energy and bandwidth S- and W-shaped temperature dependences typical of exciton localization by alloy inhomogeneities. Cathodoluminescence measurements demonstrated that the alloy inhomogeneities, responsible of exciton localization, occur on a lateral length scale below 150 nm, which is corroborated by TEM
Extended solubility and martensitic hcp nickel formation in antimony implanted nickel
International Nuclear Information System (INIS)
Johnson, E.; Sarholt-Kristensen, L.; Johansen, A.
1982-01-01
Radiation damage microstructure and associated disorder have been investigated in antimony implanted nickel crystals using combined RBS and TEM analyses. In crystals implanted at and below room temperature with 80 keV Sb + ions to a fluence of 5x10 20 m -2 , the retained antimony concentration in the implantation zone is approaching 15 at.%, with nearly all the antimony located substitutionally. The associated disorder as seen in the RBS analysis is insignificant. Annealing up to 600 0 C has little influence on the antimony distribution, whilst the dechanneling level is reduced. TEM and diffraction analysis of room temperature implanted samples show that the radiation damage consists of dense distributions of dislocation clusters and tangles, superimposed on a rather homogeneous background of new phase particles, identified as hcp nickel. The particles have a size 0.1-0.2 μm. The high substitutional antimony concentration at and below room temperature, which exceeds the solubility limit, indicates that its formation is thermally diffusionless and rather an effect of radiation enhanced solubility. The diffusionless nature of the microstructure is also indicated from the presence of martensitic hcp nickel, believed to form due to relief of radiation induced internal stress. (Auth.)
International Nuclear Information System (INIS)
Calva-Vazquez, G.; Razo-Angel, G.; Rodriguez-Fernandez, L.; Ruvalcaba-Sil, J.L.
2006-01-01
The concentration of elements with Z > 18 is measured in tree rings from forests at the surroundings of the Mexico Valley: El Chico National Park (ECP) and Desierto de los Leones National Park (DLP). The analysis was done by simultaneous PIXE-RBS using an external proton beam on tree rings of Pine and Sacred fir (species Pinus montezumae and Abies religiosa, respectively). This study provides information about the elemental concentration in trees of those parks during the years from 1965 to 2003. Typical elements such as K, Ca, Ti, V, Cr, Mn, Fe, Ni, Cu, Zn, Br, Sr and Pb were detected using PIXE technique while the wood matrix composition (mainly C and O) was determined by RBS. In general, elemental contents present large variations but concentrations oscillate around the mean value during this period of time. Nevertheless, the measurements showed some trends for Fe and Zn in the tree-rings elemental composition that may be correlated to recent volcanic activities in the region. The low Mn contents indicate soil acidification in DLP from 1968 and the forest decline in ECP during the last 15 years
Optical, structural, and nuclear scientific studies of AlGaN with high Al composition
Lin, Tse Yang; Chung, Yee Ling; Li, Lin; Yao, Shude; Lee, Y. C.; Feng, Zhe Chuan; Ferguson, Ian T.; Lu, Weijie
2010-08-01
AlGaN epilayers with higher Al-compositions were grown by Metalorganic Chemical Vapor Deposition (MOCVD) on (0001) sapphire. Trimethylgallium (TMGa), trimethylaluminium (TMAl) and NH3 were used as the source precursors for Ga, Al, and N, respectively. A 25 nm AlN nucleation layer was first grown at low-temperature of 590 °C at 300 Torr. Followed, AlxGa1-xN layers were grown at 1080 °C on low-temperature AlN nucleation layers. The heterostructures were characterized by a series of techniques, including x-ray diffraction (XRD), Rutherford backscattering (RBS), photoluminescence (PL), scanning electron microscopy (SEM) and Raman scattering. Precise Al compositions were determined through XRD, RBS, and SEM combined measurements. Room Temperature Raman Scattering spectra shows three major bands from AlGaN alloys, which are AlN-like, A1 longitudinal optical (LO) phonon modes, and E2 transverse optical (TO) band, respectively, plus several peak comes from the substrate. Raman spectral line shape analysis lead to an optical determination of the electrical property free carrier concentration of AlGaN. The optical properties of AlGaN with high Al composition were presented here.
Ion microprobe analysis of metallic pigments
International Nuclear Information System (INIS)
Pelicon, P.; Simcic, J.; Budnar, M.; Klanjsek-Gunde, M.; Kunavaer, M.
2001-01-01
Full text: Metallic paints consist of metallic flakes dispersed m a resinous binder, i.e. a light-element polymer matrix. The spatial distribution and orientation of metallic flakes inside the matrix determines the covering efficiency of the paint, glossiness, and its angular-dependent properties such as lightness flop or color flop (two-tone). Such coatings are extensively used for a functional (i.e. security) as well as decorative purpose. The ion microbeam analysis of two types of silver paint with imbedded metallic flake has been performed to test the ability of the ion microbeam spectroscopic methods on this type of samples. The average sizes of the aluminium flakes were 23 (size distribution 10-37) and 49 (size distribution 34-75) micrometers, respectively. The proton beam with the size of 2x2 micrometers at Ljubljana ion microprobe has been used to scan the surface of the pigments. PIXE mapping of Al Kα map shows lateral distribution of the aluminum flakes, whereas the RBS slicing method reveals tomographic image of the flakes in uppermost 5 micrometers of the pigment layer. The flake distribution in the larger layer depths has been accessed by RBS analysis in a point mode. (author)
Energy Technology Data Exchange (ETDEWEB)
Nilsson, E.J.C., E-mail: charlotta.nilsson@nuclear.lu.se [Division of Nuclear Physics, Department of Physics, Lund University, Box 118, SE-221 00 Lund (Sweden); Pallon, J., E-mail: jan.pallon@nuclear.lu.se [Division of Nuclear Physics, Department of Physics, Lund University, Box 118, SE-221 00 Lund (Sweden); Przybylowicz, W.J., E-mail: przybylowicz@tlabs.ac.za [Materials Research Department, iThemba LABS, National Research Foundation, P.O. Box 722, Somerset West 7129 (South Africa); AGH University of Science and Technology, Faculty of Physics and Applied Computer Science, Al. A. Mickiewicza 30, 30-059 Krakow (Poland); Wang, Y.D., E-mail: yaodongw@hotmail.com [Materials Research Department, iThemba LABS, National Research Foundation, P.O. Box 722, Somerset West 7129 (South Africa); Jönsson, K.I., E-mail: ingemar.jonsson@hkr.se [School of Education and Environment, Kristianstad University, SE-291 88 Kristianstad (Sweden); Department of Molecular Biosciences, The Wenner-Gren Institute, Stockholm University, SE-106 91 Stockholm (Sweden)
2014-08-01
Although heavy on labor and equipment, thus not often applied, cryoanalysis of frozen hydrated biological specimens can provide information that better reflects the living state of the organism, compared with analysis in the freeze-dried state. In this paper we report a study where the cryoanalysis facility with cryosectioning capabilities at Materials Research Department, iThemba LABS, South Africa was employed to evaluate the usefulness of combining three ion beam analytical methods (μPIXE, RBS and STIM) to analyze a biological target where a better elemental compositional description is needed – the tardigrade. Imaging as well as quantification results are of interest. In a previous study, the element composition and redistribution of elements in the desiccated and active states of two tardigrade species was investigated. This study included analysis of both whole and sectioned tardigrades, and the aim was to analyze each specimen twice; first frozen hydrated and later freeze-dried. The combination of the three analytical techniques proved useful: elements from C to Rb in the tardigrades could be determined and certain differences in distribution of elements between the frozen hydrated and the freeze-dried states were observed. RBS on frozen hydrated specimens provided knowledge of matrix elements.
Energy Technology Data Exchange (ETDEWEB)
Saravanan, P., E-mail: psdrdo@gmail.com [Defence Metallurgical Research Laboratory, Hyderabad 500058 (India); Department of Physics, National Taiwan University, Taipei 106, Taiwan (China); Hsu, Jen-Hwa, E-mail: jhhsu@phys.ntu.edu.tw [Department of Physics, National Taiwan University, Taipei 106, Taiwan (China); Perumal, A.; Gayen, Anabil [Department of Physics, Indian Institute of Technology Guwahati, Guwahati 781039 (India); Reddy, G.L.N.; Kumar, Sanjiv [National Centre for Compositional Characterization of Materials, Bhabha Atomic Research Centre, ECIL Post, Hyderabad 500062 (India); Kamat, S.V. [Defence Metallurgical Research Laboratory, Hyderabad 500058 (India)
2014-09-01
Multilayer films were sputtered on Si (1 0 0) substrate by following a layer sequence of Cr (10 nm)/[Fe (4 nm)/SmCo{sub 5} (20 nm)]{sub 11}/Cr (90 nm) at room temperature and subsequently, subjected to two-stage annealing. The phase composition, the extent of inter-diffusion at the SmCo{sub 5}/Fe interfaces and the magnetic properties of multilayered samples were investigated by X-ray diffraction (XRD), RBS and super-conducting quantum interference device (SQUID), respectively. The XRD studies showed the crystallization of SmCo{sub 5}-phase in the hard layer along with a bcc-Fe (Co)-phase in the soft layer, while the RBS depth profile analysis revealed the changes that occur in the effective Fe-layer thickness and diffused Co-content as minimal for the Fe-layer index, n{sub Fe}≤5. A single-phase behavior associated with strong in-plane anisotropy was evidenced with the SQUID measurements. The observed remanence enhancement (1020 kA/m) and energy product value (286 kJ/m{sup 3}) in these multilayers are discussed in the context of Fe-layer thickness and diffused Co-content.
Directory of Open Access Journals (Sweden)
Rocha Julio Cesar
2000-01-01
Full Text Available A sequential system for fractionation by ultrafiltration (SSFU equipped with advanced membranes filters (molecular size cut-off: 5, 10, 30, 50 and 100 kDalton of the polyethersulfone type was developed for analytical fractionation of humic substances (HS extracted from aquatic systems or soils. The device consists of five membrane filters (Sartocon® Micro operated by a multi-channel peristaltic pump, enabling an easy handling, working in a closed system and with simple collection of the six obtained fractions (F1>100; F2: 100-50; F3: 50-30; F4:30-10; F5: 10-5 and F6 <5 kDalton. Then, the HS sample (250 mL solution 1.0 mg/mL, pH 5.0 to 6.0 to be fractionated is pumped by pump through the series of membrane filters with a tangential flow of 85 mL/min, initial pressure 0.2 to 0.3 bar and permeation flux through the membranes of 0.8 to 1.4 mL/min. The overall time for fractionation and cleaning of the device is about 10 h and 25 mL of each fraction is obtained.