WorldWideScience

Sample records for batelada sequencial rbs

  1. Remoção de demanda química de oxigênio e nitrogênio total Kjeldahl de efluente de indústria de vegetais congelados por Reator em Batelada Sequencial

    Directory of Open Access Journals (Sweden)

    Thaís Luciana Betto

    2013-09-01

    Full Text Available O objetivo deste trabalho foi estudar o tratamento biológico de efluente de indústria de vegetais congelados em Reator em Batelada Sequencial (RBS, verificando o efeito da concentração de Sólidos Suspensos Voláteis (SSV, Demanda Química de Oxigênio inicial (DQOi e aeração na remoção biológica de carbono e nitrogênio, a fim de obter um efluente tratado que atenda aos padrões de lançamento recomendados pela legislação ambiental brasileira. Nesta pesquisa, o tratamento dos efluentes foi feito em um RBS, utilizando concentração de SSV variando entre 2000 mg.L-1 e 4000 mg.L-1, DQOi variando entre 300 mg.L-1 e 600 mg.L-1, e quantidade de aeração variando entre 3 L.min-1 e 6 L.min-1. Os resultados mostram que a maior eficiência de remoção para DQO foi de 88%, e para nitrogênio total Kjeldahl (NTK foi de 74,9%. As condições otimizadas para remoção de DQO e NTK do efluente estudado foram: DQO inicial de 600 mg.L-1, aeração de 4,5 L.min-1 e concentração de SSV de 2000 mg.L-1

  2. Aplicação da via curta para remoção biológica de nitrogênio de lixiviado de aterro sanitário utilizando reator em batelada sequencial

    OpenAIRE

    Luiz Felipe Tavares De Santana

    2015-01-01

    A presente pesquisa teve o objetivo de estudar a remoção biológica de nitrogênio amoniacal (N-NH3) e matéria orgânica biodegradável presente em lixiviado de aterro sanitário, aplicando a nitrificação por meio da via curta, operando um reator de polietileno, em bateladas sequenciais, com volumes úteis superiores a 400 L, ou seja, em escala piloto, aerado por meio de compressor de 1 cv. O experimento foi realizado no aterro sanitário em operação há onze anos, localizado no município de Camaçari...

  3. Aplicação da via curta para remoção biológica de nitrogênio de lixiviado de aterro sanitário utilizando reator em batelada sequencial

    Directory of Open Access Journals (Sweden)

    Luiz Felipe Tavares De Santana

    2015-12-01

    Full Text Available A presente pesquisa teve o objetivo de estudar a remoção biológica de nitrogênio amoniacal (N-NH3 e matéria orgânica biodegradável presente em lixiviado de aterro sanitário, aplicando a nitrificação por meio da via curta, operando um reator de polietileno, em bateladas sequenciais, com volumes úteis superiores a 400 L, ou seja, em escala piloto, aerado por meio de compressor de 1 cv. O experimento foi realizado no aterro sanitário em operação há onze anos, localizado no município de Camaçari - Bahia e operado pela empresa LIMPEC, responsável pelos serviços de coleta, transporte e destinação final dos resíduos sólidos urbanos e industriais não perigosos, gerados nos municípios de Camaçari e Dias D’Ávila, Bahia. O experimento foi conduzido durante 165 dias. Foram realizados: 7 (sete ciclos de tratamento utilizando razões de troca volumétrica de 10% e aerando o conteúdo do reator por 18 horas; 5 (cinco ciclos com razão de troca volumétrica de 20% e aerando o conteúdo do reator por 18 horas e, finalmente, 7 (sete ciclos com razão de troca volumétrica igual a 20% e aerando o conteúdo do reator por 24 horas. Todos os ciclos de tratamento foram operados com o conteúdo do reator a temperatura ambiente, sem correção de pH, e a concentração de oxigênio dissolvido (OD, durante a aeração, foi sempre inferior a 1,0 mg O2/L. Os melhores resultados de eficiência de remoção de poluentes de interesse foram obtidos quando o sistema foi operado com RTV iguais a 10 e 20% e tempos de aeração iguais a 18 e 24 horas respectivamente. Nessas condições operacionais, a remoção de N-NH3 variou entre 56 e 100%, correspondendo a concentrações efluentes entre 0,0 e 84,0 mg N-NH3/L, ou seja, durante 11 ciclos de tratamento o efluente atendeu à Resolução CONAMA 430/2011. O alcance do acúmulo de nitrito, avaliado por meio da razão nitrito/nitrogênio oxidado, mostrou-se estável durante todo o experimento. Ao longo

  4. Enhanced High Resolution RBS System

    Science.gov (United States)

    Pollock, Thomas J.; Hass, James A.; Klody, George M.

    2011-06-01

    Improvements in full spectrum resolution with the second NEC high resolution RBS system are summarized. Results for 50 Å TiN/HfO films on Si yielding energy resolution on the order of 1 keV are also presented. Detector enhancements include improved pulse processing electronics, upgraded shielding for the MCP/RAE detector, and reduced noise generated from pumping. Energy resolution measurements on spectra front edge coupled with calculations using 0.4mStr solid angle show that beam energy spread at 400 KeV from the Pelletron® accelerator is less than 100 eV. To improve user throughput, magnet control has been added to the automatic data collection. Depth profiles derived from experimental data are discussed. For the thin films profiled, depth resolutions were on the Angstrom level with the non-linear energy/channel conversions ranging from 100 to 200 eV.

  5. RBS analysis of electrochromic layers

    Energy Technology Data Exchange (ETDEWEB)

    Green, D.C.; Bell, J.M. [University of Technology, Sydney, NSW (Australia); Kenny, M.J.; Wielunski, L.S. [Commonwealth Scientific and Industrial Research Organisation (CSIRO), Lindfield, NSW (Australia). Div. of Applied Physics

    1993-12-31

    Tungsten oxide thin films produced by dip-coating from tungsten alkoxide solutions are of interest for their application in large area switchable windows. The application consists of a layer of electrochromic tungsten oxide (W0{sub 3}) on indium tin oxide (ITO) coated glass in contact with a complementary structure. Electrochromic devices are switchable between states of high and low transparency by the application of a small voltage. The mechanism relies on the dual injection of ions and electrons into the W0{sub 3} layer from adjacent layers in the device. Electrochromic tungsten oxide can be deposited using standard techniques (eg. sputtering and evaporation) but also using sol-gel deposition. Sol-gel processing has an advantage over conventional preparation techniques because of the simplicity of the equipment. The scaling up to large area coatings is also feasible. RBS and forward recoil has been used to obtain profiles for individual elements in the structure of electrochromic films. 3 refs., 3 figs.

  6. RBS using {sup 28}Si beams

    Energy Technology Data Exchange (ETDEWEB)

    Ophel, T.R. [Australian National Univ., Canberra, ACT (Australia); Mitchell, I.V. [University of Western Ontario, London, ON (Canada). Dept. of Physics

    1996-12-31

    Measurements of RBS using {sup 28}Si beams have been made to evaluate the enhancement of sensitivity that should obtain from kinematic suppression of silicon substrate scattering. Two detection methods were tried. Aside from a surface barrier detector, a magnetic spectrometer, instrumented with a multi-electrode gas focal plane detector, was used to indicate the resolution attainable with low energy {sup 28}Si ions. The results confirm that kinematically suppressed RBS does provide greatly improved sensitivity. 5 refs., 2 figs.

  7. RbsR Activates Capsule but Represses the rbsUDK Operon in Staphylococcus aureus.

    Science.gov (United States)

    Lei, Mei G; Lee, Chia Y

    2015-12-01

    Staphylococcus aureus capsule is an important virulence factor that is regulated by a large number of regulators. Capsule genes are expressed from a major promoter upstream of the cap operon. A 10-bp inverted repeat (IR) located 13 bp upstream of the -35 region of the promoter was previously shown to affect capsule gene transcription. However, little is known about transcriptional activation of the cap promoter. To search for potential proteins which directly interact with the cap promoter region (Pcap), we directly analyzed the proteins interacting with the Pcap DNA fragment from shifted gel bands identified by electrophoretic mobility shift assay. One of these regulators, RbsR, was further characterized and found to positively regulate cap gene expression by specifically binding to the cap promoter region. Footprinting analyses showed that RbsR protected a DNA region encompassing the 10-bp IR. Our results further showed that rbsR was directly controlled by SigB and that RbsR was a repressor of the rbsUDK operon, involved in ribose uptake and phosphorylation. The repression of rbsUDK by RbsR could be derepressed by D-ribose. However, D-ribose did not affect RbsR activation of capsule. Staphylococcus aureus is an important human pathogen which produces a large number of virulence factors. We have been using capsule as a model virulence factor to study virulence regulation. Although many capsule regulators have been identified, the mechanism of regulation of most of these regulators is unknown. We show here that RbsR activates capsule by direct promoter binding and that SigB is required for the expression of rbsR. These results define a new pathway wherein SigB activates capsule through RbsR. Our results further demonstrate that RbsR inhibits the rbs operon involved in ribose utilization, thereby providing an example of coregulation of metabolism and virulence in S. aureus. Thus, this study further advances our understanding of staphylococcal virulence regulation

  8. Controle de reatores de batelada exotermicos pelo metodo da linearização global

    OpenAIRE

    Luis Emilio Vasconcelos de Andrade

    1993-01-01

    Resumo: Os reatores em batelada representam um tipo de processo de grande importância na indústria química, visto que estão associados à produção de uma variada quantidade de produtos, tais como as especialidades químicas e fármacos o satisfatório controle deste processo, visando assegurar a qualidade do produto final, põe-se como uma questão bastante particular.Como muitas das reações promovidas em reatores em batelada envolvem 1iberação de calor, tem-se configurado, para efeito de controle,...

  9. Determination of accurate metal silicide layer thickness by RBS

    International Nuclear Information System (INIS)

    Kirchhoff, J.F.; Baumann, S.M.; Evans, C.; Ward, I.; Coveney, P.

    1995-01-01

    Rutherford Backscattering Spectrometry (RBS) is a proven useful analytical tool for determining compositional information of a wide variety of materials. One of the most widely utilized applications of RBS is the study of the composition of metal silicides (MSi x ), also referred to as polycides. A key quantity obtained from an analysis of a metal silicide is the ratio of silicon to metal (Si/M). Although compositional information is very reliable in these applications, determination of metal silicide layer thickness by RBS techniques can differ from true layer thicknesses by more than 40%. The cause of these differences lies in how the densities utilized in the RBS analysis are calculated. The standard RBS analysis software packages calculate layer densities by assuming each element's bulk densities weighted by the fractional atomic presence. This calculation causes large thickness discrepancies in metal silicide thicknesses because most films form into crystal structures with distinct densities. Assuming a constant layer density for a full spectrum of Si/M values for metal silicide samples improves layer thickness determination but ignores the underlying physics of the films. We will present results of RBS determination of the thickness various metal silicide films with a range of Si/M values using a physically accurate model for the calculation of layer densities. The thicknesses are compared to scanning electron microscopy (SEM) cross-section micrographs. We have also developed supporting software that incorporates these calculations into routine analyses. (orig.)

  10. Tratamento por coagulação-floculação de lixiviado bruto de aterro sanitário com e sem pré-tratamento biológico em reator sequencial em batelada

    OpenAIRE

    André Granzotto Gewehr

    2012-01-01

    A forma de tratamento e destinação final ainda mundialmente preponderante para os resíduos sólidos urbanos é o aterro sanitário, método que gera, além de uma massa sólida residual, parcialmente estabilizada, subprodutos finais líquidos e gasosos. O efluente líquido, conhecido como lixiviado, necessita tratamento específico, devido a sua elevada nocividade ao meio ambiente, em função, principalmente, de suas elevadas concentrações de nitrogênio amoniacal e de matéria orgânica, em elevado perce...

  11. Quality control of coins mint using PIXE and RBS analysis

    International Nuclear Information System (INIS)

    Roumie, M.; Nsouli, B.; Chalhoub, G.; Hamdan, M.

    2010-01-01

    PIXE and RBS analysis is used to investigate the elemental content of modern Lebanese coins, in order to control their minting quality. The coins of interest were 100, 250 and 500 Lebanese Lira (LL), which are mainly bulky metals with or without coated layer. Using 3 MeV protons, proton induced X-ray emission PIXE identified and quantified elements while Rutherford backscattering spectrometry RBS checked the thickness of the coated layer. Indeed, the combination of PIXE and RBS provides a powerful tool to investigate the elemental composition of coins, either modern or ancient. In addition, the experimental protocol was checked by analyzing some other coins of known composition, such as 1-euro and 2-euro.

  12. 7 CFR 2003.26 - Functional organization of RBS.

    Science.gov (United States)

    2010-01-01

    ..., standards, procedures, and schedules for accomplishing RBS activities related to “community empowerment... Staff. Headed by the staff director, this staff is responsible to the Administrator for preparing..., contracting, automated information systems, and accounting. The staff provides analysis and recommendations on...

  13. Advanced capabilities and applications of a sputter-RBS system

    International Nuclear Information System (INIS)

    Brijs, B.; Deleu, J.; Beyer, G.; Vandervorst, W.

    1999-01-01

    In previous experiments, sputter-RBS 1 has proven to be an ideal tool to study the interaction of low energy ions. This contribution employs the same methodology to identify surface contamination induced during sputtering and to the determine absolute sputter yields. In the first experiment ERDA analysis was used to study the evolution of Hydrogen contamination during sputter-RBS experiments. Since the determination of Hydrogen concentration in very thin near surface layers is frequently limited by the presence of a strong surface peak of Hydrogen originating from adsorbed contamination of the residual vacuum, removal of this contamination would increase the sensitivity for Hydrogen detection in the near sub surface drastically. Therefore low energy (12 keV) Argon sputtering was used to remove the Hydrogen surface peak. However enhanced Hydrogen adsorption was observed related to the Ar dose. This experiment shows that severe vacuum conditions and the use of high current densities/sputter yields are a prerequisite for an efficient detection of Hydrogen in the near surface layers. In the second experiment, an attempt was made to determine the sputter yield of Cu during low energy (12 keV) Oxygen bombardment. In order to determine the accumulated dose of the low energy ion beam, a separate Faraday cup in combination with a remote controlled current have been added to the existing sputter-RBS set-up. Alternating sputtering and RBS analysis seem to be an adequate tool for the determination of the absolute sputter yield of Cu and this as well in the as under steady state conditions

  14. Inter-diffusion study of rhodium and tantalum by RBS

    International Nuclear Information System (INIS)

    Nuttens, V.E.; Hubert, R.L.; Bodart, F.; Lucas, S.

    2005-01-01

    The inter-diffusion of rhodium and tantalum has been studied with the goal of synthesizing an alloy acting as a diffusion barrier for high temperature applications. Rh/Ta sandwiched samples were annealed in vacuum at temperature ranging from 800 to 900 deg. C and from 1000 to 1075 deg. C. The diffusion profiles were obtained by RBS. They suggest the formation of two clearly different phases in each temperature range considered

  15. RBS and RNRA studies on sorption of europium by apatite

    Energy Technology Data Exchange (ETDEWEB)

    Ohnuki, Toshihiko; Kozai, Naofumi; Isobe, Hiroshi [Japan Atomic Energy Research Inst., Tokai, Ibaraki (Japan). Tokai Research Establishment; Murakami, Takashi; Yamamoto, Shunya; Aoki, Yasushi; Naramoto, Hiroshi

    1997-03-01

    The sorption mechanism of europium, alternative of trivalent TRU has been studied based on the depth profiles of elements obtained by Rutherford Backscattering Spectroscopy (RBS) and Resonant Nuclear Reaction Analysis (RNRA). The positive peak for Eu and the negative peak for Ca were observed in the subtracted RBS spectra of the apatites on which Eu was sorbed from that of the fresh apatite. This indicates that Eu was sorbed on apatite, while a fraction of Ca was released from apatite. The peak height for Eu in the RBS spectrum of the apatite obtained at 75degC was higher than that of the apatite at 40degC. The depth profile of hydrogen of the apatite on which Eu was sorbed was similar to that of the fresh apatite. The concentration of Eu in the solution decreased with increasing temperature. On the contrary, the concentration of Ca increased with increasing temperature. Thus, it is concluded that a fraction of Eu is exchanged for Ca in the structure of apatite. (author)

  16. Remoção biológica de fósforo em reatores em bateladas sequenciais com diferentes tempos de retenção de sólidos Biological phosphorus removal in sequencing batch reactors with different solid retention times

    Directory of Open Access Journals (Sweden)

    Israel Nunes Henrique

    2010-06-01

    Full Text Available Nos últimos anos, tem surgido a necessidade de se projetarem sistemas de tratamento de águas residuárias que, além de remover carga orgânica, sejam capazes de remover nutrientes, particularmente nitrogênio e fósforo. Este trabalho avaliou a remoção biológica de fósforo em sistemas de lodo ativado, tratando esgoto doméstico por meio de reatores em bateladas sequenciais (RBS, monitorado com diferentes tempos de retenção celular (TRC: 20, 5 e 3 dias. Esses experimentos foram avaliados em escala de bancada com o uso da respirometria, utilizando-se acetato como fonte de carbono orgânico. Os resultados mostraram satisfatória remoção de fósforo total nos três experimentos, com valores médios entre 79 a 82%, sendo que o sistema RBS que operou com TRC de cinco dias obteve resultados melhores.In recent years, there has been an increasing need to design wastewater treatment systems that are capable of removing both organic material and nutrients, notably nitrogen and phosphorus. This study evaluated biological phosphorus removal by activated sludge systems fed with domestic sewage and operating as sequencing batch reactors (SBR with different solids retention times (SRT namely 20, 5 and 3 days. This was supported by respirometry experiments at bench scale using acetate as the source of organic carbon. The results showed satisfactory total phosphorus removal efficiencies mean values between 79-82% for the three regimes with the best removal efficiency occurring in the SBR operating with a five-day SRT.

  17. Estimation of the degree of authenticity of concentrational element profile derived from RBS measurements

    International Nuclear Information System (INIS)

    Egorov, V.K.; Okhulkov, A.V.

    1993-01-01

    A simple technique is offered for estimating the degree of authenticity of element concentrational profile which does not depend on the complicated character of RBS spectra and possible intercorrelation of parameters. The technique can be implemented with any program simulating RBS spectra, for instance, RUMP. 5 refs.; 1 fig.; 1 tab

  18. Análise sequencial de comportamentos ofensivos desempenhados por seleções nacionais de futebol de alto rendimento

    Directory of Open Access Journals (Sweden)

    Daniel Pimenta Castelão

    2015-09-01

    Full Text Available ResumoO presente estudo teve como objetivo identificar diferentes padrões de jogo ofensivo evidenciados pelas seis seleções de futebol participantes das finais da Copa do Mundo de 2006 e da Eurocopa de 2004 e 2008. A partir da Análise Sequencial pela Técnica de Retardos foram avaliadas 647 sequências ofensivas de jogo. Foi usada a metodologia observacional no sentido de perceber as ações feitas. Recorreu-se ao software SDIS &GSEQ para a análise dos dados a partir da técnica de retardos. Para a análise estatística inferencial foi usado o teste qui-quadrado (χ2. Os resultados levam a admitir que o jogo de futebol respeita o princípio da equifinalidade, ou seja, é possível alcançar-se o topo na classificação recorrendo-se a padrões táticos claramente diferenciados.

  19. Carbon buildup monitoring using RBS: Correlation with secondary electrons

    International Nuclear Information System (INIS)

    Aguilera, E.F.; Rosales, P.; Martinez-Quiroz, E.; Murillo, G.; Fernandez, M.C.

    2006-01-01

    The RBS technique is applied to solve the problem of on-line monitoring of the carbon deposited on a thin backed foil under ion bombardment. An iterative method is used to reliably extract quantities such as number of projectiles and target thickness in spite of beam energy changes and detector unstabilities. Experimental values for secondary electron yields are also deduced. Results are reported for the thickness variation of thin carbon foils bombarded with carbon ions of energies between 8.95 and 13 MeV. A linear correlation of this variation is found with both, the ion fluence at target and the number of secondary electrons emitted. The correlation exists even though a wide range of beam currents, beam energies and bombarding times was used during the experiment. The measured electron yields show evidence for a change in the emission process between the original foils and the deposited layer, possibly due to a texture change

  20. Involvement of the ribose operon repressor RbsR in regulation of purine nucleotide synthesis in Escherichia coli.

    Science.gov (United States)

    Shimada, Tomohiro; Kori, Ayako; Ishihama, Akira

    2013-07-01

    Escherichia coli is able to utilize d-ribose as its sole carbon source. The genes for the transport and initial-step metabolism of d-ribose form a single rbsDACBK operon. RbsABC forms the ABC-type high-affinity d-ribose transporter, while RbsD and RbsK are involved in the conversion of d-ribose into d-ribose 5-phosphate. In the absence of inducer d-ribose, the ribose operon is repressed by a LacI-type transcription factor RbsR, which is encoded by a gene located downstream of this ribose operon. At present, the rbs operon is believed to be the only target of regulation by RbsR. After Genomic SELEX screening, however, we have identified that RbsR binds not only to the rbs promoter but also to the promoters of a set of genes involved in purine nucleotide metabolism. Northern blotting analysis indicated that RbsR represses the purHD operon for de novo synthesis of purine nucleotide but activates the add and udk genes involved in the salvage pathway of purine nucleotide synthesis. Taken together, we propose that RbsR is a global regulator for switch control between the de novo synthesis of purine nucleotides and its salvage pathway. © 2013 Federation of European Microbiological Societies. Published by John Wiley & Sons Ltd. All rights reserved.

  1. PIXE and RBS applied to cultural heritage objects: Complementarity and limitations

    International Nuclear Information System (INIS)

    Morelle, M.; El Masri, Y.; Heitz, Ch.; Prieels, R.; Van Mol, J.; Dran, J.-C.; Salomon, J.; Calligaro, T.; Dubus, M.

    2005-01-01

    This paper reports on the use of PIXE and RBS (resonant and non-resonant RBS) implemented with proton beams to simultaneously analyse light and heavy elements in materials of cultural heritage significance, as exemplified by Russian icons or in lead seals. It is shown that in spite of its poor mass resolution RBS with protons can provide useful information when combined with PIXE. In the case of Russian icons, it is possible to discriminate between an Au-Ag bilayer and an alloy of these metals in the gilds. However, when applied to lead seals RBS with protons encounters a significant limitation due to some deficiency in the available computer programs used for spectrum processing

  2. Multidirectional channeling analysis of epitaxial CdTe layers using an automatic RBS/channeling system

    Energy Technology Data Exchange (ETDEWEB)

    Wielunski, L.S.; Kenny, M.J. [CSIRO, Lindfield, NSW (Australia). Applied Physics Div.

    1993-12-31

    Rutherford Backscattering Spectrometry (RBS) is an ion beam analysis technique used in many fields. The high depth and mass resolution of RBS make this technique very useful in semiconductor material analysis [1]. The use of ion channeling in combination with RBS creates a powerful technique which can provide information about crystal quality and structure in addition to mass and depth resolution [2]. The presence of crystal defects such as interstitial atoms, dislocations or dislocation loops can be detected and profiled [3,4]. Semiconductor materials such as CdTe, HgTe and Hg+xCd{sub 1-x}Te generate considerable interest due to applications as infrared detectors in many technological areas. The present paper demonstrates how automatic RBS and multidirectional channeling analysis can be used to evaluate crystal quality and near surface defects. 6 refs., 1 fig.

  3. Application of ion implantation RBS to the study of electrocatalysis

    International Nuclear Information System (INIS)

    Kelly, E.J.; Vallet, C.E.; White, C.W.

    1990-01-01

    Ir-implanted titanium near-surface alloys were prepared by ion implantation, characterized (Ir concentration/depth profiles) by Rutherford backscattering (RBS), and subsequently anodically oxidized to form electrocatalytically active Ir x Ti 1-x O 2 /Ti electrodes. The electrochemical behavior of the metallic-like Ir 4 Ti 1-x O 2 /Ti electrodes in acidic chloride, sulfate, and perchlorate solutions was investigated, and the results compared with those previously obtained with similarly prepared Ru x Ti 1-x O 2 /Ti electrodes. For both electrodes, M x Ti 1-x O 2 /Ti (M equals Ir or Ru), the Tafel slope for the Cl 2 evolution reaction is 40 mV, i.e.,δE/δlog i equals 2.303 (2RT/3F). The reaction order (n) with respect to chloride ion concentration δlogi/δlog[Cl - ] + 1, where K 9 equals 54.9 dm 3 mol -1 for Ir x Ti 1-x O 2 /Ti and K 9 equals 40 dm 3 mol -1 for Ru x Ti 1-x O 2 /Ti. A modified Volmer-Heyrovsky mechanism, one in which the role of absorbed chloride ions is taken into account, is shown to be consistent with aforementioned diagnostic parameters

  4. POTENSI MAHASISWA REGULAR BLOCK SYSTEM (RBS UNIVERSITAS KANJURUHAN MALANG

    Directory of Open Access Journals (Sweden)

    R. Anastasia Endang Susilawati

    2008-02-01

    Full Text Available Survey conducted to obtain get situation of quadran strategy determine elegibility of increase of maximum expense lecturing of program student of Regular Block System (RBS at institute education of University of Kanjuruhan Unlucky enlisting and active in year of akademic 2006/2007. Used variables shall be as follows: 1 psicografis, 2 social of demography and economics, 3 geografis, 4 benefit, 5 last experience, 6 physical medium, 7 expense, 8 advertisement, 9 word of mouth communication, 10 image of PTS, 11 quality of technical service, 12 quality of functional service, 13 satisfaction of student, and 14 student expectation. Technique data collecting use quesioner which consist of question closed and is open. Obtained to be data to be analysed to descriptive method and SWOT ( strengths, weaknesses, opportunities, threats. Result of survey indicate that University of Kanjuruhan unlucky reside in aggresive strategy ( strength 71.12% and opportunity 71.1% and also strategy diversify ( strength 71.12% and threat 69.8%, hence competent to boost up the expense of maximum study equal to 19.41% made balance to with diversification of program to overcome threats faced in this time and in the future.

  5. Cyclic voltammetry and RBS study of paint components

    International Nuclear Information System (INIS)

    Bowman, Lynn; Spencer, Dirk; Muntele, Claudiu; Muntele, Iulia; Ila, D.

    2007-01-01

    Heavy metals and metalloid ions are found in environmental matrices. The most toxic are lead, cadmium and mercury. These three heavy metals have no biological function and are toxic at all concentrations. Lead is one of the most insidious heavy metals and is introduced into the environment by many different means. It persists in both urban and rural settings, being found in paint chips, pottery, crystal and pharmaceutical and nutritional products. The analysis of heavy elements such as lead in soil is of particular importance [W.T. Sturges, R.M. Harrison, Sci. Total Environ. 44 (3) (1985) 225; M.L. Lepow, L. Bruckman, M. Gillette, S. Markowitz, R. Robino, J. Kapish, Environ. Res. 10 (3) (1975) 415; A.E. Daniels, J.R. Kominsky, P.J. Clark, J. Hazard. Mater. B 87 (2001) 117; G. Hutter, D. Moshman, J. Hazard. Mater. 40 (1995) 1]. In preparing the methods for lead detection in paint, we have used Rutherford backscattering spectrometry (RBS) in order to study the type and amount of heavy metal content in paint samples collected at various sites in the historic campus at A and M University (AAMU). We will show the results of our study with emphasis on comparison of what we learned about presence of lead in paints using our ion beam methods compared with the analysis of lead in paints using cyclic voltammetry

  6. Study of multiple scattering effects in heavy ion RBS

    Energy Technology Data Exchange (ETDEWEB)

    Fang, Z.; O`Connor, D.J. [Newcastle Univ., NSW (Australia). Dept. of Physics

    1996-12-31

    Multiple scattering effect is normally neglected in conventional Rutherford Backscattering (RBS) analysis. The backscattered particle yield normally agrees well with the theory based on the single scattering model. However, when heavy incident ions are used such as in heavy ion Rutherford backscattering (HIRBS), or the incident ion energy is reduced, multiple scattering effect starts to play a role in the analysis. In this paper, the experimental data of 6MeV C ions backscattered from a Au target are presented. In measured time of flight spectrum a small step in front of the Au high energy edge is observed. The high energy edge of the step is about 3.4 ns ahead of the Au signal which corresponds to an energy {approx} 300 keV higher than the 135 degree single scattering energy. This value coincides with the double scattering energy of C ion undergoes two consecutive 67.5 degree scattering. Efforts made to investigate the origin of the high energy step observed lead to an Monte Carlo simulation aimed to reproduce the experimental spectrum on computer. As a large angle scattering event is a rare event, two consecutive large angle scattering is extremely hard to reproduce in a random simulation process. Thus, the simulation has not found a particle scattering into 130-140 deg with an energy higher than the single scattering energy. Obviously faster algorithms and a better physical model are necessary for a successful simulation. 16 refs., 3 figs.

  7. Depth profile of In and As in Si measured by RBS with He and C ions

    Energy Technology Data Exchange (ETDEWEB)

    Yang, Q.; Fang, Z. [Newcastle Univ., NSW (Australia). Dept. of Physics; Ophel, T.R. [Australian National Univ., Canberra, ACT (Australia). Dept. of Nuclear Physics

    1993-12-31

    The depth profile of As and In implanted into Si have been measured by RBS (Rutherford Backscattering Spectrometry) with 2 MeV He ions and 6 MeV C ions. Advantages of enhanced depth and mass resolution with C ions have been demonstrated over the conventional He RBS. More reliable information for the depth profile of In and As in Si has been obtained. 12 refs., 3 figs.

  8. Filmes de polpa de banana produzidos por batelada: propriedades mecânicas e coloração

    Directory of Open Access Journals (Sweden)

    Milena dos Reis Martelli

    2014-01-01

    Full Text Available Polpa de bananas sobremaduras e impróprias ao consumo foram utilizadas como matéria-prima para a elaboração de formulações para o processamento de filmes biodegradáveis. Os filmes foram obtidos fazendo uso de uma máquina semi-industrial de laminação plástica da Mathis no modo batelada. Pequenas adições de glicerol como plastificante e de pectina como aglutinante foram avaliadas. O processamento via Mathis garantiu lâminas homogêneas e reprodutivas. O glicerol mostrou ser necessário para conferir plasticidade aos filmes. A melhor combinação entre módulo de elasticidade e máxima elongação foi a composição com 4,5% purê obtido da polpa de banana (g purê seco/100 g de solução filmogênica, 5% glicerol (g glicerol/100 g de purê seco e 0,5% pectina (g pectina/100 g de solução filmogênica. A adição de 0,5% de pectina também proporcionou maior estabilidade da coloração dos filmes.

  9. Seleção de variáveis para clusterização de bateladas produtivas através de ACP e remapeamento kernel

    Directory of Open Access Journals (Sweden)

    Victor Leonardo Cervo

    2015-12-01

    Full Text Available Técnicas de clusterização visam à formação de grupos de observações homogêneas dentro de um mesmo grupo e significativamente distintas das observações inseridas em outros grupos. Em processos industriais cuja produção é apoiada em bateladas, a definição de famílias (grupos de bateladas com perfis semelhantes auxilia na definição de estratégias de controle e monitoramento desses processos. Este artigo propõe um método para seleção das variáveis de clusterização mais relevantes para formação de famílias de bateladas. Para tanto, integra funções kernel a um novo índice de importância de variáveis gerado a partir dos parâmetros oriundos da Análise de Componentes Principais (ACP. A qualidade dos agrupamentos formados é avaliada através do Silhouette Index (SI. Quando aplicada em três processos produtivos, a sistemática proposta reteve em média 5,16% das variáveis iniciais e elevou o SI médio em 235,4% frente à utilização de todas as variáveis. Um estudo de simulação também é realizado para avaliar a robustez do método.

  10. Application of RBS and XFA methods to investigation of polyimide films from Mir space station

    International Nuclear Information System (INIS)

    Zatekin, V.V.; Kulikauskas, V.S.; Novikov, L.S.; Petukhov, V.P.; Chernik, V.N.; Chernykh, P.N.; Bakhvalov, Yu.O.; Aleksandrov, N.G.; Smirnova, T.N.

    2008-01-01

    Elemental composition of contaminations of polyimide films were studied by RBS and XFA. The films were exposed to space on orbital space station Mir during in-flight experiment KOMPLAST. Deposit dominating element is shown to be silicon in accordance with another space crafts measurements [ru

  11. ERDA and RBS measurements of Ordered Fiber Structure using Macro Beam

    Czech Academy of Sciences Publication Activity Database

    Peřina, Vratislav; Malinský, Petr; Mikšová, Romana

    (2010), s. 16-16 [Workshop lon Beam Physics. 28.03.2010-31.03.2010, Rossendorf] R&D Projects: GA AV ČR(CZ) KAN400480701; GA ČR GA106/09/0125 Institutional research plan: CEZ:AV0Z10480505 Keywords : ERDA * RBS * fiber structure Subject RIV: BG - Nuclear, Atomic and Molecular Physics, Colliders

  12. A new mapping acquisition and processing system for simultaneous PIXE-RBS analysis with external beam

    International Nuclear Information System (INIS)

    Pichon, L.; Beck, L.; Walter, Ph.; Moignard, B.; Guillou, T.

    2010-01-01

    The combination of ion beam analysis techniques is particularly fruitful for the study of cultural heritage objects. For several years, the AGLAE facility of the Louvre laboratory has been implementing these techniques with an external beam. The recent set-up permits to carry out PIXE, PIGE and RBS simultaneously on the same analyzed spot with a particle beam of approximately 20 μm diameter. A new mapping system has been developed in order to provide elemental concentration maps from the PIXE and RBS spectra. This system combines the Genie2000 spectroscopy software with a homemade software that creates maps by handling acquisition with the object position. Each pixel of each PIXE and RBS maps contains the spectrum normalised by the dose. After analysing each pixel of the PIXE maps (low and high energy X-ray spectra) with the Gupixwin peak-fitting software, quantitative elemental concentrations are obtained for the major and trace elements. This paper presents the quantitative elemental maps extracted from the PIXE spectra and the development of RBS data processing for light element distribution and thin layer characterization. Examples on rock painting and lustrous ceramics will be presented.

  13. RBS and AFM study of Ag and Au diffusion into PET foils influenced by plasma treatment

    Czech Academy of Sciences Publication Activity Database

    Macková, Anna; Švorčík, V.; Strýhal, Z.; Pavlík, J.

    2006-01-01

    Roč. 38, č. 4 (2006), s. 335-338 ISSN 0142-2421 R&D Projects: GA MŠk 1P05OC014 Institutional research plan: CEZ:AV0Z10480505 Keywords : metal diffusion * polymer metal intermixing * RBS * AFM Subject RIV: BL - Plasma and Gas Discharge Physics Impact factor: 1.427, year: 2006

  14. RBS-channeling, ERDA and XRD study of lithium tantalate modified by annealed proton exchange (APE)

    Czech Academy of Sciences Publication Activity Database

    Macková, Anna; Salavcová, L.; Špirková, J.; Groetzschel, R.; Eichhorn, F.

    2006-01-01

    Roč. 249, 1-2 (2006), s. 339-342 ISSN 0168-583X R&D Projects: GA AV ČR(CZ) KJB100480601 Institutional research plan: CEZ:AV0Z10480505 Keywords : RBS-channeling * ERDA * LiTaO3 Subject RIV: BG - Nuclear, Atomic and Molecular Physics, Colliders Impact factor: 0.946, year: 2006

  15. RBS and XPS study of TiOx layers prepared by the PVD technique .

    Czech Academy of Sciences Publication Activity Database

    Macková, Anna; Peřina, Vratislav; Krumeich, J.; Zemek, J.; Kolouch, A.

    2004-01-01

    Roč. 36, č. 8 (2004), s. 1171-1173 ISSN 0142-2421 R&D Projects: GA ČR GP102/01/D069 Institutional research plan: CEZ:AV0Z1048901 Keywords : RBS * ERDA * TiOx Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 1.209, year: 2004

  16. Experimental and Numerical Assessment of a New Alternative of RBS Moment Connection

    Science.gov (United States)

    Mirghaderi, Rasoul; Imanpour, Ali; Torabian, Shahab; Keshavarzi, Farhad

    2008-07-01

    Reduced beam section (RBS) connection has been known as a famous connection for steel moment-resisting seismic frames in high-rise buildings, because of their economical advantages and seismic ductility. In the ordinary RBS connection, often portions of the beam flanges are selectively trimmed in the region adjacent to the beam-to-column connection, and beam section is weakened in the plastic hinge region; section weakening concept in the plastic hinge region of beam cause to reduction of beam plastic section modulus in this region, and force plastic hinge to occur within the reduced section. This paper presents a new alternative of RBS connection that has been used aforesaid weakening concept in it, with this difference that corrugated steel plate webs instead of beam flange cutting has been used in limited specific length near the column face. Corrugated steel plates because of their accordion effect don't have bending rigidity, then using of these plates in plastic hinge region reduces the beam plastic section modulus and plastic hinge is formed in corrugated region. For investigating the seismic behavior and performance of new RBS moment connection, experimental specimen of new RBS connection were subjected to cyclic load, and finite element analysis were executed. The result of cyclic test and numerical analysis specified that the corrugated webs improved the plastic stability and provided capability of large plastic rotation at the plastic hinge location without any appreciable buckling and brittle fractures in this region. The test observations also showed that the specimens' plastic rotations exceeded 0.04 rad without any local and global buckling. All of the analytical results for proposed connection are generally in good agreement with the test observations.

  17. Controle ótimo em reator batelada alimentada para a hidrólise enzimática da celobiose - DOI: 10.4025/actascitechnol.v25i1.2236

    Directory of Open Access Journals (Sweden)

    Fernanda de Castilhos Corazza

    2003-04-01

    Full Text Available A glicose pode ser obtida através da hidrólise enzimática pelas enzimas do complexo celulase. a hidrólise da celobiose pela celobiase exibe inibição pelo substrato e pelo produto, que reduzem a performance da reação. os trabalhos sobre esta hidrólise enzimática disponíveis na literatura foram conduzidos em reatores batelada, portanto um estudo sobre a possibilidade de utilização de outro tipo de reator ainda não foi realizado para esta hidrólise. o objetivo deste trabalho é analisar o uso de um reator batelada alimentada para esta reação enzimática. a política de alimentação foi determinada utilizando a teoria de controle ótimo, onde a conversão do substrato e a concentração do produto final foram maximizadas. os resultados simulados foram comparados com dados experimentais obtidos por calsavara et al. (1999 em um reator batelada e indicaram que a inibição pelo substrato se sobrepõe a inibição pelo produto. a operação em batelada alimentada mostrou-se vantajosa em algumas situações.

  18. Controle multivariado de processos em batelada com duração variável Multivariate statistical control of unsynchronized batch processes

    Directory of Open Access Journals (Sweden)

    Flávio S. Fogliatto

    2008-01-01

    Full Text Available Processos em batelada são utilizados em diversos setores industriais (por exemplo, na manufatura de alimentos e fármacos. Nesses processos, matérias-primas são carregadas em uma unidade de processamento e submetidas a uma série de transformações até a obtenção do produto final. O desempenho do processo é descrito por variáveis, monitoradas ao longo da batelada. Dados resultantes desses processos tendem a apresentar uma estrutura de correlação e autocorrelação significativa, sendo usualmente monitorados usando cartas de controle baseadas na análise de componentes principais (CCPs. Neste artigo, investiga-se o caso especial, bastante freqüente na prática, de bateladas com duração variável, as quais não podem ser diretamente monitoradas através das CCPs. Para tanto, propõe-se uma nova estratégia de controle multivariado da qualidade. No procedimento proposto, bateladas não são alinhadas ou time warped relativamente a suas trajetórias, mas completadas utilizando um esquema de fácil implementação prática. Desta forma, preserva-se toda a informação sobre a variabilidade ao longo do eixo do tempo nos perfis das variáveis de processo. O conjunto de dados completados é analisado utilizando o método Statis e o monitoramento do desempenho da batelada é realizado diretamente nos gráficos de planos fatoriais, a partir dos quais cartas de controle não-paramétricas são derivadas. Um exemplo utilizando dados simulados ilustra a proposta metodológica.Batch processes are widely used in several industrial sectors, such as food and pharmaceutical manufacturing. In a typical batch, raw materials are loaded in the processing unit and submitted to a series of transformations, yielding the final product. Process performance is described by variables which are monitored as the batch progresses. Data arising from such processes are likely to display a strong correlation-autocorrelation structure, and are usually monitored using

  19. Diffusion of Sn in α-Fe Measured by RBS and HIRBS

    International Nuclear Information System (INIS)

    Torres, Dario N.

    1998-01-01

    With the development of Rutherford Back Scattering Spectrometry (RBS) and Heavy Ions RBS (HIRBS) nuclear techniques for the measurement of diffusion phenomena, it was possible to extend the experimental temperature range down to the low temperatures ferromagnetic region. In the present work, the diffusion behaviour of the impurity Sn atoms in the bcc Fe lattice, was analyzed by the above-mentioned techniques. A slight curvature of the Arrhenius plot was observed with the experimental data thus obtained during that transition. The Ruch-Girifalco model was used, which takes into account the ferromagnetic effects on the diffusion coefficient, in order to determine the influence of that phase transition. The magnetic momentum of the impurities seems to play an important role on the behaviour of the impurity element diffusing in the Fe lattice. (author)

  20. RBS characterization of Al2O3 films doped with Ce and Mn

    International Nuclear Information System (INIS)

    Martinez-Martinez, R.; Rickards, J.; Garcia-Hipolito, M.; Trejo-Luna, R.; Martinez-Sanchez, E.; Alvarez-Fregoso, O.; Ramos-Brito, F.; Falcony, C.

    2005-01-01

    Rutherford backscattering (RBS) with 4 He energies from 2 to 6 MeV has been used to study the properties of thin amorphous photoluminescent Al 2 O 3 :Ce,Mn films grown by spray pyrolysis on Corning 7059 glass substrates. The source solutions were AlCl 3 , CeCl 3 and MnCl 2 dissolved in deionized water. Different molar concentrations (Ce 10%; Mn 1%, 3%, 5%, 7% and 10%) were investigated under the same deposition conditions at a substrate temperature of 300 deg. C. The RBS spectra show a homogeneous depth profile of both Ce and Mn within the films, and the measured quantities are consistent with the original solution concentrations. An important amount of Cl, which plays a significant role in luminescent properties, was detected, in both the doped and undoped samples

  1. A 5 MeV RBS microprobe for materials analysis in the semiconductor industry

    Science.gov (United States)

    Klody, G. M.; Schroeder, J. B.; Ferry, J. A.; Pollock, T. J.; Adams, E. D.

    1991-05-01

    In the development and manufacturing environment, there is a growing need for easy analysis of materials within sample regions smaller than 100 νm with automation for unattended multiple-sample analysis. A recently developed system with a new microprobe lens has been tested for industrial applications of microbeam RBS and channeling analysis. A 1.7 MV tandem accelerator, NEC Model 5SDH Pelletron, provides helium ions at energies up to 5.1 MeV. The new electrostatic quadrupole lens is fitted in a Charles Evans & Associates, Inc. Model RBS-400 end station. The accelerator, microprobe beamline, and end station are computer controlled for unattended, multiple sample analysis. We compare the performance of the microprobe lens to ion optic calculations and describe examples of applications.

  2. RBS channeling measurement of damage annealing in InAs/AlSb HEMT structures

    International Nuclear Information System (INIS)

    Hallén, Anders; Moschetti, Giuseppe

    2014-01-01

    Electrical isolation of InAs/AlSb high electron mobility transistors has been achieved by the ion implantation isolation technique. The multilayered structures are grown by molecular beam epitaxy on GaAs substrates. The optimal isolation is provided by damaging patterned areas by 100 keV Ar ions implanted at room temperature using fluence of 2 × 10 15 cm −2 , and then annealing the samples in 365 °C for 30 min. The damage build-up and annealing is studied by channeling Rutherford backscattering spectrometry (RBS) and compared to sheet resistance measurements. Only a low level of damage annealing can be seen in RBS for the post-implant annealed samples, but for Ar fluence higher than 2 × 10 14 cm −2 , a strong electrical resistivity increase can still be achieved

  3. RBS channeling measurement of damage annealing in InAs/AlSb HEMT structures

    Energy Technology Data Exchange (ETDEWEB)

    Hallén, Anders, E-mail: ahallen@kth.se [KTH Royal Institute of Technology, ICT, P.O. Box Electrum 229, SE 164 40 Kista (Sweden); Moschetti, Giuseppe [Chalmers University of Technology, Microtechnology and Nanoscience-MC2, SE-412 96 Gothenburg (Sweden)

    2014-08-01

    Electrical isolation of InAs/AlSb high electron mobility transistors has been achieved by the ion implantation isolation technique. The multilayered structures are grown by molecular beam epitaxy on GaAs substrates. The optimal isolation is provided by damaging patterned areas by 100 keV Ar ions implanted at room temperature using fluence of 2 × 10{sup 15} cm{sup −2}, and then annealing the samples in 365 °C for 30 min. The damage build-up and annealing is studied by channeling Rutherford backscattering spectrometry (RBS) and compared to sheet resistance measurements. Only a low level of damage annealing can be seen in RBS for the post-implant annealed samples, but for Ar fluence higher than 2 × 10{sup 14} cm{sup −2}, a strong electrical resistivity increase can still be achieved.

  4. The Rossendorf broad-range magnetic spectrometer for high resolution RBS and NRA

    International Nuclear Information System (INIS)

    Groetzschel, R.; Klein, Ch.; Kruse, O.

    2001-01-01

    A simple magnetic spectrometer for high resolution RBS and NRA has been designed and installed at a dual beam facility, where both beams from a 3 MV Tandetron and a 500 kV implanter are available. The spectrometer is attached to a UHV scattering chamber with a precision 5-axes goniometer for channeling experiments. The spectrometer is described and details of the design are discussed

  5. Structural analysis of erbium {delta}-doped InP by OMVPE with RBS-channeling

    Energy Technology Data Exchange (ETDEWEB)

    Yuhara, Junji; Takeda, Hitoshi; Matsubara, Naoki; Tabuchi, Masao; Fujiwara, Yasufumi; Morita, Kenji; Takeda, Yoshikazu [Nagoya Univ. (Japan). School of Engineering

    1997-03-01

    We have determined the lattice location of Er in InP {delta}-doped by OMVPE with RBS-channeling. Er concentrations along the <001> and <011> directions are same as random yields, while a significant flux peaking effect is seen for the <111> direction. These data suggest that Er atoms occupy the site equivalent to the hexahedral site in InP lattice. (author)

  6. Timepix and FitPix detection system for RBS/C materials analysis

    CERN Document Server

    David-Bosne, Eric; Wahl, Ulrich

    This thesis reports the implementation of a Timepix position sensitive detector in a ion beam facility with a 0.5 mm collimated beam of 2MeV 1H$^{+}$ and 4He$^{+}$ for use in Rutherford Back-scattering Spectrometry channeling (RBS/C). A complete description is given of the methodology used for energy calibration, RBS data analysis and simulation with the FLUX Monte Carlo simulation program. Energy calibration was performed with internal test pulses and resulting resolution and accuracy were verified in two ways. The first time using a triple alpha source with the isotopes $^{239}$Pu, $^{241}$Am and $^{244}$Cm and secondly using a RBS spectrum of a thin film sample of Au/SiO$_{2}$/C. Setup characterization for channeling measurements was performed using single crystals of Si, 6H$^{-}$SiC and SrTiO$_{3}$. An energy resolution of 47.2 keV at 1862 keV for He$^{+}$ and an angular resolution of 0.11 (standard deviation) was achieved. Count rates as high as 2kHz were achieved with a frame rate of 15 frames/s. Higher...

  7. Positron beam and RBS studies of thermally grown oxide films on stainless steel grade 304

    Science.gov (United States)

    Horodek, P.; Siemek, K.; Kobets, A. G.; Kulik, M.; Meshkov, I. N.

    2015-04-01

    The formation of oxide films on surfaces of stainless steel 304 AISI annealed at 800 °C in vacuum, air and in flow N2 atmospheres was studied using variable energy positron beam technique (VEP) and Rutherford backscattering/nuclear reaction (RBS/NR) methods. In frame of these studies, Doppler broadening of annihilation line (DB) measurements were performed. For a sample heated in vacuum the oxide film ca. 8 nm is observed. For specimens oxidized in air and N2 the multi-layered oxide films of about a few hundred nanometers are recognized. The RBS/NR measurements have shown that the sample annealed in vacuum contains a lower quantity of oxygen while for samples heated in the air and N2 non-linear and rather linear time-dependency are observed, respectively. The thicknesses of total oxide films obtained from RBS/NR tests are in good agreement with the VEP results. Time evolution of the oxide growing was studied as well.

  8. Analysis of obsydians and films of silicon carbide by RBS technique

    International Nuclear Information System (INIS)

    Franco S, F.

    1998-01-01

    Motivated by archaeological interest this work is presented, which consist in the characterization of obsydian samples from different mineral sites in Mexico and films of silicon carbide, undertaken by an Ion Beam Analysis: RBS (Rutherford Back Scattering). As part of an intensive investigation of obsydian in Mesoamerica by anthropologists from Mexico National Institute of Anthropology and History, 818 samples were collected from different volcanic sources in Central Mexico for the purpose of establishing a data bank of element concentrations of each source. Part of this collection was analyzed by Neutron activation analysis and most of the important elements concentrations reported. In the first part of this work, the non-destructive IBA technique, RBS are used to analyze obsydian samples. The last part is an analysis of thin films of silicon carbide as a part of a research program of the Universidad Nacional Autonoma de Mexico and ININ. The application of this technique were carried out at the IF-UNAM, and the analysis was performed at laboratories of the ININ Nuclear Centre facilities. The samples considered in this work were mounted on a sample holder designed for the purpose of exposing each sample to the alpha particles beam. This RBS analysis was carried out with an ET Tandem accelerator at the IF UNAM. The spectrometry was carried out with employing a Si(Li) detector set at 15 degrees in relation to the target normal. The mean projectile energy was 2.00 MeV, and the beam profile was about 4 mm in diameter. As results were founded elemental concentrations of a set of samples from ten different sources: Altotonga (Veracruz), Penjamo (Guanajuato), Otumba (Mexico), Zinapecuaro (MIchoacan), Ucareo (Michoacan), Tres Cabezas (Puebla), Sierra Navajas (Hidalgo), Zaragoza (Puebla), Guadalupe Victoria (Puebla) and Oyameles (Puebla). The mean values are accompanied by errors expressed as one standard devistion of the mean for each element

  9. Analysis of elemental composition of porcelains unearthed from Waguantan kiln site by PIXE–RBS

    International Nuclear Information System (INIS)

    Zhou, Z.; Zhang, K.; Xia, C.D.; Liu, M.T.; Zhu, J.J.; An, Z.; Bai, B.

    2015-01-01

    Highlights: •We analyzed 61 unearthed porcelain shards in Yuan Dynasty by PIXE–RBS. •An electron gun was installed to solve the electric charge accumulations. •The factor analysis was performed for the element compositions. •The “exotic group” porcelain samples unearthed were produced locally. -- Abstract: A method combining proton-induced X-ray emission spectrometry (PIXE) and Rutherford backscattering spectrometry (RBS) was used to determine the composition of 61 porcelain shards from the Yuan Dynasty (1271–1368 A.D.) unearthed from the Waguantan kiln site at Tianzhu County in Guizhou Province, China. Based on our previous experimental setup, an electron gun device with a LaB 6 crystal cathode was installed to solve the problem created when the incident proton beams generated electric charge accumulations on the surfaces of the insulating porcelain samples, which induced a large bremsstrahlung background. The use of the electron gun has largely eliminated the large bremsstrahlung background and has therefore improved the detection limits for elements, especially for trace elements, and made it possible to determine the origin of the porcelains based on the trace elements. Major and trace elemental compositions of the porcelain bodies and glazes measured by PIXE and RBS were analyzed by the factor analysis method. The factor analysis showed that a few pieces of porcelain with a style similar to the porcelain of the Longquan kiln among the unearthed porcelains from the Waguantan kiln site did not have obvious differences in elemental compositions from other remaining porcelains unearthed from the Waguantan kiln site, indicating that the pieces of unearthed porcelain with the Longquan kiln style did in fact belong to the product fired locally by imitating the model of the Longquan celadon with local raw materials. This result therefore indicated that the Longquan kiln technology that originated from the Five Dynasties (907–960 A.D.) had been

  10. [German Language Version and Validation of the Risk-Taking Behaviour Scale (RBS-K) for High-Risk Sports].

    Science.gov (United States)

    Frühauf, Anika; Niedermeier, Martin; Ruedl, Gerhard; Barlow, Matthew; Woodman, Tim; Kopp, Martin

    2017-11-23

    Background  High-risk sports, particularly climbing, kayaking and extreme skiing, have become increasingly popular. The most widely used psychological survey instrument with regard to risk behaviour in sports is the Sensation Seeking Model, mostly assessed by the Sensation Seeking Scale (SSS-V). Until recently, the literature discussed risk behaviour solely through this model. However, this scale does not measure risk-taking behaviours. In contrast, the Risk-Taking Behaviour Scale (RBS-K) is a three-item scale that measures risk behaviour in high-risk sports. This study aimed to validate a German language version of the RBS-K. Methods  The RBS-K was translated and back-translated between English and German. High-risk sports participants (n = 2399) completed the German version of the RBS-K. Of those participants, 820 completed the RBS-K in person as part of a field survey and 1579 participated in an online survey. To validate the questionnaire, the SSS-V, accident involvement, age and sex were evaluated. The RBS-K divides the sample into deliberate risk takers (mean + standard deviation) and risk-averse persons (mean - standard deviation). We tested for internal consistency and correlations with SSS-V, age, sex and accident involvement. Group differences were calculated between deliberate risk takers and risk-averse persons. Results  For internal consistency, we obtained a Cronbach's alpha of 0.56 and a McDonald's omega of 0.63. Significant correlations were shown between RBS-K and SSS-V as well as age and sex. Compared to risk-averse persons (n = 643, 26.8 %), deliberate risk takers (n = 319, 13.3 %) scored significantly higher in sensation seeking, were significantly younger and primarily male and had a significantly higher accident involvement. Conclusion  The RBS-K discriminates well for age, sex and accident involvement. Also, correlations between the RBS-K and the well-established SSS-V are acceptable. With regard to the results and its

  11. An in-situ RBS system for measuring nuclides adsorbed at the liquid-solid interface

    Energy Technology Data Exchange (ETDEWEB)

    Morita, K.; Yuhara, J.; Ishigami, R. [Nagoya Univ. (Japan). School of Engineering] [and others

    1997-03-01

    An in-situ RBS system has been developed in which heavier nuclides adsorbed at the inner surface of a thin lighter window specimen of liquid container in order to determine the rate constants for their sorption and release at the interface. The testing of a thin silicon window of the sample assembly, in which Xe gas of one atmosphere was enclosed, against the bombardment of the probing ion beam has been performed. A desorption behavior of a lead layer adsorbed at the SiO{sub 2} layer of silicon window surface into deionized water has been measured as a preliminary experiment. (author)

  12. RBS and SEM analysis of the nickel-fullerene hybrid systems

    International Nuclear Information System (INIS)

    Vacik, Jiri; Naramoto, Hiroshi; Narumi, Kazumasa; Yamamoto, Shunya; Abe, Hiroaki

    2003-01-01

    Surprising structural variability of the Ni/C 60 /Ni thin film packaging was observed after annealing at elevated temperatures. The thermal processing of the Ni/C 60 /Ni multilayer led to a gradual disruption of the C 60 layer and to the formation of micron-sized octagonal 'pits' and rod-type particles. The unusual thermal response points out the complex physiochemical processes incited in the hybrid system by heat treatment. Here, based on the SEM and RBS analysis, the first insight into the microstructural evolution of the Ni/C 60 /Ni multilayer is presented

  13. Study of CdTe surface by SIMS and RBS ellipsometry

    International Nuclear Information System (INIS)

    Stuck, R.; Hage-Ali, M.; Grob, A.; Siffert, P.

    1978-01-01

    For a better understanding of the mechanisms involved in the rectification of metal-cadmium telluride contacts, the surface of bromine-methanol etched CdTe crystals by means of ellipsometry, secondary ions mass spectroscopy (SIMS) and Rutherford backscattering of charged particles (RBS) has been investigated. The results show that these surfaces are contaminated with bromine and that a tellurium surface oxide layer grows, its thickness increasing with time. This surface layer composition has been analyzed at different steps of its evolution [fr

  14. Scanning RBS-PIXE study of ancient artifacts from South America using a microbeam

    Science.gov (United States)

    Ruvalcaba-Sil, J. L.; Demortier, G.

    1997-07-01

    Pre-Hispanic goldsmiths developed original techniques to manufacture and to gild ornaments and artifacts. Gold metallurgy in ancient America was mainly a surface technology. Surface studies of artifacts from various regions of pre-Hispanic South America were carried out using a 2 MeV proton microbeam (10 μm diameter). Several regions of the artifacts were scanned: RBS and PIXE were used simultaneously to determine the elemental composition and to characterize the homogeneity in depth and at the surface. Complementary information is provided from previous analyses using a macrobeam. Outstanding aspects about the metallurgical processes involved in the gilding of the artifacts have been established.

  15. Towards truly simultaneous PIXE and RBS analysis of layered objects in cultural heritage

    International Nuclear Information System (INIS)

    Pascual-Izarra, Carlos; Barradas, Nuno P.; Reis, Miguel A.; Jeynes, Chris; Menu, Michel; Lavedrine, Bertrand; Ezrati, Jean Jacques; Roehrs, Stefan

    2007-01-01

    For a long time, RBS and PIXE techniques have been used in the field of cultural heritage. Although the complementarity of both techniques has long been acknowledged, its full potential has not been yet developed due to the lack of general purpose software tools for analysing the data from both techniques in a coherent way. In this work we provide an example of how the recent addition of PIXE to the set of techniques supported by the DataFurnace code can significantly change this situation. We present a case in which a non homogeneous sample (an oxidized metal from a photographic plate - heliography - made by Niepce in 1827) is analysed using RBS and PIXE in a straightforward and powerful way that can only be performed with a code that treats both techniques simultaneously as a part of one single and coherent analysis. The optimization capabilities of DataFurnace, allowed us to obtain the composition profiles for these samples in a very simple way

  16. Study of the effect of common infusions on glass ionomers using the PIXE and RBS techniques

    Science.gov (United States)

    Verón, María Gisela; Pérez, Pablo Daniel; Suárez, Sergio Gabriel; Prado, Miguel Oscar

    2017-12-01

    The effect of four commonly consumed beverages as mineral water, coffee, tea and mate tea on the elemental composition of a commercial glass ionomer was studied using Particle Induced X-ray Emission (PIXE) and Rutherford backscattering (RBS) techniques. We found that after immersion in acidic media, some elements as Al, Si and Na are lost from the glass-ionomer whereas others heavier, as K, Ca and La, increase their concentration at the surface. Although the concentration profiles of Al and Si are different in different media, in all of them the Al:Si ratio was close to unity and remained constant for different periods of immersion in all media. The incorporation of K, Mg and Fe to the surface is found for common infusions while for mineral water the glass-ionomer mainly loses F and Na.The RBS technique showed that immersion in different media produced a modification of the density of the glass ionomer surface layer due to the increment of the concentration of heavier elements at the surface. The thickness of the modified surface layer extends up to 3 μm when the immersion time is seven days and more than 6 μm after 33 days of immersion.

  17. Diffusion Experiments in Opalinus Clay: Laboratory, Large-Scale Diffusion Experiments and Microscale Analysis by RBS.

    Energy Technology Data Exchange (ETDEWEB)

    Garcia-Gutierrez, M.; Alonso de los Rios, U.; Missana, T.; Cormenzana, J.L.; Mingarro, M.; Morejon, J.; Gil, P.

    2008-08-06

    The Opalinus Clay (OPA) formation in the Zurcher Weiland (Switzerland) is a potential host rock for a repository for high-level radioactive waste. Samples collected in the Mont Terri Underground Rock Laboratory (URL), where the OPA formation is located at a depth between -200 and -300 m below the surface, were used to study the radionuclide diffusion in clay materials. Classical laboratory essays and a novel experimental set-up for large-scale diffusion experiments were performed together to a novel application of the nuclear ion beam technique Rutherford Backscattering Spectrometry (RBS), to understand the transport properties of the OPA and to enhance the methodologies used for in situ diffusion experiments. Through-Diffusion and In-Diffusion conventional laboratory diffusion experiments were carried out with HTO, 36{sup C}l-, I-, 22{sup N}a, 75{sup S}e, 85{sup S}r, 233{sup U}, 137{sup C}s, 60{sup C}o and 152{sup E}u. Large-scale diffusion experiments were performed with HTO, 36{sup C}l, and 85{sup S}r, and new experiments with 60{sup C}o, 137{sup C}s and 152{sup E}u are ongoing. Diffusion experiments with RBS technique were done with Sr, Re, U and Eu. (Author) 38 refs.

  18. Evolution of Zr/Hf/Zr trilayers during annealing studied by RBS

    International Nuclear Information System (INIS)

    Kling, A.; Soares, J.C.

    2010-01-01

    The Zr/Hf system is highly interesting due its various applications, e.g. formation of amorphous ternary alloys, superconductive properties and production of gate oxide layers with high dielectric coefficients by oxidation of Zr/Hf multilayers. In this work Zr/Hf/Zr trilayers with an individual layer thickness of approximately 50 nm were deposited by electron gun evaporation on a substrate consisting of silicon covered by a micrometer thick thermal oxide layer. Samples were subjected to annealing procedures at 500 and 1200 o C in flowing air atmosphere to promote oxidation and Zr/Hf interdiffusion effects. RBS studies of the as-deposited and annealed samples were performed at the van-de-Graaff accelerator of ITN using He + and H + beams with energies between 2.0 and 2.525 MeV in order to study compositional changes induced by the heat treatment. In the case of low-temperature annealing the layer system appears, besides the oxidation process starting from the surface, to be stable. On the other hand, high-temperature annealing leads to an asymmetric Hf-diffusion into the surface and interior Zr-layer provoked by anomalous diffusion due to a phase transition in Zr accompanied by an almost complete oxidation of the layer structure Oxygen and metal depth distributions obtained by RBS in the as-deposited and treated samples are provided.

  19. PIXE/RBS as a tool to study cementitious materials: Application to the dynamic leaching of concrete

    Energy Technology Data Exchange (ETDEWEB)

    Llorente, I., E-mail: irene@cenim.csic.e [Centro Nacional de Investigaciones Metalurgicas (CENIM-CSIC), Avda Gregorio del Amo, 8, 28040 Madrid (Spain); Castellote, M. [Instituto de Ciencias de la Construccion ' Eduardo Torroja' (IETcc-CSIC), Serrano Galvache, 4, 28033 Madrid (Spain); Gonzalez-Arrabal, R. [Parque Cientifico de Madrid, Campus de Cantoblanco, Einstein 13, 28049 Madrid (Spain); Ynsa, M.D.; Munoz-Martin, A. [Centro de Microanalisis de Materiales (CMAM), Universidad Autonoma de Madrid, Campus de Cantoblanco, 28049 Madrid (Spain); Viedma, P.G. de; Castillo, A.; Martinez, I.; Andrade, C. [Instituto de Ciencias de la Construccion ' Eduardo Torroja' (IETcc-CSIC), Serrano Galvache, 4, 28033 Madrid (Spain); Zuloaga, P.; Ordonez, M. [Empresa Nacional de Residuos Radiactivos, S.A. (ENRESA), Emilio Vargas, 7, 28043 Madrid (Spain)

    2009-12-15

    The suitability of the application of Ion Beam Analysis (IBA) techniques such as Particle Induced X-ray Emission spectrometry (PIXE) and Rutherford Backscattering Spectrometry (RBS) to elemental depth profiling in concrete is analysed, studying hardened samples of concrete prior to and after a dynamic leaching test. A calibration of the data has been done by comparing the results obtained by IBA techniques with those obtained by Chemical and Thermogravimetric Analysis (TG/DTA). From PIXE and RBS data relevant information about the migration of minor elements, within the concrete matrix after leaching is obtained.

  20. PIXE/RBS as a tool to study cementitious materials: Application to the dynamic leaching of concrete

    International Nuclear Information System (INIS)

    Llorente, I.; Castellote, M.; Gonzalez-Arrabal, R.; Ynsa, M.D.; Munoz-Martin, A.; Viedma, P.G. de; Castillo, A.; Martinez, I.; Andrade, C.; Zuloaga, P.; Ordonez, M.

    2009-01-01

    The suitability of the application of Ion Beam Analysis (IBA) techniques such as Particle Induced X-ray Emission spectrometry (PIXE) and Rutherford Backscattering Spectrometry (RBS) to elemental depth profiling in concrete is analysed, studying hardened samples of concrete prior to and after a dynamic leaching test. A calibration of the data has been done by comparing the results obtained by IBA techniques with those obtained by Chemical and Thermogravimetric Analysis (TG/DTA). From PIXE and RBS data relevant information about the migration of minor elements, within the concrete matrix after leaching is obtained.

  1. Fechamento sequencial da parede abdominal com tração fascial contínua (mediada por tela ou sutura e terapia a vácuo

    Directory of Open Access Journals (Sweden)

    Fernando Ferreira

    Full Text Available Na última década multiplicaram-se as publicações e a utilização da cirurgia de controle de danos, resultando num número crescente de pacientes deixados com o abdome aberto (ou peritoneostomia. Uma das consequências nefastas do abdome aberto são as hérnias ventrais gigantes que resultam da impossibilidade de se fechar o abdome durante a internação hospitalar do paciente. Para minimizar esta sequela têm surgido na literatura diferentes tipos de abordagem. Para abordar este tópico, a reunião de revista "Telemedicina Baseada em Evidência - Cirurgia do Trauma e Emergência" (TBE-CiTE optou por não analisar sistemas comerciais de fechamento abdominal dinâmico, com exceção da terapia de pressão negativa ou vácuo. O grupo fez uma avaliação crítica dirigida de três artigos mais relevantes publicados recentemente sobre fechamento sequencial da parede abdominal (com tela ou sutura mais vácuo. Nesta avaliação foram incluídos dois estudos retrospectivos mais um estudo prospectivo. Baseados na análise crítica desses 3 estudos mais a discussão que contou com a participação de representantes de 6 Universidades e realizada via telemedicina, são feitas as seguintes recomendações: (1 a associação de terapia de pressão negativa com tração fascial constante mediada por tela ou sutura, ajustada periodicamente, parece ser uma ótima estratégia cirúrgica para o tratamento de peritoneostomias. (2 O fechamento abdominal primário dinâmico com sutura e mediada por tela parece ser mais econômico e eficiente do que deixar o paciente com uma hérnia gigante e planejar uma reconstrução complexa tardiamente. Novos estudos com grupos maiores de pacientes separados de acordo com as diferentes apresentações e doenças são necesários para definir qual o melhor método cirúrgico para o tratamento de peritoneostomias.

  2. Analysis of elemental composition of porcelains unearthed from Waguantan kiln site by PIXE–RBS

    Energy Technology Data Exchange (ETDEWEB)

    Zhou, Z. [Key Laboratory of Radiation Physics and Technology of Ministry of Education, Institute of Nuclear Science and Technology, Sichuan University, Chengdu 610064 (China); Zhang, K. [School of History and Culture, Sichuan University, Chengdu 610064 (China); Xia, C.D.; Liu, M.T.; Zhu, J.J. [Key Laboratory of Radiation Physics and Technology of Ministry of Education, Institute of Nuclear Science and Technology, Sichuan University, Chengdu 610064 (China); An, Z., E-mail: anzhu@scu.edu.cn [Key Laboratory of Radiation Physics and Technology of Ministry of Education, Institute of Nuclear Science and Technology, Sichuan University, Chengdu 610064 (China); Bai, B., E-mail: baibin@scu.edu.cn [School of History and Culture, Sichuan University, Chengdu 610064 (China)

    2015-03-01

    Highlights: •We analyzed 61 unearthed porcelain shards in Yuan Dynasty by PIXE–RBS. •An electron gun was installed to solve the electric charge accumulations. •The factor analysis was performed for the element compositions. •The “exotic group” porcelain samples unearthed were produced locally. -- Abstract: A method combining proton-induced X-ray emission spectrometry (PIXE) and Rutherford backscattering spectrometry (RBS) was used to determine the composition of 61 porcelain shards from the Yuan Dynasty (1271–1368 A.D.) unearthed from the Waguantan kiln site at Tianzhu County in Guizhou Province, China. Based on our previous experimental setup, an electron gun device with a LaB{sub 6} crystal cathode was installed to solve the problem created when the incident proton beams generated electric charge accumulations on the surfaces of the insulating porcelain samples, which induced a large bremsstrahlung background. The use of the electron gun has largely eliminated the large bremsstrahlung background and has therefore improved the detection limits for elements, especially for trace elements, and made it possible to determine the origin of the porcelains based on the trace elements. Major and trace elemental compositions of the porcelain bodies and glazes measured by PIXE and RBS were analyzed by the factor analysis method. The factor analysis showed that a few pieces of porcelain with a style similar to the porcelain of the Longquan kiln among the unearthed porcelains from the Waguantan kiln site did not have obvious differences in elemental compositions from other remaining porcelains unearthed from the Waguantan kiln site, indicating that the pieces of unearthed porcelain with the Longquan kiln style did in fact belong to the product fired locally by imitating the model of the Longquan celadon with local raw materials. This result therefore indicated that the Longquan kiln technology that originated from the Five Dynasties (907–960 A.D.) had been

  3. Possibility of analysis using RBS, PIXE and nuclear reaction on the electrostatic Pelletron accelerator 5SDH-2

    International Nuclear Information System (INIS)

    Nguyen The Nghia; Bui Van Loat; Le Hong Khiem

    2011-01-01

    The electrostatic Pelletron accelerator 5SDH-2 is installing at Hanoi University of Sciences. This accelerator will be the first tandem electrostatic accelerator installed in Vietnam. The schematic structure, principle of operation of the machine and its application for analysis using Rutherford Back Scattering (RBS), Particle-Induced X-ray Emission (PIXE) and Nuclear Reaction Analysis (NRA) will be presented. (author)

  4. Comparative concentration analysis of Cr and Co in FeSi2 films performed by ERDA and RBS

    International Nuclear Information System (INIS)

    Bohne, W.; Reinsperger, G.-U.; Roehrich, J.; Roeschert, G.; Selle, B.; Stauss, P.

    2000-01-01

    Thin films of β-FeSi 2 doped by Co or Cr were grown on Si substrates by molecular beam epitaxy (MBE) using three separately controlled evaporation sources. The dopant concentration was measured concurrently by heavy-ion ERDA with 129 Xe ions of 140-250 MeV, by heavy-ion RBS with 15 MeV 14 N and by standard RBS with 1.4 MeV 4 He ions. Among these techniques, the TOF-ERDA was most powerful in providing a high mass resolution and a low detection limit for Co and Cr (∼0.1 at.%). Because of the complete overlap of the dopant signals with the Fe signal the standard RBS spectra were evaluated by relying on the differences between the scattering cross-sections from the dopant atoms and Fe. This approach proved to be applicable as far as the dopants had a constant depth profile with sufficiently high concentration. For Cr concentrations exceeding the miscibility limit the RBS results deviate significantly from those of ERDA due to increasing dopant depth inhomogeneities

  5. Characterization of a silver-incorporated calcium phosphate film by RBS and its antimicrobial effects

    Energy Technology Data Exchange (ETDEWEB)

    Han, I-H [Institute of Physics and Applied Physics, and Atomic-Scale Surface Science Research Center, Yonsei University, Seou1 120-749 (Korea, Republic of); Lee, I-S [Institute of Physics and Applied Physics, and Atomic-Scale Surface Science Research Center, Yonsei University, Seou1 120-749 (Korea, Republic of); Song, J-H [Advanced Analysis Center, Korea Institute of Science and Technology, Seoul 136-791 (Korea, Republic of); Lee, M-H [Department of Medical Engineering, Yonsei University, Seoul 120-752 (Korea, Republic of); Park, J-C [Department of Medical Engineering, Yonsei University, Seoul 120-752 (Korea, Republic of); Lee, G-H [Korea Institute of Machinery and Materials, Chang-Won 641-010 (Korea, Republic of); Sun, X-D [Department of Materials Science and Engineering, Tsinghua University, Beijing 100084 (China); Chung, S-M [Implantium Research Center, Seoul 135-879 (Korea, Republic of)

    2007-09-15

    A thin calcium phosphate film was synthesized on both commercially pure Ti and Si wafers by electron beam evaporation of hydroxyapatite as an evaporant with simultaneous Ar ion beam bombardments. Silver was introduced into an ion-beam-assisted deposition of a calcium phosphate thin film for antimicrobial effect. The amount of incorporated silver ions was controlled by immersing calcium-phosphate-coated samples in different AgNO{sub 3} concentrations, and Rutherford backscattering spectrometry (RBS) was employed to measure the amounts of substituted silver. The higher concentration of silver in the calcium phosphate film was more effective in reducing the bacteria of Escherichia coli ATCC 8739 and Streptococcus mutans OMZ 65 on contact with respect to controls.

  6. Characterization of a silver-incorporated calcium phosphate film by RBS and its antimicrobial effects

    International Nuclear Information System (INIS)

    Han, I-H; Lee, I-S; Song, J-H; Lee, M-H; Park, J-C; Lee, G-H; Sun, X-D; Chung, S-M

    2007-01-01

    A thin calcium phosphate film was synthesized on both commercially pure Ti and Si wafers by electron beam evaporation of hydroxyapatite as an evaporant with simultaneous Ar ion beam bombardments. Silver was introduced into an ion-beam-assisted deposition of a calcium phosphate thin film for antimicrobial effect. The amount of incorporated silver ions was controlled by immersing calcium-phosphate-coated samples in different AgNO 3 concentrations, and Rutherford backscattering spectrometry (RBS) was employed to measure the amounts of substituted silver. The higher concentration of silver in the calcium phosphate film was more effective in reducing the bacteria of Escherichia coli ATCC 8739 and Streptococcus mutans OMZ 65 on contact with respect to controls

  7. RBS cross-section of MeV ions channeling in crystals from quantum theory

    International Nuclear Information System (INIS)

    Den Besten, J.L.; Jamieson, D.N.; Spizzirri, P.G.; Allen, L.J.

    1999-01-01

    We present an alternative approach to describing Rutherford Backscattered (RBS) angular yield scans. The Bloch wave method to formulate the cross-section is a fundamental approach originating from Schrodinger's equation. This quantum formulation is often used when describing various aspects of electron diffraction including Backscattering, EDX and TEM but has seen little application to the very short wavelength regime of MeV ions. It offers several significant advantages. Great freedom is given to crystal properties and structure in the theory allowing a fundamental insight into the channeling phenomena and hence the crystal itself. We have calculated both planar and axial channeling scans and these maps are shown to be in good agreement to their experimental counterparts. There is excellent correlation between the theoretical and experimental results for both χ min and Ψ 1/2 . Further investigation is required into the area of absorption or dechanneling. This phenomenon requires different mechanisms for electron and ion scattering differ greatly

  8. Silver surface enrichment controlled by simultaneous RBS for reliable PIXE analysis of ancient coins

    International Nuclear Information System (INIS)

    Beck, L.; Alloin, E.; Berthier, C.; Reveillon, S.; Costa, V.

    2008-01-01

    Evidence of silver surface enrichment of ancient silver-copper coins has been pointed out in the past years. Surface enrichment can be fortuitous or intentional. In this paper, we have investigated the cleaning procedures usually performed after excavation or in museums. We have shown that chemicals or commercial products routinely used dissolve preferentially the copper phase and consequently contribute to the silver surface enrichment. As a result, surface analyses such as PIXE or XRF can be strongly affected by this effect. By using simultaneously RBS and PIXE, it is possible to check through the silver surface enrichment and then select the reliable measurements, characteristic of the bulk composition. Results on coins recently discovered and mechanically or chemically cleaned are presented

  9. RBS and NRA of cobalt oxide thin films prepared by the sol-gel process

    International Nuclear Information System (INIS)

    Andrade, E.; Huerta, L.; Pineda, J.C.; Zavala, E.P.; Barrera, E.; Rocha, M. F.; Vargas, C.A.

    2001-01-01

    This work presents a study of cobalt oxide thin films produced by the sol-gel process on aluminum and glass substrates. These films have been analyzed using two ion beam analysis (IBA) techniques: a) a standard RBS 4 He 2 MeV and b) nuclear reaction analysis (NRA) using a 1 MeV deuterium beam. The 12 C(d,p 0 ) 13 C nuclear reaction provides information that carbon is incorporated into the film structure, which could be associated to the sinterization film process. Other film measurements such as optical properties, XRD, and SEM were performed in order to complement the IBA analysis. The results show that cobalt oxide film coatings prepared by this technique have good optical properties as solar absorbers and potential uses in solar energy applications

  10. Study of ancient Islamic gilded pieces combining PIXE-RBS on external microprobe with sem images

    International Nuclear Information System (INIS)

    Ynsa, M.D.; Gutierrez, P.C.; Enguita, O.; Chamon, J.; Pardo, A.I.; Arroyo, M.; Barrio, J.; Gomez-Morilla, I.; Ferretti, M.; Climent-Font, A.

    2008-01-01

    Numerous metallic objects with very aesthetic and technological qualities have been recovered by archaeological excavations. Adequate processes of restoration and conservation treatments require the accurate determination of the elemental composition and distribution within the objects, as well as the identification of the nature and distribution of the corrosion products. Ideally the identification method should cause no alteration in the sample. In this work, different archaeological pieces with a gilded look have been characterized using simultaneously PIXE and RBS at the CMAM external microprobe in order to study the gilding metalworking done in the Iberian Peninsula during the Middle Ages. The gold layer thickness and its elemental concentrations of Ag, Au and Hg were determined by both techniques and compared with the scanning electron microscopy images obtained for some fragments of pieces. (orig.)

  11. Performance of resistive-charge position sensitive detectors for RBS/Channeling applications

    Energy Technology Data Exchange (ETDEWEB)

    Miranda, P.A., E-mail: pjmirand@gmail.com [Centro de Ciências e Tecnologias Nucleares, Instituto Superior Técnico, Universidade de Lisboa, 2696-953 Sacavém (Portugal); Wahl, U. [Centro de Ciências e Tecnologias Nucleares, Instituto Superior Técnico, Universidade de Lisboa, 2696-953 Sacavém (Portugal); Catarino, N. [Instituto de Plasmas e Fusão Nuclear, Instituto Superior Técnico, Universidade de Lisboa, 2696-953 Sacavém (Portugal); Ribeiro da Silva, M. [Centro de Física Nuclear da Universidade de Lisboa, Avenida Prof. Gama Pinto 2, 1649-003 Lisboa (Portugal); Alves, E. [Instituto de Plasmas e Fusão Nuclear, Instituto Superior Técnico, Universidade de Lisboa, 2696-953 Sacavém (Portugal)

    2014-10-01

    The performance of two types of 1×1 cm{sup 2} photodiode position sensitive detectors (PSDs) based on resistive charge division was evaluated for their use in Rutherford Backscattering/Channeling (RBS/C) experiments in blocking geometry. Their energy resolution was first determined for ∼5.5MeV alpha particles from a radioactive sources, and values of full width half maximum (FWHM) of 22 keV and 33 keV were achieved using a shaping time constant of τ=2.0μs. Additional tests were performed using backscattered {sup 4}He particles from the 2.0 MeV beam of a Van de Graaff accelerator. While the 22 keV FWHM detector failed after exposure to less than 5×10{sup 6} cm{sup −24}He particles, the other did not show any noticeable deterioration due to radiation damage for a fluence of 4×10{sup 8} cm{sup −2}. For this type of PSD position resolution (τ=0.5μs) standard deviations of ΔL=0.072mm at ∼5.5MeV and ΔL=0.247mm at 1.1 MeV were achieved. RBS/Channeling experiments using PSD were performed on several crystalline samples, showing that this setup seems suitable for lattice location studies, particularly for heavy ions implantation (D≳10{sup 15}at/cm{sup 2}) on light substrates like Si, SiC, and AlN.

  12. Lattice location of impurities in semiconductors: a RBS/channeling and proton-induced x-ray emission study

    Energy Technology Data Exchange (ETDEWEB)

    Kringhoj, P. [Australian National Univ., Canberra, ACT (Australia). Research School of Physical Sciences

    1993-12-31

    Rutherford backscattering spectrometry (RBS)/channeling and proton-induced x-ray emission (PIXE) are two well established and characterised techniques. Over the last three decades RBS/channeling measurements has been performed to extract the substitutional fraction of impurities in both elemental and compound semiconductors. However, due to the limitation of RBS, only elements heavier than the host crystal can be examined (except for a few elements, where a nuclear reaction or a resonance can be used). In silicon this limitation is acceptable, due to the low mass of Si, but in the III-V compounds (e.g. InP), the technique is limited to a few elements of hardly no technological or fundamental interest. One can overcome this by combining RBS/channeling with PIXE, where PIXE is applied to detect elements with a mass lower than the host crystal. In the present work, the lattice location of Ge in InP has been studied and compared to the group-III impurity Ga, and the group-VI impurity Se which is known to be a donor. The (RBS)/channeling technique has been used to detect not only the substitutional fraction, but also the relative population of the two sublattices. The half-width is approximately equal to the characteristic angle, {psi}{sub 1}. The channeling data obtained indicate that all three dopants are located exclusively on substitutional sites and that Ga is occuping the In position, Se theP position and that Ge is distributed equally between both sublattices. 6 refs., 1 tab., 3 figs.

  13. Tratamento de efluente sintético de laticínio em reatores em batelada inoculados com Aspergillus niger AN400

    Directory of Open Access Journals (Sweden)

    Luana Viana Costa e Silva

    2013-12-01

    Full Text Available Indústrias de laticínios contêm elevada concentração de matéria orgânica que podem causar poluição. Este trabalho propôs estudar a remoção de matéria orgânica e de nutrientes de um efluente sintético de laticínio, disposto em reatores em bateladas repetidas inoculados com Aspergillus niger AN400. O sistema foi composto por reatores com diferentes configurações e, para cada tipo de montagem, variou-se o material-suporte. O estudo foi realizado em quatro ciclos de cinco dias, com retiradas diárias de alíquotas. A análise dos resultados mostrou eficiência de remoção de demanda química de oxigênio com picos de até 71,7%, concluindo-se que a tecnologia mostrou-se viável na remoção de matéria orgânica. Em relação aos nutrientes, o sistema pôde remover satisfatoriamente nitrato; contudo, para remoção de amônia, não se apresentou promissor.

  14. Characterization of pre-Hispanic pottery from Teotihuacan, Mexico, by a combined PIXE-RBS and XRD analysis

    Energy Technology Data Exchange (ETDEWEB)

    Ruvalcaba-Sil, J.L.; Ontalba Salamanca, M.A.; Manzanilla, L.; Miranda, J.; Canetas Ortega, J.; Lopez, C

    1999-04-02

    A combined analysis of IBA techniques (Proton Induced X-ray Emission (PIXE) and Rutherford Backscattering Spectroscopy (RBS)) and a complementary study by X-ray Diffraction (XRD) were performed to characterize pottery corresponding to the Epiclassic period (A.D. 700-900) from Teotihuacan, Mexico. Elemental compositions of pottery samples were measured by simultaneous PIXE and RBS using 2.6 MeV protons. Red, white and brown pottery pigments were studied by non-vacuum PIXE and a proton beam of 3 MeV. The various mineralogical phases of the pottery were identified by XRD. From pottery elemental compositions and its mineralogical phases, some differences among the pottery samples and groups were established.

  15. Characterization of pre-Hispanic pottery from Teotihuacan, Mexico, by a combined PIXE-RBS and XRD analysis

    International Nuclear Information System (INIS)

    Ruvalcaba-Sil, J.L.; Ontalba Salamanca, M.A.; Manzanilla, L.; Miranda, J.; Canetas Ortega, J.; Lopez, C.

    1999-01-01

    A combined analysis of IBA techniques (Proton Induced X-ray Emission (PIXE) and Rutherford Backscattering Spectroscopy (RBS)) and a complementary study by X-ray Diffraction (XRD) were performed to characterize pottery corresponding to the Epiclassic period (A.D. 700-900) from Teotihuacan, Mexico. Elemental compositions of pottery samples were measured by simultaneous PIXE and RBS using 2.6 MeV protons. Red, white and brown pottery pigments were studied by non-vacuum PIXE and a proton beam of 3 MeV. The various mineralogical phases of the pottery were identified by XRD. From pottery elemental compositions and its mineralogical phases, some differences among the pottery samples and groups were established

  16. RBS analysis of ions implanted in light substrates exposed to hot plasmas laser-generated at PALS

    Czech Academy of Sciences Publication Activity Database

    Torrisi, L.; Gammino, S.; Picciotto, A.; Wolowski, J.; Krása, Josef; Láska, Leoš; Calcagnile, L.; Quarta, G.

    2005-01-01

    Roč. 160, 10-12 (2005), s. 685-695 ISSN 1042-0150. [Workshop PIBHI 2005 /2./. Giardini Naxos, 08.06.06-11.06.06] R&D Projects: GA MŠk(CZ) LC528 Institutional research plan: CEZ:AV0Z10100523 Keywords : RBS analysis * ion implantation * plasma-generated by lasers Subject RIV: BH - Optics, Masers, Lasers Impact factor: 0.353, year: 2005

  17. Depth dependent charge state distributions of heavy MeV ions in RBS and ERD experiments

    Science.gov (United States)

    Jamecsny, S.; Carstanjen, H. D.

    1997-04-01

    At the Max-Planck-Institut für Metallforschung in Stuttgart, Germany, a 6 MV Pelletron accelerator is being used for surface analysis by means of high resolution RBS and ERD using an electrostatic spectrometer. For the ERD analysis of ions heavier than hydrogen the recording of a second parameter is necessary to identify the particle species and its charge state. For this purpose a set-up was installed that combines the high energy resolution of the spectrometer with a measurement of the time of flight of the ions through the spectrometer using a chopped ion beam. The technique also allows to measure charge state dependent depth profiles. Energy spectra of all observable charge states were recorded for backscattered Ne and Ar ions from Au and of recoil O ions from Ta 2O 5 and Al 2O 3. The comparison of a computer simulation of the charge exchange processes with the measurements of Ar scattering on Au yields mean free path lengths for electron capture and loss.

  18. Authenticity determination of Ag-Cu Lebanese coins using combined PIXE and RBS techniques

    International Nuclear Information System (INIS)

    Roumie, M; Nsouli, B; Assafiri, Y

    2012-01-01

    A set of silver-copper coins were investigated for their stochiometry in order to check any possible counterfeit. The studied coins are 50 Lebanese Piastres and are relatively recent, minted in 1952. They are supposed to have nominal concentration of 60 wt.% Ag and 40 wt.% Cu. In this work, it is shown the utility and capability of combining PIXE (particle induced X-ray emission) and RBS (Rutherford backscattering spectrometry) techniques to determine the elemental content and check the presence, if any, of surface layer. For this aim, 3 MeV proton beam and Al funny filter, used as x-ray absorber, were used to determine the elemental composition, based on the emission and detection of the characteristic x-rays of the corresponding elements. The first PIXE results of the supposed bulky coins showed an excess of silver composition vs. copper. In addition, the experimental protocol was checked by analyzing some other coins of known composition, such as 1-euro and 2-euro coins.

  19. A 3D-RBS study of irradiation-induced deformation and masking properties of ordered colloidal nanoparticulate masks

    Energy Technology Data Exchange (ETDEWEB)

    Zolnai, Z., E-mail: zolnai@mfa.kfki.h [Research Institute for Technical Physics and Materials Science, P.O.B. 49, H-1525 Budapest (Hungary); Deak, A.; Nagy, N.; Toth, A.L. [Research Institute for Technical Physics and Materials Science, P.O.B. 49, H-1525 Budapest (Hungary); Kotai, E. [Research Institute for Particle and Nuclear Physics, P.O.B. 49, H-1525 Budapest (Hungary); Battistig, G. [Research Institute for Technical Physics and Materials Science, P.O.B. 49, H-1525 Budapest (Hungary)

    2010-01-01

    The 500 keV Xe{sup 2+} irradiation-induced anisotropic deformation of ordered colloidal silica nanoparticulate masks is followed using 2 MeV {sup 4}He{sup +} Rutherford Backscattering Spectrometry (RBS) with different measurement geometries and the improved data analysis capabilities of the RBS-MAST spectrum simulation code. The three-dimensional (3D) geometrical transformation from spherical to oblate ellipsoidal and polygonal shape and the decrease of the mask's hole size is described. The masking properties of the silica monolayer and the depth distribution of Xe in the underlying Si substrate vs. the irradiated Xe{sup 2+} fluence are discussed. Field Emission Scanning Electron Microscopy (FESEM) is applied as complementary characterization tool. Our results give contribution to clarify the impact of ion-nanoparticle interactions on the potentials and limits of nanosphere lithography. We also show the capability of the conventional RBS technique to characterize laterally ordered submicron-sized three-dimensional structures.

  20. Characterisation by PIXE RBS of metallic contamination of tissues surrounding a metallic prosthesis on a knee

    Science.gov (United States)

    Guibert, G.; Irigaray, J. L.; Moretto, Ph.; Sauvage, T.; Kemeny, J. L.; Cazenave, A.; Jallot, E.

    2006-09-01

    Implants used as biomaterials have to fulfill conditions of functionality, compatibility and sometimes bioactivity. There are four main families of biomaterials: metals and metal alloys, polymers, bioceramics and natural materials. Because of corrosion and friction in the human body, implants generate debris. This debris may develop toxicity, inflammation and prosthetic unsealing by osseous dissolution. Nature, size, morphology and amount of debris are the parameters influencing the tissue responses. In this paper, we characterised metallic contamination produced by knee prosthesis, composed with TiAl 6V 4 or Co-Cr-Mo alloys, into surrounding capsular tissue by depth migration, in vivo behaviour, content, size and nature of debris by PIXE (Particle Induced X-ray Emission) method associated with RBS (Rutherford Backscattering Spectroscopy). Debris distribution in the whole articulation is very heterogeneous. Debris migrates several thousand micrometers in tissues, with a characteristic decrease. Solid metallic particles of about micrometer size are found in the most polluted samples, in both alloys TiAl 6V 4 and Cr-Co-Mo. In the mean volume analysed by PIXE, the concentration mass ratios [Ti]/[V] and [Co]/[Cr] confirm the chemical stability of TiAl 6V 4 debris and show the chemical evolution of Cr-Co-Mo debris. Development of a protocol to prepare thin targets permits us to correlate PIXE and histological analysis in the same zone. The fibrous tissue (collagen fibres, fibroblasts) and macrophage cells are observed with optical microscope in polluted areas. This protocol could locate other pathologies in ppm contamination range, thanks to the great sensitivity of the PIXE method.

  1. Pt-CdTe Detectors Spectroscopic Performances and RBS and XRF Interface Composition Analysis

    Science.gov (United States)

    Raulo, A.; Sowinska, M.; Hennard, G.; Campajola, L.; Marano, D.; Paternoster, G.; Perillo, E.

    2012-08-01

    X- and Gamma-Ray spectroscopy measurements have been performed on differently prepared CdTe samples (as-grown or annealed, different surface treatments, etc.) with Pt electrodes deposited by electroless technique in order to extract the typical figures of merit of the material and the detectors. Moreover, Rutherford Backscattering Spectrometry (RBS) using 8 MeV 7Li+++ ions and X-Ray Fluorescence (XRF) using a Pd-anode X-Ray generator were performed to characterize the crystal surface as well as the semiconductor-electrode interface. The thickness, the stoichiometry and the concentration profiles of platinum, cadmium and tellurium present at the surface layers were determined. The distribution of Cd deficiency at the interface layers was profiled using simulations and showed complex profiles in the samples, that can greatly affect the electrical quality of the detectors. In addition, resistivity and mu-tau product mapping and electrical measurements have been performed for material characterization. The aim of this work is to understand and improve the structure of the material-electrode interface; in particular, to understand the effect of the annealing process on the fabrication of the contacts and, at the end, on the performances of the detectors. For this reason a large number of detectors have been produced applying various chemical surface treatments on as-grown and annealed material, in order to determine the best routine way to fabricate high-quality X- and Gamma-ray detectors to be used both as large size planar detectors and as elements of imaging systems in medical or industrial applications.

  2. Nuclear techniques (PIXE and RBS) applied to analysis of pre hispanic metals of the Templo Mayor at Tenochtitlan; Tecnicas nucleares (PIXE y RBS) aplicadas al analisis de metales prehispanicos del Templo Mayor de Tenochtitlan

    Energy Technology Data Exchange (ETDEWEB)

    Mendez U, I.; Tenorio, D.; Galvan, J.L. [Instituto Nacional de Investigaciones Nucleares, A.P. 18-1027, 11801 Mexico D.F. (Mexico)

    2000-07-01

    This work has the objective of determining by means of the utilization of nuclear techniques (PIXE and RBS) the composition and the alloy type of diverse aztec ornaments corresponding to Post classic period, they were manufactured principally with copper and gold such as bells, beads and disks; all they belonging at 9 oblations of Templo Mayor of Tenochtitlan. It is presented here briefly the historical and archaeological antecedents of the devices as well as the analytical methods for conclude with the results obtained. (Author)

  3. Gráficos de controle multivariados para monitoramento de processos não lineares em bateladas Multivariate control charts for monitoring non-linear batch processes

    Directory of Open Access Journals (Sweden)

    Danilo Marcondes Filho

    2011-03-01

    Full Text Available Processos industriais em bateladas são empregados com frequência na produção de certos itens. Tais processos disponibilizam uma estrutura de dados peculiar; diante disso, existe um crescente interesse no desenvolvimento de gráficos de controle multivariados mais apropriados para seu monitoramento. Investiga-se aqui uma abordagem recente que utiliza gráficos de controle baseados no método Statis. O Statis constitui-se em uma técnica exploratória que permite avaliar similaridade entre matrizes de dados. Entretanto, essa técnica considera a similaridade em um contexto linear, investigando estruturas de correlação lineares nos dados. Propõe-se neste artigo a utilização de gráficos de controle baseados no Statis em conjunto com kernels para monitoramento de processos com presença de não linearidades fortes. Através dos kernels, definem-se funções não lineares dos dados para melhor representação da estrutura a ser caracterizada pelo método Statis. Essa nova abordagem, denominada kernel-Statis, é desenvolvida e avaliada utilizando dados de um processo simulado.Industrial batch processes are widely used in the production of certain items. Such processes provide a peculiar data structure; therefore there is a growing interest in the development of customized multivariate control charts for their monitoring. We investigate a recent approach that uses control charts based on the Statis method. Statis is an exploratory technique for measuring similarities between data matrices. However, the technique only assesses similarities in a linear context, i.e. investigating structures of linear correlation in the data. In this paper we propose control charts based on the Statis method in conjunction with a kernel for monitoring processes in the presence of strong nonlinearities. Through kernels we define nonlinear functions of data for better representing the structure to be characterized by the Statis method. The new approach, named

  4. The LacI–Family Transcription Factor, RbsR, Is a Pleiotropic Regulator of Motility, Virulence, Siderophore and Antibiotic Production, Gas Vesicle Morphogenesis and Flotation in Serratia

    Directory of Open Access Journals (Sweden)

    Chin M. Lee

    2017-09-01

    Full Text Available Gas vesicles (GVs are proteinaceous, gas-filled organelles used by some bacteria to enable upward movement into favorable air/liquid interfaces in aquatic environments. Serratia sp. ATCC39006 (S39006 was the first enterobacterium discovered to produce GVs naturally. The regulation of GV assembly in this host is complex and part of a wider regulatory network affecting various phenotypes, including antibiotic biosynthesis. To identify new regulators of GVs, a comprehensive mutant library containing 71,000 insertion mutants was generated by random transposon mutagenesis and 311 putative GV-defective mutants identified. Three of these mutants were found to have a transposon inserted in a LacI family transcription regulator gene (rbsR of the putative ribose operon. Each of these rbsR mutants was GV-defective; no GVs were visible by phase contrast microscopy (PCM or transmission electron microscopy (TEM. GV deficiency was caused by the reduction of gvpA1 and gvrA transcription (the first genes of the two contiguous operons in the GV gene locus. Our results also showed that a mutation in rbsR was highly pleiotropic; the production of two secondary metabolites (carbapenem and prodigiosin antibiotics was abolished. Interestingly, the intrinsic resistance to the carbapenem antibiotic was not affected by the rbsR mutation. In addition, the production of a siderophore, cellulase and plant virulence was reduced in the mutant, whereas it exhibited increased swimming and swarming motility. The RbsR protein was predicted to bind to regions upstream of at least 18 genes in S39006 including rbsD (the first gene of the ribose operon and gvrA. Electrophoretic mobility shift assays (EMSA confirmed that RbsR bound to DNA sequences upstream of rbsD, but not gvrA. The results of this study indicate that RbsR is a global regulator that affects the modulation of GV biogenesis, but also with complex pleiotropic physiological impacts in S39006.

  5. Nuclear techniques (PIXE and RBS) applied to analysis of pre hispanic metals of the Templo Mayor at Tenochtitlan

    International Nuclear Information System (INIS)

    Mendez U, I.; Tenorio, D.; Galvan, J.L.

    2000-01-01

    This work has the objective of determining by means of the utilization of nuclear techniques (PIXE and RBS) the composition and the alloy type of diverse aztec ornaments corresponding to Post classic period, they were manufactured principally with copper and gold such as bells, beads and disks; all they belonging at 9 oblations of Templo Mayor of Tenochtitlan. It is presented here briefly the historical and archaeological antecedents of the devices as well as the analytical methods for conclude with the results obtained. (Author)

  6. Low energy RBS-channeling measurement system with the use of a time-of-flight scattered ion detector

    Energy Technology Data Exchange (ETDEWEB)

    Hasegawa, Masataka; Kobayashi, Naoto; Hayashi, Nobuyuki [Electrotechnical Lab., Tsukuba, Ibaraki (Japan)

    1996-07-01

    We have developed a low energy Rutherford backscattering spectrometry-ion channeling measurement system for the analysis of thin films and solid surfaces with the use of several tens keV hydrogen ions and a time-of-flight particle energy spectrometer. For the detection of the scattered ions new TOF spectrometer has been developed, which consists of two micro-channel-plate detectors. The pulsing of the primary ion beam is not necessary for this type of TOF measurement, and it is possible to observe continues scattered ion beams. The dimension of whole system is very compact compared to the conventional RBS-channeling measurement system with the use of MeV He ions. The energy resolution, {delta} E/E, for 25 keV H{sup +} was 4.1%, which corresponds to the depth resolution of 4.8 nm for silicon. The depth resolution of our system is better than that of conventional RBS system with MeV helium ions and solid state detectors. We have demonstrated the ion channeling measurement by this system with 25 keV hydrogen ions. The system can be available well to the analysis of thin films and solid surfaces with the use of the ion channeling effect. The observation of the reaction between Fe and hydrogen terminated silicon surface was also demonstrated. (J.P.N.)

  7. Micro-ERDA, micro-RBS and micro-PIXE techniques in the investigation of fish otoliths

    International Nuclear Information System (INIS)

    Huszank, R.; Simon, A.; Szilagyi, E.; Keresztessy, K.; Kovacs, I.

    2009-01-01

    Elemental distribution in the otolith of the fresh water fish burbot (Lota lota L.) collected in Hungary was measured with Elastic Recoil Detection Analysis (ERDA), Rutherford Backscattering Spectrometry (RBS) and as a complementary technique, Particle-Induced X-ray Emission (PIXE) with a focussed ion beam of 1.5 x 1.5 μm 2 spot size. The organic- and inorganic-rich regions of the otolith are distinguished and they are presented as hydrogen and calcium maps at depth regions of 0-70, 70-140 and 140-210 nm. The textured surface of the sample and its porosity were characterized from the effect on the RBS spectra. The oxygen and carbon PIXE elemental maps can also be used to identify the organic- and inorganic-rich regions of the otolith. The calcium map was found to be more homogeneous because the otolith structure is averaged in a larger depth. The trace elements Fe, Zn and Sr were detected only in very low concentration by micro-PIXE.

  8. Micro-ERDA, micro-RBS and micro-PIXE techniques in the investigation of fish otoliths

    Energy Technology Data Exchange (ETDEWEB)

    Huszank, R. [Institute of Nuclear Research of the Hungarian Academy of Sciences, P.O. Box 51, H-4001 Debrecen (Hungary)], E-mail: huszank@atomki.hu; Simon, A. [Institute of Nuclear Research of the Hungarian Academy of Sciences, P.O. Box 51, H-4001 Debrecen (Hungary); Szilagyi, E. [KFKI Research Institute for Particle and Nuclear Physics, P.O. Box 49, H-1525 Budapest (Hungary); Keresztessy, K. [Department of Fish Culture, Institute of Environmental and Landscape Management, Szent Istvan University, Pater K.u.1, H-2103 Goedoello (Hungary); Kovacs, I. [KFKI Research Institute for Particle and Nuclear Physics, P.O. Box 49, H-1525 Budapest (Hungary)

    2009-06-15

    Elemental distribution in the otolith of the fresh water fish burbot (Lota lota L.) collected in Hungary was measured with Elastic Recoil Detection Analysis (ERDA), Rutherford Backscattering Spectrometry (RBS) and as a complementary technique, Particle-Induced X-ray Emission (PIXE) with a focussed ion beam of 1.5 x 1.5 {mu}m{sup 2} spot size. The organic- and inorganic-rich regions of the otolith are distinguished and they are presented as hydrogen and calcium maps at depth regions of 0-70, 70-140 and 140-210 nm. The textured surface of the sample and its porosity were characterized from the effect on the RBS spectra. The oxygen and carbon PIXE elemental maps can also be used to identify the organic- and inorganic-rich regions of the otolith. The calcium map was found to be more homogeneous because the otolith structure is averaged in a larger depth. The trace elements Fe, Zn and Sr were detected only in very low concentration by micro-PIXE.

  9. Characterization of electroless Au, Pt and Pd contacts on CdTe and ZnTe by RBS and SIMS techniques

    International Nuclear Information System (INIS)

    Roumie, M.; Hageali, M.; Zahraman, K.; Nsouli, B.; Younes, G.

    2004-01-01

    Rutherford backscattering spectrometry (RBS) was applied to characterize Au, Pt and Pd contacts on II-VI semiconductor materials, CdTe and ZnTe, used as nuclear detectors. Electroless thin film depositions were prepared by changing the concentration of the reaction solution. Contrary to the deposition reaction time, it was observed that the amount of solution dilution degree had a considerable effect on increasing the thickness of the metal layer. Furthermore, PICTS electrical measurements confirmed the depth profile analysis performed by RBS and SIMS

  10. Advanced surface characterization of silver nanocluster segregation in Ag-TiCN bioactive coatings by RBS, GDOES, and ARXPS.

    Science.gov (United States)

    Escobar Galindo, R; Manninen, N K; Palacio, C; Carvalho, S

    2013-07-01

    Surface modification by means of wear protective and antibacterial coatings represents, nowadays, a crucial challenge in the biomaterials field in order to enhance the lifetime of bio-devices. It is possible to tailor the properties of the material by using an appropriate combination of high wear resistance (e.g., nitride or carbide coatings) and biocide agents (e.g., noble metals as silver) to fulfill its final application. This behavior is controlled at last by the outmost surface of the coating. Therefore, the analytical characterization of these new materials requires high-resolution analytical techniques able to provide information about surface and depth composition down to the nanometric level. Among these techniques are Rutherford backscattering spectrometry (RBS), glow discharge optical emission spectroscopy (GDOES), and angle resolved X-ray photoelectron spectroscopy (ARXPS). In this work, we present a comparative RBS-GDOES-ARXPS study of the surface characterization of Ag-TiCN coatings with Ag/Ti atomic ratios varying from 0 to 1.49, deposited at room temperature and 200 °C. RBS analysis allowed a precise quantification of the silver content along the coating with a non-uniform Ag depth distribution for the samples with higher Ag content. GDOES surface profiling revealed that the samples with higher Ag content as well as the samples deposited at 200 °C showed an ultrathin (1-10 nm) Ag-rich layer on the coating surface followed by a silver depletion zone (20-30 nm), being the thickness of both layers enhanced with Ag content and deposition temperature. ARXPS analysis confirmed these observations after applying general algorithm involving regularization in addition to singular value decomposition techniques to obtain the concentration depth profiles. Finally, ARXPS measurements were used to provide further information on the surface morphology of the samples obtaining an excellent agreement with SEM observations when a growth model of silver islands with

  11. The combined study of the organosilicon films by RBS, ERDA and AFM analytical methods obtained from PECVD and PACVD

    Science.gov (United States)

    Mackova, A.; Perina, V.; Stryhal, Z.; Pavlik, J.; Svec, M.; Quédé, A.; Supiot, P.; Borvon, G.; Granier, A.; Raynaud, P.

    2004-09-01

    Organosilicon plasma deposited polymers are of interest for different kinds of applications like packaging, passivation and dielectric layers. A large set of plasma processes is possible, among which are low-pressure plasma enhanced chemical vapour deposition (PECVD) and plasma assisted chemical vapour deposition (PACVD) often used. In this work, we studied the composition and surface morphology of the hexamethyldisiloxane (HMDSO) and tetramethyldisiloxane (TMDSO) layers produced by PECVD and PACVD deposition using three plasma generation processes (plasma reactors): RF inductively coupled plasma (RFICP), microwave distributed electron cyclotron resonance plasma (DECR) and microwave induced remote nitrogen afterglow (MIRA). The layer composition was investigated by Rutherford backscattering spectrometry (RBS) and by elastic recoil detection analysis (ERDA) and the layer surface morphology was determined by atomic force microscopy (AFM). Composition, density and morphology (roughness, porosity) of the layers is discussed in connection with deposition techniques used.

  12. Characterization of human kidney stones using micro-PIXE and RBS: A comparative study between two different populations

    Energy Technology Data Exchange (ETDEWEB)

    Pineda-Vargas, C.A. [Materials Research Group, iThemba LABS, P.O. Box 722, Somerset West 7129 (South Africa); Faculty of Health and Wellness Sciences, CPUT, Cape Town (South Africa)], E-mail: pineda@tlabs.ac.za; Eisa, M.E.M. [Department of Physics, Sudan University of Science and Technology, P.O.Box 407, Khartoum (Sudan); Rodgers, A.L. [Head Chemistry Department, University of Cape Town, Rondebosch (South Africa)

    2009-03-15

    The micro-PIXE and RBS techniques are used to investigate the matrix as well as the trace elemental composition of calcium-rich human tissues on a microscopic scale. This paper deals with the spatial distribution of trace metals in hard human tissues such as kidney stone concretions, undertaken at the nuclear microprobe (NMP) facility. Relevant information about ion beam techniques used for material characterization will be discussed. Mapping correlation between different trace metals to extract information related to micro-regions composition will be illustrated with an application using proton energies of 1.5 and 3.0 MeV and applied to a comparative study for human kidney stone concretions nucleation region analysis from two different population groups (Sudan and South Africa)

  13. Parâmetros de dimensionamento para biodigestores batelada operados com dejetos de vacas leiteiras com e sem uso de inóculo Parameters to design batch digesters running with dairy cow manure with and without inoculum

    Directory of Open Access Journals (Sweden)

    Cristiane de A. N Xavier

    2010-04-01

    Full Text Available Objetivou-se avaliar a adição de inóculo na biodigestão anaeróbia de dejetos de vacas leiteiras reciclados em biodigestores bateladas pela quantidade de biogás produzida, pela redução dos sólidos voláteis e pelos potenciais de produção de biogás para obtenção de parâmetros de dimensionamento. Foram utilizados 12 biodigestores bateladas de campo de 60 L, cujos substratos continham dejetos de vacas leiteiras, água e quatro adições de inóculo (0; 20; 30 e 40% v/v. Adotaram-se tempos médios de retenção hidráulica de 75 e 150 dias para os tratamentos contendo inóculo e sem inóculo, respectivamente, nos períodos intermediário, chuvoso e seco do ano. Maiores produções de biogás ocorreram com maiores temperaturas médias do ar. Maiores potenciais de produção de biogás foram obtidas com uso de 40% de inóculo, de 0,07 m³ de biogás por kg de dejetos, com a utilização rápida do biogás, a partir de quatro dias. Tempos de retenção hidráulica de 45 dias podem ser adotados, o que reduz o volume do biodigestor e custos de implantação.The aim of this work was to evaluate the inoculum addition on the anaerobic digestion of dairy cattle manure recycled in batch digesters by biogas yield, volatile solids reduction and biogas potential production to obtain design parameters. Twelve field batch digesters (60 L each filled with dairy catlle manure, water and four different inoculum additions (0, 20, 30 and 40%, v/v were used. Average times of hydraulic retention of 75 and 150 days were adopted for treatments with and without inoculum, respectively, during three periods of the year (intermediary, rainy and dry. The greatest daily biogas yields occurred in higher room temperatures (rainy period. Higher biogas potential production was obtained by using 40% of inoculum, 0.07 m³ kg-1 manure, with rapid use of biogas from the four days. Times of hydraulic retention of 45 days may be adopted, which reduces the volume of the

  14. Impulse control disorders and related behaviours (ICD-RBs) in Parkinson's disease patients: Assessment using “Questionnaire for impulsive-compulsive disorders in Parkinson's disease” (QUIP)

    Science.gov (United States)

    Sharma, Ashish; Goyal, Vinay; Behari, Madhuri; Srivastva, Achal; Shukla, Garima; Vibha, Deepti

    2015-01-01

    Background: There is limited data on the prevalence of impulse control disorder and related behaviors (ICD-RBs) in Indian patients with Parkinson's Disease (PD). In the context of potential genetic and environmental factors affecting the expression of ICD-RBs, studying other multiethnic populations may bring in-sights into the mechanisms of these disorders. Objectives: To ascertain point prevalence estimate of ICD-RBs in Indian PD patients, using the validated “Questionnaire for Impulsive-Compulsive Disorders in Parkinson's disease (QUIP)” and to examine their association with Dopamine replacement therapy (DRT). Materials and Methods: This was a hospital based observational cross-sectional study. After taking informed consent, patients and their informants (spouse, or primary caregiver) were made to complete the QUIP, and were instructed to answer questions based on behaviors that occurred anytime during PD that lasted at least four consecutive weeks. Results: Total of 299 patients participated in the study. At least one ICD-RB was present in 128 (42.8%), at least one Impulse control disorder (ICD) was present in 74 (24.75%) and at least one Impulse control related compulsive behaviour (ICRB) was present in 93 (31.1%) patients. Punding was the most frequent (12.4%) followed by hyper sexuality (11.04%), compulsive hobbyism (9.4%), compulsive shopping (8.4%), compulsive medication use (7.7%), compulsive eating (5.35%), walkabout (4%) and pathological gambling (3.3%). ≥ 2 ICD-RBs were observed in 15.7% of patients. After multivariate analysis, younger age of onset, being unmarried were specifically associated with presence of ICD. Longer disease duration was specifically associated with presence of ICRB. Whereas smoking and higher dopamine levodopa equivalent daily doses (DA LEDD) were associated with both presence of ICD and ICRB. Higher LD LEDD was specifically associated with presence of ICD-RB. Conclusions: Our study revealed a relatively higher frequency of

  15. Impulse control disorders and related behaviours (ICD-RBs) in Parkinson's disease patients: Assessment using "Questionnaire for impulsive-compulsive disorders in Parkinson's disease" (QUIP).

    Science.gov (United States)

    Sharma, Ashish; Goyal, Vinay; Behari, Madhuri; Srivastva, Achal; Shukla, Garima; Vibha, Deepti

    2015-01-01

    There is limited data on the prevalence of impulse control disorder and related behaviors (ICD-RBs) in Indian patients with Parkinson's Disease (PD). In the context of potential genetic and environmental factors affecting the expression of ICD-RBs, studying other multiethnic populations may bring in-sights into the mechanisms of these disorders. To ascertain point prevalence estimate of ICD-RBs in Indian PD patients, using the validated "Questionnaire for Impulsive-Compulsive Disorders in Parkinson's disease (QUIP)" and to examine their association with Dopamine replacement therapy (DRT). This was a hospital based observational cross-sectional study. After taking informed consent, patients and their informants (spouse, or primary caregiver) were made to complete the QUIP, and were instructed to answer questions based on behaviors that occurred anytime during PD that lasted at least four consecutive weeks. Total of 299 patients participated in the study. At least one ICD-RB was present in 128 (42.8%), at least one Impulse control disorder (ICD) was present in 74 (24.75%) and at least one Impulse control related compulsive behaviour (ICRB) was present in 93 (31.1%) patients. Punding was the most frequent (12.4%) followed by hyper sexuality (11.04%), compulsive hobbyism (9.4%), compulsive shopping (8.4%), compulsive medication use (7.7%), compulsive eating (5.35%), walkabout (4%) and pathological gambling (3.3%). ≥ 2 ICD-RBs were observed in 15.7% of patients. After multivariate analysis, younger age of onset, being unmarried were specifically associated with presence of ICD. Longer disease duration was specifically associated with presence of ICRB. Whereas smoking and higher dopamine levodopa equivalent daily doses (DA LEDD) were associated with both presence of ICD and ICRB. Higher LD LEDD was specifically associated with presence of ICD-RB. Our study revealed a relatively higher frequency of ICD-RBs, probably because of the use of screening instrument and because

  16. Characterisation of an enamelled metallic object found in Guerrero Negro (Baja California) by PIXE and RBS techniques

    Science.gov (United States)

    Calvo del Castillo, H.; Ruvalcaba, J. L.; Calderón, T.; Salinas Nolasco, M. F.; Mejía, L. M.; Perdigón, K.

    2008-05-01

    The coast of Guerrero Negro (Baja California) has been known for a long time by archaeologists for its shipwrecks. Archaeologists are recovering objects that come from sunken Spanish galleons in the colonial period, and reach the American coast in the frontier of the USA with Mexico. An enamelled metallic object was found next to the beach in Guerrero Negro. We have analysed the piece with proton induced X-ray emission (PIXE) and Rutherford backscattering (RBS) in an attempt to establish whether the object could come from one of the colonial shipwrecks and to valuate its cleaning process. Scanning electron microscopy (SEM) and energy dispersive X-ray spectrometry (EDS) have been also performed in three samples taken from the object in order to observe the heterogeneity of the material. The materials found revealed the presence of typical lead-glass enamels from with pigments such as cuprite (red), or lead-tin yellow used in colonial times. The metallic part consisted of brass. As for the cleaning process, the average efficiency considered as the weight% of chlorine removed, was of 83.4% for brass and 100% for enamels.

  17. Characterisation of an enamelled metallic object found in Guerrero Negro (Baja California) by PIXE and RBS techniques

    International Nuclear Information System (INIS)

    Calvo del Castillo, H.; Ruvalcaba, J.L.; Calderon, T.; Salinas Nolasco, M.F.; Mejia, L.M.; Perdigon, K.

    2008-01-01

    The coast of Guerrero Negro (Baja California) has been known for a long time by archaeologists for its shipwrecks. Archaeologists are recovering objects that come from sunken Spanish galleons in the colonial period, and reach the American coast in the frontier of the USA with Mexico. An enamelled metallic object was found next to the beach in Guerrero Negro. We have analysed the piece with proton induced X-ray emission (PIXE) and Rutherford backscattering (RBS) in an attempt to establish whether the object could come from one of the colonial shipwrecks and to valuate its cleaning process. Scanning electron microscopy (SEM) and energy dispersive X-ray spectrometry (EDS) have been also performed in three samples taken from the object in order to observe the heterogeneity of the material. The materials found revealed the presence of typical lead-glass enamels from with pigments such as cuprite (red), or lead-tin yellow used in colonial times. The metallic part consisted of brass. As for the cleaning process, the average efficiency considered as the weight% of chlorine removed, was of 83.4% for brass and 100% for enamels

  18. Application of PIXE, RBS and high energy proton microbeams to the elemental analysis of coal and coal waste

    International Nuclear Information System (INIS)

    Kraner, H.W.; Hanson, A.L.; Jones, K.W.; Oakley, S.A.; Duedall, I.W.; Woodhead, P.M.J.

    1980-01-01

    Proton and x-ray induced x-ray emission have proved to be sensitive and convenient methods to measure major trace element concentrations in bulk quantities of coal and coal waste materials. These techniques are complementary in their sensitivities as a function of atomic number, and both require little sample preparation. The PIXE measurements were made with the proton beam in air in a microprobe configuration. Collimated proton beam scans were made on several thin sections of fly ash/sludge block materials and good trace sensitivities were observed for small specific volumes; SEM scans showed a high degree of material homogeneity which precluded significant elemental variations at the approx. 100 μm spatial resolution used. Rutherford backscattering was used to directly observe major and minor elemental concentrations in coal waste materials and in several representative ranks of coals. RBS is useful for only trace concentrations of heavy elements, but it does provide a method independent of fluoresced x rays for detection of possible middle Z interferences. Arsenic, present in trace amounts in coal, is an element of concern and is enriched in fly ash. The form of As in fly ash is unknown. However, because of its volatility most of the As probably becomes attached to the surfaces of the fly ash particles during and subsequent to combustion processes. This view is supported by the fact that As is rapidly mobilized in aqueous solutions whose pH > 9

  19. Anti-lock braking system (ABS) and regenerative braking system (RBS) in hybrid electric vehicle for smart transportation system

    Science.gov (United States)

    Evuri, Geetha Reddy; Rao, G. Srinivasa; Reddy, T. Ramasubba; Reddy, K. Srinivasa

    2018-04-01

    Pulse width modulation (PWM) based (a non-consistent) breaking system is used to keep the wheels from being bolted in the proposed antilock breaking system (ABS). Using this method a better hold of the street by wheels is possible and halting separations likewise diminish essentially particularly on precarious street surfaces like frosty or wet streets. The active vitality of the wheel is by and large lost amid braking as warmth because of grinding among brake cushions. This vitality can be recuperated using regenerative braking systems (RBS). In this strategy, the overabundance vitality is put away incidentally in capacitor banks before it gets changed over to warm vitality and is squandered. This framework delays the battery life by reviving the battery utilizing the put away vitality. Subsequently the mileage of the electric vehicle likewise increments as it can travel more separation in a solitary battery charge. These two techniques together help make electric vehicle vitality productive and more secure and less demanding to utilize subsequently anticipating and diminishing the quantity of mischance's.

  20. Characterisation of an enamelled metallic object found in Guerrero Negro (Baja California) by PIXE and RBS techniques

    Energy Technology Data Exchange (ETDEWEB)

    Calvo del Castillo, H. [Departamento de Geologia y Geoquimica, Universidad Autonoma de Madrid (Spain); Instituto de Fisica, Universidad Nacional Autonoma de Mexico (Mexico); Centre Europeen d' Archeometrie - I.P.N.A.S., Universite de Liege, Allee du 6 Aout, 10 Bat-15, Sart Tilman, 4000-Liege 1 (Belgium)], E-mail: hcalvo@ulg.ac.be; Ruvalcaba, J.L. [Instituto de Fisica, Universidad Nacional Autonoma de Mexico (Mexico); Calderon, T. [Departamento de Geologia y Geoquimica, Universidad Autonoma de Madrid (Spain); Salinas Nolasco, M.F. [Coordinacion de Conservacion del Patrimonio Cultural, Instituto Nacional de Antropologia e Historia (Mexico); Mejia, L.M. [Direccion de Arqueologia Subacuatica, Instituto Nacional de Antropologia e Historia (Mexico); Perdigon, K. [Coordinacion de Conservacion del Patrimonio Cultural, Instituto Nacional de Antropologia e Historia (Mexico)

    2008-05-15

    The coast of Guerrero Negro (Baja California) has been known for a long time by archaeologists for its shipwrecks. Archaeologists are recovering objects that come from sunken Spanish galleons in the colonial period, and reach the American coast in the frontier of the USA with Mexico. An enamelled metallic object was found next to the beach in Guerrero Negro. We have analysed the piece with proton induced X-ray emission (PIXE) and Rutherford backscattering (RBS) in an attempt to establish whether the object could come from one of the colonial shipwrecks and to valuate its cleaning process. Scanning electron microscopy (SEM) and energy dispersive X-ray spectrometry (EDS) have been also performed in three samples taken from the object in order to observe the heterogeneity of the material. The materials found revealed the presence of typical lead-glass enamels from with pigments such as cuprite (red), or lead-tin yellow used in colonial times. The metallic part consisted of brass. As for the cleaning process, the average efficiency considered as the weight% of chlorine removed, was of 83.4% for brass and 100% for ename0008.

  1. RBS and ion channeling studies of Ag-doped YBa2Cu3O7-δ targets and films

    International Nuclear Information System (INIS)

    Li Yupu; Liu, J.R.; Cui, X.T.; Chu, W.K.

    1998-01-01

    The location of Ag in Ag-doped YBa 2 Cu 3 O 7-δ (YBCO) films and other high-T c materials (such as Ag-doped BiSrCaCuO films and Ag-sheathed textured BiSrCaCuO wires) is a very important issue for improving high-T c materials. In this work, laser ablated and DC magnetron sputtered YBCO films on (100) LaAlO 3 and (100) SrTiO 3 were prepared from sintered Ag-YBCO composite targets (nominally containing 5 wt% Ag) and studied by Rutherford backscattering spectrometry (RBS) and ion channeling techniques using 2.0 MeV 4 He + and 7 Li + beams. We have found that the Ag-YBCO targets contain about 3 wt% Ag and most of the retained Ag atoms form some small size Ag precipitates with a typical size smaller than a few microns. We have demonstrated that in very good single crystalline YBCO films, the percentage of retained Ag in substitutional sites can be estimated by ion channeling technique. For example, we have found that about 1.2 wt% Ag atoms remain in the laser ablated Ag-doped films prepared from the Ag-YBCO target and about two-thirds of the retained Ag atoms occupy substitutional sites. The sputtered films contain less retained Ag atoms since the deposition temperature is higher and deposition time is longer than those for laser ablated films. (orig.)

  2. Translation efficiency of heterologous proteins is significantly affected by the genetic context of RBS sequences in engineered cyanobacterium Synechocystis sp. PCC 6803.

    Science.gov (United States)

    Thiel, Kati; Mulaku, Edita; Dandapani, Hariharan; Nagy, Csaba; Aro, Eva-Mari; Kallio, Pauli

    2018-03-02

    Photosynthetic cyanobacteria have been studied as potential host organisms for direct solar-driven production of different carbon-based chemicals from CO 2 and water, as part of the development of sustainable future biotechnological applications. The engineering approaches, however, are still limited by the lack of comprehensive information on most optimal expression strategies and validated species-specific genetic elements which are essential for increasing the intricacy, predictability and efficiency of the systems. This study focused on the systematic evaluation of the key translational control elements, ribosome binding sites (RBS), in the cyanobacterial host Synechocystis sp. PCC 6803, with the objective of expanding the palette of tools for more rigorous engineering approaches. An expression system was established for the comparison of 13 selected RBS sequences in Synechocystis, using several alternative reporter proteins (sYFP2, codon-optimized GFPmut3 and ethylene forming enzyme) as quantitative indicators of the relative translation efficiencies. The set-up was shown to yield highly reproducible expression patterns in independent analytical series with low variation between biological replicates, thus allowing statistical comparison of the activities of the different RBSs in vivo. While the RBSs covered a relatively broad overall expression level range, the downstream gene sequence was demonstrated in a rigorous manner to have a clear impact on the resulting translational profiles. This was expected to reflect interfering sequence-specific mRNA-level interaction between the RBS and the coding region, yet correlation between potential secondary structure formation and observed translation levels could not be resolved with existing in silico prediction tools. The study expands our current understanding on the potential and limitations associated with the regulation of protein expression at translational level in engineered cyanobacteria. The acquired

  3. Batch and column removal of nickel from aqueous solutions using the Sargassum filipendula brown marine macroalgae = Remoção de níquel de soluções aquosas em batelada e em coluna utilizando a alga marinha marrom Sargassum filipendula

    Directory of Open Access Journals (Sweden)

    2007-07-01

    Full Text Available The nickel(II biosorption capacity of the Sargassum filipendula brown marine algae was studied in the batch mode. The biosorption study involved the determination of equilibrium data of the nickel-biomass system, considering the influence of the pretreatment,particle size and agitation speed on the biosorption process. The equilibrium data obtained for the batch and column systems were adjusted by means of the Langmuir isotherm. The results showed that the column system presents a larger capacity of nickel removal from the aqueous solutions, compared to the batch system. The biosorptionequilibrium was obtained in approximately four hours of experiment. The biomass size, agitation speed and the pre-treatment of algae did not affect nickel biosorption rate and biosorption capacity.Neste trabalho foi estudada a capacidade de biossorção de níquel(II pela alga marinha marrom Sargassum filipendula em sistema batelada. O estudo da biossorção envolveu a determinação dos dados de equilíbriodo sistema níquel-biomassa, considerando a influência do pré-tratamento, tamanho de partícula e velocidade de agitação no processo de biossorção. Os dados de equilíbrio obtidos para os sistemas em batelada e em coluna foram ajustados por meio da isoterma de Langmuir. Os resultados mostraram que o sistema em coluna apresentou maior capacidade de remoção de níquel comparado ao sistema em batelada. O equilíbrio de biossorção foi obtido em aproximadamente quatro horas de ensaio. O tamanho da partícula, a velocidadede agitação e o pré-tratamento da biomassa não afetaram significativamente a taxa de biossorção de níquel nem sua capacidade de remoção.

  4. SISTEMA DE CLASSIFICAÇÃO GEOMORFOMÉTRICA BASEADO EM UMA ARQUITETURA SEQUENCIAL EM DUAS ETAPAS: ÁRVORE DE DECISÃO E CLASSIFICADOR ESPECTRAL, NO PARQUE NACIONAL SERRA DA CANASTRA

    Directory of Open Access Journals (Sweden)

    Vinicius Vasconcelos

    2012-10-01

    Full Text Available Geomorfometria é uma ciência interdisciplinar (que combina a ciência da terra, matemática e computação que descreve a superfície terrestre como uma representação numérica com descritores quantitativos. Assim, a geomorfometria evolui com os métodos computacionais presentes em Sistema de Informação Geográfica (SIG, a fim de estudar inúmeros problemas, tais como: susceptibilidade deslizamento de terra, hidrogramas de bacia, erosão do solo, distribuição da vegetação, entre outros. Um tópico de pesquisa importante na Geomorfometria é extrair e classificar formas de relevo a partir do Modelo Digital de Elevação (MDE, que é um pré-requisito para melhorar a compreensão da dinâmica dos geossistemas naturais. Assim, os métodos de classificação automática têm sido desenvolvidos, a fim de obter resultados que asseguram um processamento de dadosrápido, preciso e reprodutível por indivíduos independentes. Vários parâmetros geomorfométricos têm sido descritos na tentativa de caracterizar a paisagem, destacando a altimetria e suas derivações de primeira e segunda ordem. Isso mostra que os atributos apresentam diferentes níveis de generalização e aplicação que devem ser usadasem condições específicas na estratificação da paisagem. Este trabalho tem como objetivo propor um método de classificação sequencial das formas do relevo considerando as diferenças inerentes dos atributos de terreno na Serra da Canastra - MG. O método proposto consiste em um sistema de classificação baseado em uma arquitetura em duas etapas sequenciais: (a classificação por árvore de decisão dos dados de altitude e de declividade, e (b subdivisão de classes anteriores pelo classificador espectral Spectral Angle Mapper (SAM, utilizando atributos de curvatura. Na classificação pelo SAM (segunda etapa é necessário estabelecer uma assinatura geomorfométrica para cada forma de terreno, que é descrita por um espectro composto

  5. Analisador fluxo-batelada com bomba-pistão aplicado à preparação de soluções de calibração e microemulsões : determinação de metais em água mineral e gasolina por GF AAS

    OpenAIRE

    Farias de Almeida, Luciano

    2007-01-01

    O desenvolvimento de analisadores em fluxo e o monitoramento contínuo de alguns processos químicos levaram ao surgimento de sistemas cada vez mais baratos e simplificados com potencial para miniaturização. Para estes propósitos, o uso de sistemas em fluxo pode ser uma atraente alternativa. Dentre estes sistemas, os analisadores fluxo-batelada (FBA) foram aplicados com sucesso na implementação de vários procedimentos analíticos, como: titulações, prétratamento de amostras, ad...

  6. RBS/channeling analysis of hydrogen-implanted single crystals of FZ silicon and 6H silicon

    International Nuclear Information System (INIS)

    Irwin, R.B.

    1984-01-01

    Single crystals of FZ silicon and 6H silicon carbide were implanted with hydrogen ions (50 and 80 keV, respectively) to fluences from 2 x 10 16 H + /cm 2 to 2 x 10 18 H+/cm 2 . The implantations were carried out at three temperatures: approx.95K, 300 K, and approx.800 K. Swelling of the samples was measured by surface profilometry. RBS/channeling was used to obtain the damage profiles and to determine the amount of hydrogen retained in the lattice. The damage profiles are centered around X/sub m/ for the implants into silicon and around R/sub p/ for silicon carbide. For silicon carbide implanted at 95 K and 300 K and for silicon implanted at 95 K, the peak damage region is amorphous for fluences above 8 x 10 16 H + /cm 2 , 4 x 10 17 H + /cm 2 , and 2 x 10 17 H + /cm 2 , respectively. Silicon implanted at 300 and 800 K and silicon carbide implanted at 800 K remain crystalline up to fluences of 1 x 10 18 H + /cm 2 . The channeling damage results agree with previously reported TEM and electron diffraction data. The predictions of a simple disorder-accumulation model with a linear annealing term explains qualitatively the observed damage profiles in silicon carbide. Quantitatively, however, the model predicts faster development of the damage profiles than is observed at low fluences in both silicon and silicon carbide. For samples implanted at 300 and 800 K, the model also predicts substantially less peak disorder than is observed. The effect of the surface, the retained hydrogen, the shape of S/sub D/(X), and the need for a nonlinear annealing term may be responsible for the discrepancy

  7. Characterisation by PIXE-RBS of metallic contamination of tissues surrounding a metallic prosthesis on a knee

    Energy Technology Data Exchange (ETDEWEB)

    Guibert, G. [Laboratoire de Physique Corpusculaire de Clermont-Ferrand, IN2P3/CNRS UMR 6533, Universite Blaise Pascal, 63177 Aubiere Cedex (France)]. E-mail: geoffroy.guibert@he-arc.ch; Irigaray, J.L. [Laboratoire de Physique Corpusculaire de Clermont-Ferrand, IN2P3/CNRS UMR 6533, Universite Blaise Pascal, 63177 Aubiere Cedex (France); Moretto, Ph. [Centre d' Etudes Nucleaires de Bordeaux-Gradignan, IN2P3/CNRS UMR 5797, Le Haut Vigneau, BP 120, 33175 Gradignan Cedex (France); Sauvage, T. [Centre d' Etudes et de Recherches par Irradiation, CNRS Orleans France, 3A rue de la ferollerie, 45071 Orleans Cedex 2 (France); Kemeny, J.L. [CHU, Service d' Anatomie et de Cytologie Pathologiques, Universite d' Auvergne, 63100 Clermont-Ferrand (France); Cazenave, A. [Institut Calot, 62608 Berck sur Mer Cedex (France); Jallot, E. [Laboratoire de Physique Corpusculaire de Clermont-Ferrand, IN2P3/CNRS UMR 6533, Universite Blaise Pascal, 63177 Aubiere Cedex (France)

    2006-09-15

    Implants used as biomaterials have to fulfill conditions of functionality, compatibility and sometimes bioactivity. There are four main families of biomaterials: metals and metal alloys, polymers, bioceramics and natural materials. Because of corrosion and friction in the human body, implants generate debris. This debris may develop toxicity, inflammation and prosthetic unsealing by osseous dissolution. Nature, size, morphology and amount of debris are the parameters influencing the tissue responses. In this paper, we characterised metallic contamination produced by knee prosthesis, composed with TiAl{sub 6}V{sub 4} or Co-Cr-Mo alloys, into surrounding capsular tissue by depth migration, in vivo behaviour, content, size and nature of debris by PIXE (Particle Induced X-ray Emission) method associated with RBS (Rutherford Backscattering Spectroscopy). Debris distribution in the whole articulation is very heterogeneous. Debris migrates several thousand micrometers in tissues, with a characteristic decrease. Solid metallic particles of about micrometer size are found in the most polluted samples, in both alloys TiAl{sub 6}V{sub 4} and Cr-Co-Mo. In the mean volume analysed by PIXE, the concentration mass ratios [Ti]/[V] and [Co]/[Cr] confirm the chemical stability of TiAl{sub 6}V{sub 4} debris and show the chemical evolution of Cr-Co-Mo debris. Development of a protocol to prepare thin targets permits us to correlate PIXE and histological analysis in the same zone. The fibrous tissue (collagen fibres, fibroblasts) and macrophage cells are observed with optical microscope in polluted areas. This protocol could locate other pathologies in ppm contamination range, thanks to the great sensitivity of the PIXE method.

  8. Diffusion Experiments with Opalinus and Callovo-Oxfordian Clays: Laboratory, Large-Scale Experiments and Microscale Analysis by RBS

    Energy Technology Data Exchange (ETDEWEB)

    Garcia-Gutierrez, M.; Alonso, U.; Missana, T.; Cormenzana, J.L.; Mingarro, M.; Morejon, J.; Gil, P.

    2009-09-25

    Consolidated clays are potential host rocks for deep geological repositories for high-level radioactive waste. Diffusion is the main transport process for radionuclides (RN) in these clays. Radionuclide (RN) diffusion coefficients are the most important parameters for Performance Assessment (PA) calculations of clay barriers. Different diffusion methodologies were applied at a laboratory scale to analyse the diffusion behaviour of a wide range of RN. Main aims were to understand the transport properties of different RNs in two different clays and to contribute with feasible methodologies to improve in-situ diffusion experiments, using samples of larger scale. Classical laboratory essays and a novel experimental set-up for large-scale diffusion experiments were performed, together to a novel application of the nuclear ion beam technique Rutherford Backscattering Spectrometry (RBS), for diffusion analyses at the micrometer scale. The main experimental and theoretical characteristics of the different methodologies, and their advantages and limitations are here discussed. Experiments were performed with the Opalinus and the Callovo-Oxfordian clays. Both clays are studied as potential host rock for a repository. Effective diffusion coefficients ranged between 1.10{sup -}10 to 1.10{sup -}12 m{sup 2}/s for neutral, low sorbing cations (as Na and Sr) and anions. Apparent diffusion coefficients for strongly sorbing elements, as Cs and Co, are in the order of 1.10-13 m{sup 2}/s; europium present the lowest diffusion coefficient (5.10{sup -}15 m{sup 2}/s). The results obtained by the different approaches gave a comprehensive database of diffusion coefficients for RN with different transport behaviour within both clays. (Author) 42 refs.

  9. Diffusion Experiments with Opalinus and Callovo-Oxfordian Clays: Laboratory, Large-Scale Experiments and Microscale Analysis by RBS

    International Nuclear Information System (INIS)

    Garcia-Gutierrez, M.; Alonso, U.; Missana, T.; Cormenzana, J.L.; Mingarro, M.; Morejon, J.; Gil, P.

    2009-01-01

    Consolidated clays are potential host rocks for deep geological repositories for high-level radioactive waste. Diffusion is the main transport process for radionuclides (RN) in these clays. Radionuclide (RN) diffusion coefficients are the most important parameters for Performance Assessment (PA) calculations of clay barriers. Different diffusion methodologies were applied at a laboratory scale to analyse the diffusion behaviour of a wide range of RN. Main aims were to understand the transport properties of different RNs in two different clays and to contribute with feasible methodologies to improve in-situ diffusion experiments, using samples of larger scale. Classical laboratory essays and a novel experimental set-up for large-scale diffusion experiments were performed, together to a novel application of the nuclear ion beam technique Rutherford Backscattering Spectrometry (RBS), for diffusion analyses at the micrometer scale. The main experimental and theoretical characteristics of the different methodologies, and their advantages and limitations are here discussed. Experiments were performed with the Opalinus and the Callovo-Oxfordian clays. Both clays are studied as potential host rock for a repository. Effective diffusion coefficients ranged between 1.10 - 10 to 1.10 - 12 m 2 /s for neutral, low sorbing cations (as Na and Sr) and anions. Apparent diffusion coefficients for strongly sorbing elements, as Cs and Co, are in the order of 1.10-13 m 2 /s; europium present the lowest diffusion coefficient (5.10 - 15 m 2 /s). The results obtained by the different approaches gave a comprehensive database of diffusion coefficients for RN with different transport behaviour within both clays. (Author) 42 refs

  10. Insight into the nature of the candidate Extreme BL Lac object RBS 0723 with the MAGIC telescopes

    Science.gov (United States)

    Carosi, A.; Lombardi, S.; Tavecchio, F.; Bonnoli, G.; Stamerra, A.

    2017-01-01

    In the past years, the MAGIC Telescopes have performed observation campaigns on candidates Extreme BL Lac objects (EHBL). These sources are known to show an extreme frequency of their synchrotron and inverse Compton peaks in the spectral energy distribution (in the hard X-ray and TeV bands respectively). Furthermore, they are characterized by the extreme hardness of the UV-X-ray and (de-absorbed) TeV continua. These characteristics are usually explained in a leptonic synchrotron+SSC emission model under the assumption that the energy distribution of the emitting relativistic electrons has a large value of the minimum Lorentz factor (˜ 105) coupled with a rather low magnetic field intensity (˜ 10-2 G); although alternative models including contributions from hadrons in the jet are also proposed. This aspect points out a significant difference with respect to the parameters usually used in 'classical' TeV BL Lacs modelling. Thus, EHBL are important and very interesting targets as their observation allows to investigate the properties of blazars belonging to a poorly known category of sources described by peculiar values of the relevant physical quantities of their jets. Despite the remarkable scientific interest, observations of the hard but faint high energy emission from EHBLs are still sparse, and only a handful of these has been discovered at TeV energies. The BL Lac object RBS 0723 fits quite well within the EHBL subclass. The source was detected on January 2014 by the MAGIC telescopes with a statistical significance of more than 5 standard deviations. Although with large uncertainties, the source shows a relatively soft spectrum. Furthermore, the non-detection in the earlier data taken in December and in the subsequent months points to a possible VHE flux variability at variance with the general view of these sources, commonly thought to be relatively steady objects.

  11. Tratamento de resíduos sólidos de centrais de abastecimento e feiras livres em reator anaeróbio de batelada Treatment of solid waste from supply centers and free markets in batch anaerobic reactor

    Directory of Open Access Journals (Sweden)

    Valderi D. Leite

    2003-08-01

    Full Text Available Em feiras livres e centrais de abastecimento são produzidas quantidades bastante significativas de resíduos sólidos, com características favoráveis ao aproveitamento integral em processo de bioestabilização anaeróbia. O processo de bioestabilização é realizado em reatores anaeróbios de batelada (RAB, com tempo de detenção de sólidos variando de 250 a 300 dias originando, como produtos finais, o biogás, com cerca de 60% de gás metano, além de composto orgânico parcialmente bioestabilizado. Neste trabalho, foram utilizados resíduos sólidos orgânicos tipicamente vegetais, advindos de centrais de abastecimento, feiras livres e lodo de esgoto sanitário. O sistema experimental utilizado era constituído basicamente por um reator anaeróbio de batelada, com capacidade unitária de 2200 litros, além de outros dispositivos complementares. O sistema experimental foi instalado e monitorado na Estação Experimental de Tratamento Biológico de Esgoto Sanitário, situada no Bairro do Tambor, na cidade de Campina Grande, Estado da Paraíba, no período de janeiro a setembro de 2001. No processo de monitoração foram realizadas caracterizações sistemáticas das frações sólidas, líquidas e gasosas. Após análise dos dados, ficou evidenciada a viabilidade desta alternativa de tratamento, restando ser investigada ainda a viabilidade econômica, quando comparada com outras alternativas tecnológicas de tratamento de resíduos sólidos orgânicos.Significant quantity of organic solid waste with favorable characteristics for integral utilization in anaerobic biostabilization is produced in free markets and supply centers. The process is conducted in anaerobic batch reactors (ABR, with detention time of solids varying from 250 to 300 days, producing biogas with about 60% of methane, besides the partially biostabilized organic compost as the final product. In this study, the organic solid waste used was typically of vegetables

  12. Uso de leitos cultivados de fluxo vertical por batelada no pós-tratamento de efluente de reator anaeróbio compartimentado Post-treatment of effluent of anaerobic baffled reactor using batchwise vertical flow constructed wetland beds

    Directory of Open Access Journals (Sweden)

    Marcelo Mazzola

    2005-06-01

    Full Text Available Neste trabalho avaliou-se o desempenho de um Reator Anaeróbio Compartimentado (RAC de duas câmaras em série, seguido de três leitos cultivados (constructed wetlands de fluxo vertical por batelada. A unidade experimental, em escala piloto, foi instalada na Faculdade de Engenharia Agrícola - UNICAMP, Campinas, SP, Brasil. O volume total do reator era de 2,3 m³ (TDH de 12 h. O efluente do RAC foi tratado em três leitos, dois cultivados com macrófitas (gêneros Typha sp. e Eleocharis sp. e um utilizado como controle (não cultivado. Os leitos, com 2,0 m³ cada um e brita #2 (24 - 35 mm como meio suporte, operaram com fluxo vertical por batelada (com tempos de reação de 24, 48, 72 e 96 h. Na avaliação do RAC, observou-se tendência de estabilização dos parâmetros pH, alcalinidade, ácidos voláteis, sólidos sedimentáveis e suspensos totais, porém a remoção de DQO revelou-se limitada (50%. Nos leitos cultivados o aumento do tempo de reação (até 72 h foi acompanhado pelo aumento de remoção de turbidez, DQO, fósforo e nitrato. O melhor desempenho de remoção de fósforo total foi obtido no leito vegetado com Typha sp para os tempos de 72 e 96 h, respectivamente, de 30 e 25%.This study evaluated the performance of vertical constructed wetlands treating effluent of anaerobic baffled reactor. The anaerobic reactor volume was 2.3 m³; it was operated with daily flow of 4.6 m³ (12 hours Hydraulic Retention Time. The reactor effluent was split into three wetlands beds, two of them cultivated with macrophytes (Typha sp. and Eleocharis sp., and one control. The wetlands were operated as a batch reactor. The medium utilized was gravel, the size ranging from 7 to 12 mm. The reaction time for each cycle (filling - reaction - drainage was 24, 48, 72, and 96 h. The anaerobic reactor achieved the following removal rates: settable solids, 93%; suspended solids, 80%; and COD 39%. The increase in reaction time (up to 72 h for the constructed

  13. Planejamento e programação da produção em plantas multipropósito operando em batelada na indústria química Short term planning and scheduling for multipurpose batch chemical plants

    Directory of Open Access Journals (Sweden)

    Luis Gimeno Latre

    2000-12-01

    Full Text Available Neste artigo, considera-se o problema de programação da produção a curto prazo em plantas químicas multipropósito operando em batelada, em que a produção da planta é determinada pela demanda a ser atendida. Nesta situação, a capacidade da planta não está bem definida porque depende do mix de produção. Propõe-se uma fase de planejamento que tem como objetivo a determinação do número de bateladas de cada tarefa necessárias para atender a produção, bem como a respectiva janela de tempo de processamento. Estas janelas permitem a análise do carregamento dos processadores e da factibilidade do plano, ou seja, o atendimento das datas de entrega, através de ferramentas desenvolvidas na área de Busca Orientada por Restrições. Esta análise é feita para uma atribuição fixa de tarefas a processadores introduzida pelo usuário. O sistema fornece informações para orientar o usuário na criação de diferentes cenários de atribuição. O resultado da fase de planejamento é formado por um conjunto de janelas de processamento que diminuem sensivelmente a dimensão do problema de programação da produção, como é discutido para duas abordagens: programação mista (Mixed Integer Linear Programming - MILP e Simulated Annealing.Short term scheduling in multipurpose batch chemical plants is specially complicated by the fact that plant capacity is not well defined due to the multipurpose nature of equipment units, allowing different routes. In order to reduce problem dimension, as well as allowing to analyze problem feasibility prior to spending time solving a large scheduling problem, a planning phase is proposed. At this level the objective is to determine a set of processing time windows for the batches necessary to fulfill final products' demand. The time windows allow analyzing equipment units load and plan feasibility in terms of satisfying final products due dates. To accomplish those tools from the area of Constrained

  14. THERMOPHILIC BACILLUS LICHENIFORMIS RBS 5 ISOLATED FROM HOT TUNISIAN SPRING CO-PRODUCING ALKALINE AND THERMOSTABLE α-AMYLASE AND PROTEASE ENZYMES

    Directory of Open Access Journals (Sweden)

    Rakia Ben Salem

    2016-06-01

    Full Text Available Bacillus licheniformis RBS 5 was isolated from thermal spring in Tunisia. The isolate coproduce α-amylase and protease enzymes. The α-amylase activity showed an optimal activity at approximately 65°C and in wide pH interval ranging from 4 to 9. This enzyme was stable over the range of 45 to 70°C after 30 min of incubation and in the pH range of 8 to 10. Protease activity was optimal; at 80°C, pH 12. This enzyme was stable until 60°C over the pH range of 10 to 12. EDTA at concentration of 5 mM reduces slightly both activities evoking the serine alkaline protease. Cationic ions (Ca2+, Cu2+, Zn2+, and Mg 2+ have an inhibition effect on α-amylase. However, protease activity was enhanced by Ca2+, Cu2+ and Mg 2+; the other cations reduce slightly the proteolytic activity. SDS and H2O2 were found as inhibitors for both activities whereas Triton X-100 and perfume have no effect. Taken together, these traits make protease activity of B. licheniformis RBS 5 as efficient for use in detergent industry.

  15. La cobertura televisiva del fútbol en el Sur de Brasil y de España: RBS – Canal Sur

    Directory of Open Access Journals (Sweden)

    Joaquín M. Marín Montín

    2002-01-01

    Full Text Available Este artículo constituye parte de un trabajo comparativo entre Brasil y España, correspondiente al tratamiento que los medios de comunicación hacen del deporte. En él se analizan las claves que configuran el acercamiento a un mismo fenómeno sociológico, como es el fútbol, en dos realidades culturales diferentes. La programación deportiva de televisión llevada a cabo por Canal Sur en Andalucía y RBS en Rio Grande do Sul, así como la cobertura que ambas cadenas realizan en sus retransmisiones en directo del fútbol completan el análisis del presente estudio.ABSTRACTThis article is part of a comparative research between Brazil and Spain, about how the media treats the sports activities. Besides, this study analyses the keys of the same sociological phenomenon, which is football, in two different cultural realities. The broadcasting on television regarding sports events in Andalusia with Canal Sur, and Rio Grande do Sul with RBS. The live broadcasting of these channels completes the analysis of the present research.

  16. MANUAL JORNALÍSTICO E PRÁTICAS CONTRADITÓRIAS: DIÁLOGO ENTRE O TEXTO DE ZERO HORA E A TRAJETÓRIA DA RBS

    Directory of Open Access Journals (Sweden)

    Maria Berenice da Costa Machado

    2007-08-01

    Full Text Available Para bem refletir sobre um jornal, no caso Zero Hora (ZH, de Porto Alegre, seria necessário, também, resgatar a história da sua controladora, a Rede Brasil Sul (RBS. O exercício fez emergir muitas contradições entre o código normativo do diário e a trajetória do Grupo de comunicação. Oito desses episódios trazemos para o diálogo neste estudo: o uso indiscriminado de nomes e siglas, dos espaços de expressão das opiniões, os cruzamentos do jornalismo – editorial – com a publicidade – comercial –, os desencontros de datas, a estrutura monopolística, os valores propagados, a relação com as pessoas e a parceria com a Rede Globo. Nossa hipótese é de que está na gênese da RBS (e de ZH a “vocação” para o contraditório. PALAVRAS-CHAVE: Zero Hora. Rede Brasil Sul. História. Contradições.

  17. Tratamento de água com hidrocarbonetos aromáticos por uso de reator em bateladas sequenciais com inoculo fúngico Treatment of water with aromatic hydrocarbons by use of sequential batch reactor with fungi inoculum

    Directory of Open Access Journals (Sweden)

    Kelly Rodrigues

    2012-06-01

    Full Text Available Um reator em batelada, aerado, com biomassa imobilizada de Aspergillus niger AN400 foi operado durante 10 ciclos de 7 dias para remover benzeno (200 mg.L-1, tolueno (200 mg.L-1 e xileno (50 mg.L-1 - BTX - e de nutrientes de meio basal. O reator era alimentado semanalmente com 4 L do meio e glicose - 1 g.L-1, na Fase I, e 0,5 g.L-1, na Fase II. Os BTX foram detectados até o quarto dia de operação, em todos os ciclos. As melhores eficiências médias de remoção foram na Fase I: 75%de matéria orgânica solúvel, 80% de ortofosfato e 77% de amônia. O reator pode ser uma alternativa viável para tratamento de águas poluídas com BTX, porém há a necessidade de estudar o comportamento do reator durante período de operação mais longo e com ciclos reacionais mais curtos, bem como da identificação dos metabólitos produzidos.A batch reactor with air and immobilized biomass of Aspergillus niger AN400 was operated during 10 cycles of 7 days to remove benzene (200 mg.L-1, toluene (200 mg.L-1, and xylene (50 mg.L-1 - BTX - and nutrients from basal medium. The reactor was weekly fed with 4 L of the medium and glucose - 1 g.L-1 (Phase I and 0.5 g.L-1 (Phase II. The BTX had been detected until the fourth day of operation in all cycles. The best efficiencies of removal had been in Phase I: 75% of soluble organic matter, 80% of orthophosphate and 77% of ammonia. The reactor can be a viable alternative for the contaminated water treatment with BTX. However it has the necessity to study behavior of the reactor during longer period of operation and with shorter reaction cycles, as well as the identification of the produced metabolites.

  18. Influência da glicose sobre o consumo de fenol por Aspergillus niger an 400 em reatores em batelada The influence of glucose on the phenol consumption by Aspergillus niger an 400 in batch reactors

    Directory of Open Access Journals (Sweden)

    Kelly de Araújo Rodrigues

    2007-06-01

    Full Text Available Aspergillus niger AN 400 foi inoculado em reatores em batelada para remoção de fenol de meio sintético, na presença e ausência de glicose. O experimento possuía: 5 reatores de controle (grupo 1 com meio contento apenas fenol; 5 reatores (grupo 2 inoculados com fungos e com meio com fenol e sem glicose; e 5 reatores (grupo 3 inoculados com fungos e com meio com fenol e glicose (5 g/L. Os reatores foram agitados a 200 rpm, a 30°C, durante 5 dias. A concentração média inicial de fenol foi de 323 mg/L e a de matéria orgânica, de 696 mg DQO/L, meio sem glicose, e 6058 mg DQO/L, meio com glicose. Os reatores do grupo 2 removeram 48% de fenol e 21% de DQO, enquanto que os reatores do grupo 3, 100% de fenol e 93% de matéria orgânica. Não houve redução significativa de fenol e de DQO nos reatores de controle. A assimilação foi a via principal de remoção de fenol.Batch reactors were inoculated with Aspergillus niger AN 400 to remove phenol from synthetic media with and without glucose. The experiment was set by: five blank reactors (group 1 with media containing only phenol; five reactors (group 2 inoculated with fungi and with media containing only phenol; and five reactors (group 3 inoculated with fungi and with media containing phenol and glucose (5 g/L. These reactors were kept at 30°C under stirring of 200 rpm during 5 days. The mean initial concentrations of phenol and COD were 323 mg/L and 696 mg COD/L for the media without glucose, and 6058 mg COD/L for the media containing glucose. The reactors of group 2 removed 48% of phenol and 21% of COD, while the reactors of group 3 removed 100% of phenol and 93% of COD. There was no significant reduction of phenol and COD in the blank reactors. The assimilation was the main pathway of phenol removal.

  19. Enriquecimento de microrganismos metanotróficos a partir de lodo de reator UASB tratando esgotos domésticos

    Directory of Open Access Journals (Sweden)

    Luciene Alves Batista Siniscalchi

    2016-03-01

    Full Text Available RESUMO Nesse estudo, microrganismos metanotróficos foram enriquecidos a partir de lodo proveniente de um reator UASB tratando esgotos domésticos em reator em batelada sequencial (RBS com meio autotrófico contendo nitrito e nitrato. As eficiências médias de remoção de nitrito e nitrato foram de 68% e 53%, respectivamente, provavelmente devido à atividade heterotrófica desnitrificante. A detecção de arquéias dos grupos ANME-I e ANME-II foram realizadas por PCR durante todo período de cultivo. A estrutura da comunidade microbiana presente no inóculo e enriquecida no RBS após 100 dias de operação foi estudada por pirosequenciamento. Os resultados das análises demonstraram que a comunidade enriquecida no reator foi diferente à inoculada. Os filos dominantes no inóculo foram Synergistestes , Firmicutes e Euryarchaeota , ao passo que na biomassa enriquecida Planctomycetes, Verrucomicrobia, Chloroflexi e Proteobacteria predominaram. As condições de cultivo do RBS reduziram a abundância de Methanobacterium (8% para 1% e selecionaram bactérias metanotróficas como Methylocaldum , Methylocistis e Methylosinus . As sequências de Methylocaldum sp. apresentaram abundância relativa de 2.5%. A presença e elevada predominância do filo Verrucomicrobia na biomassa enriquecida do RBS sugere que outras espécies de metanotróficas, ainda pouco conhecidas, relacionadas a este filo podem estar presentes no reator. O potencial de oxidação anaeróbia do metano foi determinado para ambas amostras e revelaram que a atividade metanotrófica da biomassa foi aproximadamente três vezes maior que a do inóculo. Em suma, estes resultados sugerem que o inóculo usado e as condições de cultivo aplicadas foram adequados para o enriquecimento de metanotróficas.

  20. Influência da recirculação de percolado em sistemas de batelada de uma fase e híbrido na digestão da fração orgânica de resíduos sólidos urbanos

    OpenAIRE

    Aurélio Pessôa Picanço

    2004-01-01

    Nesta tese foi estudada a influência da recirculação do percolado, ajustando as melhores taxas e freqüências, para degradação da fração orgânica dos resíduos sólidos urbanos, em sistema de batelada de uma e duas fases (híbrido). Foram utilizados reatores de 3,45 litros preenchidos com resíduo sólido urbano padrão (FORSUp), percolado como inóculo e um filtro anaeróbio como reator metanogênico. Foram testadas as taxas de recirculação do inóculo de 1%, 2,5%, 5%, 10%, 20%, 30% e 50% e seu monitor...

  1. Impulse control disorders and related behaviours (ICD-RBs in Parkinson′s disease patients: Assessment using “Questionnaire for impulsive-compulsive disorders in Parkinson′s disease” (QUIP

    Directory of Open Access Journals (Sweden)

    Ashish Sharma

    2015-01-01

    Full Text Available Background: There is limited data on the prevalence of impulse control disorder and related behaviors (ICD-RBs in Indian patients with Parkinson′s Disease (PD. In the context of potential genetic and environmental factors affecting the expression of ICD-RBs, studying other multiethnic populations may bring in-sights into the mechanisms of these disorders. Objectives: To ascertain point prevalence estimate of ICD-RBs in Indian PD patients, using the validated “Questionnaire for Impulsive-Compulsive Disorders in Parkinson′s disease (QUIP” and to examine their association with Dopamine replacement therapy (DRT. Materials and Methods: This was a hospital based observational cross-sectional study. After taking informed consent, patients and their informants (spouse, or primary caregiver were made to complete the QUIP, and were instructed to answer questions based on behaviors that occurred anytime during PD that lasted at least four consecutive weeks. Results: Total of 299 patients participated in the study. At least one ICD-RB was present in 128 (42.8%, at least one Impulse control disorder (ICD was present in 74 (24.75% and at least one Impulse control related compulsive behaviour (ICRB was present in 93 (31.1% patients. Punding was the most frequent (12.4% followed by hyper sexuality (11.04%, compulsive hobbyism (9.4%, compulsive shopping (8.4%, compulsive medication use (7.7%, compulsive eating (5.35%, walkabout (4% and pathological gambling (3.3%. ≥ 2 ICD-RBs were observed in 15.7% of patients. After multivariate analysis, younger age of onset, being unmarried were specifically associated with presence of ICD. Longer disease duration was specifically associated with presence of ICRB. Whereas smoking and higher dopamine levodopa equivalent daily doses (DA LEDD were associated with both presence of ICD and ICRB. Higher LD LEDD was specifically associated with presence of ICD-RB. Conclusions: Our study revealed a relatively higher

  2. Analysis of FeF3 and NiF2 thin films by using RBS, (α, X) reactions, and SIMS measurements

    International Nuclear Information System (INIS)

    Gevers, G.; Barriere, A.S.; Grannec, J.; Lozano, L.; Blanchard, B.

    1984-01-01

    The composition of FeF 3 and NiF 2 thin films, prepared by sublimation under vacuum, is investigated from several complementary analysis techniques (RBS, α, X reactions, and SIMS measurements). It greatly depends on fabrication parameters and further treatments. For a residual pressure in the preparation enclosure less than 10 -7 Torr and a temperature, T/sub s/, of the substrate during the condensation of the vapour greater than 400 K for FeF 3 and lower than 550 K for NiF 2 , the bulk composition of the layers is quasi stoichiometric. A lack of fluorine is observed near the two faces of the films. It is correlated to the presence of oxygen which probably corresponds to water adsorption, after an air exposure of the samples, followed by an hydrolysis of the compounds. This effect is considerably reduced by the presence of gold electrodes which protect the insulating layers, and in the conditions previously mentioned any diffusion can be noted. However in all cases some traces of impurities are pointed out, mainly: sodium, potassium, calcium, and chlorine, which are probably present in the initial powder. On the other hand, it is shown that FeF 3 diffuses throughout a gold electrode for T/sub s/ 2 , the content of fluorine decreases when T/sub s/ > 550 K or when the films are annealed. (author)

  3. Coupled PIXE and RBS using a 6MeV 4He2+ external beam: A new experimental device for particle detection and dose monitoring

    International Nuclear Information System (INIS)

    Mathis, F.; Moignard, B.; Pichon, L.; Dubreuil, O.; Salomon, J.

    2005-01-01

    AGLAE (Accelerateur Grand Louvre d'Analyses Elementaire), the IBA facility of the 'Centre de Recherche et de Restauration des Musees de France' (C2RMF) has been equipped for several years with an external micro-beam line, in order to perform ion beam analysis on materials relevant to cultural heritage. This beam line is undergoing constant improvement. Recently, a new extraction nozzle for the external beam of the accelerator has been designed in order to obtain simultaneously from the same spot: - detection of the X-ray emission by two detectors, for low and high energies; - detection of the backscattered particles for a backscattering angle between 170 and 175 deg., thanks to an annular surface barrier detector included in the nozzle; - particle current monitoring by intermittent beam deflection on a reference material included in the system. This technical development has been induced by the study of artificial patinas on archaeological copper-alloy objects and the attempt to characterize them with a 6MeV 4 He 2+ beam, an unusual beam for this type of investigation. A detailed description of the new device and some results on an application of the use of high-energy alpha beam in PIXE and RBS made on a Roman strigil are presented here

  4. VIBA-Lab 3.0: Computer program for simulation and semi-quantitative analysis of PIXE and RBS spectra and 2D elemental maps

    Science.gov (United States)

    Orlić, Ivica; Mekterović, Darko; Mekterović, Igor; Ivošević, Tatjana

    2015-11-01

    VIBA-Lab is a computer program originally developed by the author and co-workers at the National University of Singapore (NUS) as an interactive software package for simulation of Particle Induced X-ray Emission and Rutherford Backscattering Spectra. The original program is redeveloped to a VIBA-Lab 3.0 in which the user can perform semi-quantitative analysis by comparing simulated and measured spectra as well as simulate 2D elemental maps for a given 3D sample composition. The latest version has a new and more versatile user interface. It also has the latest data set of fundamental parameters such as Coster-Kronig transition rates, fluorescence yields, mass absorption coefficients and ionization cross sections for K and L lines in a wider energy range than the original program. Our short-term plan is to introduce routine for quantitative analysis for multiple PIXE and XRF excitations. VIBA-Lab is an excellent teaching tool for students and researchers in using PIXE and RBS techniques. At the same time the program helps when planning an experiment and when optimizing experimental parameters such as incident ions, their energy, detector specifications, filters, geometry, etc. By "running" a virtual experiment the user can test various scenarios until the optimal PIXE and BS spectra are obtained and in this way save a lot of expensive machine time.

  5. Apģērbs kā identitātes sastāvdaļa jauniešiem pilsētā

    OpenAIRE

    Romanovska, Ieva

    2012-01-01

    Bakalaura darbā „Apģērbs kā identitātes sastāvdaļa jauniešiem pilsētā” uzmanība tiek vērsta uz apģērba nozīmi un pielietojumu identitātes veidošanā jauniešu vidū. Tiek skatīti jautājumi par apģērba saistību ar identitāti, tās izteikšanu un komunikāciju patērētāju sabiedrības kontekstā. Veicot līdzdalīgo novērojumu Rīgā un Siguldā tika izpētīta apģērbam veltītā nozīme, tā izvēles un nesēšanas procesi, kā arī apģērba pielietojums ikdienas komunikācijā ar sabiedrību. Tāpat tika skatīti apģērba i...

  6. If it works there, will it work here? The effect of a multi-component responsible beverage service (RBS) programme on violence in Oslo.

    Science.gov (United States)

    Skardhamar, Torbjørn; Fekjær, Silje Bringsrud; Pedersen, Willy

    2016-12-01

    The Stockholm Prevents Alcohol and Drug Problems (STAD) programme has been regarded as one of the most successful programmes to date, in reducing alcohol-related violence. This multi-component Responsible Beverage Service (RBS) programme was implemented in Stockholm, Sweden, and has been documented to be extremely effective in reducing alcohol-related nightlife violence. The SALUTT programme in Oslo, Norway was carefully modelled on the STAD project. We investigate whether the results from STAD were replicated in the SALUTT intervention. Using geocoded data, the level of violence in the intervention area was compared with different control areas before and after the intervention. Autoregressive moving average models (ARIMA). The SALUTT programme had no statistically significant effect on violence. However, the level of violence in the different potential control areas of Oslo fluctuated without a clear common trend. Hence, it was difficult to establish proper control areas. The results from the Swedish STAD-intervention were not replicated in Oslo. Successful interventions are not necessarily replicated in other contexts, and the current literature does not shed sufficient light on the conditions under which such interventions actually work. Moreover, more attention should be devoted to the identification of adequate control areas in future research. Copyright © 2016 Elsevier Ireland Ltd. All rights reserved.

  7. AFM, XPS and RBS studies of the growth process of CdS thin films on ITO/glass substrates deposited using an ammonia-free chemical process

    International Nuclear Information System (INIS)

    Mazon-Montijo, D.A.; Sotelo-Lerma, M.; Rodriguez-Fernandez, L.; Huerta, L.

    2010-01-01

    This paper deals with a detailed study of the growth stages of CdS thin films on ITO/glass substrates by chemical bath deposition (CBD). The chemical and morphological characterization was done through X-ray photoelectron spectroscopy (XPS), Rutherford backscattering spectrometry (RBS), and atomic force microscopy (AFM) techniques. On the other hand, optical transmission and X-ray diffraction (XRD) measurements were performed in order to study the optical and structural properties of the films. The time, the chemistry, and morphology of the different stages that form the growth process by CBD were identified through these results. Furthermore, clear evidence was obtained of the formation of Cd(OH) 2 as the first chemical species adhered to the substrate surface which forms the first nucleation centers for a good CdS formation and growth. On the other hand, the ITO coating caused growth stages to occur earlier than in just glass substrates, with which we can obtain a determined thickness in a shorter deposition time. We were able to prove that CBD is a good technique for the manufacture of thin films of semiconductor materials, since the CdS film does not have any impurities. Completely formed films were transparent, uniform, with good adherence to the substrate, of a polycrystalline nature with a hexagonal structure. These results indicate that films obtained by CBD are good candidates to be applied in different optoelectronic devices.

  8. Production of outer membrane vesicles (OMV in batch cultivation of Neisseria meningitidis serogroup B Produção de vesículas da membrana externa (OMV em cultivo batelada de Neisseria meningitidis sorogrupo B

    Directory of Open Access Journals (Sweden)

    Silvia Santos

    2006-12-01

    membrane vesicles", com proteínas reguladoras de ferro (IRP - "iron regulated proteins" liberadas no meio de cultura, são empregadas como antígeno para a produção da vacina. A fim ter o conhecimento sobre os parâmetros cinéticos, especialmente os valores finais da concentração de OMV, cultivos batelada de 20 hs foram realizados no meio de Catlin com limitação do ferro. As condições de processo compreenderam: biorreator de 7 litros, 36ºC, 0,5 atm, vazão de ar de 1 L/min, agitação variando entre 250 a 850 rpm, controle do oxigênio dissolvido em 10% da condição de saturação. A biomassa foi determinada pela densidade ótica em 540 nm e peso seco. Glicerol, lactato, pH e oxigênio dissolvido foram medidos das amostras retiradas durante o cultivo. A concentração de OMV foi determinada pelo método de Lowry após ultracentrifugação. A presença de IRP foi verificada por SDS-PAGE. O valor mais elevado de biomassa, correspondendo à concentração inicial mais elevada de lactato (7,84 g/L foi obtido no tempo de processo de 9 horas, o qual corresponde a biomassa seca de 1,0 g/L e a densidade ótica de 2,3 em 540 nm. O consumo de lactato. foi relacionado diretamente ao crescimento celular (fator de conversão de 0,24 biomassa por lactato g/g. A concentração do glicerol no meio não se alterou significativamente ao longo do processo. A concentração de OMV alcançou o valor mais elevado de 80 mg/L no tempo final de cultivo. Os resultados obtidos sugerem que o lactato é o principal fator limitante do crescimento e o máximo do antígeno é obtido durante a fase estacionária de crescimento e de morte celular.

  9. Aproveitamento de peles de tilápia-do-nilo congeladas e salgadas para extração de gelatina em processo batelada Utilization of frozen and salted Nile tilapia skin for batch-processed gelatin extraction

    Directory of Open Access Journals (Sweden)

    Adriana Cristina Bordignon

    2012-03-01

    Full Text Available Objetivou-se caracterizar peles de tilápia-do-nilo, conservadas por congelamento e salga a seco, visando à extração de gelatina em processo batelada. Após a filetagem, as peles foram descarnadas e distribuídas em dois lotes. Um dos lotes foi congelado a -18 ºC por sete dias e o outro foi salgado e mantido a 25 ºC por sete dias. As peles foram lavadas, pesadas e pré-tratadas em solução de H2SO4 a10N (pH 3,0, na proporção de 1:6 (pele:água por uma hora a 24 ºC. Extraiu-se a gelatina em banho-maria a 50 ºC por uma hora e retirou-se uma amostra para análise do perfil molecular. O restante foi congelado a -18 ºC. Foram realizadas análises físico-químicas das peles e das gelatinas líquidas, do perfil molecular com as gelatinas e análises microbiológicas das peles. As peles congeladas e salgadas apresentaram, respectivamente, 78,13 e 76,46% de umidade; 18,16 e 19,59% de proteína bruta; 2,26 e 1,90% de extrato etéreo e 1,44 e 2,06% de cinzas. Nas gelatinas líquidas extraídas das peles congeladas e salgadas, a umidade foi de 97,68 e 96,08%, o conteúdo de proteína bruta de 3,18 e 4,12%, de extrato etéreo 0,29 e 0,18% e de cinzas de 2,31 e 3,03%, respectivamente. Os valores da força de gel e viscosidade foram maiores para a gelatina de peles salgadas (200 g e 19,02mPas em comparação à gelatina de peles conservadas pelo congelamento (12,7 g e 9,16mPas. O perfil molecular foi menor na gelatina extraída a partir de peles congeladas, portanto houve perda de β e γ-componentes, que indica grande degradação do colágeno decorrente do método de conservação.The objective was to characterize Nile tilapia skins, freeze- and dry salt dry-preserved to extract gelatins by batch processing. After filleting, the skins were separated from the meat and distributed into two lots: In one, skins were frozen for 7 days (-18 ºC; and in the other, skins were salted for seven days (25 ºC. The skins were rinsed, weighed and pretreated in

  10. DIFERENTES DILUIÇÕES E USO DE RECICLO NA BIODIGESTÃO ANAERÓBIA DE CAMA DE FRANGO TRITURADA E PENEIRADA: ENSAIO BATELADA / DIFFERENT DILUTIONS AND USE OF RECYCLE IN THE ANAEROBIC BIODIGESTION OF CRUSHED AND SIEVED POULTRY LITTER: BATCH TEST

    Directory of Open Access Journals (Sweden)

    A.L. Sagula

    2017-12-01

    Full Text Available A cama de frango gerada no processo produtivo das aves demonstra grande potencial para a obtenção de energia com o uso de biodigestores, porém é preciso que ela apresente algumas condições como separação de sólidos, para facilitar o processo. Objetivou-se neste trabalho avaliar a produção de biogás no processo de biodigestão anaeróbia da cama de frango com separação de sólidos, em diferentes diluições, com e sem utilização de 20% de reciclo (biofertilizante em sistema batelada de abastecimento. Foram utilizados 24 biodigestores batelada, com capacidade de 2L de substrato em fermentação. O equipamento utilizado para processamento da cama de frango foi uma bomba trituradora que homogeneíza e tritura a cama em partículas menores para facilitar e melhorar a eficiência na biodigestão. Para a separação da fração sólida foi utilizada uma peneira vibratória com malha de 1mm. Foram estudadas as diluições 1:8, 1:10 e 1:12 e 20% de reciclo em substituição a água. O tratamento cama de frango na diluição 1:8 foi o que apresentou maior redução de sólidos voláteis (72,76% em relação aos outros tratamentos. O tratamento com reciclo na diluição 1:8 foi o que apresentou maior produção de biogás com valor médio de 0,0328 m3, em relação aos demais tratamentos. Conclui-se que a utilização do reciclo não interfere e provoca aumento na produção de biogás.

  11. Remoção de sulfato de águas residuárias industriais em reator anaeróbio de leito fixo operado em bateladas sequenciais Sulfate removal from industrial wastewaters in fixed film anaerobic sequential batch reactor

    Directory of Open Access Journals (Sweden)

    Arnaldo Sarti

    2008-03-01

    Full Text Available Avaliou-se o potencial de uso reator anaeróbio operado em bateladas seqüenciais com biomassa imobilizada (ASBBR, em escala piloto, no tratamento de água residuária industrial contendo elevadas concentrações de sulfato. O ASBBR, com volume total de 1.2 m³, foi preenchido com carvão mineral como meio suporte para imobilização da biomassa (leito fixo. Foram aplicadas cargas de 0,15; 0,30; 0,65; 1,30 e 1,90 kg SO4-2/ciclo (ou batelada com duração de 48 h, correspondendo, respectivamente, às concentrações de sulfato no afluente de 0,25; 0,50; 1,0; 2,0 e 3,0 gSO4-2.l-1. Utilizou-se etanol como doador de elétrons para a redução do sulfato. O reator foi operado à temperatura ambiente (29±8ºC, tendo sido obtidas eficiências médias na redução de sulfato entre 88 e 92% em 92 ciclos (275 dias. Os resultados obtidos permitem concluir que o uso de reatores ASBBR constitui-se em alternativa eficiente para a remoção de sulfatos de águas residuárias com características semelhantes às utilizadas neste trabalho.The potential use of an anaerobic sequencing batch biofilm reactor (ASBBR in pilot-scale for the treatment of a sulfate-rich industrial wastewater was evaluated. The pilot 1.2 m³ ASBBR reactor was filled with mineral coal for biomass immobilization (fixed film. The sulfate loading rates applied were 0.15; 0.30; 0.65; 1.30 and 1.90 kg SO4-2/cycle (or batch. Each cycle lasted 48 h. The influent concentrations were, respectively, 0.25; 0.50; 1.0; 2.0 and 3.0 gSO4-2.l-1. Ethanol was used as electron donor for sulfate reduction. The reactor operated at ambient temperature (29±8ºC, and the mean efficiencies of sulfate removal were in the range 88 to 92% in the 92 run cycles. The total operating period comprised 275 days. Based on the results obtained in this research, it could be concluded that the ASBBR can be an efficient alternative for the removal of sulfate from other industrial wastewaters with similar characteristics.

  12. Eficiência do reator seqüencial em batelada (RSB na remoção de nitrogênio no tratamento de esgoto doméstico com DQO baixa The sequencing batch reactor (SBR efficiency in the removal of nitrogen on the treatment of domestic sewage with low COD

    Directory of Open Access Journals (Sweden)

    Luiz Fernando de Abreu Cybis

    2004-09-01

    Full Text Available Este trabalho tem como objetivo avaliar a eficiência e a estabilidade do RSB na remoção de nitrogênio no tratamento de esgoto doméstico com DQO baixa. O reator utilizado no experimento possui volume de trabalho de 600 L e trata 1200 L/d de esgoto bruto em três bateladas de oito horas. A partir dos dados obtidos na pesquisa, observou-se que o reator seqüencial em batelada possibilitou a remoção média de nitrogênio total igual a 88 % no tratamento de esgoto doméstico com DQO média de 257 mg/L. A remoção de DQO foi de 90 %, a média da alcalinidade total no efluente foi 72 mgCaCO3/L e o índice volumétrico de lodo médio ficou em 86 mL/g. Estes resultados indicam que é possível utilizar RSB para o tratamento de esgoto doméstico com matéria orgânica reduzida sem comprometer a qualidade do efluente, a remoção de nitrogênio e a estabilidade operacional do sistema.This work had the objective of evaluating the SBR efficiency and stability in the removal of nitrogen on the treatment of domestic sewage with low COD. The reactor used in the experiment has a working volume of 600 L, and treats 1200 L/d of raw sewage in three 8-hour cycles. From the data gathered during the research, it was realized that the SBR fostered an average removal of total nitrogen equal to 88% in the treatment of a domestic sewage with an average COD of 257 mg/L. The COD removal was 90%, the final effluent total alkalinity was 72 mgCaCO3/L, and the sludge volumetric index was 86 mL/g. The results indicate that is possible to use SBR for the treatment of domestic sewage with low organic matter without compromising the final effluent quality, the nitrogen removal ability, and the stability of the system.

  13. The isolated neutron star RBS1774 revisited. Revised XMM-Newton X-ray parameters and an optical counterpart from deep LBT-observations

    Science.gov (United States)

    Schwope, A. D.; Erben, T.; Kohnert, J.; Lamer, G.; Steinmetz, M.; Strassmeier, K.; Zinnecker, H.; Bechtold, J.; Diolaiti, E.; Fontana, A.; Gallozzi, S.; Giallongo, E.; Ragazzoni, R.; de Santis, C.; Testa, V.

    2009-05-01

    We report optical B-band observations with the Large Binocular Telescope (LBT) of the isolated neutron star RBS1774. The stacked image with a total exposure of 2fh5 reveals a candidate optical counterpart at mB = 26.96 ± 0.20 at position α (2000) = 21^h43^m03fs40, δ(2000) = +06degr54^prime17farcs5, within the joint Chandra and XMM-Newton error circles. We analyse archival XMM-Newton observations and derive revised spectral and positional parameters. The predicted optical flux from the extrapolated X-ray spectrum is likely twice as high as reported before. The measured optical flux exceeds the extrapolated X-ray spectral flux by a factor ˜40 (15-60 at 1σ confidence). We interpret our detection and the spectral energy distribution as further evidence of a temperature structure over the neutron star's surface and present a pure thermal model reflecting both the SED and the pulsed fraction of the light curve. Based on observations obtained with XMM-Newton, an ESA science mission with instruments and contributions directly funded by ESA Member States and NASA. Based on data acquired using the Large Binocular Telescope (LBT). The LBT is an international collaboration among institutions in the US, Italy, and Germany. LBT Corporation partners are the University of Arizona, on behalf of the Arizona university system; Istituto Nazionale di Astrofisica, Italy; LBT Beteiligungsgesellschaft, Germany, representing the Max Planck Society, the Astrophysical Institute Potsdam, and Heidelberg University; Ohio State University; and the Research Corporation, on behalf of the University of Notre Dame, the University of Minnesota, and the University of Virginia.

  14. Proposta de um método de cálculo do tempo de sedimentação no tratamento de esgotos por lodos ativados em bateladas Proposal of a calculation method to determine the settling time in batch activated sludge sewage treatment

    Directory of Open Access Journals (Sweden)

    Rafael Carvalho de Oliveira Santos

    2005-09-01

    Full Text Available Neste artigo é feita uma análise do funcionamento de reatores biológicos para tratamento de esgotos pelo processo de lodos ativados, em batelada. A análise destaca o ciclo de operação desses reatores, que inclui as etapas de aeração e sedimentação, indicando o tempo de sedimentação para o qual se obtém a máxima eficiência operacional. É apresentado um método de cálculo para a determinação racional deste tempo ótimo. O trabalho contém uma revisão da literatura concernente ao assunto estudado, com ênfase nos conceitos de sedimentação zonal e fluxo de sólidos, acompanhada da dedução do método de cálculo proposto.This paper presents an analysis of the operation of activated sludge sequencing batch reactors (SBR for sewage treatment. Emphasis is placed on the operational cycle of those reactors, which includes the phases of aeration and sedimentation, indicating the settling time corresponding to the maximum operational efficiency. An explanation is made of a calculation method to determine this optimum settling time. The work includes a review of the literature concerning the subject of the present study, considering the concepts of hindered (zone settling and solids flux, together with the derivation of the proposed calculation method.

  15. Remoção de macronutrientes de efluente da indústria de castanha de caju por uso de reator aeróbio em batelada com inóculo fúngico Removal of macronutrients from effluent of a cashew nut industry by using a batch aerobic reactor with fungal inoculums

    Directory of Open Access Journals (Sweden)

    Marina Santos da Silva Lopes

    2011-03-01

    Full Text Available Foi estudada a eficiência da remoção de nitrogênio e fósforo do efluente de indústria de castanha de caju, por uso de reator aeróbio em batelada com inóculo de Aspergillus niger AN400. O reator recebeu 5 L de água residuária, acrescida de glicose, na concentração de 1 g.L-1 (Etapa I e de 5 g.L-1 (Etapa II . Cada etapa teve seis ciclos operacionais, cada um com tempo de reação total de sete dias. Os valores de pH dos efluentes na Etapa I variaram de 6,4 a 8,7 e na Etapa II , de 3,1 a 7,0. Durante a Etapa II , o reator alcançou bons resultados para remoção de nutrientes sem acúmulo de sua concentração no meio: 49% de fósforo total, 60% de ortofosfato, 79% de amônia, 78% de nitrato e 90% de nitrito, indicando que a menor liberação de nutrientes pelos micro-organismos ocorreu na presença de concentração elevada de glicose.It was studied the removal efficiency of nitrogen and phosphorus from effluent of a cashew nut industry by using an aerobic reactor operated in repetitive batch, inoculated with Aspergillus niger AN400. The reactor was fed with 5 L of wastewater, supplemented with glucose in the concentration of 1 g.L-1 (Phase I and 5 g.L-1 (Phase II . Each phase had six operational cycles, with total reaction time of seven days per cycle. The pH values of the effluents in Phase I varied from 6.4 to 8.7 and in Phase II , it varied from 3.1 to 7.0. The reactor achieved good results of removal without nutrients accumulated in the medium, during Phase II : 49% to total phosphorus, 60% to orthophosphate, 79% to ammonia, 78% to nitrate, and 90% to nitrite, indicating that the lesser release of nutrients by microorganisms occurred in the presence of higher glucose concentration.

  16. Tratamento de esgoto sanitário em reator híbrido em bateladas sequenciais: eficiência e estabilidade na remoção de matéria orgânica e nutrientes (N, P Sewage treatment in a sequencing batch hybrid reactor: efficiency and stability in organic matter and nutrient (N, P removal

    Directory of Open Access Journals (Sweden)

    Luiz Gonzaga Lamego Neto

    2011-12-01

    Full Text Available Este trabalho apresenta os resultados de estudo sobre o comportamento de um reator híbrido, operado em bateladas sequenciais, na remoção conjunta de matéria carbonácea, nitrogênio e fósforo de esgoto sanitário. Operado em ciclos de 8 horas de duração, o reator possuía em seu interior um suporte fixo com rede de nylon. Foram testadas cargas compreendidas entre 0,39 e 1,35 kgDQO.m-3.dia-1, 42 e 60 gN-NH4-.m-3.dia e 51 e 70 gP-PO4-.m-3.dia. O reator funcionou como um sistema estável e apresentou boas condições de depuração. A remoção da matéria carbonácea mostrou-se elevada, com eficiências médias de 92% de DBO5 e 80% de DQO. A remoção de nutrientes variou entre 59 e 71% para nitrogênio total e entre 45 e 67% para fósforo total. Tanto no lodo em suspensão, quanto no biofilme, foi observada a ocorrência de bactérias oxidadoras de amônio e micro-organismos responsáveis pela desnitrificação e remoção biológica de fósforo.This paper presents the results about the behavior of a sequencing batch hybrid reactor on combined removal of carbonaceous matter, nitrogen and phosphorus from sewage. Operated in 8-hour cycles, the reactor had a nylon net fixed inside. Loads between 0.39 and 1.35 kg COD.m-3.day-1, 42 and 60 gN-NH4-m-3.day-1 and 51 and 70 gP-PO4-m-3.day-1 were tested. The reactor operated as a stable system and showed good depuration conditions. The carbonaceous matter removal was high, with 92 and 80% efficiencies average to BOD5 and COD, respectively. The nutrients removal varied between 59 and 71% for total nitrogen and between 45 and 67% for total phosphorus. In both, sludge in suspension and the biofilm, occurrence of ammonium-oxidizing bacteria and microorganisms responsible for denitrification and biological phosphorus removal was observed.

  17. Adsorção de cromo (VI por carvão ativado granular de soluções diluídas utilizando um sistema batelada sob pH controlado Chromium (VI adsorption by GAC from diluted solutions in batch system and controlled ph

    Directory of Open Access Journals (Sweden)

    Renata Santos Souza

    2009-09-01

    Full Text Available Na Amazônia o cromo é empregado principalmente na indústria de couro e de madeira, sendo responsável por vários problemas de saúde porque é tóxico para os seres vivos. A remoção de cromo de efluentes industriais é feita por meio de diversos processos como a adsorção. Este trabalho mostra os resultados da adsorção de Cr(VI por carvão ativado granular comercial (CAG como adsorvente de soluções diluídas empregando um sistema de adsorção batelada com controle de pH. Os grupos funcionais da superfície do CAG foram determinados pelo método de Boehm. Além disso, o efeito do pH na adsorção de Cr(VI, o equilíbrio e a cinética de adsorção foram estudados nas condições experimentais (pH = 6, MA = 6g, tempo de adsorção 90min.. Na superfície do CAG, os grupos carboxílicos foram determinados em maior concentração (MAS=0,43 mmol/gCAG, estes, presentes em concentrações elevadas aumentam a adsorção do metal, principalmente em valores de pH ácidos. A capacidade de adsorção é dependente do pH da solução, devido a sua influência nas propriedades de superfície do CAG e nas diferentes formas iônicas das soluções de Cr(VI. Os dados de equilíbrio da adsorção foram ajustados satisfatoriamente pela isoterma de Langmuir (R²=0,988, tipo favorável. A partir da cinética de adsorção a 5mg/L e 20mg/L, os resultados obtidos foram compatíveis com o valor limite preconizado na legislação nacional (Res. nº 357/05. Portanto, para o sistema experimental utilizando CAG foi eficiente na remoção de Cr(VI a partir de correntes líquidas contendo baixas concentrações do metal.In Amazonia, chromium is mainly used in the leather and wood industries. It is responsible for many health problems, because of its toxicity. These industries remove chromium waste by various processes, such as adsorption. This work shows the results of Cr(VI adsorption by commercial granular activated carbon (GAC as adsorbent from diluted

  18. Kinetic behavior of nitrification in the post-treatment of poultry wastewater in a sequential batch reactor Comportamento cinético da nitrificação em um reator em bateladas sequenciais usado no pós-tratamento de efluente avícola

    Directory of Open Access Journals (Sweden)

    Juliana B. R. Mees

    2011-10-01

    Full Text Available A sequential batch reactor with suspended biomass and useful volume of 5 L was used in the removal of nutrients and organic matter in workbench scale under optimal conditions obtained by central composite rotational design (CCRD, with cycle time (CT of 16 h (10.15 h, aerobic phase, and 4.35 h, anoxic phase and carbon: nitrogen ratio (COD/NO2--N+NO3--N equal to 6. Complete cycles (20, nitrification followed by denitrification, were evaluated to investigate the kinetic behavior of degradation of organic (COD and nitrogenated (NH4+-N, NO2--N and NO3--N matter present in the effluent from a bird slaughterhouse and industrial processing facility, as well as to evaluate the stability of the reactor using Shewhart control charts of individual measures. The results indicate means total inorganic nitrogen (NH4+-N+NO2- -N+NO3--N removal of 84.32±1.59% and organic matter (COD of 53.65±8.48% in the complete process (nitrification-denitrification with the process under statistical control. The nitrifying activity during the aerobic phase estimated from the determination of the kinetic parameters had mean K1 and K2 values of 0.00381±0.00043 min-1 and 0.00381±0.00043 min-1, respectively. The evaluation of the kinetic behavior of the conversion of nitrogen indicated a possible reduction of CT in the anoxic phase, since removals of NO2--N and NO3--N higher than 90% were obtained with only 1 h of denitrification.Um reator em bateladas sequenciais com biomassa em suspensão e volume útil de 5L, aplicado para remoção de nutrientes e matéria orgânica, foi operado em escala de bancada, nas condições ótimas obtidas a partir de um delineamento composto central rotacional (DCCR, tempo de ciclo (TC de 16 h (10h15 fase aeróbia e 4h35 fase anóxica e relação carbono:nitrogênio (DQO/N-NO2-+N-NO3- de 6. Avaliaram-se 20 ciclos completos, nitrificação seguida de desnitrificação, com o objetivo de efetuar o estudo do comportamento cinético de degrada

  19. RBS study of Ti/ZnO interface

    International Nuclear Information System (INIS)

    Rahman, A.M.A.; Narusawa, T.

    2008-01-01

    We have studied the interface stability of the Ti(overlayer)/ZnO(substrate) system. Ti thin film was grown on the Zn face of single crystal ZnO(0 0 0 1) substrate by the vacuum deposition technique. The Ti film thickness was typically 16 nm. Then the samples were annealed in air at 300 and 400 deg. C for 15 min, respectively. The deposition and annealing effects on the interface structure were investigated with Rutherford backscattering and channeling spectroscopy using 2 MeV He + ion beam. After Ti deposition the minimum yield from the ZnO substrate increased from 2% to 7%. This suggests severe damage caused by deposition, i.e. the interface reaction between Ti and ZnO (even at room temperature). A significant amount of Zn (approximately 6.4 x 10 16 atoms/cm 2 ) moved onto the surface after post-annealing at 400 deg. C. Since Ti has a stronger tendency to react with O than Zn, it is expected that Ti reacts with substrate oxygen leaving behind free Zn atoms, which can easily migrate onto the surface. We discuss how the Ti/ZnO interface reaction in detail, and seek to find another good metallic contact for ZnO devices, which are attracting much attention recently for practical applications as well as scientific aspects

  20. Analytical simulation of RBS spectra of nanowire samples

    Energy Technology Data Exchange (ETDEWEB)

    Barradas, Nuno P., E-mail: nunoni@ctn.ist.utl.pt [Centro de Ciências e Tecnologias Nucleares, Instituto Superior Técnico, Universidade de Lisboa, E.N. 10 ao km 139,7, 2695-066 Bobadela LRS (Portugal); García Núñez, C. [Laboratorio de Electrónica y Semiconductores, Departamento de Física Aplicada, Universidad Autónoma de Madrid, 28049 Madrid (Spain); Redondo-Cubero, A. [Laboratorio de Electrónica y Semiconductores, Departamento de Física Aplicada, Universidad Autónoma de Madrid, 28049 Madrid (Spain); Centro de Micro-Análisis de Materiales, Universidad Autónoma de Madrid, 28049 Madrid (Spain); Shen, G.; Kung, P. [Department of Electrical and Computer Engineering, The University of Alabama, AL 35487 (United States); Pau, J.L. [Laboratorio de Electrónica y Semiconductores, Departamento de Física Aplicada, Universidad Autónoma de Madrid, 28049 Madrid (Spain)

    2016-03-15

    Almost all, if not all, general purpose codes for analysis of Ion Beam Analysis data have been originally developed to handle laterally homogeneous samples only. This is the case of RUMP, NDF, SIMNRA, and even of the Monte Carlo code Corteo. General-purpose codes usually include only limited support for lateral inhomogeneity. In this work, we show analytical simulations of samples that consist of a layer of parallel oriented nanowires on a substrate, using a model implemented in NDF. We apply the code to real samples, made of vertical ZnO nanowires on a sapphire substrate. Two configurations of the nanowires were studied: 40 nm diameter, 4.1 μm height, 3.5% surface coverage; and 55 nm diameter, 1.1 μm height, 42% surface coverage. We discuss the accuracy and limits of applicability of the analysis.

  1. RBS and XRD analysis of silicon doped titanium diboride films

    International Nuclear Information System (INIS)

    Mollica, S.; Sood, D.K.; Ghantasala, M.K.; Kothari, R.

    1999-01-01

    Titanium diboride is a newly developed material suitable for protective coatings. Its high temperature oxidation resistance at temperatures of 700 deg C and beyond is limited due to its poor oxidative behaviour. This paper presents a novel approach to improving the coatings' oxidative characteristics at temperatures of 700 deg C by doping with silicon. Titanium diboride films were deposited onto Si(100) wafer substrates using a DC magnetron sputtering system. Films were deposited in two different compositions, one at pure TiB 2 and the other with 20 % Si doping. These samples were vacuum annealed at 700 deg C at 1x10 -6 Torr to investigate the anaerobic behaviour of the material at elevated temperatures and to ensure that they were crystalline. Samples were then oxidised in air at 700 deg C to investigate their oxidation resistance. Annealing the films at 700 deg C in air results in the oxidation of the film as titanium and boron form TiO 2 and B 2 O 3 . Annealing is seen to produce only minor changes in the films. There is some silicon diffusion from the substrate at elevated temperatures, which is related to the porous nature of the deposited film and the high temperature heat treatments. However, silicon doped films showed relatively less oxidation characteristics after annealing in air compared with the pure TiB 2 samples

  2. External-RBS, PIXE and NRA analysis for ancient swords

    Energy Technology Data Exchange (ETDEWEB)

    Santos, Hellen C., E-mail: hellencsa@gmail.com; Added, Nemitala; Silva, Tiago F.; Rodrigues, C.L.

    2015-02-15

    Elemental composition of the steel of two ancient swords (Japanese and Damascus from a private collection) was characterized using in air IBA techniques. Our results contribute for the understanding the processes of manufacturing (hammering and quenching) and surface treatments applied in these swords. The Particle Induced X-ray Emission (PIXE) measurements along the Damascus blade allowed to identify and to trace a superficial concentration profile for the elements such Cr, Mn, Fe, Ni, Cu, Zn and As, while results for the Japanese blade showed only the presence of iron. The carbon content on the surface was also investigated using a resonant region in the Elastic Backscattering Spectrometry (EBS) measurements and the results have shown a slightly difference between the surfaces under investigation. In order to investigate the nitrogen content on surface, that could explain the hardening process, we used Nuclear Reaction Analysis (NRA) and the results shown that nitrogen content was under our detection limit for the technique (0.3% in mass). The measurements of PIXE, NRA and EBS were taken using the external beam setup installed at Lamfi – São Paulo/Brazil, the latter being successfully implemented for the first time in this facility.

  3. External-RBS, PIXE and NRA analysis for ancient swords

    Science.gov (United States)

    Santos, Hellen C.; Added, Nemitala; Silva, Tiago F.; Rodrigues, C. L.

    2015-02-01

    Elemental composition of the steel of two ancient swords (Japanese and Damascus from a private collection) was characterized using in air IBA techniques. Our results contribute for the understanding the processes of manufacturing (hammering and quenching) and surface treatments applied in these swords. The Particle Induced X-ray Emission (PIXE) measurements along the Damascus blade allowed to identify and to trace a superficial concentration profile for the elements such Cr, Mn, Fe, Ni, Cu, Zn and As, while results for the Japanese blade showed only the presence of iron. The carbon content on the surface was also investigated using a resonant region in the Elastic Backscattering Spectrometry (EBS) measurements and the results have shown a slightly difference between the surfaces under investigation. In order to investigate the nitrogen content on surface, that could explain the hardening process, we used Nuclear Reaction Analysis (NRA) and the results shown that nitrogen content was under our detection limit for the technique (0.3% in mass). The measurements of PIXE, NRA and EBS were taken using the external beam setup installed at Lamfi - São Paulo/Brazil, the latter being successfully implemented for the first time in this facility.

  4. Computer simulation of RBS spectra from samples with surface roughness

    Czech Academy of Sciences Publication Activity Database

    Malinský, Petr; Hnatowicz, Vladimír; Macková, Anna

    2016-01-01

    Roč. 371, MAR (2016), s. 101-105 ISSN 0168-583X. [22nd International conference on Ion Beam Analysis (IBA). Opatija, 14.06.2015-19.06.2015] R&D Projects: GA MŠk(CZ) LM2011019; GA ČR GA15-01602S Institutional support: RVO:61389005 Keywords : computer simulation * Rutherford backscattering * surface roughness Subject RIV: BG - Nuclear, Atomic and Molecular Physics, Colliders Impact factor: 1.109, year: 2016

  5. Simulation of batch adsorption systems; Simulacao de sistemas adsorvedores operando em batelada

    Energy Technology Data Exchange (ETDEWEB)

    Valerio, Cristiano C.; Neves Junior, Flavio; Stachiw, Rosalvo [Universidade Federal Tecnologica do Parana (UTFPR), Curitiba, PR (Brazil)

    2008-07-01

    One of the treatments used to adequate the wastewater from petroleum industry according to environmental laws, is the treatment by the adsorption process. Powdered activated carbon is the commonly used adsorber material, for this great affinity with various organic compounds. But there are alternative adsorber materials that can substitute activated carbon, with a low cost, and limited applicability. In this work, will be used the software resulting from Efli project, developed at Federal University of Technology - Parana, to compare the alternative adsorber materials (oil shale compounds and fluid catalytic cracking) efficiency to that of activated carbon. (author)

  6. Study of Er+ ion-implanted lithium niobate structure after an annealing procedure by RBS and RBS/channelling

    Czech Academy of Sciences Publication Activity Database

    Macková, Anna; Malinský, Petr; Švecová, B.; Nekvindová, P.; Groetzschel, R.

    2010-01-01

    Roč. 268, 11-12 (2010), s. 2042-2045 ISSN 0168-583X. [19th International conference on Ion beam analysis. Cambridge, 07.09.2009-11.09.2009] R&D Projects: GA MŠk(CZ) LC06041; GA ČR GA106/09/0125 Institutional research plan: CEZ:AV0Z10480505 Keywords : Lithium niobate * Erbium * Ion implantation Subject RIV: BG - Nuclear, Atomic and Molecular Physics, Colliders Impact factor: 1.042, year: 2010

  7. Fracionamento sequencial de cádmio e chumbo em solos Sequential fractionation of cadmium and lead in soils

    Directory of Open Access Journals (Sweden)

    Claudia das Neves Costa

    2007-10-01

    Full Text Available O impacto da contaminação e/ou poluição por metais pesados não deve ser avaliado somente pelo seu teor total em solos, mas pela sua biodisponibilidade, que é uma propriedade relacionada com sua mobilidade no solo e absorção pelas plantas. Este estudo teve por objetivo avaliar, mediante extrações químicas seqüenciais, a biodisponibilidade do cádmio e do chumbo em seis solos do Estado do Rio Grande do Sul. Para isto, utilizaram-se amostras nas quais foram adicionadas três doses de Cd (1,25, 2,50 e 5,0mg kg-1 de solo e três doses de Pb (250, 500 e 1.000mg kg-1 de solo em experimento conduzido em vasos com drenagem livre para a água, a céu aberto, por 10 anos. As extrações seqüenciais detectaram diferenças entre as formas de adsorção dos dois metais nos solos. O Cd foi detectado em todas as frações, principalmente na trocável e na orgânica, enquanto que o Pb se concentrou nas frações orgânica e residual. O Cd apresentou maior mobilidade nos solos, notadamente naqueles com menor teor de argila; a mobilidade do chumbo foi muito baixa.The hazard environment impact and soil pollution by heavy metals should be evaluated not only by total concentration but mainly by their bioavailability because this property is better related with plant uptake. The objective of this experiment was to evaluate, trough sequential chemical extractions, the bioavailability of cadmium and lead in six soils of Rio Grande do Sul State, Brazil. The soil samples investigated come from a long term experiment in which 10 years ago three levels of Cd and Pb were applied (1.25, 2.50 and 5.0mg Cd and 250, 500, 1000mg Pb kg-1 soil. The sequential extractions detected differences among the adsorption forms of the two metals in the soils. The Cd was detected in all fractions, mainly in the exchangeable and organic, while Pb concentrated on the organic and residual fractions. The Cd presented larger mobility in soils, especially in those with smaller clay content; mobility of lead was very low in all soils.

  8. Sequential extraction applied to Peruibe black mud, SP, Brazil; Extracao sequencial aplicada a lama negra de Peruibe

    Energy Technology Data Exchange (ETDEWEB)

    Torrecilha, Jefferson Koyaishi

    2014-07-01

    The Peruibe Black mud is used in therapeutic treatments such as psoriasis, peripheral dermatitis, acne and seborrhoea, as well as in the treatment of myalgia, arthritis, rheumatism and non-articular processes. Likewise other medicinal clays, it may not be free from possible adverse health effects due to possible hazardous minerals leading to respiratory system occurrences and other effects, caused by the presence of toxic elements. Once used for therapeutic purposes, any given material should be fully characterized and thus samples of Peruibe black mud were analyzed to determine physical and chemical properties: moisture content, organic matter and loss on ignition; pH, particle size, cation exchange capacity and swelling index. The elemental composition was determined by Neutron Activation Analysis, Atomic Absorption Graphite Furnace and X-ray fluorescence; the mineralogical composition was determined by X-ray diffraction. Another tool widely used to evaluate the behavior of trace elements, in various environmental matrices, is the sequential extraction. Thus, a sequential extraction procedure was applied to fractionate the mud in specific geochemical forms and verify how and how much of the elements may be contained in it. Considering the several sequential extraction procedures, BCR-701 method (Community Bureau of Reference) was used since it is considered the most reproducible among them. A simple extraction with an artificial sweat was, also, applied in order to verify which components are potentially available for absorption by the patient skin during the topical treatment. The results indicated that the mud is basically composed by a silty-clay material, rich in organic matter and with good cation exchange capacity. There were no significant variations in mineralogy and elemental composition of both, in natura and mature mud forms. The analysis by sequential extraction and by simple extraction indicated that the elements possibly available in larger quantities to be absorbed by the skin during treatment are Ca, Mg, Mn and Na. (author)

  9. Batch sequencing of oil derivates in pipeline networks; Sequenciamento de bateladas de derivados leves de petroleo numa rede dutoviaria

    Energy Technology Data Exchange (ETDEWEB)

    Bonacin, Mario Vicente; Oliveira, Daniel Rossato de; Czaikowski, Daniel Irineu; Polli, Helton Luis; Magatao, Leandro; Stebel, Sergio Leandro; Neves Junior, Flavio [Universidade Tecnologica Federal do Parana (UTFPR), Curitiba, PR (Brazil); Ribas, Paulo Cesar [PETROBRAS S.A., Rio de Janeiro, RJ (Brazil). Centro de Pesquisas (CENPES)

    2008-07-01

    This work presents a computational tool to assist the operational scheduling of a pipeline network. In this network, transfer of products is carried out by batches, from a source to a destination. This tool implements a proposal to determine priorities of the outgoing batches as well as alternatives for sequencing them fulfilling the stated periods stipulated. This proposal uses an analysis of production and demand plans, stockage, products draining in terminals, as well as operational restrictions of the pipeline network, looking for optimizing the use of resources such as pipes, bombs and tanks. The scenario in study is composed by 14 areas (4 refineries, 2 harbours, 6 distribution centres and 2 costumers) and 29 pipes. Prioritizing the attendance to the areas of source or demand, the algorithm carries choices between routes and possible batches volumes, considering calculations of time windows, that determine the limited interval when transference operations must occur. Moreover, operations called 'lung' are also treated, which involve flow changes during the movement. (author)

  10. Extração sequencial de zinco e cobre em solos tratados com lodo de esgoto e composto de lixo

    Directory of Open Access Journals (Sweden)

    Regilene Angélica da Silva Souza

    2012-01-01

    Full Text Available This work aimed to access the contents and chemical forms and to estimate mobility and availability of cooper and zinc in samples from two soils (Haplortox and Paleudult previously treated with doses of sewage sludge (SS and municipal solid waste compost (MSWC, besides a control treatment. Largest percentages of Cu and Zn were determined in the organic matter fraction. Zn showed higher percentages of soluble and exchangeable fractions than Cu. Treatments with SS showed higher potential of Cu and Zn availability. Modifications in soil attributes due to residue application affected metal mobility and availability indexes.

  11. Substâncias húmicas: sistema de fracionamento sequencial por ultrafiltração com base no tamanho molecular

    Directory of Open Access Journals (Sweden)

    Rocha Julio Cesar

    2000-01-01

    Full Text Available A sequential system for fractionation by ultrafiltration (SSFU equipped with advanced membranes filters (molecular size cut-off: 5, 10, 30, 50 and 100 kDalton of the polyethersulfone type was developed for analytical fractionation of humic substances (HS extracted from aquatic systems or soils. The device consists of five membrane filters (Sartocon® Micro operated by a multi-channel peristaltic pump, enabling an easy handling, working in a closed system and with simple collection of the six obtained fractions (F1>100; F2: 100-50; F3: 50-30; F4:30-10; F5: 10-5 and F6 <5 kDalton. Then, the HS sample (250 mL solution 1.0 mg/mL, pH 5.0 to 6.0 to be fractionated is pumped by pump through the series of membrane filters with a tangential flow of 85 mL/min, initial pressure 0.2 to 0.3 bar and permeation flux through the membranes of 0.8 to 1.4 mL/min. The overall time for fractionation and cleaning of the device is about 10 h and 25 mL of each fraction is obtained.

  12. Seletividade e eficácia da aplicação sequencial de oxyfluorfen e de ioxynil-octanoato, em semeadura direta de cebola

    OpenAIRE

    Ferreira,Lino R.; Durigan,Julio C.; Churata-Masca,Manuel G. C.; Ferreira,Francisco A.; Silva,Antônio A.

    2000-01-01

    Visando avaliar os efeitos do parcelamento da dose de oxyfluorfen e ioxyniloctanoato sobre a tolerância de plantas de cebola 'Granex 33' e a eficiência no controle das plantas daninhas na cultura, instalada por semeadura direta, foram conduzidos dois experimentos, sendo um na presença de plantas daninhas e o outro na ausência das mesmas. Ioxynil-octanoato, quando aplicado em doses acima de 0,125 kg/ha, aos 19 DAS, foi menos seletivo para o cultivar Granex 33 do que o oxyfluorfen. O parcelamen...

  13. Estudo experimental de aspectos hidrodinâmicos e da partida de um reator anaeróbio sequencial tratando esgotos domésticos

    Directory of Open Access Journals (Sweden)

    Camila Fernandes Nunes

    2009-12-01

    Full Text Available It is important to provide individual sanitation systems for sewage peri-urban communities or rural areas to minimize impacts on the environment and human health caused by sewage discharge in natura into water resources. In this context, the anaerobic digestion of effluent has been one of the main considered technologies due to easy implementation, material minimization and reduction in waste production. The objective of this work was to study a Baffled Anaerobic Reactor (BAR including its hydrodynamic characteristics, percentile of inoculum to be applied and reactor operation start. It was concluded that the flow is dispersed with 3.84% of dead spaces and that 20% of the cow manure provided best results; however, due to the high fiber content of the manure, its use is not recommended as inoculum. The BAR system, composed of four chambers, presented good performance for sewage treatment of a rural community in terms of organic substance removal (COD, turbidity and solids meeting effluent disposal standards of these parameters considering the Federal and Minas Gerais State legislation, in Brazil, even in a transient phase of operation, at temperatures below 20°C. However, the effluents from the BAR can’t be released into water bodies without other parameters such as nitrogen, phosphorus, fecal coliforms, and others are investigated to be conforming to those standards.

  14. Comparison of SIMS and RBS for depth profiling of silica glasses implanted with metal ions

    Czech Academy of Sciences Publication Activity Database

    Lorinčík, Jan; Veselá, D.; Vytykáčová, S.; Švecová, B.; Nekvindová, P.; Macková, Anna; Mikšová, Romana; Malinský, Petr; Boettger, R.

    2016-01-01

    Roč. 34, č. 3 (2016), č. článku 03H129. ISSN 1071-1023 R&D Projects: GA ČR GA15-01602S; GA MŠk(CZ) LM2011019 Institutional support: RVO:67985882 ; RVO:61389005 Keywords : Nanoparticles * Spectroscopy * Backscattering Subject RIV: JA - Electronics ; Optoelectronics, Electrical Engineering; BG - Nuclear, Atomic and Molecular Physics, Colliders (UJF-V) Impact factor: 1.573, year: 2016

  15. Interface studies of metal-semiconductor contacts by means of SIMS, nuclear reactions and RBS

    International Nuclear Information System (INIS)

    Ponpon, J.P.; Grob, J.J.; Grob, A.; Stuck, R.; Siffert, P.

    1977-01-01

    The aim of this paper is to show that a combination of SIMS, nuclear reaction and Rutherford backscattering experiments is a very powerful tool to investigate interfacial layers. These techniques have been applied to the study of oxygen accumulation at the gold-silicon interface for thin gold layers which are of great interest in devices such as surface barrier detectors and Schottky solar

  16. Interface studies of metal-semiconductor contacts by means of SIMS, nuclear reaction and RBS

    International Nuclear Information System (INIS)

    Ponpon, J.P.; Grob, J.J.; Grob, A.; Stuck, R.; Siffert, P.

    1978-01-01

    The aim of this paper is to show that a combination of SIMS, nuclear reaction and Rutherford backscattering experiments is a very powerful tool to investigate interfacial layers. These techniques have been applied to the study of oxygen accumulation at the gold-silicon interface for thin gold layers which are of great interest in devices such as surface barrier detectors and Schottky solar cells. The work has been done as follows: The relative depth distribution of oxygen has been determined by profiling with SIMS the different masses of interest. The absolute oxygen concentration at the free silicon surface as well as under the gold layer has been measured by using the 3.05 MeV 16 O(α, α') 16 O elastic scattering resonance in channeling conditions and with the target held at low temperature. The depth scale of the SIMS (the latter giving only a time erosion scale) has been obtained by 1 MeV 4 He + backscattering measurements at an optimized low angle geometry. These experiments demonstrate that oxygen diffuses through the gold film and accumulates at the interface. The diffusion law has been established by analyzing the influence of time of exposure to air after gold deposition by vacuum evaporation and gold layer thickness. The experimental conditions as well as the physical results are presented and discussed in detail. (Auth.)

  17. The influence of the beam charge state on the analytical calculation of RBS and ERDA spectra

    Energy Technology Data Exchange (ETDEWEB)

    Barradas, Nuno P., E-mail: nunoni@ctn.ist.utl.pt [Centro de Ciências e Tecnologias Nucleares, Instituto Superior Técnico, Universidade de Lisboa, E.N. 10 ao km 139,7, 2695-066 Bobadela LRS (Portugal); Kosmata, Marcel [Helmholtz-Zentrum Dresden-Rossendorf, Bautzner Landstraße 400, 01328 Dresden (Germany); Globalfoundries, Wilschdorfer Landstraße 101, 01109 Dresden (Germany); Hanf, Daniel; Munnik, Frans [Helmholtz-Zentrum Dresden-Rossendorf, Bautzner Landstraße 400, 01328 Dresden (Germany)

    2016-03-15

    Analytical codes dedicated to the analysis of Ion Beam Analysis data rely on the accuracy of both the calculations and of basic data such as scattering cross sections and stopping powers. So far, the effect of the beam charge state of the incoming beam has been disregard by general purpose analytical codes such as NDF. In fact, the codes implicitly assume that the beam always has the equilibrium charge state distribution, by using tabulated stopping power values e.g. from SRIM, which are in principle valid for the effective charge state. The dependence of the stopping power with the changing charge state distribution is ignored. This assumption is reasonable in most cases, but for high resolution studies the actual change of the charge state distribution from the initial beam charge state towards equilibrium as it enters and traverses the sample must be taken into account, as it influences the shape of the observed data. In this work, we present an analytical calculation, implemented in NDF, that takes this effect into account. For elastic recoil detection analysis (ERDA), the changing charge state distribution of the recoils can also be taken into account. We apply the calculation to the analysis of experimental high depth resolution ERDA data for various oxide layers collected using a magnetic spectrometer.

  18. Perfect Composition Depth Profiling of Ionic Liquid Surfaces Using High-Resolution RBS/ERDA.

    Czech Academy of Sciences Publication Activity Database

    Nakajima, K.; Zolboo, E.; Ohashi, T.; Lísal, Martin; Kimura, K.

    2016-01-01

    Roč. 32, č. 10 (2016), s. 1089-1094 ISSN 0910-6340 R&D Projects: GA ČR(CZ) GA16-12291S Institutional support: RVO:67985858 Keywords : surface structure * ionic liquid * hydrogen Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 1.228, year: 2016

  19. 78 FR 72132 - RBS Securities Inc. and Citizens Investment Advisors; Notice of Application and Temporary Order

    Science.gov (United States)

    2013-12-02

    ... others: (A) any person directly or indirectly owning, controlling, or holding with power to vote, five... held with power to vote, by such other person; and (C) any person directly or indirectly controlling... knowledge (i) none of the current directors, officers, or employees of Citizens IA that are involved in...

  20. RBS and SEM analysis of the nickel-fullerene hybrid systems

    Czech Academy of Sciences Publication Activity Database

    Vacík, Jiří; Naramoto, J.; Narumi, K.; Yamanoto, S.; Abe, J.

    2003-01-01

    Roč. 206, - (2003), s. 395-398 ISSN 0168-583X Institutional research plan: CEZ:AV0Z1048901 Keywords : nicke-fullerene hybrid Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 1.041, year: 2003

  1. RBS, XPS, and TEM study of metal and polymer interface modified by plasma treatment

    Czech Academy of Sciences Publication Activity Database

    Macková, Anna; Švorčík, V.; Sajdl, P.; Strýhal, Z.; Pavlík, J.; Malinský, Petr; Šlouf, Miroslav

    2007-01-01

    Roč. 82, - (2007), s. 307-310 ISSN 0042-207X R&D Projects: GA MŠk(CZ) LC06041 Institutional research plan: CEZ:AV0Z10480505; CEZ:AV0Z40500505 Keywords : Ion beam analysis Subject RIV: BG - Nuclear, Atomic and Molecular Physics, Colliders Impact factor: 0.881, year: 2007

  2. RBS, PIXE and NDP study of erbium incorporation into glass surface for photonics applications

    Czech Academy of Sciences Publication Activity Database

    Macková, Anna; Havránek, Vladimír; Vacík, Jiří; Salavcová, Linda; Spirková-Hradilová, J.

    2006-01-01

    Roč. 249, 1-2 (2006), s. 856-858 ISSN 0168-583X R&D Projects: GA AV ČR(CZ) KJB100480601; GA ČR GA106/03/0505; GA ČR GA106/05/0706 Institutional research plan: CEZ:AV0Z10480505; CEZ:AV0Z20670512 Keywords : surface analyses * photonics glass * Er diffusion Subject RIV: BH - Optics, Masers, Lasers Impact factor: 0.946, year: 2006

  3. Comparison of SIMS and RBS for depth profiling of silica glasses implanted with metal ions

    Czech Academy of Sciences Publication Activity Database

    Lorinčík, Jan; Veselá, D.; Vytykáčová, S.; Švecová, B.; Nekvindová, P.; Macková, Anna; Mikšová, Romana; Malinský, Petr; Boettger, R.

    2016-01-01

    Roč. 34, č. 3 (2016), č. článku 03H129. ISSN 1071-1023 R&D Projects: GA ČR GA15-01602S; GA MŠk(CZ) LM2011019 Institutional support: RVO:67985882 ; RVO:61389005 Keywords : Nanoparticles * Spectroscopy * Backscattering Subject RIV: JA - Electronic s ; Optoelectronics, Electrical Engineering ; BG - Nuclear, Atomic and Molecular Physics, Colliders (UJF-V) Impact factor: 1.573, year: 2016

  4. XRD and RBS studies of quasi-amorphous zinc oxide layers produced by Atomic Layer Deposition

    Energy Technology Data Exchange (ETDEWEB)

    Guziewicz, Elżbieta, E-mail: guzel@ifpan.edu.pl [Institute of Physics, Polish Academy of Sciences, Al. Lotników 32/46, 02-668 Warsaw (Poland); Turos, Andrzej [Institute of Electronic Materials Technology, Wólczyńska 133, 01-919 Warsaw (Poland); National Centre for Nuclear Research, Soltana 7, 04-500 Otwock (Poland); Stonert, Anna [National Centre for Nuclear Research, Soltana 7, 04-500 Otwock (Poland); Snigurenko, Dmytro; Witkowski, Bartłomiej S. [Institute of Physics, Polish Academy of Sciences, Al. Lotników 32/46, 02-668 Warsaw (Poland); Diduszko, Ryszard [Institute of Electronic Materials Technology, Wólczyńska 133, 01-919 Warsaw (Poland); Behar, Moni [Instituto de Fisica, Universidade do Rio Grande do Sul, 91501 Porto Alegre (Brazil)

    2016-08-01

    Although zinc oxide has been widely investigated for many important applications such as laser diodes, photovoltaics, and sensors, some basic properties of this material have not been established up to now. One of these are stopping power values which are crucial for the Rutherford Backscattering Spectrometry analysis. For this kind of measurements, amorphous materials should be used. In this paper we show the results of stopping power measurements for ZnO films grown by Atomic Layer Deposition. The films were grown on a silicon (100) substrate and parameters of the growth were chosen in a way that prevents crystallization of ZnO films. A series of ZnO films with thickness between 20 and 160 nm have been investigated. Extended film characterization has proven that the obtained nanopolycrystalline ZnO films can be considered as truly amorphous with respect to ion beam applications. ZnO films have been used for precise stopping power measurement of MeV He-ions in the energy range from 200 to 5000 keV. These results provide indispensable data for ion beam modification and analysis of ZnO. - Highlights: • Thin ZnO films of low crystallographic quality were obtained by Atomic Layer Deposition at 60 °C. • Nanopolycrystalline structure and atomically flat surface has been measured by X-ray diffraction. • Stopping power measurements show a very good agreement with the calculated values.

  5. Total reflection PIXE (TPIXE) and RBS for surface and trace element analysis.

    NARCIS (Netherlands)

    van Kan, J.A.; Vis, R.D.

    1996-01-01

    MeV proton and α beams at small incident angles (0-35 mrad) were used to analyse flat surfaces such as Si wafers and coated quartz substrates. X-rays and backscattered particles were detected in a total reflection geometry. Using TPIXE a quick and simultaneous detection of different trace elements

  6. Simulation of RBS spectra with known 3D sample surface roughness

    Czech Academy of Sciences Publication Activity Database

    Malinský, Petr; Siegel, J.; Hnatowicz, Vladimír; Macková, Anna; Švorčík, V.

    2017-01-01

    Roč. 406, SEP (2017), s. 99-103 ISSN 0168-583X R&D Projects: GA MŠk LM2015056; GA ČR(CZ) GBP108/12/G108 Institutional support: RVO:61389005 Keywords : computer simulation * surface roughness * AFM Subject RIV: BG - Nuclear, Atomic and Molecular Physics, Colliders OBOR OECD: Nuclear physics Impact factor: 1.109, year: 2016

  7. Estudo qualiquantitativo do biogás produzido por substratos em biodigestores tipo batelada Qualiquantitatve study of biogas produced by substrates in batch biodigestors

    Directory of Open Access Journals (Sweden)

    João A. Galbiatti

    2010-04-01

    Full Text Available A presente pesquisa foi desenvolvida no Departamento de Engenharia Rural da FCAV/UNESP, SP, Brasil, com o objetivo de se estudar, qualiquantitativamente, o biogás produzido por 5 substratos que, após utilizados na digestão anaeróbia, foram caracterizados como: 1 - Esterco de aves de corte com cama de capim napier (EACN; 2 - Esterco de aves de corte com cama de capim napier triturado (EACNT; 3 - Esterco suíno (ES; 4 - Esterco bovino (EB e 5 - Esterco de bovino misturado com 50% de bagaço de cana-de-açúcar (EB50C. Dos dados levantados concluiu-se que: o substrato EACN e o ES produziram volumes maiores e menores de biogás, respectivamente, comparados com os demais; a mistura de bagaço de cana-de-açúcar no substrato EB prejudica a produção acumulada de biogás e sua qualidade; a partir dos 57 dias após o enchimento dos biodigestores todos os substratos já produziam biogás com teor de metano superior a 48%, com exceção do substrato ES; o substrato triturado (EACNT não apresentou características muito distintas do substrato não triturado (EACN; a qualidade do biogás na fase de produção máxima é semelhante para todos os substratos estudados; o biogás que mostrou maior valor de metano na sua composição foi o produzido com EB, superior em até 17,7% à produção do EACNT.Aiming to study the biogas produced by 5 substrates from both quality and quantity point of view, this research was conducted at the Rural Engineering Department of FCAV/UNESP - Brazil, State of São Paulo. The substractes that were used in the anaerobic digestion were characterized as: 1 - Slaughter fowls' manure with napier grass bed (MFNG; 2 - Slaughter fowls' manure with triturate napier grass bed (MFNGT; 3 - Suine manure (SM; 4 - Bovine manure (BM and 5 - Bovine manure mixed with 50% of sugarcane bagasse (BM50S. From the data colIected it was concluded that: the substract (MFNG and the substract containing SM produced higher and lower volumes of biogas respectively, when compared to the others; the mixture of sugarcane bagasse in the substract containing Bovine manure damages the accumulated biogas production and its quality; 57 days after filling the biodigestors, alI substrates produced biogas with a methane leveI higher than 48% except for the substrates containing Suine manure; the triturate substrates (MFNGT did not present such distinct characteristics from the non­triturate substrates (MFNG; the quality of biogas at the maximum production stage was similar, for alI the studied substrates; the biogas which presented higher quantity of methane in its composition was the one produced with BM, overcoming the value up to 17.7% over the MFNGT production.

  8. Quali-quantitative study of biogas produced by substrates in batch biodigestors; Estudo qualiquantitativo do biogas produzido por substratos em biodigestores tipo batelada

    Energy Technology Data Exchange (ETDEWEB)

    Galbiatti, Joao A.; Caramelo, Anaira D.; Silva, Flavia G.; Gerardi, Eliana A.B. [Universidade Estadual Paulista Julio de Mesquita Filho (DER/UNESP), Jaboticabal, SP (Brazil). Dept. de Engenharia Rural], emails: galbi@fcav.unesp.br, adcaramelo@hotmail.com, flacgs@yahoo.com.br, borgesgerardi@uol.com.br; Chiconato, Denise A. [Uniao das Instituicoes Educacionais do Estado de Sao Paulo (DCB/UNIESP), Taquaritinga, SP (Brazil)], email: denise.ac@hotmail.com

    2010-07-01

    Aiming to study the biogas produced by 5 substrates from both quality and quantity point of view, this research was conducted at the Rural Engineering Department of FCAV/UNESP - Brazil, State of Sao Paulo. The substrates that were used in the anaerobic digestion were characterized as: slaughter fowls' manure with napier grass bed (MFNG); slaughter fowls' manure with triturate napier grass bed (MFNGT); swine manure (SM); bovine manure (BM) and bovine manure mixed with 50% of sugarcane bagasse (BM50S). From the data collected it was concluded that: the substract (MFNG) and the substract containing SM produced higher and lower volumes of biogas respectively, when compared to the others; the mixture of sugarcane bagasse in the substract containing Bovine manure damages the accumulated biogas production and its quality; 57 days after filling the biodigestors, all substrates produced biogas with a methane level higher than 48% except for the substrates containing swine manure; the triturate substrates (MFNGT) did not present such distinct characteristics from the non triturate substrates (MFNG); the quality of biogas at the maximum production stage was similar, for all the studied substrates; the biogas which presented higher quantity of methane in its composition was the one produced with BM, overcoming the value up to 17.7% over the MFNGT production. (author)

  9. Cultivo mixotrófico da microalga Spirulina platensis em batelada alimentada Mixotrophic growth of Spirulina platensis in fed-batch mode

    Directory of Open Access Journals (Sweden)

    Adriana Muliterno

    2005-12-01

    Full Text Available A Spirulina platensis tem sido estudada devido a seu alto valor protéico, digestibilidade e por apresentar quantidades significativas de ácidos graxos poliinsaturados, vitaminas, fenólicos e ficocianina, podendo ser utilizada na alimentação humana. A utilização de nutrientes de baixo custo é um fator importante na produção da cianobactéria por possibilitar a redução de custos de processo. Objetivou-se com este trabalho estudar o cultivo mixotrófico da S. platensis por meio da adição de uma fonte orgânica de carbono (glicose em modo bateladaalimentada. Foi utilizado um Planejamento Fatorial Completo 2³ para o cultivo e as variáveis de estudo foram a concentração de glicose (0,5 gL-1 e 1,0 gL-1, a diluição do meio Zarrouk (50% e 75% e a iluminância (1800 lux e 3000 lux. A concentração celular máxima obtida foi de 5,38 gL-1 com uma velocidade específica máxima de crescimento de 0,0063 h-1, nas condições de 0,5 gL-1 de glicose, diluição do meio de 75% e iluminância de 3000 lux.The cyanobacterium Spirulina platensis has been studied due to its high content (~65% of highly digestible protein as well as significant amounts of polyunsaturated fatty acids, phenolics, vitamins, minerals and phycocyanin which could be useful in the human nutrition. The use of nutrients of low costs in the cyanobacterium growth could reduce the costs of production. We studied the fed-batch mixotrophic growth of the S. platensis in Zarrouk's medium with glucose (0.5 gL-1 and 1.0 gL-1 as carbon source and also investigated the effects of dilution (50% and 75%, with water and illumination (1,800 lux and 3,000 lux using a 2³ factorial design. The maximum celular concentration of 5.38 gL-1 and maximum specific growth rate of 0.0063 h-1 were obtained with a glucose concentration of 0.5 gL-1, 50% dilution and 1800 lux of illuminance.

  10. Uso de reator air-lift em batelada para tratamento de efluentes de uma indústria de beneficiamento de coco

    Directory of Open Access Journals (Sweden)

    Antonio Martins Oliveira Junior

    2011-01-01

    treatment periods (0.5 h and 1 h were conducted. A reduction in the level of TOG to 0.035 g/L, and pH to 5.17 for different process times without the addition of aluminum sulfate, in accordance with Resolution 357/05 of the CONAMA (Conselho Nacional do Meio Ambiente were observed. It was verified that this effect did not occur in relation to turbidity, despite the significant reduction to 34 NTU with the addition of aluminum sulfate. Nevertheless, the air-lift reactor proved to be a good option for treatment of wastewater of this nature with low operating costs.

  11. Sistema integrado de tratamento de efluentes sanitários com reatores anaeróbios sequenciais em batelada e wetlands construídos de fluxos alternados

    Directory of Open Access Journals (Sweden)

    Gustavo Stolzenberg Colares

    2018-01-01

    Full Text Available A concepção de um sistema integrado de wetlands construídos (WCs, de diferentes configurações, foi desenvolvida neste trabalho visando melhorias para remoção de nitrogênio e fósforo de efluentes de águas negras e amarelas, bem como da não utilização de suporte fixo para plantio das mudas de Hymenachne grumosa em parte do sistema. Canos de PVC foram utilizados em parte para montagem do sistema nas unidades de wetlands construídos flutuantes de fluxo horizontal + flutuantes de fluxo alternado + de fluxo vertical. No último estágio foram aplicadas britas de números 1 e 2 para o sistema suporte. Os estudos foram feitos no campus da Universidade de Santa Cruz do Sul - UNISC, RS. As taxas de aplicação de Carbono Orgânico Total (COT, nitrogênio amoniacal e fósforo solúvel foram controladas para não ultrapassar respectivamente os limites de 26, 1,2 e 0,2 g m-1 dia-1 nos três sistemas integrados, considerando tempo de detenção de 7 dias para cada compartimento. As disposições das macrófitas foram de 24 até 32 mudas m-2, sendo que lentilhas (Lemna sp. e alfaces d’água (Pistia stratiotes foram utilizadas para controle de espaços em aberto na superfície do líquido nas configurações flutuante de fluxo horizontal (WCFFH e flutuante de fluxo horizontal alternado (WCFFA. Os resultados revelaram faixas de reduções da carga poluente após os WCs de 50-72% para o COT; de 77,7-93,7% para N-NH3 e de 88,8-94,7% para fósforo solúvel. O desenvolvimento do sistema radicular das macrófitas dos sistemas flutuantes ainda não atingiu a potencial plenitude de até 40 cm, sendo, portanto, possíveis melhores resultados com o decorrer dos estudos.

  12. Surface Structure of Imidazolium-based Ionic Liquids: Quantitative Comparison between Simulations and High-resolution RBS Measurements.

    Czech Academy of Sciences Publication Activity Database

    Nakajima, K.; Nakanishi, S.; Lísal, Martin; Kimura, K.

    2016-01-01

    Roč. 144, č. 11 (2016), s. 114702 ISSN 0021-9606 R&D Projects: GA ČR GA16-12291S Institutional support: RVO:67985858 Keywords : spectroscopy * rutherford backscattering spectroscopy * molten-salt Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 2.965, year: 2016

  13. Surface Segregation in a Binary Mixture of Ionic Liquids: Comparison between High-Resolution RBS Measurements and Molecular Dynamics Simulations.

    Czech Academy of Sciences Publication Activity Database

    Nakajima, K.; Nakanishi, S.; Chval, Z.; Lísal, Martin; Kimura, K.

    2016-01-01

    Roč. 145, č. 18 (2016), s. 184704 ISSN 0021-9606 R&D Projects: GA ČR(CZ) GA16-12291S Institutional support: RVO:67985858 Keywords : rutherford backscattering spectroscopy * vapor interface * tensions Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 2.965, year: 2016

  14. RBS characterization of the deposition of very thin SiGe/SiO2 multilayers by LPCVD

    International Nuclear Information System (INIS)

    Munoz-Martin, A.; Climent-Font, A.; Rodriguez, A.; Sangrador, J.; Rodriguez, T.

    2005-01-01

    Multilayer structures consisting of several alternated layers of SiGe and SiO 2 with thickness ranging from 2 or Si as well as the deposition of SiO 2 on Si show negligible incubation times. The deposition of SiO 2 on SiGe, however, exhibits an incubation time of several minutes, which would be related to the oxidation of the surface necessary for the SiO 2 deposition to start. In all cases the film thickness increases linearly with deposition time, thus allowing the growth rates to be determined. These data allow the deposition process of these very thin layers to be accurately controlled

  15. PIXE and RBS investigation of growth phases of ultra-thin chemical bath deposited CdS films

    International Nuclear Information System (INIS)

    Duncan, P.C.; Hinckley, S.; Gluszak, E.A.; Dytlewski, N.

    2002-01-01

    Polycrystalline CdS films, with thicknesses typically 20-180 nm, have been chemically deposited on glass substrates using an ammonia-cadmium-thiourea reaction solution. Film elemental composition, thickness and microstructure have been examined using proton-induced X-ray emission, Rutherford backscattering and atomic force microscopy. Analysis indicates that the stability of the deposition temperature plays a critical role in CdS film growth and composition. Films deposited with high temperature stability (60±0.5 deg. C) show a consistent 1:1 Cd:S atomic ratio for all stages of film growth, and have good substrate adhesion. Films deposited with lower temperature stability (60±4 deg. C) show initial high S concentrations, followed by a rapid increase in Cd concentration, until a final 1.2:1 Cd:S ratio is achieved. A mechanism is proposed to explain this difference in film composition and properties

  16. Characterization of paint layers by simultaneous self-consistent fitting of RBS/PIXE spectra using simulated annealing

    International Nuclear Information System (INIS)

    Beck, L.; Jeynes, C.; Barradas, N.P.

    2008-01-01

    Particle induced X-ray emission (PIXE) is now routinely used for analyzing paint layers. Various setups have been developed to investigate the elemental composition of samples or wood/canvas paintings. However, the characterisation of paint layers is difficult due to their layered structure and due to the presence of organic binders. Also, standard PIXE codes do not support the quantitation of depth profiles in the general case. Elastic backscattering (both Rutherford and non-Rutherford) is usually used in ion beam analysis to determine depth profiles. However, traditional data processing using iteration between standard PIXE codes and particle scattering simulation codes is very time consuming and does not always give satisfactory results. Using two PIXE detectors and one particle detector recording simultaneously in an external beam geometry, we have applied a global minimisation code to all three spectra to solve these depth profiles self-consistently. This data treatment was applied to various different cases of paint layers and we demonstrate that the structures can be solved unambiguously, assuming that roughness effects do not introduce ambiguity

  17. RBS analysis of substoichiometric TiO{sub 2}-anatase thin films for visible-light photocatalysis

    Energy Technology Data Exchange (ETDEWEB)

    Ager, F.J. [Depto. Fisica Aplicada I, Escuela Universitaria Politecnica, Universidad de Sevilla, C. Virgen de Africa 7, E-41011 Sevilla (Spain) and Centro Nacional de Aceleradores, Av. Thomas A. Edison, E-41092 Sevilla (Spain)]. E-mail: fjager@us.es; Justicia, I. [ICMAB/CSIC, Campus UAB, 08193 Bellaterra (Spain); Gerbasi, R. [Istituto di Chimica Inorganica e delle Superficie, Corso Stati Uniti 4, I-35127 Padova (Italy); Battiston, G.A. [Istituto di Chimica Inorganica e delle Superficie, Corso Stati Uniti 4, I-35127 Padova (Italy); McSporran, N. [ICMAB/CSIC, Campus UAB, 08193 Bellaterra (Spain); Figueras, A. [ICMAB/CSIC, Campus UAB, 08193 Bellaterra (Spain); CFATA-UNAM, Juriquilla, Queretaro, C.P. 76230 Queretaro (Mexico)

    2006-08-15

    The anatase phase of TiO{sub 2} is the most promising photocatalyst for organic pollutants degradation. However, due to the large anatase band gap energy the possibility of using visible sunlight as energy source for the photocalatysis activation is ruled out and ultraviolet (UV) radiation with a wave length below the critical limit is thus required. Inducing defects in the anatase crystalline structure in the form of oxygen substoichiometry may theoretically reduce this large band gap energy. This paper focuses on the determination of the stoichiometry of TiO{sub 2} thin films and its influence on the photodegradation properties.

  18. Transplante hepático sequencial com preservação da veia cava inferior (técnica de "Duplo Piggyback") : uma técnica original

    OpenAIRE

    Silva, Eduardo Manuel Barroso Garcia da

    2012-01-01

    RESUMO:Desde a declaração de Bethesda em 1983, a transplantação hepática é considerada um processo válido e aceite na prática clínica para muitos doentes com doença hepática terminal, relativamente aos quais não houvesse outra alternativa terapêutica. Em 1991, por proposta de Holmgren, professor de genética, o cirurgião sueco Bo Ericzon realizou em Huntingdon (Estocolmo) o primeiro transplante hepático num doente PAF (Polineuropatia Amilloidótica Familiar), esperando que a substituição do ...

  19. Técnicas de preparo de amostras para a determinação de sulfonamidas em solos por cromatografia líquida de ultra-alta eficiência : espectrometria de massas sequencial

    OpenAIRE

    Natália Fernanda Tetzner

    2016-01-01

    Resumo: As sulfonamidas são antimicrobianos amplamente empregadas na medicina veterinária e sua presença tem sido observada em matrizes ambientais, como no solo. Devido à complexidade da matriz e baixas concentrações das drogas veterinárias no solo (pg g-1 a ng g-1) a etapa de preparo de amostras é fundamental para a subsequente quantificação. O objetivo deste trabalho foi avaliar diferentes preparos de amostras visando à determinação de resíduos de sulfonamidas (sulfadiazina, sulfatiazol, su...

  20. ANÁLISE POR INJEÇÃO SEQUENCIAL COM DETECÇÃO POR VOLTAMETRIA DE ONDA QUADRADA PARA DETERMINAÇÃO DE As(III EM AMOSTRAS DE ÁGUAS USANDO ELETRODO DE OURO

    Directory of Open Access Journals (Sweden)

    Fernando Henrique do Nascimento

    Full Text Available A sequential injection method with square wave anodic stripping voltammetry (SI-SWASV using screen printed and crystalline gold electrode was developed for determination of As(III. The carrier solution used for electrode conditioning and stripping medium was composed of 0.050 mol L-1 HCl, whereas the supporting electrode for samples (deposition medium was 0.50 mol L-1 HCl. The limits of detection and quantification were 20 and 70 nmol L-1 (1.5 and 5.2 µg L-1, respectively. This limit of quantification is almost two times lower than the maximum concentration of As(III allowed in waters by World Health Organization (10 µg L-1. The sampling throughput was 20 analyses per hour using a sample volume of 1500 µL, pumped through the flow cell at the flow rate of 15 µL s-1. Screen printed gold electrodes were not suitable for work with 0.50 mol L-1 HCl because the results were strongly dependent on the lot of sensors. Crystalline gold electrodes provided reproducible results and the method was applied for determination of As(III in river water samples. The accuracy was evaluated by recovery studies and analyses by Graphite Furnace Atomic Absorption Spectrometry, providing recoveries between 95 and 108%.

  1. Determinação de clorpropamida em plasma empregando empregando cromatografia liquida de alta eficiencia acoplada a espectrometria de massa sequencial (LC/MS/MS) e sua aplicação em um estudo de bioequivalencia

    OpenAIRE

    Marcia Aparecida da Silva

    2007-01-01

    Resumo: A biodisponibilidade relativa, de duas formulações de comprimido de clorpropamida 250 mg, foi avaliada em voluntários sadios de ambos os sexos. O estudo foi aberto, aleatorizado, cruzado em dois períodos com intervalo de três semanas, para o qual foram selecionados 36 voluntários. As amostras de sangue foram coletadas antes da administração de dose única de cada formulação, uma Teste (T) e outra Referência (R) e durante 72 horas após a administração. A concentração plasmática de clorp...

  2. Cultivo orgânico sequencial de hortaliças com dois sistemas de irrigação e duas coberturas de solo Successive organic cultivation of vegetable crops in two irrigation systems and two soil covers

    Directory of Open Access Journals (Sweden)

    Roberto BF Branco

    2010-03-01

    Full Text Available Com o aumento da demanda por produtos ecologicamente corretos tornaram-se necessários estudos de novas tecnologias para inseri-las no método de cultivo orgânico para que se tenha um crescimento sustentável da atividade. Neste trabalho avaliou-se o desempenho de cultivares e híbridos de hortaliças cultivados seqüencialmente no método orgânico, em diferentes ambientes. O delineamento experimental foi de parcelas sub-subdivididas com 3 repetições, resultando em 24 unidades experimentais. Foram estudados dois métodos de irrigação (aspersão convencional e localizada por gotejamento; duas coberturas do solo (plástico e palha e dois híbridos ou cultivares de espécies de hortaliças, sendo que para o cultivo do feijão-vagem utilizou-se apenas uma cultivar. Conduziram-se concomitantemente dois cultivos seqüenciais de hortaliças: (1 alface americana - tomate - brócolis e; (2 alface crespa - feijão-vagem - repolho. Avaliaram-se as características produtivas de cada espécie. Na seqüência (1 o cultivo da alface americana teve melhor desempenho quando irrigada por gotejamento, não havendo diferença entre as coberturas do solo, sendo a cv 'Rubette' a mais produtiva. O tomateiro foi mais produtivo no "mulching"plástico, independentemente do método de irrigação e o brócolis teve desempenho semelhante entre os tratamentos. Na seqüência (2 a alface crespa e o feijão-vagem foram mais produtivos quando irrigados por gotejamento e cultivados em cobertura plástica. O repolho teve melhor desempenho na cobertura do solo com filme plástico.With the growing demand for ecological products new technologies are required for organic cultivation systems in order to provide a sustainable growth of this activity. This experiment evaluated the performance of vegetable cultivars and hybrids growing successively in the organic system, in different growth environments. The experimental design was randomized blocks with split split-plots with 3 replications, resulting in 24 experimental units. The following treatments were assessed: a two irrigation systems, sprinkle and drip, b two soil covers, plastic and straw of sugar cane and c two hybrids or cultivars. Two different cropping sequences were carried out: (1 iceberg lettuce - tomato - broccoli and; (2 crisp lettuce - snap beans - cabbage. The agronomic characteristics of each species were evaluated. In sequence 1, iceberg lettuce growth performed better when irrigated by the drip system, but there was no difference between the soil covers and 'Rubette' presented higher yield. Higher tomato yields were observed in "mulching"plastic regardless the irrigation system and broccoli was unaffected by treatments. In sequence 2, crisp lettuce and snap beans were more productive when irrigated by drip and grown on plastic covering. Cabbage performed better with plastic film covering soil surface.

  3. Avaliação sequencial da proteinúria, albuminúria e eletroforese de proteínas urinárias durante a evolução do diabetes mellitus em cães

    OpenAIRE

    Cínthia Ribas Martorelli

    2012-01-01

    O Diabetes Mellitus (DM) desenvolve pela deficiência de insulina, caracterizada por hiperglicemia crônica. Complicações são freqüentes e incluem: catarata, retinopatia, infecções recorrentes e cetoacidose. A hiperglicemia crônica pode promover diversas complicações a longo prazo, como a nefropatia diabética (ND). Nos humanos diabéticos, a alteração renal é uma das complicações mais importantes, caracterizada pela lesão glomerular associada usualmente a hipertensão arterial sistêmica. Diverso...

  4. Determinação de Cu, Fe, Mn, Zn e do teor de proteína total em amostras de trigo e soja após procedimento de extração sequencial

    Directory of Open Access Journals (Sweden)

    Leila M. Bittencourt

    2012-01-01

    Full Text Available A sequential extraction procedure was applied to wheat and soybean seed samples. The total protein content (determined by two distinct methods: Bradford and bicinchoninic acid-BCA and distribution of Cu, Fe, Mn and Zn in each fraction was determined. The sequential extraction employed four different solutions: water, 0.5 mol L-1 NaCl, ethanol/water (70:30 v v-1 and 0.5 mol L-1 NaOH. For both samples, the highest concentration of metals was observed in those extracts associated with globulin-type proteins using NaCl solution. Regarding protein content, higher levels were obtained using the BCA method.

  5. Parameters to design batch digesters running with dairy cow manure with and without inoculum; Parametro de dimensionamento para biodigestores batelada operados com dejetos de vacas leiteiras com e sem uso de inoculo

    Energy Technology Data Exchange (ETDEWEB)

    Xavier, Cristiane de A.N. [Faculdade de Tecnologia de Jaboticabal, Jaboticabal, SP (Brazil)], email: crisanx@yahoo.com.br; Lucas Junior, Jorge de [Universidade Estadual Paulista (UNESP), Jaboticabal, SP (Brazil). Fac. de Ciencias Agrarias e Veterinarias. Dept. de Engenharia Rural], email: jlucas@fcav.unesp.br

    2010-03-15

    The aim of this work was to evaluate the inoculum addition on the anaerobic digestion of dairy cattle manure recycled in batch digesters by biogas yield, volatile solids reduction and biogas potential production to obtain design parameters. Twelve field batch digesters (60 L each) filled with dairy cattle manure, water and four different inoculum additions (0, 20, 30 and 40%, v/v) were used. Average times of hydraulic retention of 75 and 150 days were adopted for treatments with and without inoculum, respectively, during three periods of the year (intermediary, rainy and dry). The greatest daily biogas yields occurred in higher room temperatures (rainy period). Higher biogas potential production was obtained by using 40% of inoculum, 0.07 m{sup 3} kg{sup -1} manure, with rapid use of biogas from the four days. Times of hydraulic retention of 45 days may be adopted, which reduces the volume of the digester and the implementation costs. (author)

  6. Quali/quantitative characterization of biogas produced in batch digesters supplied with six distinct substrates Caracterização quali/quantitativa do biogás produzido em biodigestores de batelada alimentados com seis substratos distintos

    Directory of Open Access Journals (Sweden)

    João A. Galbiatti

    2011-01-01

    Full Text Available The present research was carried out at the DER/FCAV, São Paulo State University - Brazil, with the purpose of analyzing the quantity and quality of biogas produced by six types of substrates. The substrates used in the anaerobic digestion were characterized as: 1- Litter of broiler (LB; 2- Grinded broiler litter (GBL; 3- Broiler litter with wood shavings (BLWS; 4- Grinded broiler litter with wood shavings (GBLWS; 5- Broiler litter with peanut hulls (BLPH; 6- Grinded broiler litter with peanut hull (GBLPH. It was concluded from the collected data that: the (GBL substrate showed a superior biogas accumulated production in relation to the other substrates, while the BLWS presented an inferior accumulated production; the grinded substrates showed higher quantities of accumulated biogas in relation to the non-grinded substrates, except for GBLPH, with 20.9 m³ inferior than BLPH; the period of maximum biogas production started from 45 to 60 days, declining after 120 days; at 57 days after filling up the digesters the biogas produced had levels of CH4 superior than 53%, and from 99 days all of them produced biogas with levels of CH4 superior than 70%; LB and GBL presented higher concentrations of CH4 in the biogas.Com a finalidade de se analisar quali/quantitativamente o biogás produzido por 6 tipos de substratos, efetuou-se a presente pesquisa no DER/FCAV/UNESP- SP, Brasil. Os substratos utilizados na digestão anaeróbia foram caracterizados como: 1- Esterco de aves de postura (EAP; 2- Esterco de aves de postura triturado (EAPT; 3- Esterco de aves de corte com cama de maravalha (EACM; 4- Esterco de aves de corte com cama de maravalha triturado (EACMT; 5- Esterco de aves de corte com cama de casca de amendoim (EACA, e 6- Esterco de aves de corte com cama de casca de amendoim triturado (EACAT. Dos resultados obtidos, concluiu-se que, em relação à produção acumulada de biogás, o substrato EAPT foi superior aos demais, enquanto EACM apresentou produção acumulada inferior. Em geral, os substratos triturados apresentaram maior quantidade de biogás acumulado em relação aos não triturados, exceto o EACAT, com 20,9 m³ inferior ao EACA. O período de produção máxima de biogás teve início entre 45 e 60 dias, começando a decair a partir dos 120 dias. Aos 57 dias após o enchimento dos biodigestores, o gás produzido possuía teores de CH4 superiores a 53%, e a partir dos 99 dias, todos produziram biogás com teores de CH4 superiores a 70%. Os substratos EAP e EAPT apresentaram maiores concentrações de metano no biogás.

  7. Remoção de níquel de soluções aquosas em batelada e em coluna utilizando a alga marinha marrom Sargassum filipendula - DOI: 10.4025/actascitechnol.v29i2.695

    Directory of Open Access Journals (Sweden)

    Araceli Aparecida Seolatto

    2008-02-01

    Full Text Available The nickel(II biosorption capacity of the Sargassum filipendula brown marine algae was studied in the batch mode. The biosorption study involved the determination of equilibrium data of the nickel-biomass system, considering the influence of the pretreatment, particle size and agitation speed on the biosorption process. The equilibrium data obtained for the batch and column systems were adjusted by means of the Langmuir isotherm. The results showed that the column system presents a larger capacity of nickel removal from the aqueous solutions, compared to the batch system. The biosorption equilibrium was obtained in approximately four hours of experiment. The biomass size, agitation speed and the pre-treatment of algae did not affect nickel biosorption rate and biosorption capacity.

  8. VNS (Variable Neighbourhood Search) applied to batch sequencing in operational scheduling of pipeline network; VNS (Variable Neighbourhood Search) aplicado ao sequenciamento de bateladas do 'scheduling' de operacoes de uma malha dutoviaria

    Energy Technology Data Exchange (ETDEWEB)

    Yamamoto, Lia; Arruda, Lucia Valeria Ramos de; Libert, Nikolas [Universidade Tecnologica Federal do Parana (UTFPR), Curitiba, PR (Brazil)

    2008-07-01

    This work presents the VNS heuristic technique applied on batches ordering in a real network of petroleum derivatives distribution. These ordering have great influence in operational scheduling of a pipeline network. The operational scheduling purposes the efficient utilization of the resources, resulting on a better performance. Due to the great complexity of the real network problem and the necessity of its resolution in little computational time, it was adopted a problem subdivision in assignment of resources, sequencing and timing. In the resources assignment stage, it is considered the production/consumption functions and the products tankages to determine the total batches, including its volume, flow rate and the time-windows to satisfy the demand. These data are used in the sequencing stage, where a VNS based model determines the batches ordering. In a final step, the last block, realize the temporisation considering the network operational constraints. This work shows the results from the optimization of the sequencing stage which aims the improvement of the solution quality of scheduling. (author)

  9. Caracterização e aplicação de adsorvente para a remoção de corantes de efluentes têxteis em batelada e colunas de leito fixo

    OpenAIRE

    Vasques, Andressa Regina

    2008-01-01

    Dissertação (mestrado) - Universidade Federal de Santa Catarina, Centro Tecnológico. Programa de Pós-Graduação em Engenharia Química A remoção de corantes presentes em efluentes industriais tem recebido enorme atenção nos últimos anos. Isto se deve ao aumento da conscientização e ao maior rigor das leis ambientais. A adsorção é uma das técnicas que tem sido empregada com sucesso para uma remoção efetiva da cor. Devido ao alto custo de alguns adsorventes convencionais, pesquisas vêm sendo d...

  10. DETERMINAÇÃO RÁPIDA E SIMULTÂNEA DE PROPIFENAZONA, PARACETAMOL E CAFEÍNA UTILIZANDO ANÁLISE POR INJEÇÃO EM BATELADA COM DETECÇÃO AMPEROMÉTRICA

    Directory of Open Access Journals (Sweden)

    Weberson Pereira Silva

    Full Text Available A fast and simple procedure for simultaneous determination of propyphenazone (PRO, paracetamol (PAR and caffeine (CAF was performed using batch injection analysis with multiple pulse amperometric detection (BIA-MPA. Three potentials pulses were selected for the analysis: +0.90 V/50 ms: only PAR was oxidized; +1.20 V/50 ms: oxidation of PAR and PRO without the interference of CAF; +1.60 V/50 ms: oxidation of the three compounds (PAR, PRO and CAF. The sample aliquot (150 µL was directly injected onto the boron-doped diamond (BDD electrode immersed in a BIA cell. The analytical characteristics of the proposed method include high analytical frequency (75 injections per hour, good stability (RSD < 3.9%; n = 10, and low detection limits (0.3, 0.2 and 0.1 mg L−1 for PRO, PAR and CAF, respectively. The proposed method yielded similar results to those obtained by liquid chromatography at a 95% confidence level.

  11. Dinâmica e estudo dos efeitos da transferência de massa na destilação em batelada: mapeamento das principais variáveis de processo

    OpenAIRE

    da Cunha Teixeira, Jonathan

    2010-01-01

    Praticamente, toda planta química de grande porte, tem uma ou mais unidades de separação para preparação, purificação e tratamento de misturas multicomponentes como: produtos, subprodutos e matérias-primas não convertidas em produtos. Para cada unidade de separação, muitas operações unitárias podem ser viáveis, e assim, a melhor seqüência de operações de separação deve ser estabelecida, ao se considerar um processo completo de separação. As ferramentas mais utilizadas para a an...

  12. Inativação térmica de ovos de helmintos em água e em biossólidos digeridos: cinética em reator batelada e modelagem matemática em reator tubular.

    OpenAIRE

    Marilza de Fátima Simoneti

    2006-01-01

    O biossólido pode ser um valioso recurso ao ser utilizado em solos agrícolas; porém, um dos principais problemas de sua utilização é a presença de patógenos que podem disseminar doenças. Os principais patógenos presentes no biossólido são vírus, bactérias, protozoários e helmintos. Dentre os patógenos existentes no biossólido, os ovos de helmintos são os mais resistentes à inativação térmica e, para helmintos, os ovos de Ascaris são utilizados como indicador desses parasitas devido à comum oc...

  13. Effectiveness and economic analysis of the whole cell/recombinant B subunit (WC/rbs inactivated oral cholera vaccine in the prevention of traveller's diarrhoea

    Directory of Open Access Journals (Sweden)

    Diez-Diaz Rosa

    2009-05-01

    Full Text Available Abstract Background Nowadays there is a debate about the indication of the oral whole-cell/recombinant B-subunit cholera vaccine (WC/rBS in traveller's diarrhoea. However, a cost-benefit analysis based on real data has not been published. Methods A cost-effectiveness and cost-benefit study of the oral cholera vaccine (WC/rBS, Dukoral® for the prevention of traveller's diarrhoea (TD was performed in subjects travelling to cholera risk areas. The effectiveness of WC/rBS vaccine in the prevention of TD was analyzed in 362 travellers attending two International Vaccination Centres in Spain between May and September 2005. Results The overall vaccine efficacy against TD was 42,6%. Direct healthcare-related costs as well as indirect costs (lost vacation days subsequent to the disease were considered. Preventive vaccination against TD resulted in a mean saving of 79.26 € per traveller. Conclusion According to the cost-benefit analysis performed, the recommendation for WC/rBS vaccination in subjects travelling to zones at risk of TD is beneficial for the traveller, regardless of trip duration and visited continent.

  14. Elastic Scattering of 7Li+27Al at Backward Angles in the 7-11 MeV Energy Range for Application in RBS

    International Nuclear Information System (INIS)

    Carnelli, P. F. F.; Arazi, A.; Cardona, M. A.; Figueira, J. M.; Hojman, D.; Martinez Heimann, D.; Negri, A. E.; Pacheco, A. J.; Abriola, D.; Capurro, O. A.; Fimiani, L.; Grinberg, P.; Marti, G. V.; Fernandez Niello, J. O.

    2010-01-01

    We have measured elastic excitation functions for the 7 Li+ 27 Al system, in an energy range close to its Coulomb barrier (E lab = 8.4 MeV) in steps of 0.25 MeV. For this purpose, an array of eight surface-barrier detectors was used. To get an insight on the background composition (mainly α particles), a telescope-detector was used for atomic-number identification. Identical measurements for the 6 Li+ 27 Al system are planned for the near future.

  15. Characterization for rbs of Titanium Oxide thin films grown by Dip Coating in a coloidal suspension of nano structured Titanium Oxide

    International Nuclear Information System (INIS)

    Pedrero, E.; Vigil, E.; Zumeta, I.

    1999-01-01

    The depth of Titanium Oxide thin films grown by Dip Coating in a coloidal suspension of nano structured Titanium Oxide was characterized using Rutherford Backscattering Spectrometry. Film depths are compared in function of bath and suspension parameters

  16. 75 FR 24948 - Granting of Request for Early Termination of the Waiting Period Under the Premerger Notification...

    Science.gov (United States)

    2010-05-06

    ... the waiting period provided by law and the premerger notification rules. The grants were made by the....V. G RBS Sempra Oil Trading (Ireland) Limited. G RBS Sempra Metals Group Limited. G RBS Sempra...

  17. Brazilian experience using high-dose sequential therapy (HDS followed by autologous hematopoietic stem cell transplantation (ASCT for malignant lymphomas Experiência brasileira utilizando terapia sequencial de alta dose seguido de transplante autólogo de célula-tronco hematopoética para linfomas malignos

    Directory of Open Access Journals (Sweden)

    Cármino A. de Souza

    2009-08-01

    Full Text Available Using the overall survival (OS, disease free survival (DFS and progression free survival (PFS, as well as associated toxicity, the purpose of this work was to evaluate the effectiveness of HDS followed by ASCT as salvage therapy. A retrospective analysis was performed of 106 patients with high grade non-Hodgkin lymphoma receiving HDS followed by ASCT, between 1998 and 2006. Median age was 45 years (Range: 8-65, with 66 (62% men. Histopathological classification was: 78% DLBCL patients, 12% T and anaplastic and 9% Mantle cell lymphomas; 87% had B cell and 12% T cell lymphomas; 83% were stage III-IV (Ann Arbor Staging, 63% had B symptoms, 32% had bone marrow involvement, 62% bulky disease and 42% high-intermediate or high risk IPI. After HDCY, 9 patients died, 7 from toxicity and 2 from sepsis. Eighty patients underwent ASCT, 47% were in complete remission (CR and 15% died, all from toxicity. Their OS was 45% over 8 years. During the follow-up, another 35 patients died [4 CR, 1 partial response (PR, 2 relapsed disease (RD and 28 disease progression (DP], 11 (31% had not performed ASCT. OS was 37%; DFS was 49% and PFS 28%. OS by diagnosis was 42% for DLBCL, 40% for T-cell (8 y and 20% for Mantle Cell (6 y (P=NS. OS by B symptom patients was 22% vs. 58% (P=0.002 and PFS was 23% vs. 37% (P=0.03. Patients who achieved CR after HDCY (38 had significantly better OS and PFS (38% and 17% than patients who remained in DP (PA proposta deste trabalho foi avaliar a eficácia da HDS seguida do transplante autólogo como terapia de salvamento através da sobrevida global, livre de doença e livre de progressão bem como sua toxicidade. Realizou-se estudo retrospectivo com 106 pacientes com LNH de alto grau de malignidade entre 1998 e 2006. A mediana de idade foi 45 anos (8-65; 62% homens; DLBCL, 78%; 12%, T e anaplásico e 9%, linfoma da zona do manto; 87%, células B; 83% estádios III-IV; 63% com sintomas B; 32% com infiltração da medula óssea ao diagnóstico; 62% com grande massa e 42% com IPI de alto risco ou intermediário. Após alta dose de ciclofosfamida (HDCY, nove pacientes faleceram. Oitenta pacientes realizaram o transplante, sendo que 47% estavam em RC e 15% faleceram devido à toxicidade. A sobrevida global foi de 45% em oito anos para estes pacientes. Trinta e cinco pacientes não realizaram o transplante por causas diversas. Sobrevida global para todos os pacientes foi de 42%, DLBCL, 40%; T-cell, 40% e zona do manto, 20% (P=NS. Pacientes que obtiveram RC após HDCY tiveram melhor sobrevida global e livre de progressão (38% e 17%, respectivamente do que os que permaneceram em PD (P<0.0001. O modelo de Cox resultou que o número de linhas terapêuticas antes da HDCY (RR 1.41 IC 95%: 1.04-1.90, P=0.02 e PD antes da HDCY (RR 2.70, IC 95%: 1.49-4.91, P<0.001 e após HDCY (RR 5.38, IC 95%: 2.93-9.87, P<0.0001. Nosso estudo sugere que HDS é um método eficiente de tratamento para melhorar o status e reduzir a massa tumoral. Em relação à toxicidade, é factível, especialmente em pacientes de prognóstico ruim

  18. Parâmetros fitotécnicos e condições microclimáticas para videira vinífera conduzida sob dupla poda sequencial Plant parameters and microclimatic conditions for wine grapes cultivated under sequential double pruning

    Directory of Open Access Journals (Sweden)

    Antonio O. Santos

    2011-12-01

    Full Text Available A qualidade do vinho depende da qualidade da uva produzida. As condições microclimáticas incidentes no período de crescimento e desenvolvimento da videira, especialmente na fase do estabelecimento do fruto até a colheita, afetam a qualidade do fruto. A dinâmica da água no solo tem papel importante sobre a qualidade do mosto produzido à vinificação. Em São Paulo, nas bacias de maior concentração atual da vitivinicultura ocorre um período chuvoso que se estende de novembro a fevereiro, que alcança grande parte das variedades da região em fase de crescimento e maturação da baga, o que afeta negativamente a qualidade da uva e do vinho, na maioria das safras. Por outro lado, nas mesmas regiões ocorre um período mais favorável, que é o outono/inverno com potencial de soma térmica promissor para o crescimento da videira e com incidência de um longo período de baixa pluviometria, que vai de abril a outubro. Um experimento foi conduzido, objetivando estudar o cultivo da videira nas duas estações microclimáticas descritas. Avaliou-se a composição físico-química do fruto e a condições microclimáticas para maturação da baga da videira, de 2008 a 2010. Os resultados mostraram que as variedades de videira estudas desenvolveram maior potencial de qualidade da baga, quando cultivada no período de outono-inverno, sendo o efeito mais marcante sobre Vitis vinifera.The wine quality depends on the quality grapes produced. Actual micrometeorological conditions occurring in the time frame of grapevine growth and development will impact berry quality, especially from berry set to the harvest. Soil-water dynamics plays an important role on the quality grape must achieved at the vinification. In the São Paulo State (Brasil in the regions of greatest clustering of vintners, there is a marked rainy time-frame from November to February, which matches with the vine time-cycle when the majority of grape varieties are in the berry set to berry maturation bracket, which negatively affects the grape and wine quality in most of the harvests. In contrast, for the same region there is more favorable condition in the autumn/winter time, which has a promise heat summation for proper grape growing, characterized by a long time-frame of low pluviometric rate (April to October. An experiment was conducted aiming at study the cultivation o grapevines in both described ''climatic windows''�. Physico-chemical composition of and microclimatic conditions for berry maturation during 2008 to 2010 were analysed. Results showed that the studied grape varieties developed better berry quality potential when cultivated in the autumn/winter time and this effect was more pronounced for Vitis vinifera.

  19. Sequential motor task (Luria's Fist-Edge-Palm Test in children with benign focal epilepsy of childhood with centrotemporal spikes Tarefa motora sequencial (Teste de Lúria punho-lado-palma em crianças com epilepsia focal benigna da infância com descarga centrotemporal

    Directory of Open Access Journals (Sweden)

    Carmen Silvia Molleis Galego Miziara

    2013-06-01

    Full Text Available This study evaluated the sequential motor manual actions in children with benign focal epilepsy of childhood with centrotemporal spikes (BECTS and compares the results with matched control group, through the application of Luria's fist-edge-palm test. The children with BECTS underwent interictal single photon emission computed tomography (SPECT and School Performance Test (SPT. Significant difference occurred between the study and control groups for manual motor action through three equal and three different movements. Children with lower school performance had higher error rate in the imitation of hand gestures. Another factor significantly associated with the failure was the abnormality in SPECT. Children with BECTS showed abnormalities in the test that evaluated manual motor programming/planning. This study may suggest that the functional changes related to epileptiform activity in rolandic region interfere with the executive function in children with BECTS.Esse estudo avaliou ações motoras manuais sequenciais em crianças com epilepsia focal benigna da infância com descarga centrotemporal (EBICT e comparou os resultados com o grupo controle pareado, através do teste de Lúria (punho-lado-palma. As crianças com EBICT realizaram single photon emission computed tomography (SPECT interictal e Teste de Desempenho Escolar (TDE. Foram encontradas diferenças significativas entre os dois grupos nas atividades motoras de três movimentos iguais e três movimentos diferentes. As crianças com piores resultados no TDE e com SPECT alterado apresentaram mais erros no teste de imitação manual. Crianças com epilepsia fracassaram nos testes de avaliação motora que envolvem programação/planejamento. Esse estudo sugere que mudanças funcionais relacionadas à atividade epileptiforme na região rolândica interfere com as funções executivas de crianças com EBICT.

  20. Otimização térmica e econômica de bomba de calor para aquecimento de água, utilizando programação quadrática sequencial e simulação através do método de substituição Newton Raphson

    OpenAIRE

    Obed Alexander Córdova Lobatón

    2011-01-01

    Resumo: O trabalho apresenta metodologias computacionais de otimização e simulação para o desenvolvimento do projeto de um sistema de bomba de calor para aquecimento de água em prédios residenciais, especialmente para uso em banho na região de Campinas. O sistema bomba de calor foi simulado focando o estudo nos trocadores de calor (evaporador e condensador). Cada componente foi otimizado mediante uma análise térmica e econômica que permitiu reduzir custos de investimento e de operação através...

  1. Seletividade e eficácia da aplicação sequencial de oxyfluorfen e de ioxynil-octanoato, em semeadura direta de cebola Selectivity and efficacy of the sequential application of oxyfluorfen and ioxynyl-octanoate in direct sowing of onion

    Directory of Open Access Journals (Sweden)

    Lino R. Ferreira

    2000-01-01

    Full Text Available Visando avaliar os efeitos do parcelamento da dose de oxyfluorfen e ioxyniloctanoato sobre a tolerância de plantas de cebola 'Granex 33' e a eficiência no controle das plantas daninhas na cultura, instalada por semeadura direta, foram conduzidos dois experimentos, sendo um na presença de plantas daninhas e o outro na ausência das mesmas. Ioxynil-octanoato, quando aplicado em doses acima de 0,125 kg/ha, aos 19 DAS, foi menos seletivo para o cultivar Granex 33 do que o oxyfluorfen. O parcelamento da dose, em até três aplicações, aumentou a tolerância das plantas de cebola ao oxyfluorfen e ao ioxynil-octanoato. Oxyfluorfen, nas doses avaliadas, controlou Galinsoga parviflora e Amaranthus hybridus, porém não controlou Lepidium virginicum e Coronopus didymus. Ioxynil-octanoato a 0,125 kg/ha, aos 19 DAS, mais duas aplicações de 0,25 kg/ha aos 34 e 65 DAS, controlou as espécies daninhas presentes, com produção de bulbos semelhantes à testemunha capinada. Nenhum dos herbicidas influenciou a conservação pós-colheita dos bulbos até 120 dias de armazenamento.With the purpose of evaluating the splitting of the dose of oxyfluorfen and ioxynyloctanoato on the tolerance of the 'Granex 33' onion plants and the efficiency on the weed control at crop, installed by direct sowing, two experiment were carried out, one in the presence and the other in the absence of weeds. Ioxynyloctanoato, when applied in doses higher than 0.125 kg/ha, at 19 DAS, was less selective for the 'Granex 33' cultivar than oxyfluorfen. Splitting of the doses, up to three applications, increased the tolerance of onion plants toward both oxyfluorfen and ioxynyl-octanoato. Oxyfluorfen, at the evaluated doses, controlled Galinsoga parviflora and Amaranthus hybridus; however it did not control Lepidium virginicum and Coronopus didymus. Ioxynyl-octanoato at 0.125 kg/ha, at 19 DAS, plus two applications of 0.25 kg/ha at 34 and 65 DAS, controlled the existing weeds, with production of bulbs similar to the hand-hold control. None of the herbicides influenced the bulbs post-harvest conservation up to 120 days of storage.

  2. Nitrificação de efluente de abatedouro de tilápia em função da aeração e tempo de reação Nitrification of tilapia slugtherhouse effluent according to the aeration conditions and reaction time

    Directory of Open Access Journals (Sweden)

    Dilcemara C. Zenatti

    2009-12-01

    Full Text Available A ocorrência de compostos nitrogenados em água residuária de abatedouro de tilápia acima dos limites legais, tem causado sérios problemas de poluição em corpos d'água receptores. O processo biológico para remoção dessas substâncias comumente encontradas sob a forma de nitrogênio amoniacal, é conhecido como nitrificação. Objetivou-se, com o presente trabalho, estudar o efeito do tempo de reação (TR e da aeração na eficiência da remoção de nitrogênio amoniacal e na conversão do nitrogênio amoniacal a nitrato, de água residuária de abate de tilápia em um reator em batelada sequencial com biofilme. O experimento foi executado usando-se dois TR(6 e 12 h e dois níveis de vazão de ar (3 e 6 L min-1; avaliaram-se quatro tratamentos a partir da combinação dessas variáveis configuradas em um planejamento experimental do tipo factorial 2², sendo: T1 (QAr = 3 L min-1 e TR = 6 h; T2 (QAr = 6 L min-1 e TR = 6 h, T3 (QAr = 3 L min-1 e TR = 12 h e T4 (QAr = 6 L min-1 e TR = 12 h, e quatro repetições para cada tratamento. Os resultados mais significativos foram para o tratamento T4, com o qual se obteve média de eficiência para conversão de amônio a nitrato e remoção de nitrogênio amoniacal de 57,27 ± 27,05% e 81,90 ± 3,80%, respectivamente.The occurrence of composts of nitrogen above the legal limits has been causing serious pollution problems in water receptor bodies. The biological process for removal of these substances commonly found in the ammoniacal nitrogen form is known as nitrification. The present study had as its objective the evaluation of the effects of the reaction time (TR and of the aeration on the removal efficiency of the ammoniacal nitrogen and on the conversion of the ammoniacal nitrogen to nitrate in a nitrification process of the tilapia slaughterhouse effluent in sequential batch reactor with biofilm. The experiment was performed using two reaction times (6 and 12 h and two levels of air flow

  3. Efeito do bicarbonato de sódio no tratamento de vinhaça em AnSBBR operado a 55 e 35ºC Effect of the sodium bicarbonate in the treatment of vinasse in AnSBBR operated at 55 and 35ºC

    Directory of Open Access Journals (Sweden)

    Maria Magdalena Ribas Döll

    2010-09-01

    Full Text Available Avaliou-se a influência do bicarbonato de sódio (NaHCO3 no desempenho do reator anaeróbio batelada sequencial com biomassa imobilizada tratando vinhaça a 55 e a 35ºC. O reator foi preenchido com espuma de poliuretano e agitado a 300 rpm. A adaptação a 55ºC estendeu-se por 50 dias, tendo o reator sido alimentado com vinhaça (DQO de 0,3 a 1,0 g/L. Para a operação a 35ºC, procedeu-se inicialmente ao enriquecimento da população metanogênica, durante 21 dias, com substrato à base de etanol (2,5 gDQO/L. Posteriormente, cargas orgânicas volumétricas (COV de 0,85 a 5,70 gDQO/L.d foram aplicadas no reator a 55ºC, com suplementação de 1,2 a 0,4 gHCO3-/gDQO. A 35ºC, o reator foi submetido a COV de 2,85 a 36,0 gDQO/L.d com 0,4 a 0,2 gHCO3-/gDQO. A remoção de DQO variou de 43 a 78% a 55ºC e de 75 a 85% a 35ºC. A suplementação de alcalinidade mostrou-se essencial para a estabilidade do processo, sendo requerida em menor quantidade a 35ºC.The influence of the sodium bicarbonate (NaHCO3 on the performance of an anaerobic sequencing batch biofilm reactor treating vinasse at 55 and 35ºC was evaluated. The reactor was filled with polyurethane foam and agitated at 300 rpm. The acclimatization period at 55ºC lasted 50 days, and the reactor was fed with vinasse (COD from 0.3 to 1.0 g/L. A previous enrichment of methanogenic population was provided for the reactor operated at 35ºC, feeding it with an ethanol based substrate (2.5 gCOD/L during 21 days. Further on, organic loading rates (OLR ranging from 0.85 to 5.70 gCOD/L.d were applied to the reactor at 55ºC, supplemented with 1.2 to 0.4 gHCO3-/gCOD. At 35ºC the reactor was subjected to OLR ranging from 2.85 to 36.0 gCOD/L.d with 0.4 to 0.2 gHCO3-/gCOD. COD removal ranged from 43 to 78% at 55ºC and from 75 to 85% at 35ºC. Alkalinity supplementation was found to be essential for process stability, but the amount required was lower at 35ºC.

  4. Sacarificação da polpa cítrica por hidrólise ácida e cultivo pelo processo de batelada simples com reciclo de Trichoderma reesei ou Aspergillus niger com produção de celulases e poligalacturonases

    OpenAIRE

    Barbosa, Marcos de Freitas [UNESP

    2012-01-01

    A necessidade mundial por tecnologias não poluidoras ou “limpas” obtidas de fontes renováveis e uso racional da terra, a produção de insumos cada vez mais deverá ser baseada na biotecnologia com emprego de resíduos agroindustriais. A polpa cítrica obtida da laranja (Citrus sinensis) é um importante resíduo que somente no Estado de São Paulo se estima em 7,693x106 toneladas produzidas pelas indústrias cítricas. Este trabalho teve como objetivo principal o estudo da sacarificação biotecnológica...

  5. Planejamento experimental estatístico para a otimização das condições em batelada de dessorção de níquel da alga marinha Sargassum filipendula = Statistical design of experiments for optimizing the batch conditions to nickel desorption on Sargassum filipendula seaweed

    Directory of Open Access Journals (Sweden)

    Araceli Aparecida Seolatto

    2009-04-01

    Full Text Available A fim de se realizar um estudo sobre os efeitos de parâmetros importantes na dessorção de níquel da alga marinha Sargassum filipendula, quatro agentes foram testados em grupos de planejamento fatorial 4.23 (tipo de eluente (E, carga de níquel (q, concentraçãoinicial do eluente(C e razão sólido-líquido(R. Duas respostas foram analisadas: a quantidade dessorvida e a perda de massa durante o processo de dessorção. Os resultados mostraram que todos os fatores foram significativos nas duas respostas. Além disso, váriasinterações entre os fatores se mostraram significantes. Analisando a contribuição de cada fator, concluiu-se que as melhores condições operacionais foram obtidas na configuração para os eluentes H2SO4/MgSO4, na maior concentração testada, maior carga de níquel emenor razão sólido-líquido. Nestas condições, a eficiência na eluição da biomassa mostrouse superior a 95%, o que torna o processo de biossorção ainda mais interessante no tratamento de soluções que contêm níquel. A biomassa Sargassum filipendula, depois deregenerada, pode ser utilizada em ciclos subsequentes de biossorção, a fim de diminuir o custo com o biossorvente e facilitar o processo de tratamento que dispensa trocas sucessivas da biomassa.In order to conduct a study on the effect of important design parameters in nickel desorption from the macroalgae Sargassum filipendula, four agents were tested in sets of full 4.23 factorial designs (eluant agent, nickel load, initial acid concentration and solid:liquid ratio. Two responses were analyzed: the amount desorbed for the agents and the weight loss during the desorption process. The results showed that all factors were significant in both responses.Additionally, several interactions among the factors were also significant. Analyzing the contribution of each factor, it was verified that the best operational conditions were obtained for eluents H2SO4/MgSO4, at the highest tested concentration, highest nickel load and lowest solid:liquid ratio. In this configuration, the results obtained with the desorption (% was greater than 95%, making the biosorption process very interesting in the treatment of nickel solutions. Once regenerated, the Sargassum filipendula biomass can be used in subsequent biosorption cycles, lowering biomass costs and facilitating the treatment process that does not require successive biomass changes.

  6. Planejamento experimental estatístico para a otimização das condições em batelada de dessorção de níquel da alga marinha Sargassum filipendula - DOI: 10.4025/actascitechnol.v31i2.989

    Directory of Open Access Journals (Sweden)

    Araceli Aparecida Seolatto

    2009-06-01

    Full Text Available A fim de se realizar um estudo sobre os efeitos de parâmetros importantes na dessorção de níquel da alga marinha Sargassum filipendula, quatro agentes foram testados em grupos de planejamento fatorial 4.23 (tipo de eluente (E, carga de níquel (q, concentração inicial do eluente(C e razão sólido-líquido(R. Duas respostas foram analisadas: a quantidade dessorvida e a perda de massa durante o processo de dessorção. Os resultados mostraram que todos os fatores foram significativos nas duas respostas. Além disso, várias interações entre os fatores se mostraram significantes. Analisando a contribuição de cada fator, concluiu-se que as melhores condições operacionais foram obtidas na configuração para os eluentes H2SO4/MgSO4, na maior concentração testada, maior carga de níquel e menor razão sólido-líquido. Nestas condições, a eficiência na eluição da biomassa mostrou-se superior a 95%, o que torna o processo de biossorção ainda mais interessante no tratamento de soluções que contêm níquel. A biomassa Sargassum filipendula, depois de regenerada, pode ser utilizada em ciclos subsequentes de biossorção, a fim de diminuir o custo com o biossorvente e facilitar o processo de tratamento que dispensa trocas sucessivas da biomassa.

  7. The Regolith Biters: A Divide-And-Conquer Architecture for Sample Return Missions

    Data.gov (United States)

    National Aeronautics and Space Administration — Asteroid Sample Return mission architecture study, with a flyby motership releasing small sample takers, called Regolith Biters (RBs). After flyby, the RBs would...

  8. Ribose utilization by the human commensal Bifidobacterium breve UCC2003.

    Science.gov (United States)

    Pokusaeva, Karina; Neves, Ana Rute; Zomer, Aldert; O'Connell-Motherway, Mary; MacSharry, John; Curley, Peter; Fitzgerald, Gerald F; van Sinderen, Douwe

    2010-05-01

    Growth of Bifidobacterium breve UCC2003 on ribose leads to the transcriptional induction of the rbsACBDK gene cluster. Generation and phenotypic analysis of an rbsA insertion mutant established that the rbs gene cluster is essential for ribose utilization, and that its transcription is likely regulated by a LacI-type regulator encoded by rbsR, located immediately upstream of rbsA. Gel mobility shift assays using purified RbsR(His) indicate that the promoter upstream of rbsABCDK is negatively controlled by RbsR(His) binding to an 18 bp inverted repeat and that RbsR(His) binding activity is modulated by D-ribose. The rbsK gene of the rbs operon of B. breve UCC2003 was shown to specify a ribokinase (EC 2.7.1.15), which specifically directs its phosphorylating activity towards D-ribose, converting this pentose sugar to ribose-5-phosphate. © 2009 The Authors. Journal compilation © 2009 Society for Applied Microbiology and Blackwell Publishing Ltd.

  9. Planejamento estatístico de experimentos como uma ferramenta para otimização das condições de biossorção de Cu(II em batelada utilizando-se casca de nozes pecã como biossorvente Statistical design of experiments as a tool for optimizing the batch conditions of Cu(II biosorption using pecan nutshells as biosorbent

    Directory of Open Access Journals (Sweden)

    Jorge L. Brasil

    2007-06-01

    Full Text Available In order to reduce the total number of experiments for achieving the highest amount of adsorbed Cu2+ (qmax using pecan nutshells (Carya illinoensis as biosorbent, a full 2(4 factorial design with two central points was carried out (mass of biosorbent- m, pH, initial metallic ion concentration- C0, time of contact- t. In order to continue the optimization of the system, a central composite surface analysis design with two factors and five central points was carried out. The maximum amount of Cu2+ taken up by the pecan nutshells was 20 mg g-1. These results were confirmed by determining a Cu2+ isotherm using the best conditions attained by the statistical design of experiments.

  10. Simulator of a fail detector system for redundant sensors

    International Nuclear Information System (INIS)

    Assumpcao Filho, E.O.; Nakata, H.

    1990-01-01

    A failure detection and isolation system (FDI) simulation program has been developed for IBM-PC microcomputers. The program, based on the sequencial likelihood ratio testing method developed by A. Wald, was implemented with Monte-Carlo technique. The calculated failure detection rate was favorably compared against the wind-tunnel experimental redundant temperature sensors. (author)

  11. Radiographic skeletal survey and radionuclide bone scan in Langerhans cell histiocytosis of bone

    International Nuclear Information System (INIS)

    Nieuwenhuyse, J.P. van; Clapuyt, P.; Malghem, J.; Everarts, P.; Melin, J.; Pauwels, S.; Brichard, B.; Ninane, J.; Vermylen, C.; Cornu, G.

    1996-01-01

    Background. The lack of a consensus in the literature on the imaging strategy in Langerhans cell histiocytosis (LCH) bone lesions in childhood. Objective. To evaluate the relative value of radionuclide bone scan (RBS) and radiographic skeletal survey (RSS) in the detection of LCH bone lesions, both in the initial work-up of the disease and during the follow-up period. Materials and methods. Ten children with bone lesions evaluated by means of RSS and RBS in a retrospective study (1984-1993). Results. Fifty radiologically and/or scintigraphically abnormal foci were detected: 27 anomalies in the initial work-up (12 by both RSS and RBS, 8 by RSS only and 7 by RBS only) and 23 additional anomalies during follow-up (10 by both RSS and RBS, 10 by RSS only and 3 by RBS only). RSS+/RBS- lesions (n = 18) are more frequently encountered in the skull (P = 0.038), and more frequently lack radiologic signs of osteoblastic activity (P = 0.020), than RSS+/RBS+ lesions (n = 22). RSS-/RBS+ abnormalities (n = 10) were most frequently insignificant. Conclusion. In the initial work-up both RSS and RBS should be carried out, while in the follow-up only RSS should be performed. (orig.). With 2 figs., 4 tabs

  12. Exploring information provision in reconstructive breast surgery: A qualitative study.

    Science.gov (United States)

    Potter, Shelley; Mills, Nicola; Cawthorn, Simon; Wilson, Sherif; Blazeby, Jane

    2015-12-01

    Women considering reconstructive breast surgery (RBS) require adequate information to make informed treatment decisions. This study explored patients' and health professionals' (HPs) perceptions of the adequacy of information provided for decision-making in RBS. Semi-structured interviews with a purposive sample of patients who had undergone RBS and HPs providing specialist care explored participants' experiences of information provision prior to RBS. Professionals reported providing standardised verbal, written and photographic information about the process and outcomes of surgery. Women, by contrast, reported varying levels of information provision. Some felt fully-informed but others perceived they had received insufficient information about available treatment options or possible outcomes of surgery to make an informed decision. Women need adequate information to make informed decisions about RBS and current practice may not meet women's needs. Minimum agreed standards of information provision, especially about alternative types of reconstruction, are recommended to improve decision-making in RBS. Copyright © 2015 Elsevier Ltd. All rights reserved.

  13. The molecular mechanism underlying Roberts syndrome involves loss of ESCO2 acetyltransferase activity

    DEFF Research Database (Denmark)

    Gordillo, M.; Vega, H.; Trainer, A.H.

    2008-01-01

    Roberts syndrome/SC phocomelia (RBS) is an autosomal recessive disorder with growth retardation, craniofacial abnormalities and limb reduction. Cellular alterations in RBS include lack of cohesion at the heterochromatic regions around centromeres and the long arm of the Y chromosome, reduced growth...... and nonsense mutations associated with decreased levels of mRNA and absence of protein. We found decreased proliferation capacity in RBS cell lines associated with cell death, but not with increased cell cycle duration, which could be a factor in the development of phocomelia and cleft palate in RBS...

  14. ORF Alignment: NC_005027 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available nsport ... protein rbsD [Pirellula sp.] ... Length = 135 ... Query: 1 ... MKRTRLLNSELSYEISRIGHTASIT...LCDAGLPIPSGVKRIDLAIEEGYPTFLRTLDAILS 60 ... MKRTRLLNSELSYEISRIGHTASITLCDAGL...PIPSGVKRIDLAIEEGYPTFLRTLDAILS Sbjct: 1 ... MKRTRLLNSELSYEISRIGHTASITLCDAGLPIPSGVKRIDLAIEEGYPTFLRTLDAILS 60 ... Qu

  15. Sleep-Promoting Effects and Possible Mechanisms of Action Associated with a Standardized Rice Bran Supplement

    Directory of Open Access Journals (Sweden)

    Hyejin Yang

    2017-05-01

    Full Text Available Natural sleep aids are becoming more popular due to the widespread occurrence of sleep disorders. The objective of this study was to assess the sleep-promoting effects of rice bran—a product that is considered as a functional ingredient. To evaluate the sleep-promoting effects of a standardized rice bran supplement (RBS, we employed a pentobarbital-induced sleep test and conducted analyses of sleep architecture. In addition, the effect of RBS on a caffeine-induced sleep disturbance was investigated. Oral administration of RBS (500 and 1000 mg/kg produced a significant decrease in sleep latency and increase in sleep duration in pentobarbital-induced sleep in mice. Moreover, both RBS (1000 mg/kg and doxepin hydrochloride (histamine H1 receptor antagonist, 30 mg/kg counteracted a caffeine-induced sleep disturbance in mice. In terms of sleep phases, RBS (500 mg/kg promoted non-rapid eye movement sleep for the first 3 h following its administration. Lastly, we unveiled a possible mechanism for RBS action as the hypnotic effect of RBS was blocked by a histamine H1 receptor agonist. The present study revealed sleep-promoting effects of RBS using various animal assays. Such effects seem to be mediated through the histaminergic system. Our findings suggest that RBS may be a promising natural aid for relieving sleep problems.

  16. Making the Case for Reusable Booster Systems: The Operations Perspective

    Science.gov (United States)

    Zapata, Edgar

    2012-01-01

    Presentation to the Aeronautics Space Engineering Board National Research Council Reusable Booster System: Review and Assessment Committee. Addresses: the criteria and assumptions used in the formulation of current RBS plans; the methodologies used in the current cost estimates for RBS; the modeling methodology used to frame the business case for an RBS capability including: the data used in the analysis, the models' robustness if new data become available, and the impact of unclassified government data that was previously unavailable and which will be supplied by the USAF; the technical maturity of key elements critical to RBS implementation and the ability of current technology development plans to meet technical readiness milestones.

  17. Sleep-Promoting Effects and Possible Mechanisms of Action Associated with a Standardized Rice Bran Supplement.

    Science.gov (United States)

    Yang, Hyejin; Yoon, Minseok; Um, Min Young; Lee, Jaekwang; Jung, Jonghoon; Lee, Changho; Kim, Yun-Tai; Kwon, Sangoh; Kim, Boknam; Cho, Suengmok

    2017-05-18

    Natural sleep aids are becoming more popular due to the widespread occurrence of sleep disorders. The objective of this study was to assess the sleep-promoting effects of rice bran-a product that is considered as a functional ingredient. To evaluate the sleep-promoting effects of a standardized rice bran supplement (RBS), we employed a pentobarbital-induced sleep test and conducted analyses of sleep architecture. In addition, the effect of RBS on a caffeine-induced sleep disturbance was investigated. Oral administration of RBS (500 and 1000 mg/kg) produced a significant decrease in sleep latency and increase in sleep duration in pentobarbital-induced sleep in mice. Moreover, both RBS (1000 mg/kg) and doxepin hydrochloride (histamine H₁ receptor antagonist, 30 mg/kg) counteracted a caffeine-induced sleep disturbance in mice. In terms of sleep phases, RBS (500 mg/kg) promoted non-rapid eye movement sleep for the first 3 h following its administration. Lastly, we unveiled a possible mechanism for RBS action as the hypnotic effect of RBS was blocked by a histamine H₁ receptor agonist. The present study revealed sleep-promoting effects of RBS using various animal assays. Such effects seem to be mediated through the histaminergic system. Our findings suggest that RBS may be a promising natural aid for relieving sleep problems.

  18. The molecular mechanism underlying Roberts syndrome involves loss of ESCO2 acetyltransferase activity

    NARCIS (Netherlands)

    Gordillo, Miriam; Vega, Hugo; Trainer, Alison H.; Hou, Fajian; Sakai, Norio; Luque, Ricardo; Kayserili, Hülya; Basaran, Seher; Skovby, Flemming; Hennekam, Raoul C. M.; Uzielli, Maria L. Giovannucci; Schnur, Rhonda E.; Manouvrier, Sylvie; Chang, Susan; Blair, Edward; Hurst, Jane A.; Forzano, Francesca; Meins, Moritz; Simola, Kalle O. J.; Raas-Rothschild, Annick; Schultz, Roger A.; McDaniel, Lisa D.; Ozono, Keiichi; Inui, Koji; Zou, Hui; Jabs, Ethylin Wang

    2008-01-01

    Roberts syndrome/SC phocomelia (RBS) is an autosomal recessive disorder with growth retardation, craniofacial abnormalities and limb reduction. Cellular alterations in RBS include lack of cohesion at the heterochromatic regions around centromeres and the long arm of the Y chromosome, reduced growth

  19. The molecular mechanism underlying Roberts syndrome involves loss of ESCO2 acetyltransferase activity

    DEFF Research Database (Denmark)

    Gordillo, M.; Vega, H.; Trainer, A.H.

    2008-01-01

    Roberts syndrome/SC phocomelia (RBS) is an autosomal recessive disorder with growth retardation, craniofacial abnormalities and limb reduction. Cellular alterations in RBS include lack of cohesion at the heterochromatic regions around centromeres and the long arm of the Y chromosome, reduced grow...

  20. 77 FR 65532 - Submission for OMB Review; Comment Request

    Science.gov (United States)

    2012-10-29

    ... each State. RBS will collect information using various forms from the lender and the borrower. This information is vital for making prudent financial decisions. Need and Use of the Information: RBS will collect information to monitor the guaranteed loan portfolio to ensure that the lenders are adequately servicing the...

  1. Parent-Reported Repetitive Behavior in Toddlers on the Autism Spectrum

    Science.gov (United States)

    Schertz, Hannah H.; Odom, Samuel L.; Baggett, Baggett M.; Sideris, John H.

    2016-01-01

    Toddlers with autism spectrum disorder (ASD) were assessed on the Repetitive Behavior Scale-Revised (RBS-R), which we found to have acceptable internal consistency. Stereotypical subscale scores showed a negligible association with cognitive level, but correlated more strongly with adaptive and social indicators. Relative to earlier reported RBS-R…

  2. Ecological correlates of relative brain size in some South African ...

    African Journals Online (AJOL)

    Relative brain size (size of the brain once body size effects have been removed) has been calculated for 16 species of rodent from South Africa and is shown to vary with six species having a positive RBS (that is a brain larger than expected) and 10 a negative RBS. Arboreal species such as Paraxerus cepapi and ...

  3. The manufacture and compound investigation of the isotope supportless targets with higher purity and radiation durability for the nuclear physics experiments

    International Nuclear Information System (INIS)

    Bondarenko, V.B.; Dryapachenko, Yi.P.; Katsubo, L.P.; Kozeryats'ka, G.M.; Mozhzhukhyin, E.M.; Pavlenko, Yu.M.; Posmyityukh, Yi.V.; Khvastunov, O.V.; Sharov, A.F.

    2007-01-01

    Method is presented for target manufacturing from the isotope materials with melting temperature up to 2300 degree C. Vacuum evaporation unit (VUP-5M) was used after the appropriate modernization. Target compound determination with using of the nuclear physics measurements of the Rutherford back scattering (RBS) of the accelerated ions was studied. The target thickness was determined as gravimetric as RBS methods

  4. THE EPISTEMOLOGICAL PERSPECTIVE OF FRACTIONAL RESERVE BANKING AND FULL RESERVE BANKING: WHERE ISLAMIC BANKING SHOULD STAND?

    Directory of Open Access Journals (Sweden)

    Yaser Taufik Syamlan

    2017-06-01

    Full Text Available Objectives – this research is aimed to compare those epistemological bases to the mindset of Islamic Bank and try to drive the philosophy in practical operation whether based on the Fractional Reserve Banking Sytem (RBS or 100% RBS and analyze the challenges in deploying the 100%RBS. Methods - This research will be conducted based on an extensive literature review.Results - Based on the epistemological analysis of money and the business cycle as well as the views of Islamic scholars, 100%RBS should be the best for Islamic Bank. There are four types of 100% RBS namely Pure Commodity Money, Sovereign Money, Narrow Banking, and Limited Purpose Banking. To deploy it into the economic system, another philosophical work should be done to choose one of the types and strengthen it so that the theory of 100%RBS can be implemented for the goodness of Islamic Bank.  Conclusion - In Conclusions, Based on the epistemology defined by Islamic Scholars, FractRBS has more mafsadah if we compare to the maslahah. Therefore, 100% RBS should be better for the Islamic Bank.

  5. A atuação de sequências do tipo narrativo em um texto jornalístico impresso

    Directory of Open Access Journals (Sweden)

    Gustavo XIMENES CUNHA

    2010-12-01

    Full Text Available O objetivo é mostrar que a heterogeneidade composicional de um texto jornalístico não é um fenômeno discursivo simples. Adotando os postulados do Modelo de Análise Modular, evidenciamos a importância que sequências discursivas do tipo narrativo podem assumir quando um jornalista delas se vale para tentar produzir determinados efeitos. Num primeiro momento, o estudo da forma de organização sequencial permite a identificação de duas sequências narrativas. Em seguida, a combinação da forma de organização sequencial com informações de outros planos do discurso permite o estudo das marcas linguísticas das sequências, bem como das funções cotextuais e contextuais que elas desempenham em toda a reportagem estudada.

  6. Robotic Versus Laparoscopic Bariatric Surgery: a Systematic Review and Meta-Analysis.

    Science.gov (United States)

    Li, Kun; Zou, Jianan; Tang, Jianxiong; Di, Jianzhong; Han, Xiaodong; Zhang, Pin

    2016-12-01

    We aim to summarize the available literature on patients treated with robotic bariatric surgery (RBS) or laparoscopic bariatric surgery (LBS) and compare the clinical outcomes between RBS and LBS. A systematic literature was conducted in accordance with the PRISMA guidelines. Thirty-four observational studies met our inclusion criteria, and 27 studies of 27,997 patients were included in the meta-analysis. There were no significant differences between RBS and LBS regarding overall postoperative complications, major complications, the length of hospital stay, reoperation, conversion, and mortality. Nevertheless, RBS was burdened by longer operative times and higher hospital costs when compared with LBS. On the contrary, the incidence of anastomotic leak was lower in RBS than in LBS. Further studies with a longer follow-up are recommended.

  7. Exposure of farm workers to electromagnetic radiation from cellular network radio base stations situated on rural agricultural land.

    Science.gov (United States)

    Pascuzzi, Simone; Santoro, Francesco

    2015-01-01

    The electromagnetic field (EMF) levels generated by mobile telephone radio base stations (RBS) situated on rural-agricultural lands were assessed in order to evaluate the exposure of farm workers in the surrounding area. The expected EMF at various distances from a mobile telephone RBS was calculated using an ad hoc numerical forecast model. Subsequently, the electric fields around some RBS on agricultural lands were measured, in order to obtain a good approximation of the effective conditions at the investigated sites. The viability of this study was tested according to the Italian Regulations concerning general and occupational public exposure to time-varying EMFs. The calculated E-field values were obtained with the RBS working constantly at full power, but during the in situ measurements the actual power emitted by RBS antennas was lower than the maximum level, and the E-field values actually registered were much lower than the calculated values.

  8. Metal content determination in polymerization catalysts by direct methods

    International Nuclear Information System (INIS)

    Bichinho, K.M.; Pires, Gilvan P.; Stedile, F.C.; Santos, J.H.Z. dos

    2002-01-01

    Metal contents in polymerization catalysts were comparatively determined by Rutherford backscattering spectrometry (RBS), X-ray photoelectron spectroscopy (XPS) and X-ray fluorescence (XRF) spectroscopy. Catalysts were prepared by grafting metallocene onto bare silica or onto silica chemically modified with methylaluminoxane (MAO). Catalysts were compressed as self-supporting pellets (RBS and XRF), or mounted on adhesive copper tape (XPS). The proximity of the mass of the atomic nuclei did not allow resolution by RBS of the signals corresponding to Zr and Nb, nor Si and Al in catalyst systems such as (nBuCp) 2 ZrCl 2 /Cp 2 NbCl 2 /MAO/SiO 2 . On the other hand, Zr, Nb, Si and Al lines were completely resolved in an XRF spectrum. For supported metallocenes on bare silica, XPS measurement was ca. 40% higher than that obtained by RBS. Silica-supported zirconocene showed good agreement in Zr content determination by XRF and RBS

  9. Incidence and causes of iatrogenic retinal breaks in idiopathic macular hole and epiretinal membrane.

    Science.gov (United States)

    Yagi, Fumihiko; Takagi, Seiji; Tomita, Goji

    2014-03-01

    To evaluate the incidence and cause of iatrogenic retinal breaks (RBs) and postoperative retinal detachment (RD) in cases of idiopathic macular hole (MH) and epiretinal membrane (ERM). We analyzed 79 eyes with MH and 41 eyes with ERM, the relationship between the incidence of RBs and RD, and the frequency of posterior vitreous detachment (PVD) and lattice degeneration (LD). The incidence of RBs related to the operation was significantly higher in eyes with MH. The frequency of PVD was significantly higher in eyes with ERM. The frequency of LD did not differ between groups. In the MH group, the incidence of RBs related to the operation was high in eyes without PVD, but with LD. We observed four cases of RD in the MH group. The MH group had higher incidence of RBs related to the operation, especially in eyes without PVD or with LD.

  10. Red-back spider (Latrodectus hasselti) antivenom prevents the toxicity of widow spider venoms.

    Science.gov (United States)

    Graudins, A; Padula, M; Broady, K; Nicholson, G M

    2001-02-01

    Widow spiders of the genus Latrodectus are found worldwide and produce similar clinical envenomation syndromes. In Australia, red-back spider antivenom (RBS-AV) is effective therapy for Latrodectus hasselti envenomation and it has been reported to reverse envenomation by other widow spiders. This study assessed the efficacy of RBS-AV in preventing in vitro and in vivo toxicity of widow spider venoms of North America and Europe. The binding of RBS-AV to alpha-latrotoxin and Latrodectus venoms (Latrodectus spp mactans, hesperus, lugubris, tredecimguttatus, hasselti) was assayed using Western blotting. Prevention of in vitro toxicity to alpha-latrotoxin and the same venoms was tested by pretreating an isolated chick biventer cervicis nerve-muscle preparation with RBS-AV. Prevention of in vivo toxicity was determined by a lethality study in male Balb/c mice (2.5 to 5x median lethal dose [LD50]) or alpha-latrotoxin (10x LD50) preincubated with antivenom or without RBS-AV (control). In Western blots, RBS-AV bound to alpha-latrotoxin and similar widow spider proteins in all venoms tested, indicating antigenic similarity with proteins found in RBS venom. Antivenom prevented the typical in vitro muscle contracture and loss of twitch tension seen with alpha-latrotoxin and the venoms tested. Control mice rapidly developed signs of envenomation, but mice treated with RBS-AV remained free of signs of envenomation. RBS-AV prevented both in vitro and in vivo toxicity from Latrodectus venoms and alpha-latrotoxin in mice. These data suggest that RBS-AV may be clinically effective in the treatment of envenomation resulting from the bite of other widow spiders.

  11. Semi-continuous xylitol bioproduction in sugarcane bagasse hydrolysate: effect of nutritional supplementation Bioprodução semi-contínua de xilitol em hidrolisado de bagaço de cana: efeito da suplementação nutricional

    Directory of Open Access Journals (Sweden)

    Walter Carvalho

    2007-03-01

    Full Text Available Xylose-to-xylitol bioconversion by Ca-alginate entrapped Candida guilliermondii cells in sugarcane bagasse hemicellulosic hydrolysate was carried out in erlenmeyer flasks using the repeated-batch mode of fermentation. The hydrolysate was supplemented or not with ammonium sulfate and/or rice bran extract at the beginning of each repeated batch. Altogether, six sets of three repeated-batches were carried out, the immobilized cells being reused at the end of each batch. The best results were achieved when the hydrolysate was supplemented with both nutrients in all the three repeated batches, which provided xylitol productions of 25.9, 46.8, 48.7 gL-1, productivities of 0.27, 0.49, 0.51 gL-1h-1, and yields of 0.45, 0.58, 0.55 gg-1, respectively. In the absence of nutrients, the xylitol production, productivity and yield did not exceed 12.1 gL-1, 0.13 gL-1h-1 and 0.30 gg-1, respectively.A bioconversão de xilose em xilitol por células de Candida guilliermondii imobilizadas em alginato de cálcio, em hidrolisado hemicelulósico de bagaço de cana-de-açúcar, foi realizada em frascos erlenmeyer no modo bateladas repetidas de fermentação. O hidrolisado foi suplementado ou não com sulfato de amônio e/ou extrato de farelo de arroz no início de cada batelada repetida. No total, seis experimentos com três bateladas repetidas cada um foram realizados, sendo as células imobilizadas reutilizadas ao final de cada batelada. Os melhores resultados foram alcançados quando o hidrolisado foi suplementado com ambos nutrientes em todas as três bateladas repetidas, resultando em concentrações de xilitol iguais a 25,9, 46,8 e 48,7 gL-1, produtividades de 0,27, 0,49 e 0,51 gL-1h-1, e rendimentos de 0,45, 0,58 e 0,55 gg-1, respectivamente. Na ausência de nutrientes, a concentração de xilitol, a produtividade e o rendimento não ultrapassaram 12,1 gL-1, 0,13 gL-1h-1 e 0.30 gg-1, respectivamente.

  12. Influence of carbon source and the fermentation process on levan production by Zymomonas mobilis analyzed by the surface response method Influência da fonte de carbono e do processo fermentativo na produção de levana por Zymomonas mobilis analisada pela metodologia de superfície de resposta

    Directory of Open Access Journals (Sweden)

    Raquel Renan Jorge Borsari

    2006-09-01

    Full Text Available The aim of this study is to assess sugar cane juice and sucrose as substrates, the batch and fed batch processes and their interaction in the levan production using a complete factorial design. Zymomonas mobilis was cultivated in different sugar cane juice and sucrose concentrations in two fermentation processes at 25 °C for 20 h. A complete factorial design (2³ was used to analyze the effects of the type and concentration of the substrate, as well as the batch and fed batch processes. A complete second factorial design (2² was used to observe the importance of sugar cane juice. The results indicated that the batch process improved the levan production reaching 40.14 g/L. The addition of sugar cane juice was not statistically significant for levan formation, however sugar cane juice stimulated biomass, sorbitol and ethanol production. The best medium for levan production was 150 g/L sucrose in batch.O presente estudo avaliou caldo de cana de açúcar e sacarose como substratos e os processos batelada e batelada alimentada e suas interações na produção de levana. Zymomonas mobilis foi cultivada em diferentes concentrações de caldo de cana de açúcar e sacarose nos dois processos fermentativos a 25 °C por 20 h. Foi utilizado um delineamento fatorial completo (23 para analisar os efeitos do tipo e concentração de substratos e processos batelada e batelada alimentada. Um segundo delineamento fatorial completo (22 foi usado para confirmar a importância do caldo de cana de açúcar. Os resultados indicam que o processo batelada foi o melhor para a produção de levana, atingindo 40,14 g/L em 150 g/L de sacarose. A adição de caldo de cana de açúcar não foi estatisticamente significativa para formação de levana, porém o caldo estimulou a produção de biomassa, sorbitol e etanol.

  13. Development and process evaluation of a Web-based responsible beverage service training program.

    Science.gov (United States)

    Danaher, Brian G; Dresser, Jack; Shaw, Tracy; Severson, Herbert H; Tyler, Milagra S; Maxwell, Elisabeth D; Christiansen, Steve M

    2012-09-22

    Responsible beverage service (RBS) training designed to improve the appropriate service of alcohol in commercial establishments is typically delivered in workshops. Recently, Web-based RBS training programs have emerged. This report describes the formative development and subsequent design of an innovative Web-delivered RBS program, and evaluation of the impact of the program on servers' knowledge, attitudes, and self-efficacy. Formative procedures using focus groups and usability testing were used to develop a Web-based RBS training program. Professional alcohol servers (N = 112) who worked as servers and/or mangers in alcohol service settings were recruited to participate. A pre-post assessment design was used to assess changes associated with using the program. Participants who used the program showed significant improvements in their RBS knowledge, attitudes, and self-efficacy. Although the current study did not directly observe and determine impact of the intervention on server behaviors, it demonstrated that the development process incorporating input from a multidisciplinary team in conjunction with feedback from end-users resulted in creation of a Web-based RBS program that was well-received by servers and that changed relevant knowledge, attitudes, and self-efficacy. The results also help to establish a needed evidence base in support of the use of online RBS training, which has been afforded little research attention.

  14. Psychometric Testing of a Religious Belief Scale.

    Science.gov (United States)

    Chiang, Yi-Chien; Lee, Hsiang-Chun; Chu, Tsung-Lan; Han, Chin-Yen; Hsiao, Ya-Chu

    2017-12-01

    Nurses account for a significant percentage of staff in the healthcare system. The religious beliefs of nurses may affect their competence to provide spiritual care to patients. No reliable and valid instruments are currently available to measure the religious beliefs of nurses in Taiwan. The aims of this study were to develop a religious belief scale (RBS) for Taiwanese nurses and to evaluate the psychometric properties of this scale. A cross-sectional study design was used, and 24 RBS items were generated from in-depth interviews, a literature review, and expert recommendations. The RBS self-administered questionnaire was provided to 619 clinical nurses, who were recruited from two medical centers and one local hospital in Taiwan during 2011-2012. A calibration sample was used to explore the factor structure, whereas a validation sample was used to validate the factor structure that was constructed by the calibration sample. Known-group validity and criterion-related validity were also assessed. An exploratory factor analysis resulted in an 18-item RBS with four factors, including "religious effects," "divine," "religious query," and "religious stress." A confirmatory factor analysis recommended the deletion of one item, resulting in a final RBS of 17 items. The convergent validity and discriminate validity of the RBS were acceptable. The RBS correlated positively with spiritual health and supported concurrent validity. The known-group validity was supported by showing that the mean RBS between nurses with or without religious affiliation was significant. The 17-item RBS developed in this study is a reliable, valid, and useful scale for measuring the religious beliefs of nurses in Taiwan. This scale may help measure the religious beliefs of nurses and elicit the relationship between these beliefs and spirituality.

  15. 7 CFR 4284.3 - Definitions.

    Science.gov (United States)

    2010-01-01

    ... evidenced by increase in total income, employment opportunities, decreased out-migration of population.... National Office—USDA RBS headquarters in Washington, DC. Nonprofit institution—Any organization or...

  16. 77 FR 59888 - Notice of Request for Revision of a Currently Approved Information Collection

    Science.gov (United States)

    2012-10-01

    ... announces the Rural Business-Cooperative Service's (RBS) intention to request an extension for a currently... small businesses for the purchase of renewable energy systems and the implementation of energy...

  17. Surface disorder production during plasma immersion implantation

    NARCIS (Netherlands)

    Lohner, T.; Khanh, N.Q.; Petrik, P.; Biro, L.P.; Fried, M.; Pinter, I.; Lehnert, W.; Frey, L.; Ryssel, H.; Wentink, D.J.; Gyulai, J.

    1998-01-01

    Comparative investigations were performed using high-depth-resolution Rutherford backscattering (RBS) combined with channeling, spectroellipsometry (SE) and atomic force microscopy (AFM) to analyze surface disorder and surface roughness formed during plasma immersion implantation of silicon (100)

  18. Surface disorder production during plasma immersion implantation and high energy ion implantation

    NARCIS (Netherlands)

    El-sherbiny, M.A.; Khanh, N.Q.; Wormeester, Herbert; Fried, M.; Fried, M.; Lohner, T.; Lohner, T.; Pinter, I.; Gyulai, J.

    1996-01-01

    High-depth-resolution Rutherford Backscattering Spectrometry (RBS) combined with channeling technique was used to analyze the surface layer formed during plasma immersion ion implantation (PIII) of single crystal silicon substrates. Single wavelength multiple angle of incidence ellipsometry (MAIE)

  19. A comparison of the structural changes and optical properties of LiNbO3, Al2O3 and ZnO after Er+ ion implantation

    Czech Academy of Sciences Publication Activity Database

    Macková, Anna; Malinský, Petr; Pupíková, Hana; Nekvindová, P.; Cajzl, J.; Švecová, B.; Oswald, Jiří; Wilhelm, R. A.; Kolitsch, A.

    2014-01-01

    Roč. 331, JUL (2014), s. 182-186 ISSN 0168-583X R&D Projects: GA ČR(CZ) GBP108/12/G108; GA MŠk(XE) LM2011019 Institutional support: RVO:68378271 ; RVO:61389005 Keywords : Er ion implantation * crystals * depth profiles * RBS * RBS channelling * photoluminescence Subject RIV: BG - Nuclear, Atomic and Molecular Physics, Colliders Impact factor: 1.124, year: 2014

  20. Contribution to cadmium telluride characterizations by ion beams and nuclear detection

    International Nuclear Information System (INIS)

    Hage-Ali, Makram.

    1980-01-01

    A short survey of the thermodynamics and crystal growth of CdTe is followed by the description of high mass and depth resolution Rutherford backscattering (RBS) with light and heavy ions. Energy losses in CdTe have been measured. Analysis of CdTe surfaces by RBS, SIMS, ellipsometry have also been performed. Diffused, implanted, or simply contacted CdTe junctions have been analyzed and then investigated as gamma spectrometers. The problem of polarization was specially studied [fr

  1. Cytochemical localization of glycogen in Chlamydia trachomatis inclusions.

    OpenAIRE

    Chiappino, M L; Dawson, C; Schachter, J; Nichols, B A

    1995-01-01

    The origin and distribution of glycogen in inclusions of Chlamydia trachomatis were demonstrated with silver proteinate stain for electron microscopy. Glycogen particles were detected in all developmental stages of C. trachomatis, as well as free in the inclusions. Intrachlamydial glycogen was most common in elementary bodies but was also detected in intermediate forms and reticulate bodies (RBs). Abnormal divisions and breakdown of cytoplasmic membranes were common in RBs. Cytoplasmic conten...

  2. Ecological correlates of relative brain size in some South African ...

    African Journals Online (AJOL)

    1992-07-02

    Jul 2, 1992 ... species of rodent from South Africa and is shown to vary with six species having a positive RBS (that is a brain larger than expected) .... RBS and life style (for example, of the four fossorlal. RSS. -0.2 -0,1. 0. P.ca. H.a .... and it is not known whether arboreal forms evolved from terrestrial forms or vice versa.

  3. Application of atomic and nuclear techniques to the study of inhomogeneities in electrodeposited {alpha}-particle sources

    Energy Technology Data Exchange (ETDEWEB)

    Martin Sanchez, A. E-mail: ams@unex.es; Nuevo, M.J.; Jurado Vargas, M.; Diaz Bejarano, J.; Silva, M.F. da; Roldan Garcia, C.; Paul, A.; Ferrero Calabuig, J.L.; Mendez Vilas, A.; Juanes Barber, D

    2002-05-01

    Three {alpha}-particle sources made by different methods of electrodeposition were analysed using {alpha}-particle spectrometry, Rutherford backscattering (RBS), and atomic force microscopy (AFM) on several surface zones. The thickness and homogeneity of these sources was studied using RBS, and the results were analysed jointly with those obtained with {alpha}-particle spectrometry and AFM techniques. The comparison of the electrodeposition methods showed that the most homogeneous electrodeposited zones corresponded to the source made with a stirring cathode.

  4. Study of diffusion of Ag in Cu single crystals

    CERN Document Server

    Wang, R

    2002-01-01

    4.0 MeV sup 7 Li sup + sup + RBS and AES were used for investigations of thermal diffusion of Ag in Cu single crystals. The annealing of samples was carried out in vacuum in the temperature range from 498 to 613 K. The element depth concentration profiles transformed from RBS spectra indicate that the diffusion of Ag into Cu is a typical volume diffusion. The Arrhenius parameters corresponding to the diffusion were obtained.

  5. Ribosomal binding site switching: an effective strategy for high-throughput cloning constructions.

    Directory of Open Access Journals (Sweden)

    Yangbo Hu

    Full Text Available Direct cloning of PCR fragments by TA cloning or blunt end ligation are two simple methods which would greatly benefit high-throughput (HTP cloning constructions if the efficiency can be improved. In this study, we have developed a ribosomal binding site (RBS switching strategy for direct cloning of PCR fragments. RBS is an A/G rich region upstream of the translational start codon and is essential for gene expression. Change from A/G to T/C in the RBS blocks its activity and thereby abolishes gene expression. Based on this property, we introduced an inactive RBS upstream of a selectable marker gene, and designed a fragment insertion site within this inactive RBS. Forward and reverse insertions of specifically tailed fragments will respectively form an active and inactive RBS, thus all background from vector self-ligation and fragment reverse insertions will be eliminated due to the non-expression of the marker gene. The effectiveness of our strategy for TA cloning and blunt end ligation are confirmed. Application of this strategy to gene over-expression, a bacterial two-hybrid system, a bacterial one-hybrid system, and promoter bank construction are also verified. The advantages of this simple procedure, together with its low cost and high efficiency, makes our strategy extremely useful in HTP cloning constructions.

  6. Comparisons between continuous and batch processing to produce clavulanic acid by Streptomyces clavuligerus

    Directory of Open Access Journals (Sweden)

    Álvaro Baptista-Neto

    2005-06-01

    Full Text Available The aim of the present work was to compare CA production in continuous culture with and without cell recycling and in batch process by Streptomyces clavuligerus. Continuous cultivations with high cell concentration using cell recycling were performed utilizing a hollow fiber ultrafiltration module to separate cells from the filtrate broth. The continuous cultures without cell recycling and the batch cultivations were performed conventionally. The highest productivity was attained in the continuous cultivation with cell recycling (22.2 mg.L-1.h-1. The highest CA concentration was obtained in the batch process (470 mg.L-1.h-1.O ácido clavulânico (AC é um importante inibidor de beta-lactamases, enzimas que degradampartir do metabolismo secundário do Streptomyces clavuligerus, bactéria filamentosa e estritamente aeróbia. Considerando que a velocidade de produção de metabólitos secundários está ligada à concentração celular, o presente trabalho teve como objetivo comparar a produção de AC nos processos contínuos com e sem reciclo celular e em batelada, realizando cultivos dessa bactéria com alta densidade celular. Para cumprir com o objetivo proposto, foram realizados experimentos em biorreator operando na forma contínua com reciclo utilizando-se um módulo de filtração tangencial de fibra oca para a separação celular. Os processos contínuos sem reciclo e em batelada foram realizados de forma convencional. A produtividade em AC no cultivo contínuo com reciclo celular (22,2 mg.L-1h-1 foi superior aos processos convencionais, apesar de obter-se maior concentração do produto (470 mg.L-1 em batelada.

  7. TRATAMENTO DE EFLUENTES ÁCIDOS RICOS EM METAIS COM AUXÍLIO DE SULFETO BIOGÊNICO E CAL

    OpenAIRE

    Guimarães, Damaris; Redemat - Rede Temática em Engenharia de Materiais (UFOP/CETEC/UEMG); Lopes, Klinger Carlos Silva; Laboratório de Bio&Hidrometalurgia – Escola de Minas – Universidade Federal de Ouro Preto; Rodrigues, Michael Leonardo Marques; Redemat - Rede Temática em Engenharia de Materiais (UFOP/CETEC/UEMG); Bertolino, Sueli Moura; Instituto de Ciências Agrárias - Universidade Federal de Uberlândia; Leão, Versiane Albis; Departamento de Engenharia Metalurgica e de Materiais - Laboratório de Bio&Hidrometalurgia – Escola de Minas – Universidade Federal de Ouro Preto

    2014-01-01

    A proposta do presente trabalho foi estudar uma forma de tratamento alternativo para efluentes líquidos ácidos ricos em metais utilizando para isso um efluente sulfetogênico gerado em um reator anaeróbio (UASB) e cal. Os ensaios foram realizados em batelada utilizando dois efluentes ácidos distintos: (i) um efluente proveniente de ensaios de lixiviação e (ii) um efluente ácido proveniente de um laboratório de pesquisas na área de Bio&Hidrometalurgia. O efluente dos ensaios de lixiviação apres...

  8. INFLUÊNCIA DA TEMPERATURA NO DESEMPENHO DE BIODIGESTORES COM ESTERCO BOVINO

    Directory of Open Access Journals (Sweden)

    Larissa Rodrigues de Castro

    1998-04-01

    Full Text Available RESUMO A presente pesquisa trata do estudo de biodigestores de batelada mantidos a diferentes temperaturas, visando analisar os níveis mais favoráveis à produção de biogás e à degradação de sólidos totais e voláteis de esterco bovino. A temperatura mais adequada obtida em laboratório (31ºC foi aplicada em um biodigestor rural modelo indiano, com 10m3 de capacidade, a fim de se verificar seu desempenho.

  9. Narrar, mostrar, ver: como analisar um álbum de fotos de família em conexão com uma entrevista narrativa = Narrating, showing, seeing: how to analyze a family photo album in connection with a narrative interview

    OpenAIRE

    Breckner, Roswitha

    2014-01-01

    Álbuns de fotos de família são lugares onde memórias são criadas e fixadas (Chalfen, 1987). Eles consistem principalmente de fotografias e outros tipos de material visual (cartões postais, bilhetes ou ingressos etc. ), bem como de legendas e comentários mais ou menos extensos. Tradicionalmente, os retratos são organizados em um livreto, isto é, em uma ordem sequencial que se baseia implicitamente em uma estrutura pictórica e narrativa de apresentação e criação de uma moldura familiar (Hirsch,...

  10. Estrutura química e atividade antiviral de polissacarídeos sulfatados obtidos de algas do Complexo Laurencia (Ceramiales, Rhodophyta)

    OpenAIRE

    Ferreira, Luciana Garcia

    2013-01-01

    Resumo: A extração sequencial realizada nas algas vermelhas Palisada flagellifera, Laurencia filiformis e Laurencia aldingensis (Complexo Laurencia, Rhodomelaceae, Ceramiales) com água a 25°C e 80°C, seguido de tratamento com KCl e cromatografia de troca iônica deu origem a frações polissacarídicas homogêneas obtidas a partir dessas espécies. A análise estrutural da agarana homogênea obtida de P. flagellifera (FCS-3) mostrou uma estrutura complexa, com pelo menos 18 diferentes tipos de deriva...

  11. Conjuntos infinitos e suas surpresas : uma sequência de atividades

    OpenAIRE

    Fábio Luís Baccarin

    2013-01-01

    Este trabalho tem como objetivo apresentar uma sequência de atividades para o ensino de matemática, direcionadas a professores e estudantes do Ensino Médio. Baseadas na Teoria de Georg Cantor sobre conjuntos infinitos, o resultado deste trabalho são sete atividades estruturadas para serem aplicadas em sala de aula. A fundamentação teórica para o desenvolvimento de cada proposta está presente, de forma sequencial, na construção dos temas. Inicia-se com uma retomada dos conteúdos de conjuntos n...

  12. KINERJA ALGORITMA PARALEL UNTUK PENCARIAN KATA DENGAN METODE BOYER-MOORE MENGGUNAKAN PVM

    Directory of Open Access Journals (Sweden)

    Maria Angela Kartawidjaja

    2009-01-01

    Full Text Available Search process is one of important activity in data processing. Searching can take more time if conducted in the huge search space. Therefore, it is needed an efficient search technique. One technique that can be used is parallel computing. This article discusses the search process in parallel using the Boyer-Moore algorithm. Parallel scope is emulated with PVM (Parallel Virtual Machine software. From the research results, it can be concluded that the performance of parallel computing will increase the word searching compared to the computing performance for its word sequencial search consisting of one letter, and will drop to the word search consisting of two letters or more.

  13. EFFECTS OF LYSINE SUPPLEMENTATION ON PERFORMANCE CHARACTERISTICS AND MINERAL RETENTION OF BROILER CHICKENS FED RAW BENNE SEED BASED DIETS

    Directory of Open Access Journals (Sweden)

    A. M. Akanji

    2016-06-01

    Full Text Available The objective of the study was to determine the effects of raw benne seed (RBS, Sesamum indicum with or without lysine supplementation on the performance characteristics and mineral retention of broiler chickens. The feeding trial lasted for 56 days. One hundred and forty unsexed day old  broiler chicks (Marshall strain were used for the study. RBS was incorporated into the diets at 15% and 30% levels and  supplemented with  0%, 0.25% and 0.5% of lysine, respectively. Average  weekly feed intake in birds fed the control diet and 15% RBS based diet supplemented with 0.25 % and 0.5% lysine were not significantly different, but significantly (P<0.05 higher than those fed other diets. Feed conversion efficiency and protein efficiency ratio were significantly (P<0.05 reduced in birds fed 30% RBS with or without lysine supplementation. At 0.25% and 0.5% lysine supplementation, significant (P<0.05 increases were obtained in the retention of nitrogen, calcium, phosphorus and iron in birds fed 15% RBS based diets, but markedly reduced in those fed 30% RBS  based diets. The reductions in the performance characteristics of the birds fed 30% RBS diets with or without lysine can be attributed to interactions in the toxic effects of the higher intakes anti-nutritional factors like tannin, oxalate and phytate.  In conclusion,  the response indices were better enhanced when 15% RBS supplemented with 0.5% lysine was fed to the birds.

  14. Xylitol production by Candida parapsilosis under fed-batch culture

    Directory of Open Access Journals (Sweden)

    Sandra A. Furlan

    2001-06-01

    Full Text Available Xylitol production by Candida parapsilosis was investigated under fed-batch cultivation, using single (xylose or mixed (xylose and glucose sugars as substrates. The presence of glucose in the medium induced the production of ethanol as secondary metabolite and improved specific rates of growth, xylitol formation and substrate consumption. Fractionated supply of the feed medium at constant sugar concentration did not promote any increase on the productivity compared to the single batch cultivation.A produção de xylitol por Candida parapsilosis foi investigada em regime de batelada alimentada, usando substratos açucarados de composição simples (xilose ou composta (xilose e glicose. A presença de glicose no meio induziu a formação de etanol como metabólito secundário. A suplementação fracionada do meio de alimentação numa concentração fixa de açúcar não resultou em aumento da produtividade em relação àquela alcançada em batelada simples.

  15. Impact of fine mesh sieve primary treatment on nitrogen removal in moving bed biofilm reactors.

    Science.gov (United States)

    Rusten, B; Razafimanantsoa, V A; Andriamiarinjaka, M A; Otis, C L; Sahu, A K; Bilstad, T

    2016-01-01

    The purpose of this project was to investigate the effect of selective particle removal during primary treatment on nitrogen removal in moving bed biofilm reactors (MBBRs). Two small MBBR pilot plants were operated in parallel, where one train treated 2 mm screened municipal wastewater and the other train treated wastewater that had passed through a Salsnes Filter SF1000 rotating belt sieve (RBS) with a 33 µs sieve cloth. The SF1000 was operated without a filter mat on the belt. The tests confirmed that, for the wastewater characteristics at the test plant, Salsnes Filter primary treatment with a 33 µs RBS and no filter mat produced a primary effluent that was close to optimum. Removal of organic matter with the 33 µs sieve had no negative effect on the denitrification process. Nitrification rates improved by 10-15% in the train with 33 µs RBS primary treatment. Mass balance calculations showed that without RBS primary treatment, the oxygen demand in the biological system was 36% higher. Other studies have shown that the sludge produced by RBS primary treatment is beneficial for biogas production and will also significantly improve sludge dewatering of the combined primary and biological sludge.

  16. Spinning wave plate design for retinal birefringence scanning

    Science.gov (United States)

    Irsch, K.; Gramatikov, B. I.; Wu, Y.-K.; Guyton, D. L.

    2009-02-01

    To enhance foveal fixation detection while bypassing the deleterious effects of corneal birefringence in retinal birefringence scanning (RBS), we developed a new RBS design introducing a double-pass spinning half wave plate (HWP) and a fixed double-pass retarder into the optical system. Utilizing the measured corneal birefringence from a data set of 300 human eyes, an algorithm and a related computer program, based on Mueller-Stokes matrix calculus, were developed in MATLAB for optimizing the properties of both wave plates. Foveal fixation detection was optimized with the HWP spun 9/16 as fast as the circular scan, with the fixed retarder having a retardance of 45° and fast axis at 90°. With this new RBS design, a significant statistical improvement of 7.3 times in signal strength, i.e. FFT power, was achieved for the available data set compared with the previous RBS design. The computer-model-optimized RBS design has the potential not only for eye alignment screening, but also for remote fixation sensing and eye tracking applications.

  17. Single fiber colorless symmetric WDM-PON architecture using time interleaved remodulation technique for mitigating Rayleigh backscattering resilience

    Science.gov (United States)

    Afridi, Muhammad Idrees; Zhang, Jie; Zhao, Yong-li; Latif, Abdul; Niazi, Shahab Ahmed

    2013-01-01

    A time interleaved differential phase shift keying (DPSK) remodulation technique is proposed to mitigate the effect of Rayleigh backscattering (RBS)-induced noise in a single fiber colorless wavelength-division-multiplexing passive optical network (WDM-PON). In order to achieve a cost effective optical network unit (ONU) solution without dedicated laser sources for upstream signals to provide optimum symmetric capacity in a colorless WDM-PON, remodulation becomes the core attraction. Also as the performance of colorless WDM-PON systems suffers from the transmission impairments due to RBS, it is mitigated by using this remodulation scheme. Simulation results show that downstream and upstream signals achieve the error-free performance at 10 Gbit/s with negligible penalty, and enhance the tolerance to RBS-induced noise over a 25 km single-mode fiber.

  18. The analysis of Rutherford scattering-channelling measurements of disorder production and annealing in ion irradiated semiconductors

    International Nuclear Information System (INIS)

    Carter, G.; Elliman, R.G.

    1983-01-01

    Rutherford scattering and channelling of light probe ions (e.g. He + ) has been extensively used for studies of disorder production in ion implanted semiconductors. Various authors have analysed models of amorphousness accumulation and Carter and Webb have indicated the general difficulties in assessing disorder production models from RBS/channelling studies if the production modes are complex and the manner in which the technique responds to different defect structures is unspecified. For less complex disorder production modes and by making reasonable assumptions about the technique response however, some insight into the form of backscattering yield - ion implant fluence functions can be obtained as is discussed in the present communication. It thus becomes possible to infer the importance of different disorder generation processes from RBS/channelling - ion influence studies. It will also be shown how simple annealing processes modify disorder accumulation and thus again how the operation of such processes may be inferred from RBS/channelling - ion fluence measurements. (author)

  19. Using Rutherford Backscattering Spectroscopy to Characterize Targets for MTW

    Science.gov (United States)

    Brown, Gunnar; Stockler, Barak; Ward, Ryan; Freeman, Charlie; Padalino, Stephen; Stillman, Collin; Ivancic, Steven; Reagan, S. P.; Sangster, T. C.

    2017-10-01

    A study is underway to determine the composition and thickness of targets used at the Multiterawatt (MTW) laser facility at the Laboratory for Laser Energetics (LLE) using Rutherford backscattering spectroscopy (RBS). In RBS, an ion beam is incident on a sample and the scattered ions are detected with a surface barrier detector. The resulting energy spectra of the scattered ions can be analyzed to determine important parameters of the target including elemental composition and thickness. Proton, helium and deuterium beams from the 1.7 MV Pelletron accelerator at SUNY Geneseo have been used to characterize several different targets for MTW, including CH and aluminum foils of varying thickness. RBS spectra were also obtained for a cylindrical iron buried-layer target with aluminum dopant which was mounted on a silicon carbide stalk. The computer program SIMNRA is used to analyze the spectra. This work was funded in part by a Grant from the DOE through the Laboratory for Laser Energetics.

  20. vNet Zero Energy for Radio Base Stations- Balearic Scenario

    DEFF Research Database (Denmark)

    Sabater, Pere; Mihovska, Albena Dimitrova; Pol, Andreu Moia

    2016-01-01

    The Balearic Islands have one of the best telecommunications infrastructures in Spain, with more than 1500 Radio Base Stations (RBS) covering a total surface of 4.991,66 km². This archipelago has high energy consumption, with high CO2 emissions, due to an electrical energy production system mainly...... based on coal and fossil fuels which is not an environmentally sustainable scenario. The aim of this study is to identify the processes that would reduce the energy consumption and greenhouse gas emissions, designing a target scenario featuring "zero CO2 emissions" and "100% renewable energies" in RBS....... The energy costs, CO2 emissions and data traffic data used for the study are generated by a sample of RBS from the Balearic Islands. The results are shown in terms of energy performance for a normal and net zero emissions scenarios....

  1. The cellular phenotype of Roberts syndrome fibroblasts as revealed by ectopic expression of ESCO2.

    Directory of Open Access Journals (Sweden)

    Petra van der Lelij

    Full Text Available Cohesion between sister chromatids is essential for faithful chromosome segregation. In budding yeast, the acetyltransferase Eco1/Ctf7 establishes cohesion during DNA replication in S phase and in response to DNA double strand breaks in G2/M phase. In humans two Eco1 orthologs exist: ESCO1 and ESCO2. Both proteins are required for proper sister chromatid cohesion, but their exact function is unclear at present. Since ESCO2 has been identified as the gene defective in the rare autosomal recessive cohesinopathy Roberts syndrome (RBS, cells from RBS patients can be used to elucidate the role of ESCO2. We investigated for the first time RBS cells in comparison to isogenic controls that stably express V5- or GFP-tagged ESCO2. We show that the sister chromatid cohesion defect in the transfected cell lines is rescued and suggest that ESCO2 is regulated by proteasomal degradation in a cell cycle-dependent manner. In comparison to the corrected cells RBS cells were hypersensitive to the DNA-damaging agents mitomycin C, camptothecin and etoposide, while no particular sensitivity to UV, ionizing radiation, hydroxyurea or aphidicolin was found. The cohesion defect of RBS cells and their hypersensitivity to DNA-damaging agents were not corrected by a patient-derived ESCO2 acetyltransferase mutant (W539G, indicating that the acetyltransferase activity of ESCO2 is essential for its function. In contrast to a previous study on cells from patients with Cornelia de Lange syndrome, another cohesinopathy, RBS cells failed to exhibit excessive chromosome aberrations after irradiation in G2 phase of the cell cycle. Our results point at an S phase-specific role for ESCO2 in the maintenance of genome stability.

  2. A zebrafish model of Roberts syndrome reveals that Esco2 depletion interferes with development by disrupting the cell cycle.

    Directory of Open Access Journals (Sweden)

    Maren Mönnich

    Full Text Available The human developmental diseases Cornelia de Lange Syndrome (CdLS and Roberts Syndrome (RBS are both caused by mutations in proteins responsible for sister chromatid cohesion. Cohesion is mediated by a multi-subunit complex called cohesin, which is loaded onto chromosomes by NIPBL. Once on chromosomes, cohesin binding is stabilized in S phase upon acetylation by ESCO2. CdLS is caused by heterozygous mutations in NIPBL or cohesin subunits SMC1A and SMC3, and RBS is caused by homozygous mutations in ESCO2. The genetic cause of both CdLS and RBS reside within the chromosome cohesion apparatus, and therefore they are collectively known as "cohesinopathies". However, the two syndromes have distinct phenotypes, with differences not explained by their shared ontology. In this study, we have used the zebrafish model to distinguish between developmental pathways downstream of cohesin itself, or its acetylase ESCO2. Esco2 depleted zebrafish embryos exhibit features that resemble RBS, including mitotic defects, craniofacial abnormalities and limb truncations. A microarray analysis of Esco2-depleted embryos revealed that different subsets of genes are regulated downstream of Esco2 when compared with cohesin subunit Rad21. Genes downstream of Rad21 showed significant enrichment for transcriptional regulators, while Esco2-regulated genes were more likely to be involved the cell cycle or apoptosis. RNA in situ hybridization showed that runx1, which is spatiotemporally regulated by cohesin, is expressed normally in Esco2-depleted embryos. Furthermore, myca, which is downregulated in rad21 mutants, is upregulated in Esco2-depleted embryos. High levels of cell death contributed to the morphology of Esco2-depleted embryos without affecting specific developmental pathways. We propose that cell proliferation defects and apoptosis could be the primary cause of the features of RBS. Our results show that mutations in different elements of the cohesion apparatus have

  3. Management of Complications and Outcomes After Revisional Bariatric Surgery: 3-Year Experience at a Bariatric Center of Excellence.

    Science.gov (United States)

    Abdelgawad, Mohamed; De Angelis, Francesco; Iossa, Angelo; Rizzello, Mario; Cavallaro, Giuseppe; Silecchia, Gianfranco

    2016-09-01

    Laparoscopic revisional bariatric surgery (RBS) is increasingly common. A tailored decision-making process is advocated. In this retrospective study, we reviewed the RBS experience of a single center, analyzing perioperative complications to provide insight into management options and midterm outcomes. Records from November 2011 to March 2015 were reviewed from prospectively maintained database. Six hundred eighteen patients underwent laparoscopic bariatric procedures; of these, 81 (13.1 %) underwent RBS. Patients with a minimum follow-up of 6 months (n = 77) were evaluated. Fifty-nine underwent revised laparoscopic sleeve gastrectomy, and 18 underwent revised Roux-en-Y gastric bypass. Indications for RBS were inadequate weight loss or weight regain in 42 cases (54.5 %) and gastroesophageal reflux disease (GERD), procedure-related complications, or technical failure in 35 cases (45.5 %). There were no deaths or conversions to open surgery. After a mean follow-up of 22 months, body mass index (BMI) decreased from 40.9 ± 6.7 to 31.9 ± 4.8 kg/m(2), mean % excess weight loss (%EWL) was 58 ± 24.3 %, and 55.3 % of patients had resolution of comorbidities. Eight major complications (10.4 %) occurred: five leaks and three intra-abdominal hematomas. Non-surgical management succeeded in 50 % of complications. This study confirms that RBS is challenging; a complication rate of 10 % is expected. Major surgery can be avoided when devoted endoscopists and radiologists are available. Intensive follow-up after complications allows early diagnosis and treatment of unfavorable sequelae. RBS induced a mean %EWL of 58 % at 2 years and resolution of comorbidities in 50 % of cases. However, the durability of these effects remains questionable.

  4. Preoperative blood glucose and prognosis in diabetic patients undergoing lower extremity amputation

    DEFF Research Database (Denmark)

    Nayak, Raj Kumar; Kirketerp-Møller, Klaus

    2016-01-01

    INTRODUCTION: Previous work has shown that uncontrolled diabetes mellitus is associated with adverse surgical outcomes. The purpose of the present study was to establish if a high peri-operative random blood sugar (RBS) concentration among patients with diabetes with non-traumatic lower-extremity......INTRODUCTION: Previous work has shown that uncontrolled diabetes mellitus is associated with adverse surgical outcomes. The purpose of the present study was to establish if a high peri-operative random blood sugar (RBS) concentration among patients with diabetes with non-traumatic lower...

  5. Present and future role of ion beam analysis in the study of cultural heritage materials: The example of the AGLAE facility

    International Nuclear Information System (INIS)

    Salomon, J.; Dran, J.-C.; Guillou, T.; Moignard, B.; Pichon, L.; Walter, P.; Mathis, F.

    2008-01-01

    The application of IBA to cultural heritage mostly relies on the use of PIXE because of its high sensitivity and its ease of implementation at atmospheric pressure. The need for depth information not easily available with this technique has conducted to associate RBS also in external beam mode. We have progressively developed a set-up that permits such a combination of techniques either simultaneously or sequentially. The set-up is currently further improved to permit NRA measurement (depth profiles of light elements) in addition to PIXE and RBS. The coupling of all these techniques provides a wealth of information on cultural heritage objects, not easily attainable with any other single method

  6. Non-destructive study of ancient documents and books by means of ion beams; Estudio no destructivo de documentos y libros antiguos mediante haces de iones

    Energy Technology Data Exchange (ETDEWEB)

    Ruvalcaba S, J.L.; Monroy, M. [IFUNAM, A.P. 20-364, 01000 Mexico D.F. (Mexico)

    2004-07-01

    In this work, a non destructive methodology for the analysis of ancient manuscripts and books using an external beam system and the techniques Particle Induced X-ray Emission Spectroscopy (PIXE) and Rutherford Backscattering Spectrometry (RBS) is presented. This application shows the analytical features of the particle accelerator based techniques for the characterization of this kind of historical materials. This methodology was used for the analysis of inks of an European book from XVII century. This is the first study in Mexico of an ancient book using simultaneously PIXE and RBS non-vacuum techniques. (Author) 21 refs., 9 figs.

  7. Mitigation of Rayleigh crosstalk using noise suppression technique in 10-Gb/s REAM-SOA.

    Science.gov (United States)

    Jeong, Jong Sool; Kim, Hyun-Soo; Choi, Byung-Seok; Kim, Dong Churl; Kim, Ki-Soo; Park, Mi-Ran; Kwon, O-Kyun

    2012-11-19

    We demonstrate a mitigation of Rayleigh back-scattering (RBS) impact in 10-Gb/s reflective electroabsorption modulator monolithically integrated with semiconductor optical amplifier (REAM-SOA). The technique is based on the intensity-noise suppression of the centralized incoherent seed-light, which enables smooth evolution of deployed DWDM applications. We exhibit the power penalty of less than 1 dB at the large RBS crosstalk value of about 8 dB when the optical power of seed-light is lowered about -10 dBm.

  8. Application of Rutherford backscattering and nuclear reaction analysis techniques for investigation of thin films

    International Nuclear Information System (INIS)

    Kiss, A.Z.; Simon, A.; Elekes, Z.; Ditroi, F.; Meszaros, S.; Beke, D.L.; Langer, G.A.; Daroczy, L.

    2002-01-01

    A study of the intermixing of the elements in amorphous Si-Ge multilayers have been carried out using Rutherford backscattering Spectrometry (RBS) technique. Interdiffusion coefficient was determined by measuring the intensity of the first Ge peak (having best depth resolution) in the RBS spectrum as a function of annealing time. The oxygen content of the multilayer was measured by the resonance elastic scattering method in co-operation with Dubna. A cross comparison of multilayered films were performed between the laboratories in Debrecen, Dubna, Albany and Dhaka. An essay to determine the nitrogen content of CVD diamond by the deuteron induced gamma ray emission method has been done. (author)

  9. Nondestructive depth profiling of rare-earth and actinide zeolites via Rutherford backscattering methods

    International Nuclear Information System (INIS)

    Baumann, S.A.; Strathman, M.D.; Suib, S.L.

    1988-01-01

    Rutherford backscattering (RBS) methods have been used to study rare-earth and actinide-ion-exchanged small pore (A) and large pore (Y) zeolites. A theoretical discussion of the RBS method and a novel method of data treatment are given. Experimental data for zeolites have been simulated and theoretical depth profiles have been determined. Both experimental and theoretical data suggest that uranyl-exchanged A zeolite has a large uranium to oxygen surface ratio while the corresponding Y zeolite has a large uranium to oxygen bulk ratio. Relative atomic fractions of all zeolite elements are also given

  10. Automated Detection of Ocular Alignment with Binocular Retinal Birefringence Scanning

    Science.gov (United States)

    Hunter, David G.; Shah, Ankoor S.; Sau, Soma; Nassif, Deborah; Guyton, David L.

    2003-06-01

    We previously developed a retinal birefringence scanning (RBS) device to detect eye fixation. The purpose of this study was to determine whether a new binocular RBS (BRBS) instrument can detect simultaneous fixation of both eyes. Control (nonmyopic and myopic) and strabismic subjects were studied by use of BRBS at a fixation distance of 45 cm. Binocularity (the percentage of measurements with bilateral fixation) was determined from the BRBS output. All nonstrabismic subjects with good quality signals had binocularity >75%. Binocularity averaged 5% in four subjects with strabismus (range of 0 -20%). BRBS may potentially be used to screen individuals for abnormal eye alignment.

  11. Sensory characteristics and consumer liking of sausages with 10% fat and added rye or wheat bran

    DEFF Research Database (Denmark)

    Jakobsen, Louise Margrethe Arildsen; Vuholm, Stine; Aaslyng, Margit Dall

    2014-01-01

    and added rye or wheat bran. Sensory descriptive attributes (odor, appearance, texture, and flavor) of rye bran sausage (RBS) and wheat bran sausage (WBS) were evaluated by a trained sensory panel (n = 9). A sausage with wheat flour (WFS) and two commercial 20% (20%S) and 10% (10%S) (w/w) fat sausages were...... the other sausages. RBS was similar to the commercial 10%S with regard to several sensory attributes and liking, whereas WBS was the least juicy, had a higher intensity of cereal odor and flavor, and the lowest liking....

  12. Determination of the composition of light thin films with artificial neural network analysis of Rutherford backscattering experiments

    Science.gov (United States)

    Matias, V.; Öhl, G.; Soares, J. C.; Barradas, N. P.; Vieira, A.; Cardoso, S.; Freitas, P. P.

    2003-04-01

    AlOxNy ultrathin films are used as insulating layers in advanced microelectronic devices. Structural characterization of these films is often done by the Rutherford backscattering (RBS) analysis. The RBS analysis of these oxinitrides is a difficult task since the relevant signals of the spectrum are washed out by the large substrate background and a considerable time is required for an analyst to characterize the sample. In this work we developed specialized artificial neural networks that are able to perform a fast and efficient analysis of the data. The results are in good agreement with traditional methods.

  13. Reverse painting on glass as seen by the proton beam

    International Nuclear Information System (INIS)

    Neelmeijer, C.; Maeder, M.

    2004-01-01

    The combination of PIXE, RBS and PIGE proves ideal for non-destructive overall analysis of reverse paintings on glass. Simultaneous PIXE-RBS studies assist to clarify the thin-layered pigment arrangements of details painted on the reverse of the glass pane. In a second measurement, the spectra of both PIGE-PIXE taken from the pure glass front side inform on the individual glass type. This complete perception of corresponding unique objects is important and valuable regarding the knowledge of special painting techniques and the necessity of preventive conservation

  14. Estudo da descoloração e degradação de corantes azo mediante processo oxidativo avançado: UV/H2O2

    OpenAIRE

    Adailton Alves

    2009-01-01

    Este estudo teve como objetivo o uso de Processos Oxidativos Avançados (POA\\'s), para a descoloração e degradação dos corantes azo (Congo Red) e (Acid Yellow 42) em solução aquosa, sendo realizado em escala de bancada (processo batelada), utilizando-se reator tubular. Utililizou-se o Processo Oxidativo Avançado UV/H2O2, avaliando a influência dos seguintes fatores: concentração dos corantes, pH, temperatura, concentração do H2O2, concentração do NaCl e concentração do Na2SO4. Para a otimizaçã...

  15. Utilização de serragem de couro do tipo wet blue como meio suporte de filtros percoladores para pós-tratamento de esgoto sanitário tratado em reator anaeróbio compartimentado

    OpenAIRE

    Rita de Cascia Avelino Suassuna

    2004-01-01

    Nesta tese foi estudada a utilização da serragem de couro do tipo wet blue como meio suporte de filtros percoladores no pós-tratamento de esgoto sanitário. O desenvolvimento deu-se em três fases: na primeira fase foram realizadas a classificação e caracterização da serragem, bem como a sua preparação através de peneiramento, lavagens e secagem. Foram realizados dois tipos de lavagens: uma em batelada com solução alcalina de pH em torno de 9,0 e outra contínua com água corrente com pH em torno...

  16. Sistema automático de titulação baseado em bomba peristáltica e detecção potenciométrica

    OpenAIRE

    Ganzarolli, Edgard Moreira

    2001-01-01

    Tese (doutorado) - Universidade Federal de Santa Catarina, Centro de Ciências Físicas e Matemáticas. Programa de Pós-Graduação em Química. O presente trabalho descreve um sistema automático de titulação que associa o método de fluxo contínuo ao método de batelada. Uma bomba peristáltica impulsiona soluções através de um sistema de fluxos, composto basicamente por 4 válvulas solenóides de três vias, uma mini-câmara de titulação e um amostrador automático. A mini-câmara é dotada de agitador ...

  17. Influência da concentração de sólidos totais e da temperatura no processo de co-digestão anaeróbia de resíduos sólidos orgânicos

    OpenAIRE

    Barbosa, Larissa Barreto

    2016-01-01

    Neste trabalho foi investigada a influência da concentração de sólidos totais e da temperatura no processo de co-digestão anaeróbia de resíduos sólidos orgânicos em reatores de batelada única, aplicando três diferentes concentrações de sólidos totais: 30,5 -1 -1 -1 g.L (ST1) ; 39,5 g.L (ST2) e 48,2 g.L (ST3), e três níveis de temperaturas: ambiente (média 24ºC) (T1), 35ºC (T2) e 40ºC (T3). O sistema experimental foi construído, instalado e monitorado por 180 dias nas dependências físicas da ...

  18. Screening of filamentous fungi for production of xylitol from D-xylose Triagem de fungos filamentosos para produção de xilitol a partir de D-xilose

    Directory of Open Access Journals (Sweden)

    Fábio Coelho Sampaio

    2003-12-01

    Full Text Available Eleven filamentous fungi were screened for xylitol production in batch cultures. Production was generally low under the growth conditions used in this study. Penicillium crustosum presented the highest production, 0.52 g L-1 from 11.50 g L-1 of D-xylose, representing consumption of 76% of the original D-xylose.Foram avaliados onze fungos filamentosos para a produção de xilitol em batelada. A produção foi baixa nas condições de cultivo utilizadas. A máxima, 0,52 g L-1 de xilitol a partir de 11,50 g L-1 de xilose, foi obtida com Penicillium crustosum, com consumo de 76% da xilose inicial.

  19. Application of microfiltration with ceramic membranes in the separation process of biodiesel and glycerin

    OpenAIRE

    Gomes, Maria Carolina Sérgi; Universidade Estadual de Maringá; Ferreira, Mariza Zanon; Universidade Estadual de Maringá; Tonelli, Vinícius Passador; Universidade Estadual de Maringá; Barros, Sueli Teresa Devantel de; UEM; Pereira, Nehemias Curvelo; UEM

    2011-01-01

    Neste trabalho foi avaliada a eficiência da microfiltração com membranas cerâmicas na separação de biodiesel e glicerina. Foram preparadas misturas sintéticas com composição mássica de 80% de biodiesel, 10% de glicerina e 10% de etanol anidro. Os experimentos em batelada foram realizados em uma unidade piloto de micro e ultrafiltração que utiliza o princípio de filtração tangencial com membranas. Foram utilizadas membranas tubulares cerâmicas de α-Al2O3/TiO2 com diâmetros médios de poro...

  20. Martensite transformation in antimony implanted stainless steel

    International Nuclear Information System (INIS)

    Johnson, E.; Littmark, U.; Johansen, A.; Christodoulides, C.

    1981-01-01

    The authors have used Rutherford backscattering analysis (RBS) and transmission electron microscopy (TEM) and diffraction to investigate austenitic stainless steel crystals implanted at room temperature with 80 keV Sb + ions to a fluence of 5 x 10 20 ions/m 2 , thus providing implantation with a heavy group V element. RBS channeling spectra from implanted crystals show a damage peak which approaches the height of the random level and therefore indicates a very high degree of disorder in the implanted layers. The distribution of the disorder extends to a depth 3-5 times the depth of the primary radiation damage. The Sb peaks under channeling as well as random conditions are indistinguishable, confirming that substitutionality during implantation is negligible. To establish the nature of the disorder which cannot be assessed from the RBS analysis alone, and in particular to assess whether an amorphous alloy is formed in the implanted layer as indicated from the RBS spectra, samples implanted under similar conditions were investigated in the TEM. Significant extra spots in the patterns can be ascribed to the presence of a radiation induced b.c.c. phase of martensitic origin. The result that a significant amount of martensite can be induced by antimony implantation seems to indicate that the main driving force for the transition is due to damage induced stress concentrations. (Auth.)

  1. Geostrophic Turbulence in the Frequency-Wavenumber Domain: Eddy-Driven Low-Frequency Variability

    Science.gov (United States)

    2014-08-01

    de l’Environnement, CNRS, and Université Grenoble Alpes, Grenoble, and Centre Européen de Recherche et de Formation Avancée en Calcul Scientifique ...601153N. RBS acknowledges support from Centre National de la Recherche Scientifique (CNRS), NSF Grants OCE-0960834 and OCE-0851457, a contract with the

  2. Cohesinopathies of a feather flock together.

    Directory of Open Access Journals (Sweden)

    Robert V Skibbens

    Full Text Available Roberts Syndrome (RBS and Cornelia de Lange Syndrome (CdLS are severe developmental maladies that present with nearly an identical suite of multi-spectrum birth defects. Not surprisingly, RBS and CdLS arise from mutations within a single pathway--here involving cohesion. Sister chromatid tethering reactions that comprise cohesion are required for high fidelity chromosome segregation, but cohesin tethers also regulate gene transcription, promote DNA repair, and impact DNA replication. Currently, RBS is thought to arise from elevated levels of apoptosis, mitotic failure, and limited progenitor cell proliferation, while CdLS is thought to arise, instead, from transcription dysregulation. Here, we review new information that implicates RBS gene mutations in altered transcription profiles. We propose that cohesin-dependent transcription dysregulation may extend to other developmental maladies; the diagnoses of which are complicated through multi-functional proteins that manifest a sliding scale of diverse and severe phenotypes. We further review evidence that cohesinopathies are more common than currently posited.

  3. Physical properties and interface studies of YBa2Cu3O7 thin films deposited by laser ablation on S1 (111) with buffer layer

    NARCIS (Netherlands)

    Blank, David H.A.; Aarnink, W.A.M.; Aarnink, W.A.M.; Flokstra, Jakob; Rogalla, Horst; van Silfhout, Arend

    1990-01-01

    The physical properties of laser-deposited YBaCuO on Si using a single buffer layer of ZrO2 and a double layer of NiSi2 and ZrO2 have been studied. The influence of the deposition temperature has been investigated. Interface studies were performed by RBS and SAM. SEM pictures, resistivity and

  4. Oakland Harbor. Deep-Draft Navigation Improvements. Design Memorandum Number 1, General Design and Final Supplement 1 to the Environmental Impact Statement, Alameda County, California.

    Science.gov (United States)

    1988-03-01

    CP=NG CF RB-.S) (April 1987 Price Levels) Accont Ui No. Dscrifticn )QantitV Unit Pri4ce Arpmt Clashell direct t-o site Bi C9 Mcobilizaticn andi...expose ore deposits, began in 1853 and continued until stopped by court injunction in 1884. The debris obstructed Delta river channels that because of

  5. Study of the thermal diffusion of ion-alloyed cesium in aluminium, silicon and titanium by the Rutherford backscattering method

    International Nuclear Information System (INIS)

    Bulgakov, Yu.V.; Savel'eva, L.M.

    1987-01-01

    Thermal diffusion of cesium implanted at 120 keV energy in monocrystal silicon and in polycrystal aluminium and titanium is investigated by the method of Rutherford backscattering (RBS). Parameters of temperature dependence of the cesium diffusion coefficient in materials given above are determined. Cesium is shown to be one of the most movable impurities

  6. Phenotypic variability in 49 cases of ESCO2 mutations, including novel missense and codon deletion in the acetyltransferase domain, correlates with ESCO2 expression and establishes the clinical criteria for Roberts syndrome

    NARCIS (Netherlands)

    Vega, H.; Trainer, A. H.; Gordillo, M.; Crosier, M.; Kayserili, H.; Skovby, F.; Uzielli, M. L. Giovannucci; Schnur, R. E.; Manouvrier, S.; Blair, E.; Hurst, J. A.; Forzano, F.; Meins, M.; Simola, K. O. J.; Raas-Rothschild, A.; Hennekam, R. C. M.; Jabs, E. Wang

    2010-01-01

    Background Roberts syndrome (RBS) and SC phocomelia are caused by mutations in ESCO2, which codes for an acetyltransferase involved in the regulation of sister chromatid cohesion. Of 26 mutations described to date, only one missense mutation has been reported and all others are predicted to be

  7. Study of Ag and PE interface after plasma treatment

    Czech Academy of Sciences Publication Activity Database

    Macková, Anna; Malinský, Petr; Bočan, Jiří; Švorčík, V.; Pavlík, J.; Strýhal, Z.; Sajdl, P.

    2008-01-01

    Roč. 5, č. 4 (2008), s. 964-967 ISSN 1610-1634 R&D Projects: GA MŠk(CZ) LC06041 Institutional research plan: CEZ:AV0Z10480505 Keywords : metal/polymer interfacerface * metallized polymers * RBS Subject RIV: JJ - Other Materials

  8. Comparison of estimated and experimental subaqueous seed transport.

    Science.gov (United States)

    Scott Markwith; David Leigh

    2011-01-01

    We compare the estimates from the relative bed stability (RBS) equation that indicates incipient bed movement, and the inertial settling (‘Impact’) law and Wu and Wang (2006) settling velocity equations that indicate suspended particle movement, to flume and settling velocity observations to confirm the utility of the equations for subaqueous hydrochory analyses, and...

  9. Rare earth doped gallium gadolinium orthogallate films prepared by pulsed laser deposition

    Czech Academy of Sciences Publication Activity Database

    Lančok, Ján; Novotný, Michal; Garapon, C.; Jelínek, Miroslav

    2007-01-01

    Roč. 59, - (2007), s. 400-403 ISSN 1742-6588 R&D Projects: GA AV ČR KJB1010417 Institutional research plan: CEZ:AV0Z10100522 Keywords : Gd 3 Ga 5 O 12 * PLD * doped Gd 3 Ga 5 O 12 * RBS Subject RIV: BM - Solid Matter Physics ; Magnetism

  10. Phenotypic variability in 49 cases of ESCO2 mutations, including novel missense and codon deletion in the acetyltransferase domain, correlates with ESCO2 expression and establishes the clinical criteria for Roberts syndrome

    DEFF Research Database (Denmark)

    Vega, H; Trainer, A H; Gordillo, M

    2010-01-01

    Roberts syndrome (RBS) and SC phocomelia are caused by mutations in ESCO2, which codes for an acetyltransferase involved in the regulation of sister chromatid cohesion. Of 26 mutations described to date, only one missense mutation has been reported and all others are predicted to be truncating mu...

  11. 75 FR 11836 - Bioenergy Program for Advanced Biofuels

    Science.gov (United States)

    2010-03-12

    ... Biofuels AGENCY: Rural Business-Cooperative Service (RBS), USDA. ACTION: Notice of Contract for Proposal... Year 2009 for the Bioenergy Program for Advanced Biofuels under criteria established in the prior NOCP... Bioenergy Program for Advanced Biofuels. In response to the previously published NOCP, approximately $14.5...

  12. Administering for Change Program Innovation Process Study. Work Unit 12, Milestone 2.

    Science.gov (United States)

    Temkin, Sanford; Clark, Carolyn

    The work reported here is exploratory and investigative in nature, but it is expected to lead to a systematic research program designed to test the validity of propositions about the innovation process. Part 1 is introductory. Part 2 sets the stage for discussion of the Research for Better Schools, Inc. (RBS) field research. Part 3 enumerates the…

  13. Responsible Hospitality. Prevention Updates

    Science.gov (United States)

    Colthurst, Tom

    2004-01-01

    Responsible Hospitality (RH)--also called Responsible Beverage Service (RBS)--encompasses a variety of strategies for reducing risks associated with the sale and service of alcoholic beverages. RH programs have three goals: (1) to prevent illegal alcohol service to minors; (2) to reduce the likelihood of drinkers becoming intoxicated; and (3) to…

  14. Co-digestion of wheat and rye bread suspensions with source-sorted municipal biowaste

    International Nuclear Information System (INIS)

    Li, Chaoran; Mörtelmaier, Christoph; Winter, Josef; Gallert, Claudia

    2015-01-01

    Graphical abstract: Volatile fatty acid spectra of acidified WBS, RBS or FBS differ, but methanogenesis is similar. Display Omitted - Highlights: • Biogas improvement by co-digestion of wheat and rye bread. • Increased population density at high organic loading rates. • Less Pelotomaculum but increased numbers of Syntrophobacter and Smithella found in rye bread reactor. • Replacement of Methanosarcinales by acetate-oxidizers in rye bread co-digestion. • Increasing proportion of Methanomicrobiales in biowaste + rye bread reactor. - Abstract: Acidification of wheat bread (WBS), rye bread (RBS) and fresh biowaste suspensions (FBS), leading to lactate+acetate, lactate+acetate+n-buyrate, and acetate+propionate+n-butyrate, respectively, and biogas production as well as population dynamics were investigated. Co-fermentation of FBS (14 kg m −3 d −1 organic loading rate (OLR)) with WBS or RBS was stable up to an OLR of 22 kg m −3 d −1 and resulted in up to 3 times as much biogas. During co-fermentation at more than 20 kg m −3 d −1 OLR the total population increased more than 2-fold, but the originally low share of propionate-oxidizing bacteria significantly decreased. The proportion of methanogens also decreased. Whereas the proportion of Methanosarcinales to Methanomicrobiales in biowaste and biowaste+WBS remained constant, Methanosarcinales and in particular Methanosaeta spec. in the biowaste+RBS assay almost completely disappeared. Methanomicrobiales increased instead, indicating propionate oxidation via acetate cleavage to CO 2 and hydrogen

  15. Au implantation into various types of silicate glasses

    Czech Academy of Sciences Publication Activity Database

    Malinský, Petr; Macková, Anna; Bočan, Jiří; Švecová, B.; Nekvindová, P.

    2009-01-01

    Roč. 267, - (2009), s. 1575-1578 ISSN 0168-583X R&D Projects: GA MŠk(CZ) LC06041 Institutional research plan: CEZ:AV0Z10480505 Keywords : Au+ ion implantation * Glass es * RBS Depth profiling Subject RIV: BG - Nuclear, Atomic and Molecular Physics, Colliders Impact factor: 1.156, year: 2009

  16. Collaboration for the design of an irradiation line in the Tandetron area; Colaboracion para el diseno de una linea de irradiacion en el area de Tandetron

    Energy Technology Data Exchange (ETDEWEB)

    Quezada G, A. [ININ, 52750 La Marquesa, Estado de Mexico (Mexico)

    2006-07-01

    Presently work is sought to contribute in the design of a new line for the Tandetron accelerator that allows the application of other analytical techniques as its are: Rutherford backscattering analysis (RBS), elastic setback scattering analysis (ERDA) elastic scattering toward ahead (EFA) and materials modification by means of the particle beams application. (Author)

  17. Electrical properties of epitaxially grown VOx thin films

    NARCIS (Netherlands)

    Rata, A.D.; Chezan, A.R; Presura, C.N.; Hibma, T

    2003-01-01

    High quality VOx thin films on MgO(100) substrates were prepared and studied from the structural and electronic point of view. Epitaxial growth was confirmed by RHEED and XRD techniques. The oxygen content of VOx thin films as a function of oxygen flux was determined using RBS. The upper and lower

  18. 78 FR 68022 - Notice of Request for Extension of a Currently Approved Information Collection

    Science.gov (United States)

    2013-11-13

    ... grants made by the Rural Business-Cooperative Service (RBS) to public bodies, non-profit corporations... collection of information is estimated to average 7.4 hours per response. Respondents: Public bodies, non... will be summarized and included in the request for OMB approval. All comments will also become a matter...

  19. Ultrafast Approximation for Phylogenetic Bootstrap

    NARCIS (Netherlands)

    Bui Quang Minh, [No Value; Nguyen, Thi; von Haeseler, Arndt

    Nonparametric bootstrap has been a widely used tool in phylogenetic analysis to assess the clade support of phylogenetic trees. However, with the rapidly growing amount of data, this task remains a computational bottleneck. Recently, approximation methods such as the RAxML rapid bootstrap (RBS) and

  20. Micro-PIXE for the quantitative imaging of chemical elements in single cells

    International Nuclear Information System (INIS)

    Ortega, R.

    2013-01-01

    Full text: The knowledge of the intracellular distribution of biological relevant metals is important to understand their mechanisms of action in cells, either for physiological, toxicological or pathological processes. However, the direct detection of trace metals in single cells is a challenging task that requires sophisticated analytical developments. The aim of this seminar will be to present the recent achievements in this field using micro-PIXE analysis. The combination of micro-PIXE with RBS (Rutherford Backscattering Spectrometry) and STIM (Scanning Transmission lon Microscopy) allows the quantitative determination of trace metal content within sub-cellular compartments. The application of STlM analysis will be more specifically highlighted as it provides high spatial resolution imaging (<200 nm) and excellent mass sensitivity (<0.1 ng). Application of the STIM-PIXE-RBS methodology is absolutely needed when organic mass loss appears during PIXE-RBS irradiation. This combination of STIM-PIXE-RBS provides fully quantitative determination of trace element content, expressed in μg/g, which is a quite unique capability for micro-PIXE compared to other micro-analytical methods such as the electron and synchrotron X-ray fluorescence or the techniques based on mass spectrometry. Examples of micro-PIXE studies for subcellular imaging of trace elements in the various fields of interest will be presented such as metal-based toxicology, pharmacology, and neuro degeneration [1] R. Ortega, G. Devés, A. Carmona. J. R. Soc. Interface, 6, (2009) S649-S658. (author)

  1. Micro-PIXE for single cell analysis

    International Nuclear Information System (INIS)

    Ortega, Richard

    2012-01-01

    The knowledge of the intracellular distribution of biological relevant metals is important to understand their mechanisms of action in cells, either for physiological, toxicological or pathological processes. However, the direct detection of trace metals in single cells is a challenging task that requires sophisticated analytical developments. The combination of micro-PIXE with RBS and STIM (Scanning Transmission Ion Microscopy) allows the quantitative determination of trace metal content within sub-cellular compartments. The application of STIM analysis provides high spatial resolution imaging (< 200 nm) and excellent mass sensitivity (< 0.1 ng). Application of the STIM-PIXE-RBS methodology is absolutely needed when organic mass loss appears during PIXE-RBS irradiation. This combination of STIM-PIXE-RBS provides fully quantitative determination of trace element content, expressed in μg/g, which is a quite unique capability for micro-PIXE compared to other micro-analytical methods such as the electron and synchrotron x-ray fluorescence. Examples of micro-PIXE studies for sub-cellular imaging of trace elements in various fields of interest will be presented: in patho-physiology of trace elements involved in neurodegenerative diseases such as Parkinson's disease, and in toxicology of metals such as cobalt. (author)

  2. Nuclear and conventional techniques applied to the analysis of Purhepecha metals of the Pareyon collection

    International Nuclear Information System (INIS)

    Mendez, U.; Tenorio C, D.; Ruvalcaba, J.L.; Lopez, J.A.

    2005-01-01

    The main objective of this investigation was to determine the composition and microstructure of 13 metallic devices by means of the nuclear techniques of PIXE, RBS and conventional; which were elaborated starting from copper and gold, and they were in the offering of a tarasc personage located in the 'Matamoros' porch in Uruapan, Michoacan, Mexico. (Author)

  3. Optimization of nanocrystalline γ-alumina coating for direct spray ...

    Indian Academy of Sciences (India)

    2016-08-26

    Aug 26, 2016 ... The fabricated metal oxide films were characterized using techniques such as atomic force microscopy (AFM), X-ray diffraction (XRD), spectrophotometry, ellipsometry and Rutherford backscattering (RBS) analysis. Modifications of the partial gas percentage influences the optical properties and composition ...

  4. Extraction of ISOLDE parameters from CALS, streaming of pressure data through web-services and visual target documentation

    CERN Document Server

    Rakhmatov, Eradzh

    2017-01-01

    This report gives a short description of the projects I have been involved in during my stay as a Non Member State Summer Student at the European Organization for Nuclear Research (CERN). All my work took place within ISOLDE collaboration, in the EN-STI-RBS section.

  5. Atomic mixing effects on high fluence Ge implantation into Si at 40 keV

    International Nuclear Information System (INIS)

    Gras-Marti, A.; Jimenez-Rodriguez, J.J.; Peon-Fernandez, J.; Rodriguez-Vidal, M.; Tognetti, N.P.; Carter, G.; Nobes, M.J.; Armour, D.G.

    1982-01-01

    Ion implanted profiles of 40 keV Ge + into Si at fluences ranging from approx. equal to 10 15 ions/cm 2 up to saturation have been measured using the RBS technique. The profiles compare well with the predictions of an analytical model encompasing sputter erosion plus atomic relocation. (orig.)

  6. Key Recovery Attacks on Recent Authenticated Ciphers

    DEFF Research Database (Denmark)

    Bogdanov, Andrey; Dobraunig, Christoph; Eichlseder, Maria

    2014-01-01

    In this paper, we cryptanalyze three authenticated ciphers: AVALANCHE, Calico, and RBS. While the former two are contestants in the ongoing international CAESAR competition for authenticated encryption schemes, the latter has recently been proposed for lightweight applications such as RFID systems...

  7. Associations between Responsible Beverage Service Laws and Binge Drinking and Alcohol-Impaired Driving

    Science.gov (United States)

    Linde, Ann C.; Toomey, Traci L.; Wolfson, Julian; Lenk, Kathleen M.; Jones-Webb, Rhonda; Erickson, Darin J.

    2016-01-01

    We explored potential associations between the strength of state Responsible Beverage Service (RBS) laws and self-reported binge drinking and alcohol-impaired driving in the U.S. A multi-level logistic mixed-effects model was used, adjusting for potential confounders. Analyses were conducted on the overall BRFSS sample and drinkers only. Seven…

  8. Pramana – Journal of Physics | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    The folded tandem ion accelerator (FOTIA) project at BARC has been commissioned. The analysed carbon beams of 40 nA(3+) and 25 nA(4+), at terminal voltage of 2.5 MV with N2 + CO2 as insulating gas, were obtained. The beams were characterized by performing the Rutherford back scattering (RBS) on gold, tin and ...

  9. Characterization of thin films and surfaces by ion-beam analytical techniques

    International Nuclear Information System (INIS)

    Pelicon, P.; Budnar, M.; Zorko, B.; Razpet, A.

    1999-01-01

    The optimization of Rutherford Backscattering Spectroscopy (RBS) and Elastic Recoil Detection Analysis (ERDA) at the tandetron facility of J. Stefan Inst.e is reported. The most recent applications of these techniques for the analysis of thin films and surfaces are presented. The construction of the isotope - resolved Time-Of-Flight ERDA telescope for depth profiling of light elements is reviewed.(author)

  10. Early stages of growth of gold layers sputter deposited on glass and silicon substrates

    Czech Academy of Sciences Publication Activity Database

    Malinský, Petr; Slepička, P.; Hnatowicz, Vladimír; Švorčík, V.

    2012-01-01

    Roč. 7, č. 241 (2012), s. 1-7 ISSN 1931-7573 R&D Projects: GA ČR(CZ) GBP108/12/G108 Institutional support: RVO:61389005 Keywords : sputtering * gold layer * glass * silicon * RBS Subject RIV: BG - Nuclear, Atomic and Molecular Physics, Colliders Impact factor: 2.524, year: 2012

  11. Interface behaviour and electrical performance of ruthenium ...

    Indian Academy of Sciences (India)

    Rutherford backscattering spectrometry (RBS) analysis, carried out at various annealing temperatures, of a thin film of ruthenium on n-type four-hexagonal silicon carbide (4H-SiC) showed the evidence of ruthenium oxidation, ruthenium silicide formation and diffusion of ruthenium into silicon carbide starting from an ...

  12. Passivation of cobalt nanocluster assembled thin films with hydrogen

    DEFF Research Database (Denmark)

    Romero, C.P.; Volodin, A.; Di Vece, M.

    2012-01-01

    The effect of hydrogen passivation on bare and Pd capped cobalt nanocluster assembled thin films was studied with Rutherford backscattering spectrometry (RBS) and magnetic force microscopy (MFM) after exposure to ambient conditions. The nanoclusters are produced in a laser vaporization cluster...

  13. Surface ion implantation induced by laser-generated plasmas

    Czech Academy of Sciences Publication Activity Database

    Giuffrida, L.; Torrisi, L.; Gammino, S.; Wolowski, J.; Ullschmied, Jiří

    2010-01-01

    Roč. 165, 6-10 (2010), s. 534-542 ISSN 1042-0150. [International Workshop on Pulsed Plasma Laser Ablation (PPLA)/4./. Monte Pieta, Messina, 18.06.2009-20.06.2009] Institutional support: RVO:61389021 Keywords : laser ablation * laser plasma * ion implantation * RBS analysis Subject RIV: BL - Plasma and Gas Discharge Physics Impact factor: 0.660, year: 2010

  14. Lessons from Neno, Malawi

    African Journals Online (AJOL)

    As Malawi continues to suffer from a large burden of noncommunicable diseases (NCDs), models for NCD screening need to be ... cut-off of 160/110 mmHg, as well as adults 40 years and above for diabetes, measuring either random blood sugar (RBS) or fasting .... patients with HIV, epilepsy, heart failure, hypertension,.

  15. 75 FR 50983 - Submission for OMB Review; Comment Request

    Science.gov (United States)

    2010-08-18

    ... program. Rural Business Service (RBS) mission is to improve the quality of life in rural America by... respond, including through the use of appropriate automated, electronic, mechanical, or other... required to respond to the collection of information unless it displays a currently valid OMB control...

  16. 78 FR 67099 - Submission for OMB Review; Comment Request

    Science.gov (United States)

    2013-11-08

    ... it displays a currently valid OMB control number. Rural Business--Cooperative Service Title: Rural.... 940(c)) that established a loan and grant program. Rural Business Service (RBS) mission is to improve... respond, including through the use of appropriate automated, electronic, mechanical, or other...

  17. 77 FR 75969 - Submission for OMB Review; Comment Request

    Science.gov (United States)

    2012-12-26

    ... it displays a currently valid OMB control number. Rural Business Service (RBS) Title: 7 CFR 4279-A..., electronic, mechanical, or other technological collection techniques or other forms of information technology... Development Act, as amended. The purpose of the program is to improve, develop, or finance businesses...

  18. Use of an ultra-high resolution magnetic spectrograph for materials research

    NARCIS (Netherlands)

    Boerma, DO; Arnoldbik, WM; Wolfswinkel, W; Balogh, AG; Walter, G

    1997-01-01

    A brief description is given of a magnetic spectrograph for RBS and ERD analysis with MeV beams, delivered by a Tandem accelerator. With a number of examples of thin layer analysis it is shown that the spectrograph is uniquely suited for the measurement of concentration depth profiles up to a depth

  19. Optimization of nanocrystalline γ-alumina coating for direct spray ...

    Indian Academy of Sciences (India)

    The fabricated metal oxide films were characterized using techniques such as atomic force microscopy (AFM), X-ray diffraction (XRD), spectrophotometry, ellipsometry and Rutherford backscattering (RBS) analysis. Modifications of the partial gas percentage influences the optical properties and composition of the deposited ...

  20. Optical, electrical and thermoelectric power studies of Al–Sb thin film ...

    Indian Academy of Sciences (India)

    Unknown

    been made to study the bilayer diffusion properties of Al–. Sb thin films. In the present communication, RBS analysis, optical, electrical and thermoelectric power studies of Al–. Sb bilayer structure of thin films prepared by thermal co- evaporation technique is reported. 2. Experimental. Aluminium antimonide films were ...

  1. SwissProt search result: AK068266 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK068266 J013149A10 (P16881) Ribulose bisphosphate carboxylase small chains, chloro...plast precursor (EC 4.1.1.39) (RuBisCO small subunits) [Contains: Ribulose bisphosphate carboxylase small chain P1; Ribulos...e bisphosphate carboxylase small chain P2; Ribulose bispho RBS_EUGGR 1e-32 ...

  2. SwissProt search result: AK068555 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK068555 J013156H12 (P16881) Ribulose bisphosphate carboxylase small chains, chloro...plast precursor (EC 4.1.1.39) (RuBisCO small subunits) [Contains: Ribulose bisphosphate carboxylase small chain P1; Ribulos...e bisphosphate carboxylase small chain P2; Ribulose bispho RBS_EUGGR 6e-34 ...

  3. SwissProt search result: AK070257 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK070257 J023042N11 (P16881) Ribulose bisphosphate carboxylase small chains, chloro...plast precursor (EC 4.1.1.39) (RuBisCO small subunits) [Contains: Ribulose bisphosphate carboxylase small chain P1; Ribulos...e bisphosphate carboxylase small chain P2; Ribulose bispho RBS_EUGGR 5e-33 ...

  4. SwissProt search result: AK061611 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK061611 001-032-F07 (P16881) Ribulose bisphosphate carboxylase small chains, chlor...oplast precursor (EC 4.1.1.39) (RuBisCO small subunits) [Contains: Ribulose bisphosphate carboxylase small chain P1; Ribulos...e bisphosphate carboxylase small chain P2; Ribulose bispho RBS_EUGGR 4e-33 ...

  5. SwissProt search result: AK099574 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK099574 J013036G21 (P16881) Ribulose bisphosphate carboxylase small chains, chloro...plast precursor (EC 4.1.1.39) (RuBisCO small subunits) [Contains: Ribulose bisphosphate carboxylase small chain P1; Ribulos...e bisphosphate carboxylase small chain P2; Ribulose bispho RBS_EUGGR 8e-34 ...

  6. SwissProt search result: AK121444 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK121444 J023141B14 (P16881) Ribulose bisphosphate carboxylase small chains, chloro...plast precursor (EC 4.1.1.39) (RuBisCO small subunits) [Contains: Ribulose bisphosphate carboxylase small chain P1; Ribulos...e bisphosphate carboxylase small chain P2; Ribulose bispho RBS_EUGGR 6e-33 ...

  7. SwissProt search result: AK119219 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK119219 001-046-F11 (P16881) Ribulose bisphosphate carboxylase small chains, chlor...oplast precursor (EC 4.1.1.39) (RuBisCO small subunits) [Contains: Ribulose bisphosphate carboxylase small chain P1; Ribulos...e bisphosphate carboxylase small chain P2; Ribulose bispho RBS_EUGGR 4e-33 ...

  8. SwissProt search result: AK059909 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK059909 006-209-C06 (P16881) Ribulose bisphosphate carboxylase small chains, chlor...oplast precursor (EC 4.1.1.39) (RuBisCO small subunits) [Contains: Ribulose bisphosphate carboxylase small chain P1; Ribulos...e bisphosphate carboxylase small chain P2; Ribulose bispho RBS_EUGGR 2e-33 ...

  9. Interface behaviour and electrical performance of ruthenium ...

    Indian Academy of Sciences (India)

    P/Bag 5507, Oshakati, Namibia. MS received 14 April 2014; revised 3 October 2014. Abstract. Rutherford backscattering spectrometry (RBS) analysis, ... beam deposition technique through a metal contact mask at. 10−6 mbar pressure. The Ru film thickness was monitored by Infincon meter until the required thickness was ...

  10. Merksi Läti konkurendi juht läheb altkäemaksu andmise eest vangi / Silvia Kruusmaa

    Index Scriptorium Estoniae

    Kruusmaa, Silvia

    2008-01-01

    Läti rahvusraamatukogu ehitusega seotud ehitusettevõtte RBS Skalsi juhatuse liige Andris Treijs mõisteti altkäemaksu andmise eest vangi. Raamatukogu ehitusest on korruptsiooni tõttu kõrvale tõrjutud ka Merko Ehituse tütarfirma Merks

  11. India mainstreams medicinal plants | IDRC - International ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    2011-02-03

    Feb 3, 2011 ... The program is partly sponsored by IDRC's Medicinal and Aromatic Plants Program in Asia (MAPPA). IDRC has supported medicinal plant research in the region since 1992. Improving quality control. R.B.S. Rawat, CEO of India's National Medicinal Plants Board, said people in Chhattisgarh and other ...

  12. Absence of single critical dose for the amorphization of quartz under ion irradiation

    Science.gov (United States)

    Zhang, S.; Pakarinen, O. H.; Backholm, M.; Djurabekova, F.; Nordlund, K.; Keinonen, J.; Wang, T. S.

    2018-01-01

    In this work, we first simulated the amorphization of crystalline quartz under 50 keV 23 Na ion irradiation with classical molecular dynamics (MD). We then used binary collision approximation algorithms to simulate the Rutherford backscattering spectrometry in channeling conditions (RBS-C) from these irradiated MD cells, and compared the RBS-C spectra with experiments. The simulated RBS-C results show an agreement with experiments in the evolution of amorphization as a function of dose, showing what appears to be (by this measure) full amorphization at about 2.2 eVṡatom-1 . We also applied other analysis methods, such as angular structure factor, Wigner–Seitz, coordination analysis and topological analysis, to analyze the structural evolution of the irradiated MD cells. The results show that the atomic-level structure of the sample keeps evolving after the RBS signal has saturated, until the dose of about 5 eVṡatom-1 . The continued evolution of the SiO2 structure makes the definition of what is, on the atomic level, an amorphized quartz ambiguous.

  13. IBA techniques: Examples of useful combinations for the characterisation of cultural heritage materials

    International Nuclear Information System (INIS)

    Beck, L.; Pichon, L.; Moignard, B.; Guillou, T.; Walter, P.

    2011-01-01

    For many years, ion beam analysis techniques have successfully been used to the study of cultural heritage objects. The chemical composition of work art is usually determined by PIXE, but in many cases, RBS and/or PIGE can provide useful complementary information. RBS gives information about the depth distribution and concentration in light elements, such as carbon and oxygen. In the past years, the experimental facilities at the AGLAE (Accélérateur Grand Louvre d’Analyse Élémentaire) accelerator has been progressively developed in order to apply simultaneously PIXE, PIGE and RBS under optimal conditions using an external beam. This combination is now routinely used for point analyses or mappings. In this contribution, we present several examples of applications: manufacturing technology of lustre-decorated ceramics and silver plating, control of altered or restored surfaces, and quantification of organic phase in painting and bone. The final conclusion is that the association of PIXE with RBS is very attractive for the investigation of cultural heritage objects, in particular of materials containing both mineral and organic components or possessing a multilayered structure. The first results of the production of monochromatic X-rays for radiography purposes by PIXE are also presented.

  14. 77 FR 55864 - Applications and Amendments to Facility Operating Licenses and Combined Licenses Involving...

    Science.gov (United States)

    2012-09-11

    .... ML111940200), which approved the RBS Cyber Security Plan and associated implementation milestone schedule. The Cyber Security Plan Implementation Schedule contained in the licensee's letter dated April 4, 2011... consequences of an accident previously evaluated? Response: No. The proposed change to the Cyber Security Plan...

  15. Lattice location of helium in uranium dioxide single crystals

    Energy Technology Data Exchange (ETDEWEB)

    Garrido, F.; Nowicki, L. E-mail: lech.nowicki@fuw.edu.pl; Sattonnay, G.; Sauvage, T.; Thome, L

    2004-06-01

    Lattice location of {sup 3}He atoms implanted into UO{sub 2} single crystals was performed by means of the channeling technique combined with nuclear reaction analysis (NRA) and Rutherford backscattering spectrometry (RBS). The {sup 3}He(d,p){sup 4}He reaction was used. The experimental angular scans show that helium atoms occupy octahedral interstitial positions.

  16. Microbial and heavy metal contamination of pineapple products ...

    African Journals Online (AJOL)

    SAM

    maximum permissible limits set by Codex Alimentarius Commission (CAC), East African Standards. (EAS) and Rwanda ... permissible Codex and RBS limits with total plate counts >300 CFU/ml and yeasts and mould counts. >300 CFU/ml. ...... maximum levels for certain contaminants in foodstuffs (Text with EEA relevance).

  17. Sequential application of non-pharmacological interventions reduces the severity of labour pain, delays use of pharmacological analgesia, and improves some obstetric outcomes: a randomised trial

    Directory of Open Access Journals (Sweden)

    Rubneide Barreto Silva Gallo

    2018-01-01

    Trial registration: NCT01389128. [Gallo RBS, Santana LS, Marcolin AC, Duarte G, Quintana SM (2018 Sequential application of non-pharmacological interventions reduces the severity of labour pain, delays use of pharmacological analgesia, and improves some obstetric outcomes: a randomised trial. Journal of Physiotherapy 64: 33–40

  18. Study of annealing effects in Al–Sb bilayer thin films

    Indian Academy of Sciences (India)

    Keywords. AlSb; thin film; RBS; optical band gap. Abstract. In this paper, we present preparation and characterization of Al–Sb bilayer thin films. Thin films of thicknesses, 3000/1000 Å and 3000/1500 Å, were obtained by the thermal evaporation (resistive heating) method. Vacuum annealing and rapid thermal annealing ...

  19. Nuclear analysis of a rare earth containing protective oxide on aluminium

    Energy Technology Data Exchange (ETDEWEB)

    Gorman, J.D.; Paterson, P.J.K. [Royal Melbourne Inst. of Tech., VIC (Australia); Hughes, A.E. [Commonwealth Scientific and Industrial Research Organisation (CSIRO), Melbourne, VIC (Australia). Div. of Materials Science

    1996-12-31

    The aim is study was to examine the thickness of the conversion coating as well as the elemental depth distribution of cerium and molybdenum using Rutherford Backscattering Spectroscopy (RBS), Scanning Electron Microscopy (SEM), Scanning Auger Electron Spectroscopy and Forward Recoil Spectroscopy (FRS). In addition, RBS has been used to examine how changes in processing conditions, particularly the treatment temperatures, influences the coating thickness and Ce distribution at each process step. SEM established that a crazed oxide structure was developed over the matrix of the alloy using the above process steps. RBS was chosen to provide elemental concentration versus depth information on these samples since it is largely insensitive to surface topography when the detector is set to high scattering angles. A other advantage of using RBS for this particular system is that the heavy elements incorporated into the coating such as Ce and Mo because of their high atomic number compared to the aluminium oxide, are well separated from aluminium and oxygen at their higher recoil energies. Forward Recoil Spectroscopy is capable of detecting hydrogen and it has been used to confirm that the coating is hydrated and to establish the hydrogen distribution within the final oxide coating on each alloy. 7 refs., 1 tab., 4 figs.

  20. 75 FR 3197 - Notice of a Public Meeting on Administration of the Business and Industry Guaranteed Loan Program

    Science.gov (United States)

    2010-01-20

    ... DEPARTMENT OF AGRICULTURE Rural Business-Cooperative Service Notice of a Public Meeting on Administration of the Business and Industry Guaranteed Loan Program AGENCY: Rural Business-Cooperative Service, USDA. ACTION: Notice of public meeting. SUMMARY: The Rural Business-Cooperative Service (RBS), an...

  1. Numerical Study on the Behaviour of Reduced Beam Section Presence in Rectangular Concrete Filled Tubes Connection

    Science.gov (United States)

    Amalia, A. R.; Suswanto, B.; Kristijanto, H.; Irawan, D.

    2018-01-01

    This paper discusses about the behaviour of two types of RCFT column connections with steel beams due to cyclic loads using software based on finite element method ABAQUS 6.14. This comparison involves modelling RCFT connections with rigid connection that do not allow any deformation and rotation in the joint. There are two types of model to be compared: BB and BRBS which include RCFT connections to ordinary beam without RBS (BB) and to Reduce Beam Section Beam (BRBS). The models behaviour can be discussed in this study are stress value, von misses stress pattern and rotational degree of each model. From the von misses stress pattern value, it found that the highest regions of stress occurs in vicinity of beam flange near column face for connection without RBS (BB). For earthquake resistant building, that behaviour needs to be avoided because sudden collapse often happen in that joint connection. Moreover, the connection with the presence of RBS (BRBS), the highest regions of stress occurs in reduced beam section of the beam, it means that the failure might be happen as proposed plan. The ultimate force that can be restrained by BB model (402 kN) is higher than BRBS model (257,18 kN) because of reducing of flange area. BRBS model has higher rotation angle (0,057 rad) than BB model (0,045 rad). The analysis results also observed that cyclic performances of the moment connection with RBS (BRBS) were more ductile than the connection with ordinary beam (BB).

  2. JPRS Report Science & Technology Japan

    Science.gov (United States)

    1989-05-04

    Energy Research Institute), Joyo (Power Reactor and Nuclear Fuel Devel- opment Corporation), and Microbeam PIXE RBS (Elec- trotechnical Laboratory). In...for conferences and company employee education. The full-scale use of satellite communications can provide momentum in invigorating business activi

  3. 78 FR 23316 - The Royal Bank of Scotland plc, et al.; Notice of Application and Temporary Order

    Science.gov (United States)

    2013-04-18

    ... 12, 2013, by RBS Securities Japan Limited (the ``Settling Firm'') in the U.S. District Court for the... Marunouchi, Chiyoda-ku, Tokyo 100- 0005, Japan. FOR FURTHER INFORMATION CONTACT: Bruce R. MacNeil, Senior... Narragansett Tax-Free Income Fund (the ``Fund'') (such activity, ``Fund Service Activities''). The Settling...

  4. Conference on instrumental activation analysis IAA 92

    International Nuclear Information System (INIS)

    Frana, J.; Obrusnik, I.

    1992-05-01

    The publication contains 26 abstracts primarily concerned with neutron activation analysis, although other analytical techniques based on X-ray fluorescence analysis, PIXE, PIGE, RBS are also included. Some contributions deal with aspects of quality practice and assurance in radioanalytical laboratories, with marketing of instrumental neutron activation analysis services, with hard- and software aspects of radiation detection, etc. (Z.S.)

  5. Risk-based methods for fish and terrestrial animal disease surveillance.

    Science.gov (United States)

    Oidtmann, Birgit; Peeler, Edmund; Lyngstad, Trude; Brun, Edgar; Bang Jensen, Britt; Stärk, Katharina D C

    2013-10-01

    Over recent years there have been considerable methodological developments in the field of animal disease surveillance. The principles of risk analysis were conceptually applied to surveillance in order to further develop approaches and tools (scenario tree modelling) to design risk-based surveillance (RBS) programmes. In the terrestrial animal context, examples of risk-based surveillance have demonstrated the substantial potential for cost saving, and a similar benefit is expected also for aquatic animals. RBS approaches are currently largely absent for aquatic animal diseases. A major constraint in developing RBS designs in the aquatic context is the lack of published data to assist in the design of RBS: this applies to data on (i) the relative risk of farm sites becoming infected due to the presence or absence of a given risk factor; (ii) the sensitivity of diagnostic tests (specificity is often addressed by follow-up investigation and re-testing and therefore less of a concern); (iii) data on the variability of prevalence of infection for fish within a holding unit, between holding units and at farm level. Another constraint is that some of the most basic data for planning surveillance are missing, e.g. data on farm location and animal movements. In Europe, registration or authorisation of fish farms has only recently become a requirement under EU Directive 2006/88. Additionally, the definition of the epidemiological unit (at site or area level) in the context of aquaculture is a challenge due to the often high level of connectedness (mainly via water) of aquaculture facilities with the aquatic environment. This paper provides a review of the principles, methods and examples of RBS in terrestrial, farmed and wild animals. It discusses the special challenges associated with surveillance for aquatic animal diseases (e.g. accessibility of animals for inspection and sampling, complexity of rearing systems) and provides an overview of current developments relevant

  6. Measurement-based modeling of bromine chemistry in the boundary layer: 1. Bromine chemistry at the Dead Sea

    Directory of Open Access Journals (Sweden)

    E. Tas

    2006-01-01

    Full Text Available The Dead Sea is an excellent natural laboratory for the investigation of Reactive Bromine Species (RBS chemistry, due to the high RBS levels observed in this area, combined with anthropogenic air pollutants up to several ppb. The present study investigated the basic chemical mechanism of RBS at the Dead Sea using a numerical one-dimensional chemical model. Simulations were based on data obtained from comprehensive measurements performed at sites along the Dead Sea. The simulations showed that the high BrO levels measured frequently at the Dead Sea could only partially be attributed to the highly concentrated Br− present in the Dead Sea water. Furthermore, the RBS activity at the Dead Sea cannot solely be explained by a pure gas phase mechanism. This paper presents a chemical mechanism which can account for the observed chemical activity at the Dead Sea, with the addition of only two heterogeneous processes: the "Bromine Explosion" mechanism and the heterogeneous decomposition of BrONO2. Ozone frequently dropped below a threshold value of ~1 to 2 ppbv at the Dead Sea evaporation ponds, and in such cases, O3 became a limiting factor for the production of BrOx (BrO+Br. The entrainment of O3 fluxes into the evaporation ponds was found to be essential for the continuation of RBS activity, and to be the main reason for the jagged diurnal pattern of BrO observed in the Dead Sea area, and for the positive correlation observed between BrO and O3 at low O3 concentrations. The present study has shown that the heterogeneous decomposition of BrONO2 has a great potential to affect the RBS activity in areas influenced by anthropogenic emissions, mainly due to the positive correlation between the rate of this process and the levels of NO2. Further investigation of the influence of the decomposition of BrONO2 may be especially important in understanding the RBS activity at mid-latitudes.

  7. Penicillin induced persistence in Chlamydia trachomatis: high quality time lapse video analysis of the developmental cycle.

    Directory of Open Access Journals (Sweden)

    Rachel J Skilton

    2009-11-01

    Full Text Available Chlamydia trachomatis is a major human pathogen with a unique obligate intracellular developmental cycle that takes place inside a modified cytoplasmic structure known as an inclusion. Following entry into a cell, the infectious elementary body (EB differentiates into a non-infectious replicative form known as a reticulate body (RB. RBs divide by binary fission and at the end of the cycle they redifferentiate into EBs. Treatment of C.trachomatis with penicillin prevents maturation of RBs which survive and enlarge to become aberrant RBs within the inclusion in a non-infective persistent state. Persistently infected individuals may be a reservoir for chlamydial infection. The C.trachomatis genome encodes the enzymes for peptidoglycan (PG biosynthesis but a PG sacculus has never been detected. This coupled to the action of penicillin is known as the chlamydial anomaly. We have applied video microscopy and quantitative DNA assays to the chlamydial developmental cycle to assess the effects of penicillin treatment and establish a framework for investigating penicillin induced chlamydial persistence.Addition of penicillin at the time of cell infection does not prevent uptake and the establishment of an inclusion. EB to RB transition occurs but bacterial cytokinesis is arrested by the second binary fission. RBs continue to enlarge but not divide in the presence of penicillin. The normal developmental cycle can be recovered by the removal of penicillin although the large, aberrant RBs do not revert to the normal smaller size but remain present to the completion of the developmental cycle. Chromosomal and plasmid DNA replication is unaffected by the addition of penicillin but the arrest of bacterial cytokinesis under these conditions results in RBs accumulating multiple copies of the genome.We have applied video time lapse microscopy to the study of the chlamydial developmental cycle. Linked with accurate measures of genome replication this provides a

  8. Measurement-based modeling of bromine chemistry in the boundary layer: 1. Bromine chemistry at the Dead Sea

    Science.gov (United States)

    Tas, E.; Peleg, M.; Pedersen, D. U.; Matveev, V.; Pour Biazar, A.; Luria, M.

    2006-12-01

    The Dead Sea is an excellent natural laboratory for the investigation of Reactive Bromine Species (RBS) chemistry, due to the high RBS levels observed in this area, combined with anthropogenic air pollutants up to several ppb. The present study investigated the basic chemical mechanism of RBS at the Dead Sea using a numerical one-dimensional chemical model. Simulations were based on data obtained from comprehensive measurements performed at sites along the Dead Sea. The simulations showed that the high BrO levels measured frequently at the Dead Sea could only partially be attributed to the highly concentrated Br- present in the Dead Sea water. Furthermore, the RBS activity at the Dead Sea cannot solely be explained by a pure gas phase mechanism. This paper presents a chemical mechanism which can account for the observed chemical activity at the Dead Sea, with the addition of only two heterogeneous processes: the "Bromine Explosion" mechanism and the heterogeneous decomposition of BrONO2. Ozone frequently dropped below a threshold value of ~1 to 2 ppbv at the Dead Sea evaporation ponds, and in such cases, O3 became a limiting factor for the production of BrOx (BrO+Br). The entrainment of O3 fluxes into the evaporation ponds was found to be essential for the continuation of RBS activity, and to be the main reason for the jagged diurnal pattern of BrO observed in the Dead Sea area, and for the positive correlation observed between BrO and O3 at low O3 concentrations. The present study has shown that the heterogeneous decomposition of BrONO2 has a great potential to affect the RBS activity in areas influenced by anthropogenic emissions, mainly due to the positive correlation between the rate of this process and the levels of NO2. Further investigation of the influence of the decomposition of BrONO2 may be especially important in understanding the RBS activity at mid-latitudes.

  9. OBTENÇÃO DE AUXILIAR DE FLOCULAÇÃO A PARTIR DE RESÍDUOS DE SEMENTES DE FRUTAS VISANDO O TRATAMENTO DE ÁGUA

    Directory of Open Access Journals (Sweden)

    Erivaldo Reis

    2014-12-01

    Full Text Available Este estudo objetivou avaliar o potencial de utilização de resíduos de sementes de frutas como auxiliar de floculação no tratamento de água. Os biomateriais utilizados foram sementes de mangaba (Hancornia speciosa, maracujá (Passiflora edulis, graviola (Annona muricata e goiaba (Psidium guajava. As sementes foram lavadas e secas em mufla a 170°C por 1 h e 30 min, sendo em seguida trituradas. As sementes foram usadas sem e com modificação química com ácido cítrico,hidróxido de amônio e peróxido de hidrogênio. Os testes em batelada de remoção de cor, turbidez e ferro foram realizados usando Jar Test. No tratamento utilizou-se água sintética preparada com argila com granulometria 100 m mesh. Os testes em batelada foram desenvolvidos utilizando velocidade de mistura rápida de 150 rpm com duração de 1 min, velocidade de mistura lenta de 30 rpm com duração de 15 mim, 1,5 mL de coagulante sulfato férrico, 3 gotas de permanganato de potássio e auxiliar de floculação (pó de semente. Todos os testes foram realizados no pH fixado em 6,0. A determinação de turbidez foi feita utilizando o método nefelométrico. A análise de ferro e cor foi realizada por espectrofotometria. A remoção média de íons para Fe foi de 53% utilizando os biomateriais mangaba e graviola. Para turbidez e cor aparente obteve um percentual de remoção em torno de 90% para todos os biomateriais.

  10. Alternativas De Comercialização Cinematográfica: novas janelas e o caso 3 efes

    OpenAIRE

    Couto Melo, Maria Cristina

    2012-01-01

    O modelo industrial de produção cinematográfica estrutura-se a partir da divisão da realização de um filme entre os setores de produção, distribuição e exibição, e da oferta gradual e sequencial de conteúdos nas janelas de exibição. Em contrapartida, o desenvolvimento das novas mídias e da convergência dos meios comunicacionais resultou em um modelo que propõe a exibição de conteúdos em múltiplas janelas e produção por demanda de nichos. O presente artigo propõe a discussão e compreensão do p...

  11. Adoção e implantação da NBC TG 1000 – Contabilidade para pequenas e médias empresas: um estudo nas empresas de serviços contábeis de Pernambuco

    OpenAIRE

    Granha, Marco Antonio

    2014-01-01

    O presente estudo teve como objetivo explicar como as empresas de serviços contábeis se adaptaram a NBC TG 1000 – Contabilidade para Pequenas e Médias Empresas para a preparação, elaboração e divulgação das demonstrações contábeis de seus clientes. Para alcançar esse objetivo, a pesquisa utilizou uma abordagem de métodos misto sequencial, sendo inicialmente aplicado um questionário de pesquisa para as 148 empresas de serviços contábeis associadas ao SESCAP-PE obtendo 35 respostas representand...

  12. DISTRIBUIÇÃO E FRACIONAMENTO DO FÓSFORO NOS SEDIMENTOS DOS RIOS BACANGA E ANIL NA ILHA DO MARANHÃO

    OpenAIRE

    MARIA DE LOURDES FERREIRA NUNES

    2013-01-01

    No presente estudo, foi determinado o estoque total de fósforo (TP) em sedimentos de rios Anil e Bacanga localizados na ilha do Maranhão. Além disso, com a finalidade de avaliar a labilidade de fósforo no sedimento, foi realizada a extração química sequencial de acordo com o protocolo da Comissão Europeia (normas, medidas e programa de testes). Os resultados do Rio Bacanga indicou concentrações de PT que variam de 877,91 mg kgˉ e 1466,44 mg Kgˉ, o que permite classificar estes sedim...

  13. Avaliação quimiométrica da distribuição de metais pesados em composto de lixo urbano domiciliar

    Directory of Open Access Journals (Sweden)

    Egreja Filho Fernando Barboza

    1999-01-01

    Full Text Available The main obstacle to the use of compost from urban waste in agriculture is the presence of heavy metals. Once in the soil, their effect is accumulative and they may contaminate crops and water. The present study reports the evaluation of the chemical distributions of Cu, Pb, Mn and Zn in three different sized fractions (unsieved, < 1,18mm and > 1,18mm of compost, by means of a sequencial extraction procedure and a chemometric analysis of the total content of all metals in each fraction. The pattern recognition methods showed significant differences in total heavy metal contents for the different fractions. The finest one was the most contaminated. Meanwhile, this fraction presented lower amounts of metals in avaliable forms. This behavior can be attributed to the presence of metal particles in their elemental states in this fraction.

  14. Predatory behavior of the paguroid Dardanus venosus (H. Milne-Edwards, 1848 (Anomura: Diogenidae on the snail Aurantilaria aurantiaca (Lamarck, 1816 (Gastropoda: Fasciolariidae

    Directory of Open Access Journals (Sweden)

    Felipe Bezerra Ribeiro

    Full Text Available Abstract Paguroids are usually detritivorous organisms and the occurrence of predation on mollusks is very unusual. This contribution reports the occurrence of a predatory behavior of the paguroid Dardanus venosus (H. Milne Edwards, 1848 on the snail Aurantilaria aurantiaca (Lamarck, 1816. Single specimen of paguroid was found attacking the snail in a sea grass meadow dominated by Halodule wrightii Ascherson on the coast of Ceará, northeastern Brazil. The paguroid and gastropod specimens were brought to the laboratory and placed in an aquarium and the behavior was recorded by photos. Paguroid behavior was characterized by sequencial movements of chelipeds in the attack to the snail when the snail was hold by paguroid ambulatory legs. External lip of shell aperture, operculum and foot of the gastropod were severely damaged.

  15. Plasma emission spectroscopy (DCP) for rare earths determination in waters from Morro do Ferro (MG) Brazil, after chromatographic preconcentration

    International Nuclear Information System (INIS)

    Figueiredo, A.M.R. de.

    1987-01-01

    Rare earth determinations in surface and well waters from Morro do Ferro was studied using chemical preconcentration methods of the group and plasma emission spectroscopy excited by direct current are - DCP. A method that combines retention in alumina is HF medium with ion exchange for the preconcentration of the group was developed in semi micro scale. DCP determination, in the sequencial mode by using mixed standards containing, Y, La, Ce, Nd, Pr, Sm, Eu, Ga, Tb, Dy, Er, Yb and Al, principal concentrate componentes was studied by analysis of the profile of each spectral line. Principal cations, anions, ph and Eh were determined. Semi-micro techniques were developed for anions preconcentration and for determination of sulphate, phosphate and carbonate. (M.J.C.) [pt

  16. Análise de política como metodologia em estudo do transporte escolar rural

    Directory of Open Access Journals (Sweden)

    Calinca Jordânia Pergher

    2017-09-01

    Full Text Available O texto apresenta o marco teórico-metodológico de análise de políticas públicas que fundamentou uma pesquisa sobre a política do transporte escolar rural no Rio Grande do Sul. São explicitadas diversas noções, conceitos e abordagens, mas a ênfase recai sobre a abordagem cognitiva, de linha francesa, e sobre a análise sequencial de políticas, suas características e o modo como foram combinadas na pesquisa. São narradas rotas percorridas na reconstrução analítica da política, nas fases de emergência do problema, colocação na agenda, formulação e adoção do programa e implementação.

  17. Classificação de Muscidae (Diptera: uma proposta através da análise cladístical

    Directory of Open Access Journals (Sweden)

    Cláudio José Barros de Carvalho

    1989-01-01

    Full Text Available A cladistic analysis for 27 muscid genera is given, running the PAUP program (SWOFFORD, 1985. The 35 characters used in this study are polarized based on three outgroups of related families. A cladogram showing hypothetical phylogenetic relationships among genera and a discussion of the characters enable to propose a sequencial phylogenetic classification of Muscidae at tribal level. The following seven subfamilies and eight tribes are included: Achanthipterinae; Atherigoninae; Muscinae, with Muscini and Stomoxiini; Azeliinae, with Azeliini and Reinwardtiini; Phaoniinae; Mydaeinae, with Graphomyiini and Mydaeini and Coenosiinae, with Coenosiini and Limnophorini. Helina Robineau-Desvoidy, 1830 has not a defined position in the obtained cladogram to the considered levels. The neotropical species of Phaonia (aut. must be separated in a new genus. The proposed classification is compared with contemporaneous classifications. The greatest congruence is found with that of SKIDMORE (1985.

  18. Revisitando a Estratégia de Execução das Reformas Gerenciais no Setor Público: uma abordagem à luz do equilíbrio de Nash

    Directory of Open Access Journals (Sweden)

    Saulo Felipe Costa

    2017-07-01

    Full Text Available A década de 1990 inaugurou um conjunto de políticas públicas marcadas pela busca do aumento da eficiência governamental na geração e execução de suas ações. Às políticas orientadas para o mercado seguiram-se esforços de descentralização do processo decisório com vistas ao aprimoramento da gestão pública, onde se buscou combinar ajuste fiscal (eficiência orçamentária com mudança institucional (instituições voltadas para os resultados. Entretanto, o problema da falha sequencial das reformas administrativas, decorrente do dilema do controle, se constituiu no vetor de constrangimento para a implementação exitosa dessas concepções gerencialistas. Qual a natureza dos conflitos e a estratégia de ação dos policy-makers no interior da “coalizão reformadora”? Este trabalho, em uma tentativa de responder tal questão, apresenta uma abordagem analítica do dilema do controle baseada na teoria dos jogos. Objetivou-se com isto, apresentar uma formalização do problema da falha sequencial, via dilema do controle, como esforço analítico para o desenvolvimento de modelos formais para fenômenos decisórios na área das Ciências Sociais em geral, e da Ciência Política em particular.

  19. Comparação das habilidades auditivas e visuais em paralíticos cerebrais diplégicos

    Directory of Open Access Journals (Sweden)

    Dionísia Aparecida Cusin Lamônica

    2014-04-01

    Full Text Available Objetivo comparar o desempenho das habilidades psicolinguísticas auditivas e visuais de crianças com PC-D. Métodos participaram dez crianças com PC-D, classificados por meio da escala Gross Motor Function Measure System (GMFMS, de idade entre quatro anos e um mês a cinco anos e seis meses. A avaliação fonoaudiológica constou de entrevista com responsável, análise de prontuário e aplicação dos subtestes auditivos e visuais do Teste de Illinois de Habilidades Psicolinguísticas (ITPA. O tratamento estatístico constou de análise descritiva e aplicação do teste de Wilcoxon (nível de significância foi p≤ 0,05. Resultados os subtestes que obtiverem os menores escores foram na memória sequencial auditiva e memória sequencial visual. Na comparação entre as habilidades auditivas e visuais somente houve diferenças estatisticamente significante nos subtestes de recepção e associação. O grupo se comportou de forma heterogênea. Este estudo pretende chamar atenção para esta questão, pois se considera que estas habilidades são de extrema importância para o desenvolvimento das habilidades linguísticas e comunicativas que devem ser pensadas nos programas de reabilitação destes indivíduos. Conclusão houve diferenças estatisticamente significantes nos subtestes auditivos e visuais de recepção e associação nesta população.

  20. Misturas em tanque com glyphosate para o controle de trapoeraba, erva-de-touro e capim-carrapicho em soja RR®

    Directory of Open Access Journals (Sweden)

    Cleber Daniel de Goes Maciel

    2011-02-01

    Full Text Available O uso de misturas de glyphosate, em tanque, para manejo de espécies de plantas daninhas de difícil controle tem sido prática comum entre os agricultores brasileiros. Desta forma, este trabalho teve como objetivo avaliar a eficácia e seletividade de misturas, em tanque, de herbicidas com glyphosate para o controle de trapoeraba (Commelina benghalensis L., erva-de-touro (Tridax procumbens L. e capim-carrapicho (Cenchrus echinatus L. na cultura da soja RR®. O experimento foi conduzido em Maracaí, São Paulo, no período de novembro de 2006 a março de 2007, utilizando-se o cultivar CD-214RR® e delineamento experimental de blocos ao acaso, com 21 tratamentos e quatro repetições. Os tratamentos foram constituídos da aplicação de: glyphosate (180; 360; 540 e 720 g ha-1; glyphosate em sequencial (180/360; 360/360 e 540/360 g ha-1; glyphosate + chlorimuron-ethyl 360+10; 540+10; 360+5/ 360+5 g ha-1; glyphosate + lactofen (360+120; 540+120; 360+60/ 360+60 g ha-1; glyphosate + cloransulam-methyl (360+30; 540+30; 360+16,9/ 360+12,9 g ha-1; glyphosate + carfentrazone (360+4 g ha-1; glyphosate + imazethapyr (360+50 g ha-1; glyphosate + imazethapyr (177,8+30 g ha-1 e testemunhas capinada e sem capina. Apesar da similaridade de produtividade de grãos entre os tratamentos com glyphosate isolado e sequencial, nas doses 540, 720 e 540/ 360 g ha-1, as misturas em tanque com chlorimuron-ethyl, cloransulam-methyl, lactofen e imazethapyr favoreceram o controle de espécies de plantas daninhas tolerantes ao glyphosate como C. benghalensis e T. procumbens.

  1. Assessment of Safety Culture within the Pakistan Nuclear Regulatory Authority (PNRA)

    Energy Technology Data Exchange (ETDEWEB)

    Afzal, Muhammad [Pakistan Nuclear Regulatory Authority, Islamabad (Pakistan); Choi, Kwang Sik [Korea Institute of Nuclear Safety, Daejeon (Korea, Republic of)

    2015-10-15

    The objective of this study is to assess the SC of the Pakistan Nuclear Regulatory Authority (PNRA) by developing a performance indicator-based questionnaire. Aspects that potentially play important roles in developing perceptions of SC, including age, type of job, gender and duty hours of regulatory staff, are given due importance in this study. The study also identifies the strengths and weaknesses in the SC of the PNRA and can be used as a model study to assess the SC of other RBs. The questionnaire, developed to assess the SC of the PNRA, was in line with the PNRA's own defined attributes for SC. In the past, significant efforts have been made to ensure the safe operation of NPPs by improving designs and operating procedures; however, the nuclear accident at the Fukushima NPP in Japan in March 2011 revealed that the currently allotted hardware safety margins are not sufficient, and much work is needed to improve safety management in terms of SC. Initially, the concept of SC was introduced for operating organizations to ensure safe operation of NPPs; nonetheless, more recent investigations of nuclear events and accidents, especially Fukushima, and at Davis-Besse, in the US, have revealed that a strong focus is required to address and improve the SC of Regulatory Bodies (RBs). Strong SC is considered a vital tool for RBs to achieve their objectives and discharge their responsibilities in an effective and efficient manner. Though the relationship between the SC of RBs and that of operating organizations is not straight forward, it is believed that the former has a strong influence over the latter. The questionnaire was consistent in terms of the credible nature of its questions, and the response group covered different levels of PNRA staff, from managers to lower level staff. The results show that the PNRA staff have a very good understanding of the nature and significance of attributes of SC and are doing their best to exercise the same within the

  2. Roles of dopamine receptors in mediating acute modulation of immunological responses in Macrobrachium rosenbergii.

    Science.gov (United States)

    Chang, Zhong-Wen; Ke, Zhi-Han; Chang, Chin-Chyuan

    2016-02-01

    Dopamine (DA) was found to influence the immunological responses and resistance to pathogen infection in invertebrates. To clarify the possible modulation of DA through dopamine receptors (DAR) against acute environmental stress, the levels of DA, glucose and lactate in the haemolymph of Macrobrachium rosenbergii under hypo- and hyperthermal stresses were measured. The changes in immune parameters such as total haemocyte count (THC), differential haemocyte count (DHC), phenoloxidase (PO) activity, respiratory bursts (RBs), superoxide dismutase (SOD) and glutathione peroxidase (GPx) activities and phagocytic activity (PA) were evaluated in prawns which received DAR antagonists (SCH23390, SCH, D1 antagonist; domperidone, DOM, D2 antagonist; chlorpromazine, CH, D1+2 antagonist) followed by hypo- (15 °C) and hyperthermal (34 °C) stresses. In addition, pharmacological analysis of the effect DA modulation was studied in haemocytes incubated with DA and DAR antagonists. The results revealed a significant increase in haemolymph DA accompanied with upregulated levels of glucose and lactate in prawns exposed to both hypo- and hyperthermal stresses in 2 h. In addition, a significant decrease in RBs per haemocyte was noted in prawns which received DAR antagonists when they exposed to hyperthermal stress for 30 min. In in vitro test, antagonism on RBs, SOD and GPx activity of haemocytes were further evidenced through D1, D1, D1+D2 DARs, respectively, in the meantime, no significant difference in PO activity and PA was observed among the treatment groups. These results suggest that the upregulation of DA, glucose and lactate in haemolymph might be the response to acute thermal stress for the demand of energy, and the DAR occupied by its antagonistic action impart no effect on immunological responses except RBs in vivo even though the modulation mediated through D1 DAR was further evidenced in RBs, SOD and GPx activities in vitro. It is therefore concluded that thermal

  3. Impacto do glyphosate associado com endossulfan e tebuconazole sobre microrganismos endossimbiontes da soja Impact of glyphosate associated with endosulphan and tebuconazole on the endosymbiotic microorganisms of the soybean

    Directory of Open Access Journals (Sweden)

    M.R. Reis

    2010-01-01

    Full Text Available Objetivou-se neste trabalho avaliar o efeito do glyphosate, em aplicação sequencial, e da sua interação com endossulfan + tebuconazole na colonização micorrízica, na nodulação e nos teores de fósforo e nitrogênio foliar em plantas de soja. O experimento foi conduzido a campo em Argissolo Vermelho-Amarelo câmbico, no ano agrícola de 2007/08. Foram avaliados dez tratamentos em em esquema de parcelas subdivididas, no delineamento de blocos casualizados, com quatro repetições. Nas parcelas, avaliou-se o efeito da aplicação ou não da mistura de inseticida (endossulfan + fungicida (tebuconazole e, nas subparcelas, o efeito dos métodos de controle de plantas daninhas (testemunha não capinada, testemunha capinada, aplicação única de glyphosate, aplicação sequencial de glyphosate e aplicação única de fomesafen + fluazifop-p-butil. A matéria seca de nódulos (MSN e da parte aérea (MSPA, o número de nódulos (NN, a colonização micorrízica e os teores de N e P foliar foram avaliados quando as plantas de soja atingiram o estádio R2. O glyphosate e fomesafen + fluazifop-p-butil não reduziram a MSN de plantas de soja, exceto na presença de endossulfan + tebuconazole. O glyphosate em aplicação sequencial, na ausência de endossulfan + tebuconazole, reduziu o NN das plantas de soja em relação às plantas tratadas com inseticida + fungicida. A mistura fomesafen + fluazifop-p-butil e o glyphosate em aplicação sequencial afetaram negativamente os teores de N foliar em relação à testemunha capinada na ausência de endossulfan + tebuconazole, enquanto que na presença dessa mistura não se observou efeito. O glyphosate não afetou a colonização micorrízica em soja tratada ou não com a mistura endossulfan + tebuconazole. Já a mistura de fomesafen + fluazifop-p-butil estimulou a colonização micorrízica na ausência da mistura endossulfan + tebuconazole. O glyphosate, em aplicação sequencial, não afetou a coloniza

  4. Chemical bath deposition of indium sulphide thin films: preparation and characterization

    Energy Technology Data Exchange (ETDEWEB)

    Lokhande, C.D.; Ennaoui, A.; Patil, P.S.; Giersig, M.; Diesner, K.; Muller, M.; Tributsch, H. [Hahn-Meitner-Institut Berlin GmbH (Germany). Bereich Physikalische Chemie

    1999-02-26

    Indium sulphide (In{sub 2}S{sub 3}) thin films have been successfully deposited on different substrates under varying deposition conditions using chemical bath deposition technique. The deposition mechanism of In{sub 2}S{sub 3} thin films from thioacetamide deposition bath has been proposed. Films have been characterized with respect to their crystalline structure, composition, optical and electrical properties by means of X-ray diffraction, TEM, EDAX, optical absorption, TRMC (time resolved microwave conductivity) and RBS. Films on glass substrates were amorphous and on FTO (flourine doped tin oxide coated) glass substrates were polycrystalline (element of phase). The optical band gap of In{sub 2}S{sub 3} thin film was estimated to be 2.75 eV. The as-deposited films were photoactive as evidenced by TRMC studies. The presence of oxygen in the film was detected by RBS analysis. (orig.) 27 refs.

  5. Trace element determination in tomato puree using particle induced X-ray emission and Rutherford backscattering

    International Nuclear Information System (INIS)

    Romero-Davila, E.; Miranda, J.

    2004-01-01

    Particle induced X-ray emission (PIXE) and Rutherford backscattering spectrometry (RBS) were used to determine the concentrations of trace elements in samples of 12 tomato puree brands sold in the Mexican market. While RBS offered information about the main elements present in the matrix, PIXE gave results on trace elements. As a whole, data for 17 elements (C, N, O, Na, Mg, S, Cl, K, Ca, Ti, V, Cr, Mn, Fe, Ni, Cu, and Zn) were obtained. To evaluate the results, a comparison with brands from USA, Japan, Colombia, and Chile was carried out, using tomato purees produced following the domestic technology recipe. Additionally, the results were considered in the light of the Codex Alimentarius and the Mexican standard. It was found that all of the brands fall within the limits established by these standards, being of the same order of magnitude as the foreign brands. (author)

  6. How journalism contributes to reproduce inequalities: an ethnographic study about news production

    Directory of Open Access Journals (Sweden)

    Marcia Veiga da Silva

    2011-12-01

    Full Text Available This article analyzes the data originated in a research carried out in order to cast some light on the participation of journalism in shaping values that create stereotypes and social inequalities. The research investigated how these values are formed and how they evolve. Through an ethnographic method, all the stages of the news production of a news broadcast were monitored along 11 weeks. The program is regularly broadcast by RBS TV, which belongs to Grupo RBS, the biggest communication conglomerate in Southern Brazil. Analyzing the daily routine of the journalists, with focus on the relationships they keep among themselves, and also on the productive routines, the study reached the conclusion that heterosexuality was a normative pattern that guided their personal and professional values in the decision-taking process, which resulted in presentations marked by hegemonic social values that reinforce hierarchies and inequalities from some social markers

  7. Formation and characterization of ZnO : Tm+ optical waveguides fabricated by Tm+ and O+ ion implantation

    International Nuclear Information System (INIS)

    Ming Xianbing; Lu Fei; Liu Hanping; Chen Ming; Wang Lei

    2009-01-01

    Planar optical waveguides were formed in ZnO crystal by Tm + and O + ion implantation. The distributions of Tm + in as-implanted and annealed ZnO samples were investigated by the RBS technique. A shift of the Tm + peak towards the sample surface and out diffusion were observed after thermal treatment and subsequent O + ion implantation. Waveguide formation was determined after O + implantation in Tm + -implanted ZnO crystal. By using the prism-coupling method two guided modes were detected. The refractive index profile in the implanted waveguide was reconstructed according to the SRIM and RCM simulation. The RBS/channelling measurements show that the lattice structure of ZnO did not suffer detectable damage after O + implantation.

  8. Bovine Blood Constituents as Fat Replacers in Ham Pâté

    Directory of Open Access Journals (Sweden)

    Fabiana Ribeiro Viana

    2004-01-01

    Full Text Available Some tests were carried out in this work with the aim of evaluating a partial replacement of fat in the raw batter of ham pâté by using bovine blood constituents, such as globin (GL, plasma (PL or 1:1 globin and plasma (GP. Plasma was separated from red cells by blood centrifugation, and globin was extracted by the carboxymethylcellulose method. The salt-soluble protein content (SSP and the binding properties including water holding capacity (WHC and raw batter stability (RBS were estimated. The results indicated that among the 3 treatments studied, the use of globin showed to be a little more advantageous for the quality of the raw batter of ham pâté, since its incorporation as fat replacer led to an increase in RBS but no change of SSP was observed.

  9. Industrial oriented research at Ljubljana Tandetron Facility

    International Nuclear Information System (INIS)

    Pelicon, P.; Simcic, J.; Razpet, A.; Budnar, M.

    2001-01-01

    Full text: Galvanization is the cheapest and the most frequently used industrial coating technique. The diagnostics of usually thick deposited layers is rather time consuming and expensive, when surface layers have to be removed to obtain depth concentration profiles. Proton- impact RBS exhibits both large range and sufficient depth resolution for efficient and cost-effective depth profiling. Several galvanic coatings, composed of Sn/Cu/Ni/Graphite layers were analyzed by current-normalized RBS. 3 MeV protons were used to enable detection range of up to 25 micrometers. SIMNRA code was used to analyze the spectra. The depth concentration profiles obtained enable the control of annealing to obtain proper concentration mixing at the interfaces. In this way, the melting point of the upper layer for contact welding and wear hardness could be optimized. (author)

  10. Implementation of ionoluminescence in the AGLAE scanning external microprobe

    International Nuclear Information System (INIS)

    Pichon, L.; Calligaro, T.; Gonzalez, V.; Lemasson, Q.; Moignard, B.; Pacheco, C.

    2015-01-01

    The scope of this work is to present the implementation of an IBIL imaging system in the scanning external microprobe of the AGLAE facility so as to correlate luminescence and composition maps provided by PIXE, RBS and PIGE. The challenging integration of the optical spectrometer, due to incompatibility of acquisition timings and data formats with the other IBA channels has motivated the development of a specific acquisition system. This article details the IBIL setup and explains the technical solutions retained for the coupling of IBIL with IBA techniques in order to produce fast and large IBIL-IBA maps. The IBIL maps stored in the same format as the PIXE, RBS and PIGE ones can be visualised and compared using the dedicated AGLAEmap program or the PyMCA processing package. An example of such a coupled mapping on Mesoamerican jade is presented to emphasise the interest of performing simultaneously IBA and IBIL large mappings

  11. Nuclear microscopy in medical research. Investigations into degenerative diseases

    Energy Technology Data Exchange (ETDEWEB)

    Makjanic, J.; Thong, P.; Watt, F. [National University of Singapore (Singapore). Dept. of Physics

    1997-03-01

    The high energy (1-4MeV) focused ion beam (nuclear microbeam) has found uses in many scientific disciplines through a wide variety of ion beam based techniques. Of the many techniques available, the powerful combination of Particle Induced X-Ray Emission (PIXE), Rutherford Backscattering Spectrometry (RBS), and Scanning Transmission Ion Microscopy (STIM) is proving to be extremely useful, particularly in the characterisation and elemental analysis of thin specimens. In this paper we briefly review these ion beam techniques, as well as the hardware required for their application. Finally, we describe the application of the PIXE, RBS and STIM techniques in conjunction with a scanning focused 2MeV proton microbeam (nuclear microscopy). The examples chosen to illustrate the potential of nuclear microscopy are recent investigations into the degenerative diseases atherosclerosis (coronary heart disease), Parkinson`s disease and Alzheimer`s disease. (author)

  12. Ion beam-based studies for tribological phenomena

    Science.gov (United States)

    Racolta, P. M.; Popa-Simil, L.; Alexandreanu, B.

    1996-06-01

    Custom-designed experiments based on the Thin Layer Activation technique (TLA) were completed, providing information on the wear level of some engine components with additional data on transfer and adhesion of material between metallic friction couples using the RBS method. RBS experimental results concerning material transfer for a steel-brass friction couple are presented and discussed in the paper. Also, the types and concentrations of the wear products in used lubricant oils were determined by in-air PIXE. A sequential lubricant filtering-based procedure for determining the dimension distribution of the resulting radioactive wear particles by low level γ-spectrometry is presented. Experimental XRF spectra showing the non-homogeneous distribution of the retained waste particles on the filtering paper are shown.

  13. Effects of high-energy (MeV) ion implantation of polyester films

    International Nuclear Information System (INIS)

    Ueno, Keiji; Matsumoto, Yasuyo; Nishimiya, Nobuyuki; Noshiro, Mitsuru; Satou, Mamoru

    1991-01-01

    The effects of high-energy ion beam irradiation on polyester (PET) films using a 3 MeV tandem-type ion beam accelerator were studied. O, Ni, Pt, and Au as ion species were irradiated at 10 14 -10 15 ions/cm 2 on 50 μm thick PET films. Physical properties and molecular structure changes were studied by the surface resistivity measurements and RBS. The surface resistivity decreases with an increase in irradiation dose. At 10 15 ions/cm 2 irradiation, the surface resistivity is 10 8 Ω/□. According to RBS and XPS analyses, some carbon and oxygen atoms in the PET are replaced by implanted ions and the -C=O bonds are destroyed easily by the ion beam. (orig.)

  14. Ion beam analysis of pottery from Teotihuacan, Mexico

    International Nuclear Information System (INIS)

    Ontalba Salamanca, M.A.; Ruvalcaba-Sil, J.L.; Bucio, L.; Manzanilla, L.; Miranda, J.

    2000-01-01

    This work presents the characterization of sherds and pottery paints from Teotihuacan, Mexico, belonging to the Mesoamerican Epiclassic (700-900 AD) and Postclassic (900-1521 AD) periods. A simultaneous analysis by Particle Induced X-ray Emission (PIXE) and Rutherford Backscattering Spectroscopy (RBS) was carried out to measure the elemental composition of pottery and clays sources of the Teotihuacan region. Also, a semiquantitative X-Ray Diffraction study (XRD) was performed to determine the mineralogical phases. From elemental and mineralogical composition, groups of local and foreign sherds were established. Results showed that the PIXE-RBS method combined with XRD proved to be a very powerful and general procedure for archaeological characterization. Moreover, non-vacuum differential PIXE analysis was carried out on colored regions of some representative vessels to study the layered structure of the paints-clay system

  15. Ion beam analysis of pottery from Teotihuacan, Mexico

    Energy Technology Data Exchange (ETDEWEB)

    Ontalba Salamanca, M.A. E-mail: ontalba@cica.es; Ruvalcaba-Sil, J.L.; Bucio, L.; Manzanilla, L.; Miranda, J

    2000-03-01

    This work presents the characterization of sherds and pottery paints from Teotihuacan, Mexico, belonging to the Mesoamerican Epiclassic (700-900 AD) and Postclassic (900-1521 AD) periods. A simultaneous analysis by Particle Induced X-ray Emission (PIXE) and Rutherford Backscattering Spectroscopy (RBS) was carried out to measure the elemental composition of pottery and clays sources of the Teotihuacan region. Also, a semiquantitative X-Ray Diffraction study (XRD) was performed to determine the mineralogical phases. From elemental and mineralogical composition, groups of local and foreign sherds were established. Results showed that the PIXE-RBS method combined with XRD proved to be a very powerful and general procedure for archaeological characterization. Moreover, non-vacuum differential PIXE analysis was carried out on colored regions of some representative vessels to study the layered structure of the paints-clay system.

  16. An ASEAN Ion Beam Analysis Center at Chiang Mai University, Thailand

    International Nuclear Information System (INIS)

    Tippawan, U.; Kamwann, T.; Yu, L.D.; Intarasiri, S.; Puttaraksa, N.; Unai, S.; Thongleurm, C.; Singkarat, S.

    2014-01-01

    To contribute to the development of nuclear science and technology in Thailand, a comprehensive ion beam analysis center unique in the ASEAN region has recently been established at Chiang Mai University, Thailand. The center is equipped with a 1.7-MV Tandetron tandem accelerator with an ion beam analysis beam line. The beam line is currently capable of performing ion beam analysis techniques such as Rutherford Backscattering Spectrometry (RBS), RBS/channeling, Elastic BackScattering (EBS), Particle Induced X-ray Emission (PIXE) and Ionoluminescence (IL) with assistance of commercial and in-house-developed softwares. Micro ion beam for MeV-ion mapping using programmable aperture or capillary focusing techniques is being developed. Ion beam analysis experiments and applications have been vigorously developed, especially for novel materials analysis focused on archeological, gemological and biological materials besides other conventional materials.

  17. Ion beam studies of hydrogen implanted Si wafers

    International Nuclear Information System (INIS)

    Nurmela, A.; Henttinen, K.; Suni, T.; Tolkki, A.; Suni, I.

    2004-01-01

    We have studied silicon-on-insulator (SOI) materials with two different ion beam analysis methods. The SOI samples were implanted with boron and hydrogen ions. After implantation the wafers were annealed, and some of them were bonded to thermally oxidized silicon wafers. The damage in silicon single crystal due to ion implantations has been studied by Rutherford Backscattering in the channeling mode (RBS/C). The content of the ion-implanted hydrogen has been studied by elastic recoil detection analysis (ERDA) method. The strength of the implanted region after thermal annealings were measured with the crack opening method. The boron implantation before hydrogen implantation resulted to shallower implantation depth and lower splitting temperature than in samples implanted with hydrogen only. The boron implantation after hydrogen implantation did not influence the splitting temperature and RBS spectra showed that B implantation drove the H deeper to the sample

  18. Use of Rutherford Backscattering to determine uranium deposit uniformity

    International Nuclear Information System (INIS)

    Wasson, O.A.; Schrack, R.A.

    1988-01-01

    A Rutherford Backscattering (RBS) facility has been established at the 3-MV positive-ion accelerator at the National Bureau of Standards. This facility has been used to study the areal density distribution of uranium deposits used in neutron cross section measurements. A versatile scattering chamber with numerous ports, five-axis goniometer, target ladder, and solid state detector is in operation. Beams of 1 MeV He + ions and 5 MeV He ++ ions are available. The variation in areal density of a 75 cm diameter UO 2 deposit was measured using a 1 MeV He + beam. The results are in excellent agreement with those obtained from alpha-particle activity measurements. However, the RBS measurements provide better definition of the uniformity near the edge of the deposits. Our experience in the use of these two methods to characterize the areal densities of deposits for cross section measurements will be presented. (author). Abstract only

  19. Exploring advantages of 4He-PIXE analysis for layered objects in cultural heritage

    International Nuclear Information System (INIS)

    Roehrs, S.; Calligaro, T.; Mathis, F.; Ortega-Feliu, I.; Salomon, J.; Walter, P.

    2006-01-01

    In the field of cultural heritage 4 He particle beams are often used to perform RBS analysis. In most cases the simultaneously produced X-rays are not considered for PIXE analysis. This paper aims to explore the potentials of 4 He induced X-ray emission (α-PIXE) using 4, 5 and 6 MeV 4 He beams and to compare its performance with that of conventional PIXE with 3 MeV protons. The α-PIXE and α-RBS spectra were collected at the same time in a vacuum chamber. The X-ray yields produced by 6 MeV 4 He beam for K-lines were found to be superior to those of protons for atomic numbers below 25. An additional advantage of α-PIXE is the lower bremsstrahlung background which leads to an improved peak to noise ratio for certain elements

  20. IBA of iridescent Art Nouveau glass - comparative studies

    International Nuclear Information System (INIS)

    Maeder, M.; Jembrih-Simbuerger, D.; Neelmeijer, C.; Schreiner, Manfred

    2005-01-01

    Simultaneous PIXE, PIGE, and RBS in air were employed to characterise the surface structure of iridescent Art Nouveau glass artefacts produced around 1900 by Tiffany, USA and Loetz, Austria. Using PIXE and PIGE, the chemical composition of the bulk glass and the overlays was determined in a non-destructive manner. Furthermore, the combination of PIXE and RBS enabled the layer structure of the analysed glasses (bulk, overlays, and iridescent layers) and the thicknesses of the thin layers in the near-surface domain to be determined. The measurement and evaluation procedure is demonstrated on blue iridescent glass fragments of Tiffany and Loetz by way of example. The initial results showing similarities but also differences in the layered glass structure of Tiffany and Loetz objects are presented

  1. Building a fingerprint database for modern art materials: PIXE analysis of commercial painting and drawing media

    Energy Technology Data Exchange (ETDEWEB)

    Zucchiatti, A., E-mail: alessandro.zucchiatti@uam.es [Centro de Micro Análisis de Materiales, Universidad Autónoma de Madrid, C/ Faraday 3, Madrid (Spain); Climent-Font, A. [Centro de Micro Análisis de Materiales, Universidad Autónoma de Madrid, C/ Faraday 3, Madrid (Spain); Departamento de Física Aplicada, Universidad Autónoma de Madrid, Avda. Francisco Tomás y Valiente 7, 28049 Madrid (Spain); Gómez-Tejedor, J. García [Museo Nacional Centro de Arte Reina Sofia, Departamento de Restauración, Calle Santa Isabel, 52, 28012 Madrid (Spain); Martina, S. [Centro de Micro Análisis de Materiales, Universidad Autónoma de Madrid, C/ Faraday 3, Madrid (Spain); Universitá degli Studi di Torino, Turin (Italy); Muro García, C.; Gimeno, E.; Hernández, P.; Canelo, N. [Museo Nacional Centro de Arte Reina Sofia, Departamento de Restauración, Calle Santa Isabel, 52, 28012 Madrid (Spain)

    2015-11-15

    We have examined by PIXE (and by RBS in parallel) about 180 samples of commercial painting and drawing media including pencils, pastels, waxes, inks, paints and paper. Given the high PIXE sensitivity we produced X-ray spectra at low collected charges and currents, operating in good conservation conditions. For drawing media containing inorganic components or a unique marker element, we have defined colouring agent fingerprints which correspond, when applicable, to the composition declared by the manufacturer. For thin layers, the ratios of areal densities of elements are close to those expected given the declared composition, which is promising from the perspective of compiling the database. The quantitative PIXE and RBS analysis of part of the set of samples is provided.

  2. Sputtering and coloration process in LiF thin layers induced by MeV ion bombardment

    Science.gov (United States)

    Cremona, M.; Pereira, J. A. M.; Mauricio, M. H. P.; Carmo, L. C. Scavarda Do; Somma, F.

    Beams of 2.0 MeV nitrogen ions, produced by a Van de Graaff generator, were used in order to create point defects in polycrystalline LiF thin films. The radiation effects were examined by optical absorption, RBS, PDMS and XPS methods. The concentration of the produced F-centers exhibits a saturation behavior, but decreases for doses higher than ˜ 1 × 1016 cm-2. A fluorine sputtering yield Y ˜ 3 was determined by using RBS. Moreover, XPS and PDMS techniques detected surface Li enrichment as a result of the ion bombardment. All these results denote the relevance of the sputtering in the de-coloration process of LiF thin layers.

  3. Self-consistent depth profiling and imaging of GaN-based transistors using ion microbeams

    Energy Technology Data Exchange (ETDEWEB)

    Redondo-Cubero, A., E-mail: andres.redondo@uam.es [IPFN, Instituto Superior Técnico, Campus Tecnológico e Nuclear, Universidade de Lisboa, 2686-953 Bobadela (Portugal); Departamento de Física Aplicada y Centro de Micro-Análisis de Materiales, Universidad Autónoma de Madrid, 28049 Madrid (Spain); Corregidor, V. [IPFN, Instituto Superior Técnico, Campus Tecnológico e Nuclear, Universidade de Lisboa, 2686-953 Bobadela (Portugal); Vázquez, L. [Instituto de Ciencia de Materiales de Madrid, Consejo Superior de Investigaciones Científicas, 28049 Madrid (Spain); Alves, L.C. [C2TN, Instituto Superior Técnico, Campus Tecnológico e Nuclear, Universidade de Lisboa, 2686-953 Bobadela (Portugal)

    2015-04-01

    Using an ion microprobe, a comprehensive lateral and in-depth characterization of a single GaN-based high electron mobility transistor is carried out by means of Rutherford backscattering spectrometry (RBS) in combination with particle induced X-ray emission (PIXE). Elemental distribution was obtained for every individual section of the device (wafer, gate and source contact), identifying the basic constituents of the transistor (including the detection of the passivant layer) and checking its homogeneity. A self-consistent analysis of each individual regions of the transistor was carried out with a simultaneous fit of RBS and PIXE spectra with two different beam conditions. Following this approach, the quantification of the atomic content and the layer thicknesses was successfully achieved overcoming the mass-depth ambiguity of certain elements.

  4. Report on the Acadiana Research Laboratory nuclear microprobe system

    Science.gov (United States)

    Glass, Gary A.; Hollerman, William A.; Hynes, Shelly F.; Fournet, Justin; Bailey, Alan M.; Liao, Changgeng

    2001-07-01

    The Acadiana Research Laboratory of the University of Louisiana at Lafayette provides high energy ion beams for materials research. Major components of the ion beam systems include a National Electrostatics Corporation (NEC) 1.7 MV tandem Pelletron accelerator system with both SNICS and RF ion sources and a Varian CF-4 200 kV implanter. The NEC Pelletron has three operational beamlines that provide a wide range of capabilities for materials modification and analysis, including such techniques as PIXE, PIGE, RBS, RFS, TOF-ERDA and ion implantation. An Oxford Microbeams Ltd. microprobe system was recently declared operational with the attainment of a 1.5 μm×2.0 μm beam spot size. Microprobe techniques presently available include μPIXE, μRBS and scanning transmission ion microscopy (STIM).

  5. The effects of automated scatter feeders on captive grizzly bear activity budgets.

    Science.gov (United States)

    Andrews, Nathan L P; Ha, James C

    2014-01-01

    Although captive bears are popular zoo attractions, they are known to exhibit high levels of repetitive behaviors (RBs). These behaviors have also made them particularly popular subjects for welfare research. To date, most research on ursid welfare has focused on various feeding methods that seek to increase time spent searching for, extracting, or consuming food. Prior research indicates an average of a 50% reduction in RBs when attempts are successful and, roughly, a 50% success rate across studies. This research focused on decreasing time spent in an RB while increasing the time spent active by increasing time spent searching for, extracting, and consuming food. The utility of timed, automated scatter feeders was examined for use with captive grizzly bears (Ursis arctos horribilis). Findings include a significant decrease in time spent in RB and a significant increase in time spent active while the feeders were in use. Further, the bears exhibited a wider range of behaviors and a greater use of their enclosure.

  6. A comparison of repetitive behaviors in Aspergers Disorder and high functioning autism.

    Science.gov (United States)

    Cuccaro, Michael L; Nations, Laura; Brinkley, Jason; Abramson, Ruth K; Wright, Harry H; Hall, Alicia; Gilbert, John; Pericak-Vance, Margaret A

    2007-04-01

    In this study we compared 33 IQ and age matched pairs of individuals with Aspergers Disorder (ASP) and high functioning autism (HFA) on measures of repetitive behavior. On the Repetitive Behavior Scale-Revised (RBS-R), the ASP and HFA groups showed no differences in RBS-R Intensity score (severity) score or Frequency score (number of problems present). This suggests that the two groups are similar with respect to the intensity or severity of repetitive behaviors and the presence of repetitive behaviors. At the item level there were no differences on scales typically associated with autism (Stereotyped Behavior) and ASP (Restricted Interests). Similarly, there were no differences between the groups on the Aberrant Behavior Checklist Stereotypy scale. These findings add to the body of literature showing that HFA and ASP fail to differ with respect to repetitive behaviors. The implications of the findings for neurobiologic and genetic studies are discussed.

  7. Au-nanoparticles grafted on plasma treated PE

    International Nuclear Information System (INIS)

    Svorcik, V.; Chaloupka, A.; Rezanka, P.; Slepicka, P.; Kolska, Z.; Kasalkova, N.; Hubacek, T.; Siegel, J.

    2010-01-01

    Polyethylene (PE) surface was treated with Ar plasma. Activated surface was grafted from methanol solution of 1,2-ethanedithiol. Then the sample was immersed into freshly prepared colloid solution of Au-nanoparticles. Finally Au layer was sputtered on the samples. Properties of the modified PE were studied using various methods: AFM, EPR, RBS and nanoindentation. It was shown that the plasma treatment results in degradation of polymer chain (AFM) and creation of free radicals by EPR. After grafting with dithiol, the concentration of free radicals declines. The presence of Au and S in the surface layer after the coating with Au-nanoparticles was proved by RBS. Plasma treatment changes PE surface morphology and increases surface roughness, too. Another significant change in surface morphology and roughness was observed after deposition of Au-nanoparticles. Nanoindentation measurements show that the grafting with Au-nanoparticles increases adhesion of subsequently sputtered Au layer.

  8. Ion beam induced luminescence from diamond using an MeV ion microprobe

    Energy Technology Data Exchange (ETDEWEB)

    Bettiol, A.A.; Jamieson, D. N.; Prawer, S.; Allen, M.G. [Melbourne Univ., Parkville, VIC (Australia). School of Physics

    1993-12-31

    Analysis of the luminescence induced by a MeV ion beam offers the potential to provide useful information about the chemical properties of atoms in crystals to complement the information provided by more traditional Ion Beam Analysis (IBA) such as Rutherford Backscattering Spectrometry (RBS), ion channeling and Particle Induced X-ray Emission (PIXE). Furthermore, the large penetration depth of the MeV ion beam offers several advantages over the relatively shallow penetration of keV electrons typically employed in cathodoluminescence. An Ion Beam Induced Luminescence (IBIL) detection system was developed for the Melbourne microprobe that allows the spatial mapping of the luminescence signal along with the signals from RBS and PIXE. Homoepitaxial diamond growth has been studied and remarkable shifts in the characteristic blue luminescence of diamond towards the green were observed in the overgrowth. This has been tentatively identified as being due to transition metal inclusions in the epitaxial layers. 8 refs., 2 refs.

  9. Selective Rutherford backscattering techniques in the study of transition-metal implanted YBa{sub 2}C{sub 3}O{sub 7-{delta}}

    Energy Technology Data Exchange (ETDEWEB)

    Martin, J.W.; Russell, G.J. [New South Wales Univ., Kensington, NSW (Australia). School of Physics; Cohen, D.D.; Evans, P.J. [Australian Nuclear Science and Technology Organisation, Lucas Heights, NSW (Australia)

    1993-12-31

    Using a metal-vapor vacuum arc ion source, several as-grown, large single crystal YBa{sub 2}Cu{sub 3}O{sub 7-{delta}} were implanted with a dose of 1x10{sup 17} zinc, nickel and iron ions. After implantation the crystal was subjected to two anneal cycles that has allowed to examine crystal structure, superconducting transitions and composition, through X-ray diffraction, rutherford backscattering spectroscopy (RBS) and AC susceptibility measurements respectively. Although RBS discriminates strongly against light elements, such as oxygen, the use of resonant reaction {sup 16}O ({alpha}, {alpha}){sup 16}O at 3.4 MeV was beneficial, as its cross section is nearly 23 times that of the rutherford cross section. 4 figs.

  10. Heavy ion time-of-flight ERDA of high dose metal implanted germanium

    Energy Technology Data Exchange (ETDEWEB)

    Dytlewski, N.; Evans, P.J.; Noorman, J.T. [Australian Nuclear Science and Technology Organisation, Lucas Heights, NSW (Australia); Wielunski, L.S. [Commonwealth Scientific and Industrial Research Organisation (CSIRO), Lindfield, NSW (Australia). Div. of Applied Physics; Bunder, J. [New South Wales Univ., Wollongong, NSW (Australia). Wollongong Univ. Coll

    1996-12-31

    With the thick Ge substrates used in ion implantation, RBS can have difficulty in resolving the mass-depth ambiguities when analysing materials composed of mixtures of elements with nearly equal masses. Additional, and complimentary techniques are thus required. This paper reports the use of heavy ion time-of-flight elastic recoil detection analysis (ToF- ERDA), and conventional RBS in the analysis of Ge(100) implanted with high dose Ti and Cu ions from a MEWA ion source . Heavy ion ToF ERDA has been used to resolve, and profile the implanted transition metal species, and also to study any oxygen incorporation into the sample resulting from the implantation, or subsequential reactions with air or moisture. This work is part of a study on high dose metal ion implantation of medium atomic weight semiconductor materials. 13 refs., 6 figs.

  11. Inspection of Emergency Arrangements

    International Nuclear Information System (INIS)

    2013-01-01

    The Working Group on Inspection Practices (WGIP) was tasked by the NEA CNRA to examine and evaluate the extent to which emergency arrangements are inspected and to identify areas of importance for the development of good inspection practices. WGIP members shared their approaches to the inspection of emergency arrangements by the use of questionnaires, which were developed from the requirements set out in IAEA Safety Standards. Detailed responses to the questionnaires from WGIP member countries have been compiled and are presented in the appendix to this report. The following commendable practices have been drawn from the completed questionnaires and views provided by WGIP members: - RBs and their Inspectors have sufficient knowledge and information regarding operator's arrangements for the preparedness and response to nuclear emergencies, to enable authoritative advice to be given to the national coordinating authority, where necessary. - Inspectors check that the operator's response to a nuclear emergency is adequately integrated with relevant response organisations. - Inspectors pay attention to consider the integration of the operator's response to safety and security threats. - The efficiency of international relations is checked in depth during some exercises (e.g. early warning, assistance and technical information), especially for near-border facilities that could lead to an emergency response abroad. - RB inspection programmes consider the adequacy of arrangements for emergency preparedness and response to multi-unit accidents. - RBs assess the adequacy of arrangements to respond to accidents in other countries. - The RB's role is adequately documented and communicated to all agencies taking part in the response to a nuclear or radiological emergency. - Inspectors check that threat assessments for NPPs have been undertaken in accordance with national requirements and that up-to-date assessments have been used as the basis for developing emergency plans for

  12. Air Force Reusable Booster System A Quick-look, Design Focused Modeling and Cost Analysis Study

    Science.gov (United States)

    Zapata, Edgar

    2011-01-01

    Presents work supporting the Air force Reusable Booster System (RBS) - A Cost Study with Goals as follows: Support US launch systems decision makers, esp. in regards to the research, technology and demonstration investments required for reusable systems to succeed. Encourage operable directions in Reusable Booster / Launch Vehicle Systems technology choices, system design and product and process developments. Perform a quick-look cost study, while developing a cost model for more refined future analysis.

  13. Effect of current density and behaviour of second phases in anodizing of a Mg-Zn-RE alloy in a fluoride/glycerol/water electrolyte

    Czech Academy of Sciences Publication Activity Database

    Němcová, A.; Kuběna, Ivo; Šmíd, Miroslav; Habazaki, H.; Skeldon, P.; Thompson, G.

    2016-01-01

    Roč. 20, č. 4 (2016), s. 1155-1165 ISSN 1432-8488 R&D Projects: GA MŠk(CZ) ED1.1.00/02.0068 Institutional support: RVO:68081723 Keywords : magnesium * anodizing * anodic film * TEM * RBS Subject RIV: JK - Corrosion ; Surface Treatment of Materials Impact factor: 2.316, year: 2016 http://link.springer.com/article/10.1007/s10008-015-2864-1

  14. Co-digestion of wheat and rye bread suspensions with source-sorted municipal biowaste

    Energy Technology Data Exchange (ETDEWEB)

    Li, Chaoran, E-mail: Chaoran.Li3@kit.edu [Karlsruhe Institute of Technology (KIT), Institute of Biology for Engineers and Biotechnology of Wastewater, Am Fasanengarten, D-76128 Karlsruhe (Germany); Mörtelmaier, Christoph, E-mail: Christoph.Moertelmaier@kit.edu [Karlsruhe Institute of Technology (KIT), Institute of Biology for Engineers and Biotechnology of Wastewater, Am Fasanengarten, D-76128 Karlsruhe (Germany); Winter, Josef, E-mail: Josef.Winter@kit.edu [Karlsruhe Institute of Technology (KIT), Institute of Biology for Engineers and Biotechnology of Wastewater, Am Fasanengarten, D-76128 Karlsruhe (Germany); Gallert, Claudia, E-mail: Claudia.Gallert@HS-Emden-Leer.de [Karlsruhe Institute of Technology (KIT), Institute of Biology for Engineers and Biotechnology of Wastewater, Am Fasanengarten, D-76128 Karlsruhe (Germany); University of Applied Science, Hochschule Emden-Leer, Faculty of Technology, Division Microbiology – Biotechnology, Constantiaplatz 4, D-26723 Emden (Germany)

    2015-06-15

    Graphical abstract: Volatile fatty acid spectra of acidified WBS, RBS or FBS differ, but methanogenesis is similar. Display Omitted - Highlights: • Biogas improvement by co-digestion of wheat and rye bread. • Increased population density at high organic loading rates. • Less Pelotomaculum but increased numbers of Syntrophobacter and Smithella found in rye bread reactor. • Replacement of Methanosarcinales by acetate-oxidizers in rye bread co-digestion. • Increasing proportion of Methanomicrobiales in biowaste + rye bread reactor. - Abstract: Acidification of wheat bread (WBS), rye bread (RBS) and fresh biowaste suspensions (FBS), leading to lactate+acetate, lactate+acetate+n-buyrate, and acetate+propionate+n-butyrate, respectively, and biogas production as well as population dynamics were investigated. Co-fermentation of FBS (14 kg m{sup −3} d{sup −1} organic loading rate (OLR)) with WBS or RBS was stable up to an OLR of 22 kg m{sup −3} d{sup −1} and resulted in up to 3 times as much biogas. During co-fermentation at more than 20 kg m{sup −3} d{sup −1} OLR the total population increased more than 2-fold, but the originally low share of propionate-oxidizing bacteria significantly decreased. The proportion of methanogens also decreased. Whereas the proportion of Methanosarcinales to Methanomicrobiales in biowaste and biowaste+WBS remained constant, Methanosarcinales and in particular Methanosaeta spec. in the biowaste+RBS assay almost completely disappeared. Methanomicrobiales increased instead, indicating propionate oxidation via acetate cleavage to CO{sub 2} and hydrogen.

  15. Ion-beam assisted deposition of C-, Ti-, Zr-, Mo-based thin films on silicon substrate

    International Nuclear Information System (INIS)

    Tashlykov, I.S.; Vesh, V.; Vendler, Eh.

    2004-01-01

    With the help pf RBS/channeling method and scattering spectrum computer simulation C-, Ti-, Zr- and Mo-based coatings deposited by ion beam assisted deposition technique on Si substrate have been investigated. Si, O, C, and H atoms were found to be incorporated into the coatings composition. Radiation damage of silicon near the coating-substrate interface region does not depend on the mass of bombarding ions [ru

  16. Chemistry of plasma-polymerized vinyltriethoxysilane controlled by deposition conditions

    Czech Academy of Sciences Publication Activity Database

    Čech, V.; Zemek, Josef; Peřina, Vratislav

    2008-01-01

    Roč. 5, č. 8 (2008), s. 745-752 ISSN 1612-8850 Grant - others:GAČR(CZ) GA104/06/0437 Institutional research plan: CEZ:AV0Z10100521; CEZ:AV0Z10480505 Keywords : ESCA/XPS * FTIR * plasma-enhanced chemical vapor deposition (PECVD) * Rutherford back-scattering (RBS) * thin films Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 2.921, year: 2008

  17. 40Ar-39Ar age of carbonatite-alkaline magmatism in Sung Valley ...

    Indian Academy of Sciences (India)

    40Ar-39Ar analyses of one alkali pyroxenite whole rock and two phlogopite separates of calcite carbonatites from the Sung Valley carbonatite-alkaline complex, which is believed to be a part of the Rajmahal-Bengal-Sylhet (RBS) ood basalt province, yielded indistinguishable plateau ages of 108.8 ± 2.0 Ma, 106:4 ± 1.3 Ma ...

  18. Uniform-large Area BaSrTiO3 Growth and Novel Material Designs to Enable Fabrication of High Quality, Affordable, and Performance Consistent Phase Shifters for OTM Phased Array Antennas

    Science.gov (United States)

    2012-07-11

    Washington Headquarters Services , Directorate for Information Operations and Reports, 1215 Jefferson Davis Highway, Suite 1204, Arlington VA, 22202-4302...particular, the integrity of the hardware/ sofware communications, PID control system parameters, memory management and behavior of fault conditions needed...availability. Unfortunately the RBS facilities at ARL had been off-line during this time, and we employed the services of a commercial analytical

  19. Thin Film Materials and Devices for Resistive Temperature Sensing Applications

    Science.gov (United States)

    2015-05-21

    85 Figure 4-14. Complex dielectric function, , spectra for nanocrystalline Ge:H (nc...materials are metals, their alloys, semiconducting materials, and thermistor materials such as spinels of manganese, cobalt and nickel oxides. 16 10...Rutherford backscattering spectroscopy (RBS), Raman spectroscopy, scanning electron microscopy (SEM), TEM, and atomic force microscopy (AFM) did

  20. IAEA progress report I - Study of archeological objects using PIXE analytical technique

    International Nuclear Information System (INIS)

    Roumie, M.

    2005-01-01

    This is the first IAEA progress report for the period 2005-2006 (CRP number F23023). Since 1999 a particle accelerator, located at the Lebanese Atomic Energy Commission in Beirut, has been devoted to elemental analysis in different domains of application: Archeology, Environment and Material Science. It constitutes the first and unique, till now, ion beam analysis facility in Lebanon. Several nuclear analytical techniques are performed, such as PIXE, RBS, PIGE, ERDA and others. (author)

  1. [Analysis of acid rain characteristics of Lin'an Regional Background Station using long-term observation data].

    Science.gov (United States)

    Li, Zheng-Quan; Ma, Hao; Mao, Yu-Ding; Feng, Tao

    2014-02-01

    Using long-term observation data of acid rain at Lin'an Regional Background Station (Lin'an RBS), this paper studied the interannual and monthly variations of acid rain, the reasons for the variations, and the relationships between acid rain and meteorological factors. The results showed that interannual variation of acid rain at Lin'an RBS had a general increasing trend in which there were two obvious intensifying processes and two distinct weakening processes, during the period ranging from 1985 to 2012. In last two decades, the monthly variation of acid rain at Lin'an RBS indicated that rain acidity and frequency of severe acid rain were increasing but the frequency of weak acid rain was decreasing when moving towards bilateral side months of July. Acid rain occurrence was affected by rainfall intensity, wind speed and wind direction. High frequency of severe acid rain and low frequency of weak acid rain were on days with drizzle, but high frequency of weak acid rain and low frequency of severe acid rain occurred on rainstorm days. With wind speed upgrading, the frequency of acid rain and the proportion of severe acid rain were declining, the pH value of precipitation was reducing too. Another character is that daily dominant wind direction of weak acid rain majorly converged in S-W section ,however that of severe acid rain was more likely distributed in N-E section. The monthly variation of acid rain at Lin'an RBS was mainly attributed to precipitation variation, the increasing and decreasing of monthly incoming wind from SSE-WSW and NWN-ENE sections of wind direction. The interannual variation of acid rain could be due to the effects of energy consumption raising and significant green policies conducted in Zhejiang, Jiangsu and Shanghai.

  2. A study of the degradation of polymers irradiated by Cn+ and On+ 9.6 MeV heavy ions

    Czech Academy of Sciences Publication Activity Database

    Mikšová, Romana; Macková, Anna; Malinský, Petr; Slepička, P.; Švorčík, V.

    2015-01-01

    Roč. 122, DEC (2015), s. 110-121 ISSN 0141-3910 R&D Projects: GA MŠk LM2011019; GA ČR GA15-01602S Institutional support: RVO:61389005 Keywords : energy loss * heavy ions * polymers * RBS/ERDA methods * AFM method Subject RIV: BG - Nuclear, Atomic and Molecular Physics, Colliders Impact factor: 3.120, year: 2015

  3. Characterization of PEEK, PET and PI implanted with Mn ions and sub-sequently annealed

    Czech Academy of Sciences Publication Activity Database

    Macková, Anna; Malinský, Petr; Mikšová, Romana; Pupíková, Hana; Khaibullin, R. I.; Slepička, P.; Gombitová, A.; Kováčik, L.; Švorčík, V.; Matoušek, J.

    2014-01-01

    Roč. 325, APR 15 (2014), s. 89-96 ISSN 0168-583X R&D Projects: GA MŠk(XE) LM2011019; GA ČR GA106/09/0125; GA ČR GBP302/12/G157 Institutional support: RVO:61389005 Keywords : Mn ion implantation * polymers * depth profiles * RBS * TEM * AFM Subject RIV: BG - Nuclear, Atomic and Molecular Physics, Colliders Impact factor: 1.124, year: 2014

  4. Characterisation of PEEK, PET and PI implanted with 80 keV Fe+ ions to high fluencies

    Czech Academy of Sciences Publication Activity Database

    Macková, Anna; Malinský, Petr; Mikšová, Romana; Hnatowicz, Vladimír; Khaibullin, R. I.; Slepička, P.; Švorčík, V.

    2014-01-01

    Roč. 331, JUL (2014), s. 176-181 ISSN 0168-583X R&D Projects: GA ČR GA106/09/0125; GA MŠk(XE) LM2011019 Institutional support: RVO:61389005 Keywords : Fe ion implantation * polymers * depth profiles * RBS * TEM * UV Vis Subject RIV: BG - Nuclear, Atomic and Molecular Physics, Colliders Impact factor: 1.124, year: 2014

  5. Yttrium implantation effects on extra low carbon steel and pure iron

    Energy Technology Data Exchange (ETDEWEB)

    Caudron, E.; Buscail, H. [Clermont-Ferrand-2 Univ., Le Puy en Velay (France). Lab. Vellave d`Elaboration; Jacob, Y.P.; Stroosnijder, M.F. [Institute for Advanced Materials, Joint Research Center, The European Commission, 21020, Ispra (Vatican City State, Holy See) (Italy); Josse-Courty, C. [Laboratoire de Recherche sur la Reactivite des Solides, UMR 56-13 CNRS, UFR Sciences et Techniques, 9 Avenue A. Savary, B.P. 400, 21011, Dijon Cedex (France)

    1999-05-25

    Extra low carbon steel and pure electrolytic iron samples were yttrium implanted using ion implantation technique. Compositions and structures of pure iron and steel samples were investigated before and after yttrium implantation by several analytical and structural techniques (RBS, SIMS, RHEED and XRD) to observe the yttrium implantation depth profiles in the samples. This paper shows the different effects of yttrium implantations (compositions and structures) according to the implanted sample nature. (orig.) 23 refs.

  6. Journal of Earth System Science | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    40Ar-39Ar analyses of one alkali pyroxenite whole rock and two phlogopite separates of calcite carbonatites from the Sung Valley carbonatite-alkaline complex, which is believed to be a part of the Rajmahal-Bengal-Sylhet (RBS) ood basalt province, yielded indistinguishable plateau ages of 108.8 ± 2.0 Ma, 106:4 ± 1.3 Ma ...

  7. The electronic stopping powers and angular energy-loss dependence of helium and lithium ions in the silicon crystal

    Czech Academy of Sciences Publication Activity Database

    Mikšová, Romana; Macková, Anna; Malinský, Petr

    2017-01-01

    Roč. 406, SEP (2017), s. 179-184 ISSN 0168-583X R&D Projects: GA MŠk LM2015056; GA ČR GA15-01602S Institutional support: RVO:61389005 Keywords : energy-loss measurement * SOI material * RBS-channelling Subject RIV: BG - Nuclear, Atomic and Molecular Physics, Colliders OBOR OECD: Nuclear physics Impact factor: 1.109, year: 2016

  8. Study of thin oxide films by electron, ion and synchrotron radiation beams

    CERN Document Server

    Sammelselg, V; Tarre, A; Asari, J; Rauhala, E; Arstila, K; Seppaelae, A; Zakharov, A; Aarik, J; Karlis, J; Martinson, Indrek

    2002-01-01

    Titanium oxide and zirconium oxide thin films deposited on silicon substrates were characterized using electron probe microanalysis (EPMA), Rutherford backscattering spectroscopy (RBS), time-of-flight elastic recoil detection analysis (TOF-ERDA) and scanning photoelectron microscopy (SPEM). The composition and mass thickness of the films were determined and the results of different methods compared. lt was revealed that the synchrotron radiation used for SPEM studies caused considerable modification of zirconia films grown at low temperatures. (author)

  9. Investigation by the Rutherford backscattering method of impurity deposited on the T-3M tokamak diaphragm

    International Nuclear Information System (INIS)

    Danelyan, L.S.; Egorova, I.M.; Kulikauskas, V.S.; Baratov, D.G.; Belykh, T.A.

    1994-01-01

    The Rutherford backscattering of helium-4 ions was used for investigation of impurity deposited on the annular graphite diaphragm as a result of the interaction between hydrogen plasma and liquid-metal spray limiter. The experimental RBS spectra distributions of the impurity elements surface densities along the direction from plasma to the chamber wall are presented as depth of the elements. The erosion coefficient of the main liquid-metal limiter element has been estimated

  10. Implications of life cycle energy assessment of a new school building, regarding the nearly zero Energy Buildings targets in EU: A case of study

    OpenAIRE

    Muñoz, Pedro; Morales, M P (UNIR); Letelier, V; Muñoz, Luis (UNIR); Mora, Daniel

    2017-01-01

    Lately EU has promoted several policies with the aim of reducing buildings energy impact. Despite such policies have successfully contributed to reduce residential buildings (RBs) energy consumption, non-residential buildings (NRBs) have shown an increasing of operational energy demand by 15.7%, during last decade. On the one hand, energy impacts are underestimated since only primary energy consumption (PEC) is considered while other energies, such as those related to the construction phase, ...

  11. Surface damage on polycrystalline $\\beta$-SiC by xenon ion irradiation at high fluence

    OpenAIRE

    Baillet, J.; Gavarini, S.; Millard-Pinard, N.; Garnier, V.; Peaucelle, C.; Jaurand, X.; Duranti, A.; Bernard, C.; Rapegno, R.; Cardinal, S.; Escobar-Sawa, L; De Echave, T.; Lanfant, B.; Leconte, Y.

    2018-01-01

    International audience; Nano-grained $\\beta$-silicon carbide ($\\beta$-SiC) pellets were prepared by Spark Plasma Sintering (SPS). These were implanted at room temperature with 800 keV xenon at ion fluences of 5.10$^{15}$ and 1.10$^{17}$ cm$^{-2}$. Microstructural modifications were studied by electronic microscopy (TEM and SEM) and xenon profiles were determined by Rutherford Backscattering Spectroscopy (RBS). A complete amorphization of the implanted area associated with a significant oxidat...

  12. Ion beam mixing of titanium films on stainless steel

    International Nuclear Information System (INIS)

    Bolse, W.; Weber, T.

    1990-01-01

    The ion mixing of Ti-steel bilayers with N + , Ar + , Ti + , Kr + and Xe + ions was investigated by means of Rutherford backscattering spectroscopy (RBS). The mixing rates exhibit a linear scaling with the deposited damage energy F D . No correlation between the properties of the mixing ion and the mixing efficiency was found. The results are compared with the predictions of ballistic and thermal-spike models. (orig.)

  13. Study of Ag and PE interface after plasma treatment

    Czech Academy of Sciences Publication Activity Database

    Macková, Anna; Malinský, Petr; Bočan, Jiří; Švorčík, V.; Pavlík, J.; Strýhal, Z.; Sajdl, P.

    2008-01-01

    Roč. 5, č. 4 (2008), s. 964-967 ISSN 1862-6351. [9th International workshop on plasma based ion implantation and deposition. Leipzig, 02.09.2007-06.09.2007] R&D Projects: GA MŠk(CZ) LC06041 Institutional research plan: CEZ:AV0Z10480505 Keywords : RBS and AFM study * metal-polymer interface * plasma treatment Subject RIV: JJ - Other Materials

  14. High-intensity laser for Ta and Ag implantation into different substrates for plasma diagnostics

    Czech Academy of Sciences Publication Activity Database

    Cutroneo, Mariapompea; Macková, Anna; Malinský, Petr; Matoušek, J.; Torrisi, L.; Ullschmied, Jiří

    2015-01-01

    Roč. 354, JUL (2015), s. 56-59 ISSN 0168-583X R&D Projects: GA ČR(CZ) GBP108/12/G108; GA MŠk LM2011019 Institutional support: RVO:61389005 ; RVO:68378271 Keywords : multi-energy implantation * laser-produced plasma * RBS analysis Subject RIV: BG - Nuclear, Atomic and Molecular Physics, Colliders; BL - Plasma and Gas Discharge Physics (FZU-D) Impact factor: 1.389, year: 2015

  15. Ta-ion implantation induced by a high-intensity laser for plasma diagnostics and target preparation

    Czech Academy of Sciences Publication Activity Database

    Cutroneo, Mariapompea; Malinský, Petr; Macková, Anna; Matoušek, J.; Torrisi, L.; Slepička, P.; Ullschmied, Jiří

    2015-01-01

    Roč. 365, DEC (2015), s. 384-388 ISSN 0168-583X R&D Projects: GA MŠk(CZ) LM2011019; GA ČR(CZ) GBP108/12/G108 Institutional support: RVO:61389005 ; RVO:68378271 Keywords : multi-energy implantation * laser-generated plasma * RBS analysis Subject RIV: BG - Nuclear, Atomic and Molecular Physics, Colliders Impact factor: 1.389, year: 2015

  16. An unconventional ion implantation method for producing Au and Si nanostructures using intense laser-generated plasmas

    Czech Academy of Sciences Publication Activity Database

    Torrisi, L.; Cutroneo, Mariapompea; Macková, Anna; Lavrentiev, Vasyl; Pfeifer, Miroslav; Krouský, Eduard

    2016-01-01

    Roč. 58, č. 2 (2016), č. článku 025011. ISSN 0741-3335 R&D Projects: GA MŠk(CZ) LM2011019; GA ČR(CZ) GBP108/12/G108 Institutional support: RVO:61389005 ; RVO:68378271 Keywords : multi-energy ion implantation * laser-generating plasma * RBS analysis Subject RIV: BL - Plasma and Gas Discharge Physics; BH - Optics, Masers, Lasers (FZU-D) Impact factor: 2.392, year: 2016

  17. Status report of IOP pelletron

    International Nuclear Information System (INIS)

    Ravi Prasad, G.V.; Som, T.

    2006-01-01

    The 3MV pelletron accelerator at IOP is being primarily utilised by the internal and external users for synthesis, modification and characterisation of samples. Besides the surface physics studies, the accelerator is also being used for Particle Induced X-ray Emission (PIXE) and Rutherford Backscattering Spectrometry (RBS) experiments as well as for radiocarbon Accelerator Mass Spectrometry (AMS). In this report, we present the details of the utilisation of the machine. (author)

  18. Characterisation of Ni+ implanted PEEK, PET and PI

    Czech Academy of Sciences Publication Activity Database

    Macková, Anna; Bočan, Jiří; Khaibulline, R.; Valeev, V. F.; Slepička, P.; Sajdl, P.; Švorčík, V.

    2009-01-01

    Roč. 267, - (2009), s. 1549-1552 ISSN 0168-583X R&D Projects: GA MŠk(CZ) LC06041; GA AV ČR(CZ) KJB100480601 Institutional research plan: CEZ:AV0Z10480505 Keywords : Ion implantation * Polymers * TRIDYN * RBS * XPS * Depth profiles Subject RIV: BG - Nuclear, Atomic and Molecular Physics, Colliders Impact factor: 1.156, year: 2009

  19. The hot-water extract of leaves of noni, Morinda citrifolia, promotes the immunocompetence of giant freshwater prawn, Macrobrachium rosenbergii.

    Science.gov (United States)

    Marisa Halim, Atika; Lee, Pai-Po; Chang, Zhong-Wen; Chang, Chin-Chyuan

    2017-05-01

    The hot-water Morinda citrifolia leaf extract (HMLE) was prepared for in vitro assessment on phenoloxidase (PO) activity, respiratory bursts (RBs), and phagocytic activity (PA). Furthermore, the HMLE was administrated in the diet at 0.6, 3, and 6 g (kg diet) -1 for Macrobrachium rosenbergii, and the potential effects on the immunocompetence of prawns were evaluated. PO activity, RBs, and PA in hemocytes incubated with the HMLE at 140, 20, 20, and 140 mg l -1 significantly increased. The immune parameters of the total hemocyte count (THC), differential hemocyte count (DHC), RBs, PO activity, superoxide dismutase (SOD) activity, PA, transglutaminase (TG) activity and hemolymph clotting time were evaluated before and after 1, 3, 5, 7, and 9 weeks of the feeding trial. During 9 weeks of the feeding trial, higher THCs, DHCs, RBs, PO, and TG as well as accelerated clotting times were observed in prawns fed HMLE-containing diets at 0.6 g kg -1 . The mRNA expressions of prophenoloxidase, TG, crustin, and lysozyme of prawns fed HMLE-containing diets at 0.6 g kg -1 for 9 weeks of the feeding trial significantly increased. The susceptibility of prawns fed the HMLE at 0.6 g kg -1 to Lactococcus garvieae infection significantly decreased, and the relative survival percentage was 23.1%. We therefore found that HMLE administrated through the diet at 0.6 g kg -1 was capable of enhancing the immunity and resistance against L. garvieae in M. rosenbergii. Copyright © 2017 Elsevier Ltd. All rights reserved.

  20. L-leucine partially rescues translational and developmental defects associated with zebrafish models of Cornelia de Lange syndrome.

    Science.gov (United States)

    Xu, Baoshan; Sowa, Nenja; Cardenas, Maria E; Gerton, Jennifer L

    2015-03-15

    Cohesinopathies are human genetic disorders that include Cornelia de Lange syndrome (CdLS) and Roberts syndrome (RBS) and are characterized by defects in limb and craniofacial development as well as mental retardation. The developmental phenotypes of CdLS and other cohesinopathies suggest that mutations in the structure and regulation of the cohesin complex during embryogenesis interfere with gene regulation. In a previous project, we showed that RBS was associated with highly fragmented nucleoli and defects in both ribosome biogenesis and protein translation. l-leucine stimulation of the mTOR pathway partially rescued translation in human RBS cells and development in zebrafish models of RBS. In this study, we investigate protein translation in zebrafish models of CdLS. Our results show that phosphorylation of RPS6 as well as 4E-binding protein 1 (4EBP1) was reduced in nipbla/b, rad21 and smc3-morphant embryos, a pattern indicating reduced translation. Moreover, protein biosynthesis and rRNA production were decreased in the cohesin morphant embryo cells. l-leucine partly rescued protein synthesis and rRNA production in the cohesin morphants and partially restored phosphorylation of RPS6 and 4EBP1. Concomitantly, l-leucine treatment partially improved cohesinopathy embryo development including the formation of craniofacial cartilage. Interestingly, we observed that alpha-ketoisocaproate (α-KIC), which is a keto derivative of leucine, also partially rescued the development of rad21 and nipbla/b morphants by boosting mTOR-dependent translation. In summary, our results suggest that cohesinopathies are caused in part by defective protein synthesis, and stimulation of the mTOR pathway through l-leucine or its metabolite α-KIC can partially rescue development in zebrafish models for CdLS. © The Author 2014. Published by Oxford University Press.

  1. The structural and optical properties of metal ion-implanted GaN

    Czech Academy of Sciences Publication Activity Database

    Macková, Anna; Malinský, Petr; Sofer, Z.; Šimek, P.; Sedmidubský, D.; Veselý, M.; Bottger, R.

    2016-01-01

    Roč. 371, MAR (2016), s. 254-257 ISSN 0168-583X. [22nd International conference on Ion Beam Analysis (IBA). Opatija, 14.06.2015-19.06.2015] R&D Projects: GA MŠk(CZ) LM2011019; GA ČR GA15-01602S Institutional support: RVO:61389005 Keywords : RBS channelling * metal-implanted GaN * structural changes Subject RIV: BG - Nuclear, Atomic and Molecular Physics , Colliders Impact factor: 1.109, year: 2016

  2. Studies of PMMA sintering foils with and without coating by magnetron sputtering Pd

    Czech Academy of Sciences Publication Activity Database

    Cutroneo, Mariapompea; Macková, Anna; Torrisi, L.; Vad, K.; Csik, A.; Ando, L.; Švecová, B.

    2017-01-01

    Roč. 406, SEP (2017), s. 42-47 ISSN 0168-583X R&D Projects: GA MŠk LM2015056; GA ČR(CZ) GBP108/12/G108 Institutional support: RVO:61389005 Keywords : opaque PMMA * beads * RBS Subject RIV: BG - Nuclear , Atomic and Molecular Physics, Colliders OBOR OECD: Nuclear physics Impact factor: 1.109, year: 2016

  3. Analysis of surface with low energy ions

    International Nuclear Information System (INIS)

    Oliver, A.; Miranda, J.

    1989-01-01

    Nuclear techniques applied to element analysis presents different characteristics depending on projectile energy. It can seen observed than an energy (E ≅ 1 MeV) exists which separate two regions for which sensitivity, information analysis and resolution in detection are different. For this work, we describe for the energy region E ≤ 1 MeV, the advantage of the three most used techniques which are PIXE, RBS y RNR. (Author)

  4. Elastic recoil detection analysis (ERDA) in hydrogenated samples for TNSA laser irradiation

    Czech Academy of Sciences Publication Activity Database

    Torrisi, L.; Cutroneo, Mariapompea

    2016-01-01

    Roč. 48, č. 1 (2016), s. 10-16 ISSN 0142-2421 R&D Projects: GA MŠk(CZ) LM2011019; GA ČR(CZ) GBP108/12/G108 Institutional support: RVO:61389005 Keywords : ERDA * RBS * TNSA * hydrogen and deuterium * proton acceleration Subject RIV: BG - Nuclear, Atomic and Molecular Physics, Colliders Impact factor: 1.132, year: 2016

  5. Ion Implantation Technology: Proceedings of the International Conference on Ion Implantation Technology (8th) Held at the University of Surrey, Guildford, UK on 30 July - 3 August 1990

    Science.gov (United States)

    1991-01-01

    pressure is measured by a nude Bayard Alpert ioniza- ion depth profile. Their results confirmed those of tion gauge which is mounted directly on the...I,,. increases teen these chambers, therefore, even a corrosive gas as /ar is increased. This enables us to adjust 1, just by fed to the plasma...t0Cempetur wasueldbcostat teen in Fig. 2 Schematic In profiles obtained from RBS spectra Solid and 400°C depending on substrate type. An in situ curves

  6. Produção de celulases por Aspergillus niger e cinética da desativação celulásica=Cellulases production by Aspergillus niger and cellulase deactivation kinetic

    Directory of Open Access Journals (Sweden)

    Caroline Mariana de Aguiar

    2011-10-01

    Full Text Available O presente trabalho teve como objetivo a avaliação da cinética de produção de enzimas celulases pelo fungo Aspergillus niger e da cinética de desativação das celulases. Foi utilizado bagaço de cana-de-açúcar pré-tratado como fonte de carbono na fermentação para a produção do complexo celulásico e também como substrato da hidrólise enzimática. A. niger foi cultivado em três bateladas, cada uma contendo 10, 50 e 100 g L-1 de bagaço pré-tratado com NaOH 4% (m v-1. A cinética da produção das celulases foi obtida determinando-se a atividade enzimática das amostras coletadas ao longo do tempo. As variações do pH também foram determinadas. A deativação enzimática foi avaliada determinando-se periodicamente a atividade das amostras armazenadas nas condições de resfriamento (4°C e de congelamento (-18ºC. Conclui-se que o A. niger produz celulases quando cultivado em meio de cultivo contendo bagaço de cana-de-açúcar pré-tratado e que o tempo ideal para coleta do caldo enzimático foi de aproximadamente sete dias, com produtividade máxima de 0,0013 U mL-1∙h para a batelada com 10 g L-1 e 0,0018 U mL-1∙h para as bateladas com 50 e 100 g L-1. O complexo celulásico não sofre desativação se armazenado à temperatura de -18°C por 43 dias, mas perde cerca de 40% da sua atividade após 48h se armazenado a 4°C.This work aimed to evaluate the kinetic for the cellulase production by Aspergillus niger and the deactivation kinetic of the cellulase enzymes. Cellulase were produced in three different batches using NaOH 4% (w v-1 pre-treated sugarcane bagasse as the carbon source in the fermentation broth. The amount of the bagasse in each batch was 10, 50 and 100 g L-1. The kinetic of the cellulase production was accomplished by periodically determining the cellulasic activity of the fermentation broth using pre-treated bagasse as the hydrolysis substrate. Changes in the pH also were determined. The cellulase

  7. Governing equations of multi-component rigid body-spring discrete element models of reinforced concrete columns

    International Nuclear Information System (INIS)

    Guan, P B; Tingatinga, E A; Longalong, R E; Saguid, J

    2016-01-01

    During the past decades, the complexity of conventional methods to perform seismic performance assessment of buildings led to the development of more effective approaches. The rigid body spring-discrete element method (RBS-DEM) is one of these approaches and has recently been applied to the study of the behavior of reinforced concrete (RC) buildings subjected to strong earthquakes. In this paper, the governing equations of RBS-DEM planar elements subjected to lateral loads and horizontal ground motion are presented and used to replicate the hysteretic behavior of experimental RC columns. The RBS-DEM models of columns are made up of rigid components connected by systems of springs that simulate axial, shear, and bending behavior of an RC section. The parameters of springs were obtained using Response-2000 software and the hysteretic response of the models of select columns from the Pacific Earthquake Engineering Research (PEER) Structural Performance Database were computed numerically. Numerical examples show that one-component models were able to simulate the initial stiffness reasonably, while the displacement capacity of actual columns undergoing large displacements were underestimated. (paper)

  8. Sensory characteristics and consumer liking of sausages with 10% fat and added rye or wheat bran.

    Science.gov (United States)

    Arildsen Jakobsen, Louise Margrethe; Vuholm, Stine; Aaslyng, Margit Dall; Kristensen, Mette; Sørensen, Karina Vejrum; Raben, Anne; Kehlet, Ursula

    2014-09-01

    Improving the nutritional profile of sausages through the addition of dietary fiber might affect appetite, sensory characteristics, and liking differently depending on the fiber source. This study investigates the sensory characteristics and consumer acceptance of sausages with 10% (w/w) fat and added rye or wheat bran. Sensory descriptive attributes (odor, appearance, texture, and flavor) of rye bran sausage (RBS) and wheat bran sausage (WBS) were evaluated by a trained sensory panel (n = 9). A sausage with wheat flour (WFS) and two commercial 20% (20%S) and 10% (10%S) (w/w) fat sausages were also included. Liking was investigated in consumer tests with two Danish target groups (49 children aged between six and nine and 24 parents). RBS and WBS were similar with regard to their sensory descriptive attributes, but the structure of these sausages was coarser and the color was more brown than the other sausages. RBS was similar to the commercial 10%S with regard to several sensory attributes and liking, whereas WBS was the least juicy, had a higher intensity of cereal odor and flavor, and the lowest liking.

  9. Ion beam analysis of golden threads from Romanian medieval textiles

    Energy Technology Data Exchange (ETDEWEB)

    Balta, Z.I., E-mail: balta_z_i@yahoo.com [National History Museum of Romania, Calea Victoriei 12, Sector 3, Bucharest (Romania); Csedreki, L.; Furu, E. [Institute for Nuclear Research, Hungarian Academy of Sciences, H-4001 Debrecen, P.O. Box 51 (Hungary); Cretu, I. [National Art Museum of Romania, Calea Victoriei 49-53, Sector 1, Bucharest (Romania); Huszánk, R. [Institute for Nuclear Research, Hungarian Academy of Sciences, H-4001 Debrecen, P.O. Box 51 (Hungary); Lupu, M. [National Art Museum of Romania, Calea Victoriei 49-53, Sector 1, Bucharest (Romania); Török, Z.; Kertész, Z.; Szikszai, Z. [Institute for Nuclear Research, Hungarian Academy of Sciences, H-4001 Debrecen, P.O. Box 51 (Hungary)

    2015-04-01

    In this study, metal threads from Romanian religious embroideries and precious velvet brocades dated from 15th to 18th century were analyzed by using IBA methods (PIXE and RBS) which, in comparison to the traditional analytical techniques (XRF, EDS), allowed the detection of their structures and accurate identification of the trace elements (detection limits of few tens of ppm). PIXE results confirmed that both types of the metal threads studied – wires and strips – have layered structures being made of fine silver, refined by cupellation, and gilded most probably with pure gold, and not of Au–Ag alloy, or gilded Ag–Cu alloy or Au–Ag–Cu alloy, as resulted from the previously performed SEM-EDS analysis. Trace elements of historical interest like lead, mercury and bismuth have been also possible to be detected by PIXE. The resulting elemental maps allowed us to identify the areas from which the metal thread structure and quantitative composition could be accurately determined. RBS measurements revealed that the gilding layer is separated from the silver bulk by an interface layer resulting through atomic diffusion of silver into the gold, which lead to the conclusion that the methods used for gilding were probably either the diffusion bonding or the fire gilding. The gilding layers thicknesses were estimated by PIXE with the GUPIX software and also determined from RBS measurements.

  10. Quantitative analysis of chemical elements in single cells using nuclear microprobe and nano-probe

    International Nuclear Information System (INIS)

    Deves, Guillaume

    2010-01-01

    The study of the role of trace elements at cellular level requires the use of state-of-the-art analytical tools that could achieve enough sensitivity and spatial resolution. We developed a new methodology for the accurate quantification of chemical element distribution in single cells based on a combination of ion beam analysis techniques STIM, PIXE and RBS. The quantification procedure relies on the development of a STIM data analysis software (Paparamborde). Validity of this methodology and limits are discussed here. The method allows the quantification of trace elements (μg/g) with a 19.8 % uncertainty in cellular compartments with mass below 0.1 ng. The main limit of the method lies in the poor number of samples that can be analyzed, due to long irradiation times required and limited access to ion beam analysis facilities. This is the reason why we developed a database for cellular chemical composition capitalization (BDC4). BDC4 has been designed in order to use cellular chemical composition as a tracer for biological activities and is expected to provide in the future reference chemical compositions for any cellular type or compartment. Application of the STIM-PIXE-RBS methodology to the study of nuclear toxicology of cobalt compounds is presented here showing that STIM analysis is absolutely needed when organic mass loss appears during PIXE-RBS irradiation. (author)

  11. Ion beam analysis of Cu(In,Ga)Se{sub 2} thin film solar cells

    Energy Technology Data Exchange (ETDEWEB)

    Karydas, A.G. [International Atomic Energy Agency (IAEA), IAEA Laboratories, Nuclear Science and Instrumentation Laboratory, A-2444 Seibersdorf (Austria); Institute of Nuclear and Particle Physics, NCSR “Demokritos”, 153 10 Aghia Paraskevi, Athens Greece (Greece); Streeck, C. [Physikalisch-Technische Bundesanstalt (PTB), Abbestr. 2-12, 10587 Berlin (Germany); Radovic, I. Bogdanovic [Ruđer Bošković Institute (RBI), Zagreb (Croatia); Kaufmann, C.; Rissom, T. [Helmholtz-Zentrum Berlin für Materialien und Energie GmbH (HZB), Hahn-Meitner-Platz 1, 14109 Berlin (Germany); Beckhoff, B. [Physikalisch-Technische Bundesanstalt (PTB), Abbestr. 2-12, 10587 Berlin (Germany); Jaksic, M. [Ruđer Bošković Institute (RBI), Zagreb (Croatia); Barradas, N.P. [Centro de Ciências e Tecnologias Nucleares, Instituto Superior Técnico, Universidade de Lisboa, E. N. 10, Apartado 21, 2686-953 Sacavém (Portugal)

    2015-11-30

    Graphical abstract: - Highlights: • Elemental depth profiles for various CIGS thin films were quantitatively determined. • Pure absorbers, complete cell and bilayer solar cells were prepared and analyzed. • Synergistic PIXE and RBS analysis of thin solar cells using alpha beam particles. • High energy alpha beam resolved completely the Indium depth profile. • Synchrotron based Reference Free GIXRF quantitative analysis validated IBA results. - Abstract: The present work investigates the potential of ion beam analysis (IBA) techniques such as the Rutherford backscattering spectrometry (RBS) and particle induced X-ray emission (PIXE) using helium ions to provide quantitative in-depth elemental analysis of various types of Cu(In,Ga)Se{sub 2} thin films. These films with a thickness of about 2 μm are used as absorber layers in photovoltaic devices with continuously increasing the performance of this technology. The preparation process generally aims to obtain an in-depth gradient of In and Ga concentrations that optimizes the optoelectronic and electrical properties of the solar cell. The measurements were performed at directly accessible single or double layered CIGS absorbers and at buried absorbers in completed thin film solar cells. The IBA data were analyzed simultaneously in order to derive best fitted profiles that match all experimental RBS and PIXE spectra. For some samples elemental profiles deduced form synchrotron based, reference free grazing incidence X-ray fluorescence analysis were compared with the IBA results and an overall good agreement was observed within quoted uncertainties.

  12. Epitaxial Pb(Zr{sub x}Ti{sub 1{minus}x})O{sub 3}/SrRuO{sub 3} (x = 0, 0.35, 0.65) multilayer thin films on SrTiO{sub 3}(100) and MgO(100) prepared by MOCVD and RF sputtering

    Energy Technology Data Exchange (ETDEWEB)

    Foster, C.M.; Csencsits, R.; Baldo, P.M.; Bai, G.R.; Li, Z.; Rehn, L.E. [Argonne National Lab., IL (United States). Materials Science Div.; Wills, L.A.; Hiskes, R. [Hewlett-Packard Co., Palo Alto, CA (United States). Hewlett Packard Labs.

    1995-02-01

    Epitaxial SrRuO{sub 3} thin films were deposited on SrTiO{sub 3}(100) and MgO(100) substrates by RF sputtering for use as bottom electrodes and epitaxial buffer layers. On these conductive substrates, epitaxial Pb(Zr{sub x}Ti{sub 1{minus}x})O{sub 3} (PZT; x = 0.35,0.65) and PbTiO{sub 3} (PT; x = 0) thin films were deposited by metalorganic chemical vapor deposition (MOCVD). X-ray diffraction (XRD), RBS channeling (RBS), transmission electron microscopy (TEM) and optical waveguiding were used to characterize the phase, microstructure, defect structure, refractive index, and film thickness of the deposited films. The PZT and PT films were epitaxial and c-axis oriented. 90{degree} domains, interfacial misfit dislocations and threading dislocations were the primary structural defects, and the films showed as high as a 70% RBS channeling reduction. Ferroelectric hysteresis and dielectric measurements of epitaxial PZT ferroelectric capacitor structures formed using evaporated Ag top electrode showed: a remanent polarization of 46.2 {mu}C/cm{sup 2}, a coercive field of 54.9 kV/cm, a dielectric constant of 410, a bipolar resistivity of {approximately}5.8 {times} 10{sup 9} {Omega}-cm at a field of 275 kV/cm, and a breakdown strength of >400 kV/cm. Cyclic fatigue measurements showed that the remanent polarization was maintained for >10{sup 9} cycles.

  13. On the annealing behaviour of dysprosium ion implanted nickel: a combined study using Rutherford backscattering, transmission electron microscopy, and total current spectroscopy

    International Nuclear Information System (INIS)

    Chadderton, L.T.; Johnson, E.

    1977-01-01

    Despite continuing improvements in applications of the analytical method of Rutherford backscattering (RBS) to solid state physics it is recognized that more complete information can be obtained if other techniques - for example transmission electron microscopy (TEM) - are employed simultaneously. Experiments are described in which a combined RBS and TEM study of the annealing of nickel, rendered amorphous by implantation of 20 keV dysprosium ions is supplemented with a completely new technique - total current spectroscopy (TCS). In TCS low energy electrons (0-15 eV) are used to probe the damaged nickel. Observations have been made during annealing of both the reappearance of the bulk band structure of the metal and of a 'surface peak' which is highly sensitive to the recovery process. Changes in the height of the surface peak reveal three sharp annealing stages, the first two being preceded by reverse annealing which correlates well with RBS and TEM results. The first annealing stage - following the amorphous to crystalline transition - may be associated with electronic effects in the vicinity of the Curie point. Changes in the position of the surface peak allow one to trace the diffusion of dysprosium to the surface. Quantum mechanical resonances at the damage/crystal interface have also been followed throughout annealing. The initially amorphous layer (approximately 2.2nm) increases in thickness slightly during recovery. (Auth.)

  14. Unjuk Kerja Jaringan Seluler 2G dan 3G PT. XL Axiata di Area Jawa Tengah Bagian Utara setelah Proyek Swap dan Modernisasi

    Directory of Open Access Journals (Sweden)

    Eva Yovita Dwi Utami

    2015-04-01

    Full Text Available The increasing number of customers and the need for reliable communication require the availability of coverage, sufficient capacity and good quality of mobile communications networks. New BTS implementation is required to cover a wider area with good network quality. However, it often requires high cost and long time to get permission from the government and local residents. Swap and Modernization Project is a project that swap the previous 3G equipment using BTS 3900 Huawei with Ericsson RBS 6000 and modernize the 2G RBS 2000 to RBS 6000 and then carry out parameter settings to optimize the network. In this paper, we report the results of mobile network performance after Swap and Modernization projects had been done in terms of the signal strength improvements, which are showed by Rx Level, RSCP and CDD Dump parameters. The study was conducted in PT XL Axiata Northern Areas of Central Java with D5 cluster as a sample. The results show improvement of Rx Level that increased by 89.93 %, and RSCP value increased by 58.36 %. The swap and modernization of the BTS and parameter settings are able to improve CDD Dump parameters. These improvements are able to expand the coverage area of cluster D5 sites.

  15. Ion backscattering and X-ray investigations of violin varnish and wood

    International Nuclear Information System (INIS)

    Sigurd, D.; Tove, P.A.; Petersson, S.

    1980-01-01

    The use of Rutherford backscattering (RBS) of ions (i.e. α-particles) and excitation of characteristic X-rays by protons, for determining the elemental composition of the top layers of violin varnish and wood is described. The amount of elements such as C, O, Si, S, Ca, Cu, Fe, Ni, Zn, Pb has been measured, on the varnished and unvarnished sides of wood samples from old instrument makers such as A. Stradivari, G. Guarneri del Gesu, Santo Serafin, C. Tononi etc. Differences in both the shape of the RBS spectra and in the presence of different elements are found and discussed. The use of X-ray excitation by ions (i.e. protons) helps in assessing the presence of the different elements. X-ray investigations can be done with instruments in air while RBS (at least in the presently used form) has to be performed in a vacuum chamber. Apart from offering an aid in determining the materials and procedures which were used in fabricating acoustically excellent instruments, the method could be of value for identifying their authenticity. (orig.)

  16. Ion backscattering and x-ray investigations of violin varnish and wood

    Science.gov (United States)

    Arne Tove, Per; Sigurd, Dag; Petersson, Sture

    1980-01-01

    The use of Rutherford backscattering (RBS) of ions (i.e. α-particles) and excitation of characteristic X-rays by protons, for determining the elemental composition of the top layers of violin varnish and wood is described. The amount of elements such as C, O, Si, S, Ca, Cu, Fe, Ni, Zn, Pb has been measured, on the varnished and unvarnished sides of wood samples from old instrument makers such as A. Stradivari, G. Guarneri del Gesu, Santo Serafin, C. Tononi etc. Differences in both the shape of the RBS spectra and in the presence of different elements are found and discussed. The use of X-ray excitation by ions (i.e. protons) helps in assessing the presence of the different elements. X-ray investigations can be done with instruments in air while RBS (at least in the presently used form) has to be performed in a vacuum chamber. Apart from offering an aid in determining the materials and procedures which were used in fabricating acoustically excellent instruments, the method could be of value for identifying their authenticity.

  17. Hyperfine and ion beam interaction studies of Sn, Te, I and Sm impurities in silicon

    International Nuclear Information System (INIS)

    Kemerink, G.J.

    1981-01-01

    In this thesis the author reports investigations on ion implanted and oven or laser annealed silicon using Moessbauer spectroscopy, Rutherford backscattering (RBS) and channeling, time differential perturbed angular correlation and the Hall-effect. Chapter 1 gives an introduction to this field of research. Chapter 2 deals with an outline of the experimental methods used throughout this work. In chapter 3 results are presented from RBS and channeling experiments on Te-implanted Si. Chapters 4 and 5 concern the results from a study of dopant dependent effects in laser annealed TeSi using 119 Sn, 125 Te and 129 I-Moessbauer spectroscopy. Chapter 6 gives the results from a study of as-implanted and oven annealed TeSi using 129 I-time differential perturbed angular correlation and 129 I-Moessbauer spectroscopy. Chapter 7 describes the results from RBS and channeling experiments on oven and laser annealed ISi. Chapter 8 deals with Hall-effect measurements on TeSi and ISi. Chapter 9 finally covers the investigations of 153 Sm-implanted diamond, Si, Ge and α-Sn using channeling and 153 Eu-Moessbauer spectroscopy. (Auth.)

  18. Damage recovery in ZnO by post-implantation annealing

    International Nuclear Information System (INIS)

    Audren, A.; Hallen, A.; Linnarsson, M.K.; Possnert, G.

    2010-01-01

    ZnO bulk samples were implanted with 200 keV-Co ions at room temperature with two fluences, 1 x 10 16 and 8 x 10 16 cm -2 , and then annealed in air for 30 min at different temperatures up to 900 o C. After the implantation and each annealing step, the samples were analyzed by Rutherford backscattering spectrometry (RBS) in random and channeling directions to follow the evolution of the disorder profile. The RBS spectra reveal that disorder is created during implantation in proportion to the Co fluence. The thermal treatments induce a disorder recovery, which is however, not complete after annealing at 900 o C, where about 15% of the damage remains. To study the Co profile evolution during annealing, the samples were, in addition to RBS, characterized by secondary ion mass spectrometry (SIMS). The results show that Co diffusion starts at 800 o C, but also that a very different behavior is seen for Co concentrations below and above the solubility limit.

  19. Growth of Co2MnAl Thin Films by Pulsed Laser Deposition

    Directory of Open Access Journals (Sweden)

    Isber Samih

    2014-07-01

    Full Text Available The effects of the deposition temperature and laser energy on the characteristics of Co2MnAl films deposited on GaAs substrates were investigated. The grown films were characterized by AFM for film roughness and surface topography. Film thickness and elemental composition were measured using Rutherford Back Scattering (RBS technique, while crystalline structure and phase composition were investigated by XRD. The RBS measurements showed that the stochiometry of the films was satisfactory and very close to that of the target Co: 0.5, Mn: 0.25, Al: 0.25. The thickness of the films was found to increase as the laser energy was increased from 200 to 400 mJ, in particular for the films deposited at 400 °C. We also found an increase in the films thicknesses as the deposition temperature was increased for the samples grown at 200 and 300 mJ. The best film quality as deduced from XRD, RBS and AFM results for producing these single layers were those deposited at 600 °C with the laser energy at 300 mJ.

  20. New pediatric vision screener employing polarization-modulated, retinal-birefringence-scanning-based strabismus detection and bull's eye focus detection with an improved target system: opto-mechanical design and operation

    Science.gov (United States)

    Irsch, Kristina; Gramatikov, Boris I.; Wu, Yi-Kai; Guyton, David L.

    2014-06-01

    Amblyopia ("lazy eye") is a major public health problem, caused by misalignment of the eyes (strabismus) or defocus. If detected early in childhood, there is an excellent response to therapy, yet most children are detected too late to be treated effectively. Commercially available vision screening devices that test for amblyopia's primary causes can detect strabismus only indirectly and inaccurately via assessment of the positions of external light reflections from the cornea, but they cannot detect the anatomical feature of the eyes where fixation actually occurs (the fovea). Our laboratory has been developing technology to detect true foveal fixation, by exploiting the birefringence of the uniquely arranged Henle fibers delineating the fovea using retinal birefringence scanning (RBS), and we recently described a polarization-modulated approach to RBS that enables entirely direct and reliable detection of true foveal fixation, with greatly enhanced signal-to-noise ratio and essentially independent of corneal birefringence (a confounding variable with all polarization-sensitive ophthalmic technology). Here, we describe the design and operation of a new pediatric vision screener that employs polarization-modulated, RBS-based strabismus detection and bull's eye focus detection with an improved target system, and demonstrate the feasibility of this new approach.

  1. Impact of antiretroviral therapy on glycemia and transaminase levels in patients living with HIV/AIDS in Limbe, Cameroon.

    Science.gov (United States)

    Ottop, Francisca M; Atashili, Julius; Ndumbe, Peter M

    2013-01-01

    This study aimed to determine the effect of antiretroviral therapy (ART) on glycemia and transaminase levels in HIV-infected patients in Limbe, Cameroon. A total of 200 ART-experienced patients and 30 ART-naive HIV-infected controls were recruited after submitting signed informed consent forms. The blood samples collected were screened for hepatitis B and C, and liver transaminases and random blood sugar (RBS) levels were determined spectrophotometrically. No significant correlation existed between the RBS and transaminase levels with either the duration of ART or the duration since HIV diagnosis. Although both groups of patients appeared to have similar transaminase and RBS levels, after controlling for confounders, patients on ART had significantly higher aspartate aminotransferase levels, significantly lower alanine aminotransferase levels, and slightly (but not significantly) lower glycemia levels (respective mean differences of 14.92 IU/L, P = .00; 11.95 IU/L, P = .00; and 7.60 mg/dL, P = .19). These changes need to be considered in monitoring patients on ART in this setting and other similar settings.

  2. Heavy ion elastic recoil detection analysis of optoelectronic and semiconductor devices

    Energy Technology Data Exchange (ETDEWEB)

    Dytlewski, N.; Cohen, D.D. [Australian Nuclear Science and Technology Organisation, Lucas Heights, NSW (Australia); Johnston, P.; Walker, S. [Royal Melbourne Inst. of Tech., VIC (Australia); Whitlow, H.; Hult, M. [Lund Univ. (Sweden); Oestling, M.; Zaring, C. [Royal Inst. of Tech., Stockholm (Sweden)

    1993-12-31

    In recent years, the use of heavy ion time-of-flight elastic recoil spectrometry (HIERDA) has been applied to analyse multi-phase, thin layer devices used in optoelectronics, semiconductors and solar power generation. HIERDA gives simultaneously, mass resolved elemental concentration vs depth profiles of the matrix constituents, and is particularly suited to the determination of light elements in a heavy matrix. The beam/target interaction process is similar to RBS, but has the difference that the recoiling target atoms are detected instead of the scattered projectile. High energy, heavy ions beams bombard the sample, ejecting recoil atoms which are detected at a forward angle of 45 deg. A time-of-flight and total energy detection system enables the ejected particle`s mass to be identified, and allows energy spectra to be obtained and interpreted in an analogous way to RBS, but with the important difference that the elemental spectra are separated, and not superimposed on a background as in RBS. Some of the measurements made with a HIERDA system on the ANTARES Tandem Accelerator at ANSTO are described. 1 refs., 4 figs.

  3. Damage accumulation in MgO irradiated with MeV Au ions at elevated temperatures

    Energy Technology Data Exchange (ETDEWEB)

    Bachiller-Perea, Diana, E-mail: dianabachillerperea@gmail.com [Centre de Sciences Nucléaires et de Sciences de la Matière (CSNSM), Univ. Paris-Sud, CNRS-IN2P3, Université Paris-Saclay, 91405, Orsay Cedex (France); Centro de Micro-Análisis de Materiales, Universidad Autónoma de Madrid, C/Faraday 3, 28049, Madrid (Spain); Dpto. de Física Aplicada, Universidad Autónoma de Madrid, Ciudad Universitaria de Cantoblanco, 28049, Madrid (Spain); Debelle, Aurélien, E-mail: aurelien.debelle@u-psud.fr [Centre de Sciences Nucléaires et de Sciences de la Matière (CSNSM), Univ. Paris-Sud, CNRS-IN2P3, Université Paris-Saclay, 91405, Orsay Cedex (France); Thomé, Lionel [Centre de Sciences Nucléaires et de Sciences de la Matière (CSNSM), Univ. Paris-Sud, CNRS-IN2P3, Université Paris-Saclay, 91405, Orsay Cedex (France); Behar, Moni [Instituto de Física, Universidade Federal do Rio Grande do Sul, C.P. 15051, 91501-970, Porto Alegre, RS (Brazil)

    2016-09-15

    The damage accumulation process in MgO single crystals under medium-energy heavy ion irradiation (1.2 MeV Au) at fluences up to 4 × 10{sup 14} cm{sup −2} has been studied at three different temperatures: 573, 773, and 1073 K. Disorder depth profiles have been determined through the use of the Rutherford backscattering spectrometry in channeling configuration (RBS/C). The analysis of the RBS/C data reveals two steps in the MgO damage process, irrespective of the temperature. However, we find that for increasing irradiation temperature, the damage level decreases and the fluence at which the second step takes place increases. A shift of the damage peak at increasing fluence is observed for the three temperatures, although the position of the peak depends on the temperature. These results can be explained by an enhanced defect mobility which facilitates defect migration and may favor defect annealing. X-ray diffraction reciprocal space maps confirm the results obtained with the RBS/C technique. - Highlights: • High-temperature MeV-ion irradiated MgO exhibits a two-step damage process. • The occurrence of the second step is delayed with increasing temperature. • The damage level decreases with increasing temperature. • A shift of the damage peak is observed with increasing fluence. • A high defect mobility at high temperatures in MgO is clearly evidenced.

  4. Sputtering and surface structure modification of gold thin films deposited onto silicon substrates under the impact of 20–160 keV Ar{sup +} ions

    Energy Technology Data Exchange (ETDEWEB)

    Mammeri, S., E-mail: smammeri@yahoo.fr [Centre de Recherche Nucléaire d’Alger, B.P. 399, 02 Bd. Frantz Fanon, Alger-Gare, Algiers (Algeria); Ouichaoui, S. [Université des Sciences et de la Technologie H. Boumediene (USTHB), Faculté de Physique, Laboratoire SNIRM, B.P. 32, El-Alia, 16111 Bab Ezzouar, Algiers (Algeria); Ammi, H.; Dib, A. [Centre de Recherche Nucléaire d’Alger, B.P. 399, 02 Bd. Frantz Fanon, Alger-Gare, Algiers (Algeria)

    2014-10-15

    Highlights: •Sputter yields were measured for gold thin films under keV Ar{sup +} ion bombardment. •RBS analysis was used to derive energy dependence of sputtering yield. •Surface effects under Ar{sup +} ion irradiation were studied by SEM and XRD analyses. -- Abstract: The induced sputtering and surface state modification of Au thin films bombarded by swift Ar{sup +} ions under normal incident angle have been studied over an energy range of (20–160) keV using three complementary techniques: Rutherford backscattering spectroscopy (RBS), scanning electron microscopy (SEM) and X-ray diffraction (XRD). The sputtering yields determined by RBS measurements using a 2 MeV {sup 4}He{sup +} ion beam were found to be consistent with previous data measured within the Ar{sup +} ion energy region E ⩽ 50 keV, which are thus extended to higher bombarding energies. Besides, the SEM and XRD measurements clearly point out that the irradiated Au film surfaces undergo drastic modifications with increasing the Ar{sup +} ion energy, giving rise to the formation of increasingly sized grains of preferred (1 1 1) crystalline orientations. The relevance of different sputtering yield models for describing experimental data is discussed with invoking the observed surface effects induced by the Ar{sup +} ion irradiation.

  5. Thermal annealing behavior of niobium-implanted {alpha}-Al{sub 2}O{sub 3} under reducing environment

    Energy Technology Data Exchange (ETDEWEB)

    Zeng Jianer; Naramoto, Hiroshi; Aoki, Yasushi; Yamamoto, Shunya; Gan Mingle; Takeshita, Hidefumi [Japan Atomic Energy Research Inst., Takasaki, Gunma (Japan). Takasaki Radiation Chemistry Research Establishment

    1997-03-01

    Thermal annealing behavior is studied in {alpha}-Al{sub 2}O{sub 3} implanted with {sup 93}Nb{sup +} using RBS/channeling technique and optical absorption spectrometry. The samples with <0001> and <112-bar0> orientations are implanted with 300 keV and 400 keV {sup 93}Nb{sup +} ions. Thermal annealing under reducing environment (Ar+3%H{sub 2}) is employed in the temperature range from 600 to 1000degC to explore unusual materials phase. The annealing up to 1000degC for an hour does not show any essential change in RBS/channeling spectra in two kinds of samples but the significant decrease in the visible region is observed in optical absorption spectra. After annealing at 1000degC for 10 hours, the recovery of the lattice damage is detected by RBS/channeling analysis especially in (112-bar0) sample. In the optical absorption spectra, new absorption envelope appears in the ultraviolet region. The results are related to the formation of niobium metal fine particles, and the sharp distribution is realized especially in (0001) sample. (author)

  6. Achados na triagem imitanciométrica e de processamento auditivo em escolares Acoustic immitance and auditory processing screening findings in school children

    Directory of Open Access Journals (Sweden)

    Camila Lucia Etges

    2012-12-01

    Full Text Available OBJETIVOS: verificar os achados da triagem imitanciométrica e dos testes da avaliação simplificada de processamento auditivo em escolares. MÉTODO: participaram da pesquisa alunos de 1ª a 4ª séries, de sete a dez anos de idade, de uma escola de ensino público de Porto Alegre. Foram avaliados 130 escolares na triagem imitanciométrica, que foi constituída por timpanometria e pesquisa do reflexo acústico ipsilateral e avaliação simplificada do processamento auditivo, incluindo testes de localização sonora, memória sequencial para sons verbais e memória sequencial para sons não verbais. RESULTADOS: na triagem imitanciométrica 43,08% dos escolares passaram, tendo a curva tipo A como mais frequente. O reflexo acústico em 4000 Hz teve percentual de presença inferior comparado com os demais. Passaram nos testes da avaliação simplificada do processamento auditivo 76,15% das crianças. Além disso, foi observado que o teste no qual os escolares obtiveram pior desempenho foi o de memória sequencial para sons verbais. Falharam na triagem imitanciométrica e na avaliação simplificada de processamento auditivo 12,3% dos escolares. CONCLUSÃO: a curva timpanométrica tipo A foi a mais frequente na população estudada. Na avaliação simplificada do processamento auditivo a maioria dos sujeitos passou, tendo maior frequência de acertos no teste de localização sonora. Não houve associação estatística entre o resultado da triagem imitanciométrica e o resultado da avaliação simplificada de processamento auditivo.PURPOSE: to check acoustic immittance screening findings and results of the simplified evaluation of auditory processing in school children. METHOD: the subjects under this study were students from the 1st to the 4th grade, with ages ranging from seven to ten year-old, from a public school in Porto Alegre. 130 students were evaluated in the immitance screening, which consisted of a tympanometry and an ipsilateral

  7. Influence of static magnetic fields on S. cerevisae biomass growth

    Directory of Open Access Journals (Sweden)

    João B. Muniz

    2007-05-01

    Full Text Available Biomass growth of Saccharomyces cerevisiae DAUFPE-1012 was studied in eight batch fermentations exposed to steady magnetic fields (SMF running at 23ºC (± 1ºC, for 24 h in a double cylindrical tube reactor with synchronic agitation. For every batch, one tube was exposed to 220mT flow intensity SMF, produced by NdFeB rod magnets attached diametrically opposed (N to S magnets on one tube. In the other tube, without magnets, the fermentation occurred in the same conditions. The biomass growth in culture (yeast extract + glucose 2% was monitored by spectrometry to obtain the absorbance and later, the corresponding cell dry weight. The culture glucose concentration was monitored every two hours so as the pH, which was maintained between 4 and 5. As a result, the biomass (g/L increment was 2.5 times greater in magnetized cultures (n=8 as compared with SMF non-exposed cultures (n=8. The differential (SMF-control biomass growth rate (135% was slightly higher than the glucose consumption rate (130 % leading to increased biomass production of the magnetized cells.O crescimento da biomassa da Saccharomyces cerevisiae DAUFPE-1012 foi estudado em oito bateladas de fermentação, cada uma exposta aos campos magnéticos contínuos (CMC, à 23ºC (± 1ºC, durante um período de 24 horas em um reator duplo com agitação sincrônica. Em cada batelada,um tubo foi exposto ao CMC, com 220mT de intensidade de fluxo, produzidos por imãs de NdFeB fixados diametralmente opostos (N para S em um tubo do reator de fermentação. Em outro tubo, sem imãs, a fermentação ocorreu nas mesmas condições. O crescimento da biomassa nas culturas (extrato de fermento + glicose 2% foi monitorado através de espectrometria e correlacionado ao peso seco de levedura. A concentração de glicose nas culturas foi monitorada a cada duas horas e o pH foi mantido entre 4 e 5. Como resultado, a biomassa (g/L aumentou 2,5 vezes nas culturas magnetizadas (n=8 quando comparadas com as

  8. Avaliação da nanofiltração e da osmose inversa na remoção de carbofurano em águas de abastecimento

    Directory of Open Access Journals (Sweden)

    Marcelo Zawadzki Bueno

    Full Text Available RESUMO: A complexidade físico-química de micropoluentes, como os defensivos agrícolas, exige o uso de tecnologias avançadas de tratamento de água para abastecimento. O objetivo deste estudo foi avaliar a remoção de carbofurano em nível de bancada (batelada utilizando membranas comerciais de nanofiltração (NF90 - DowFilmtec (r e osmose inversa (HR - Koch Membrane Systems(r . Nos experimentos foi avaliada a influência da qualidade da matriz de alimentação (água ultrapura, bruta e pré-tratada contendo carbofurano (50 µgL-1, e da pressão de operação (8 e 15 bar para a NF90 e 15 e 30 bar para a HR. Para a NF90, com a matriz de água ultrapura, as eficiências de remoção foram inferiores (89,8%, porém o fluxo permeado foi superior (132,1 Lm-2h-1 àquelas obtidas com a matriz de água bruta (98,4% - 94,7 Lm-2h-1 e água pré-tratada (95,2% - 95,3 Lm-2h-1 para a pressão de 15 bar. Para a membrana HR, remoções relativamente superiores foram observadas para a pressão de 30 bar para as três matrizes, com a água bruta apresentando os melhores resultados (99,7% - 49,7 Lm-2h-1. Concluiu-se, portanto, que o pré-tratamento da água bruta não acarretou diferença significativa na remoção do carbofurano e não influenciou no fluxo de permeado de acordo com a metodologia adotada (baixo tempo de separação em batelada com recirculação.

  9. Batch and continuous extraction of bromelain enzyme by reversed micelles

    Directory of Open Access Journals (Sweden)

    Ana Maria Frattini Fileti

    2009-10-01

    Full Text Available The main aim of this study was to optimize the conditions for bromelain extraction by reversed micelles from pineapple juice (Ananas comosus. The purification was carried out in batch extraction and a micro-column with pulsed caps for continuous extraction. The cationic micellar solution was made of BDBAC as a surfactant, isooctane as a solvent and hexanol as a co-solvent. For the batch process, a purification factor of 3 times at the best values of surfactant agent, co-solvent and salt concentrations, pH of the back and forward extractions were, 100 mM, 10% v/v, 1 M, 3.5 and 8, respectively. For the continuous operation, independent variables optimal point was determined: ratio between light phase flow rate and total flow rate equal to 0.67 and 1 second for the time interval between the pulses. This optimal point led to a productivity of 1.29 mL/min and a purification factor of 4.96.Este trabalho teve como objetivo principal otimizar as condições para extração da bromelina do suco do abacaxi (Ananas comosus por micelas reversas. A purificação foi feita usando o processo de extração em batelada e contínuo, este último em uma micro-coluna de campânulas pulsantes. A solução micelar catiônica foi preparada com o surfactante BDBAC, i-octano como solvente e hexanol como co-solvente. Na extração em batelada encontrou-se um fator de purificação de 3 vezes, e seus melhores valores de concentração do agente surfactante, co-solvente e sal, de pH da re-extração e extração, foram respectivamente iguais a: 100 mM, 10% v/v, 1 M, 3,5 e 8. Para a operação contínua, as variáveis independentes ótimas foram: 0,67 para a razão entre as taxas de fluxos da fase leve e a total e 1 s para o intervalo de tempo entre pulsos das campânulas. Este ponto ótimo leva a uma produtividade de 1,29 mL/min e a um fator de purificação igual a 4,96.

  10. Gerando planos de produção através de um problema linear quadrático Gaussiano com restrições nas variáveis de decisão

    Directory of Open Access Journals (Sweden)

    Oscar S. Silva Filho

    2010-04-01

    Full Text Available Neste artigo um problema sequencial de planejamento agregado da produção é formulado como um modelo de otimização sequencial do tipo Linear-Quadrático Gaussiano (LQG com restrições probabilísticas nas variáveis de estado e controle. Este problema está baseado em um modelo clássico desenvolvido por Holt, Modigliani, Muth e Simon, e conhecido na literatura como modelo HMMS. Como ideia central do trabalho busca-se estender o modelo original HMMS de modo que ele possa levar em conta restrições de chance nas variáveis de decisão e também uma representação do tipo ARMA como modelo de flutuação de demanda. Essencialmente, o artigo examina as principais características que permitem transformar o modelo HMMS para um padrão LQG com restrições de chances. Além disso, duas heurísticas subótimas muito simples são apresentadas como estratégias de resolução para este tipo de problema. Por fim, um exemplo ilustrativo de como gerar planos de produção agregados via o modelo proposto, é apresentado.A single product, multi-period, aggregate production planning problem is formulated as a Linear-Quadratic Gaussian (LQG optimal control problem with probabilistic constraints on state and control variables. This stochastic problem is based on a classical model developed by Holt, Modigliani, Muth and Simon, and known in the literature as HMMS model. The central idea is to extend the original HMMS model in order to take into account both chance-constraints on the decision variables and an ARMA forecasting model to represent the fluctuation of demand. Essentially, the paper discusses the main features that allow transforming the problem into a chance constrained LQG pattern. In addition, two sub-optimal techniques for solving this kind of problem are briefly described. At last, an illustrative example of how to provide aggregate production plans from the proposed problem is presented.

  11. Advanced characterization of materials using swift ion beams

    International Nuclear Information System (INIS)

    Tabacniks, Manfredo H.

    2011-01-01

    Swift ion beams are powerful non destructive tools for material analysis especially thin films. In spite of their high energy, usually several MeV/u, little energy is deposited by the ion on the sample. Energetic ions also use to stop far away (or outside) the inspected volume, hence producing negligible damage to the sample. Ion beam methods provide quantitative trace element analysis of any atomic element (and some isotopes) in a sample and are able to yield elemental depth profiles with spatial resolution of the order of 10mm. Relying on nuclear properties of the atoms, these methods are insensitive to the chemical environment of the element, consequently not limited by matrix effects. Ion beam methods are multielemental, can handle insulating materials, are quick (an analysis usually takes less than 15 minutes), and need little (if any) sample preparation. Ion beams are also sensitive to surface roughness and sample porosity and can be used to quickly inspect these properties in a sample. The Laboratory for Ion Beam Analysis of the University of Sao Paulo, LAMFI, is a multi-user facility dedicated to provide Ion Beam Methods like PIXE, RBS, FRS and NRA techniques for the analysis of materials and thin films. Operating since 1994, LAMFI is being used mostly by many researchers from within and outside USP, most of them non specialists in ion beam methods, but in need of ion beam analysis to carry out their research. At LAMFI, during the last 9 years, more than 50% of the accelerator time was dedicated to analysis, usually PIXE or RBS. 21% was down time and about 14% of the time was used for the development of ion beam methods which includes the use of RBS for roughness characterization exploring the shading of the beam by structures on the surface and by modeling the RBS spectrum as the product of a normalized RBS spectrum and a height density distribution function of the surface. Single element thick target PIXE analysis is being developed to obtain the thin

  12. Cohesin mediates Esco2-dependent transcriptional regulation in a zebrafish regenerating fin model of Roberts Syndrome

    Directory of Open Access Journals (Sweden)

    Rajeswari Banerji

    2017-12-01

    Full Text Available Robert syndrome (RBS and Cornelia de Lange syndrome (CdLS are human developmental disorders characterized by craniofacial deformities, limb malformation and mental retardation. These birth defects are collectively termed cohesinopathies as both arise from mutations in cohesion genes. CdLS arises due to autosomal dominant mutations or haploinsufficiencies in cohesin subunits (SMC1A, SMC3 and RAD21 or cohesin auxiliary factors (NIPBL and HDAC8 that result in transcriptional dysregulation of developmental programs. RBS arises due to autosomal recessive mutations in cohesin auxiliary factor ESCO2, the gene that encodes an N-acetyltransferase which targets the SMC3 subunit of the cohesin complex. The mechanism that underlies RBS, however, remains unknown. A popular model states that RBS arises due to mitotic failure and loss of progenitor stem cells through apoptosis. Previous findings in the zebrafish regenerating fin, however, suggest that Esco2-knockdown results in transcription dysregulation, independent of apoptosis, similar to that observed in CdLS patients. Previously, we used the clinically relevant CX43 to demonstrate a transcriptional role for Esco2. CX43 is a gap junction gene conserved among all vertebrates that is required for direct cell-cell communication between adjacent cells such that cx43 mutations result in oculodentodigital dysplasia. Here, we show that morpholino-mediated knockdown of smc3 reduces cx43 expression and perturbs zebrafish bone and tissue regeneration similar to those previously reported for esco2 knockdown. Also similar to Esco2-dependent phenotypes, Smc3-dependent bone and tissue regeneration defects are rescued by transgenic Cx43 overexpression, suggesting that Smc3 and Esco2 cooperatively act to regulate cx43 transcription. In support of this model, chromatin immunoprecipitation assays reveal that Smc3 binds to a discrete region of the cx43 promoter, suggesting that Esco2 exerts transcriptional regulation of cx

  13. Treatment and prognosis of patients with late rectal bleeding after intensity-modulated radiation therapy for prostate cancer

    International Nuclear Information System (INIS)

    Takemoto, Shinya; Kataoka, Hiromi; Mimura, Mikio; Shibamoto, Yuta; Ayakawa, Shiho; Nagai, Aiko; Hayashi, Akihiro; Ogino, Hiroyuki; Baba, Fumiya; Yanagi, Takeshi; Sugie, Chikao

    2012-01-01

    Radiation proctitis after intensity-modulated radiation therapy (IMRT) differs from that seen after pelvic irradiation in that this adverse event is a result of high-dose radiation to a very small area in the rectum. We evaluated the results of treatment for hemorrhagic proctitis after IMRT for prostate cancer. Between November 2004 and February 2010, 403 patients with prostate cancer were treated with IMRT at 2 institutions. Among these patients, 64 patients who developed late rectal bleeding were evaluated. Forty patients had received IMRT using a linear accelerator and 24 by tomotherapy. Their median age was 72 years. Each patient was assessed clinically and/or endoscopically. Depending on the severity, steroid suppositories or enemas were administered up to twice daily and Argon plasma coagulation (APC) was performed up to 3 times. Response to treatment was evaluated using the Rectal Bleeding Score (RBS), which is the sum of Frequency Score (graded from 1 to 3 by frequency of bleeding) and Amount Score (graded from 1 to 3 by amount of bleeding). Stoppage of bleeding over 3 months was scored as RBS 1. The median follow-up period for treatment of rectal bleeding was 35 months (range, 12–69 months). Grade of bleeding was 1 in 31 patients, 2 in 26, and 3 in 7. Nineteen of 45 patients (42%) observed without treatment showed improvement and bleeding stopped in 17 (38%), although mean RBS did not change significantly. Eighteen of 29 patients (62%) treated with steroid suppositories or enemas showed improvement (mean RBS, from 4.1 ± 1.0 to 3.0 ± 1.8, p = 0.003) and bleeding stopped in 9 (31%). One patient treated with steroid enema 0.5-2 times a day for 12 months developed septic shock and died of multiple organ failure. All 12 patients treated with APC showed improvement (mean RBS, 4.7 ± 1.2 to 2.3 ± 1.4, p < 0.001) and bleeding stopped in 5 (42%). After adequate periods of observation, steroid suppositories/enemas are expected to be effective. However, short

  14. Treatment and prognosis of patients with late rectal bleeding after intensity-modulated radiation therapy for prostate cancer

    Directory of Open Access Journals (Sweden)

    Takemoto Shinya

    2012-06-01

    Full Text Available Abstract Background Radiation proctitis after intensity-modulated radiation therapy (IMRT differs from that seen after pelvic irradiation in that this adverse event is a result of high-dose radiation to a very small area in the rectum. We evaluated the results of treatment for hemorrhagic proctitis after IMRT for prostate cancer. Methods Between November 2004 and February 2010, 403 patients with prostate cancer were treated with IMRT at 2 institutions. Among these patients, 64 patients who developed late rectal bleeding were evaluated. Forty patients had received IMRT using a linear accelerator and 24 by tomotherapy. Their median age was 72 years. Each patient was assessed clinically and/or endoscopically. Depending on the severity, steroid suppositories or enemas were administered up to twice daily and Argon plasma coagulation (APC was performed up to 3 times. Response to treatment was evaluated using the Rectal Bleeding Score (RBS, which is the sum of Frequency Score (graded from 1 to 3 by frequency of bleeding and Amount Score (graded from 1 to 3 by amount of bleeding. Stoppage of bleeding over 3 months was scored as RBS 1. Results The median follow-up period for treatment of rectal bleeding was 35 months (range, 12–69 months. Grade of bleeding was 1 in 31 patients, 2 in 26, and 3 in 7. Nineteen of 45 patients (42% observed without treatment showed improvement and bleeding stopped in 17 (38%, although mean RBS did not change significantly. Eighteen of 29 patients (62% treated with steroid suppositories or enemas showed improvement (mean RBS, from 4.1 ± 1.0 to 3.0 ± 1.8, p = 0.003 and bleeding stopped in 9 (31%. One patient treated with steroid enema 0.5-2 times a day for 12 months developed septic shock and died of multiple organ failure. All 12 patients treated with APC showed improvement (mean RBS, 4.7 ± 1.2 to 2.3 ± 1.4, p  Conclusions After adequate periods of observation, steroid suppositories

  15. A lithium depth-marker technique for rapid erosion and deposition measurements

    International Nuclear Information System (INIS)

    Sullivan, R.M.; Pang, A.; Martinez-Sanchez, M.; Whyte, D.G.

    2014-01-01

    Highlights: • Rutherford backscattering spectrometry (RBS) to determine the change in depth. • Rutherford backscattering spectrometry (RBS) to determine the change in depth. • Rutherford backscattering spectrometry (RBS) to determine the change in depth. -- Abstract: A novel, high-resolution technique has been developed for the measurement of erosion and deposition in solid material surfaces. The technique uses a combination of nuclear reaction analysis (NRA) and Rutherford backscattering spectrometry (RBS) to determine the change in depth of a previously implanted marker layer consisting of 7 Li. A scoping study shows that 7 Li is an ideal marker candidate due to a high Q (∼18 MeV) nuclear reaction, 7 Li(p,α) 4 He. Net erosion or deposition is measured by NRA of modified alpha energy passing through the bulk material. The reaction’s high cross-section provides for the fast time resolution needed to measure erosion from high flux plasmas, and a highly penetrating proton beam provides for a large range of erosion/deposition measurements. Additionally, the implantation of low-Z Li leads to relatively low vacancy concentrations in the solid material due to implantation. This technique thus provides greater assurance that the measured erosion rate is indicative of the solid material: due to both the low vacancy production and the fact that no films or deposits are involved. Validation was performed by comparing the measured and predicted amount of erosion based on previously measured sputtering yields; the two were found to agree, within the uncertainty of the experiment. The depth resolution of the techniques is ∼60 nm at a net erosion depth of about 1 μm. The benefits of this technique are summarized as: short time scales (minutes) to obtain results, the marker layer can be used in any solid material, greater assurance that the measured erosion is indicative of the unperturbed solid material, and the continuous monitoring of the surface composition for

  16. Radiation level survey of a mobile phone base station

    International Nuclear Information System (INIS)

    Campos, M.C.; Schaffer, S.R.

    2006-01-01

    Electromagnetic field (E.M.F.) evaluations were carried out in the surroundings of a roof-top mobile-phone radio-base station (R.B.S.). Four of its sector-panel antennas are installed on two parallel vertical masts, each supporting two panels in a vertical collinear-array. The geometry is such that the vertical plane containing both masts is about 10 meters distant and parallel to the backside of an educational institution. This proximity provoked great anxiety among the local community members regarding potential health hazards.1. Introduction: To keep up with the expansion of the mobile-phone services, the number of Radio-Base Stations (R.B.S.) installations is increasing tremendously in Brazil. Efficient control and radiation monitoring to assess R.B.S. compliance to existing regulations are still lacking and particularly in big cities, clearly non - compliant R.B.S. can be seen which represent potentially hazardous E.M.F. sources to the nearby population. This first survey of an irregular R.B.S. revealed significant E-field strengths outside, as well as inside a classroom of an educational building where an usually prolonged stay is necessary. These results confirm that this problem deserves further attention, moreover, if one considers that public and occupational exposure limits set by I.C.N.I.R.P. (also adopted in Brazil) are exclusively based on the immediate thermal effects of acute exposure, disregarding any potential health risk from prolonged exposure to lower level radiation. Research activities focusing on quantitative aspects of electromagnetic radiation from R.B.S., as well as on biological and adverse health effects are still at a very incipient level, urging for immediate actions to improve this scenario in our country. 2. Material, methods and results Measurements were carried out with a broadband field strength monitor, E.M.R.-300 (W and G) coupled to an isotropic E-field probe (100 khz to 3 GHz). Preliminary measurements helped locating

  17. Fermentation of sweet whey by recombinant Escherichia coli K011 Fermentação de soro de leite por Escherichia coli KO11 recombinante

    Directory of Open Access Journals (Sweden)

    Amarildo Ricardo Leite

    2000-09-01

    Full Text Available The production of ethanol from sweet whey using the recombinant Escherichia coli KO11, in batch fermentation, was tested. The maximum ethanol yield was reached after 96h, representing only 38% of the theoretical yield. The supplementation of whey with components of LB broth increased the maximum yield to 96% in 72h. The addition of 0.5% yeast extract to whey resulted in maximum yield of 74% at 36h and it increased to over 100% when yeast extract and trace metals solution (Fe++, Mn++ and Zn++ were added.A produção de etanol a partir de soro de leite empregando a cepa Escherichia coli KO11 recombinante, em fermentação de batelada, foi testada. O rendimento máximo de etanol foi obtido em 96h, representando apenas 38% do rendimento teórico. A suplementação do soro com os componentes do caldo LB aumentou o rendimento para 96% em 72h. A adição de 0,5% de extrato de levedura ao soro resultou em um rendimento máximo de 74% em 36h que aumentou para acima de 100% quando se adicionou extrato de levedura e uma solução de metais traço (Fe++, Mn++ e Zn++.

  18. AVALIAÇÃO DA SEDIMENTABILIDADE DE BIOMASSA GRANULAR E FLOCULENTA EM SISTEMAS DE LODO ATIVADO

    Directory of Open Access Journals (Sweden)

    Jéssyca de Freitas Lima

    2014-07-01

    Full Text Available A sedimentação é uma importante operação unitária no tratamento de esgotos, pois pode definir o desenvolvimento de projetos mais econômicos. A pesquisa visou avaliar a sedimentabilidade de biomassa aeróbia granular e floculenta. Foram montados dois sistemas de lodo ativado, um sistema University of Cape Town - UCT com características de lodo floculento e um reator em bateladas sequenciais com estratégias para a granulação aeróbia - RBSG. Com os resultados obtidos foi possível afirmar que o lodo granular obteve uma velocidade de sedimentação elevada (35 m/h, sendo superior à velocidade considerada ideal pela literatura especializada (faixa de 6 a 10 m/h. Já o sistema UCT teve uma média de 7,9 m/h. Foi confirmado que o lodo granular do reator intermitente além da vantagem de maior acúmulo de sólidos no sistema e menor espaço construtivo, também é capaz de tratar mais esgoto por unidade de tempo quando comparado ao sistema contínuo com lodo floculento (UCT. Isso faz com que a escolha por sistemas granulares aeróbios se torne cada vez mais atrativa para o tratamento de efluentes de diferentes naturezas.

  19. Encapsulamento do Dióxido de Titânio (TiO2 pela Técnica de Polimerização em Emulsão

    Directory of Open Access Journals (Sweden)

    Oliveira Adriano M.

    2002-01-01

    Full Text Available Este trabalho apresenta uma metodologia de encapsulamento do TiO2 pela técnica de polimerização em emulsão. O pigmento foi previamente modificado por um titanato em heptano. O titanato usado foi o tri-isoestearato iso-propoxi de titânio, que reage com os grupos hidroxilas da superfície do TiO2. O pigmento modificado foi encapsulado por metacrilato de metila (MMA, usando persulfato de amônio como iniciador e dodecil sulfato de sódio (SDS como emulsificante. A reação de encapsulamento foi conduzida em um reator de vidro encamisado, utilizando dois processos de polimerização diferentes: batelada e semi-contínuo. A caracterização do pigmento modificado foi feita pela técnica de Infravermelho com Transformada de Fourier (FTIR. Os rendimentos das reações de modificação e de encapsulamento foram determinados pela técnica de Análise Termogravimétrica (TGA.

  20. COMPORTAMENTO DOS SÓLIDOS TOTAIS NO PROCESSO DE DIGESTÃO ANAERÓBIA DE RESÍDUOS SÓLIDOS URBANOS E INDUSTRIAIS

    Directory of Open Access Journals (Sweden)

    Valderi Duarte Leite

    1999-08-01

    Full Text Available RESUMO O processo de digestão anaeróbia pode ser aplicado para bioestabilizar uma grande variedade de substratos. Neste trabalho, empregou-se o processo de digestão anaeróbia à fração orgânica putrescível dos resíduos sólidos urbanos, tomando-se como parâmetros avaliativos os sólidos totais e os sólidos totais voláteis. O trabalho foi realizado em quatro reatores anaeróbios de batelada, com capacidade unitária de 50 L e a análise dos seus dados mostra que é possível se empregar o processo de digestão anaeróbia a esse tipo de substrato que, além de bioestabilizar a matéria orgânica putrescível, produz gás metano, que pode ser utilizado como fonte alternativa de energia para fins domésticos e industriais.

  1. Redução de Bactérias Indicadoras de Poluição Fecal em Estrume de Aves de Postura Tratados por Biodigestão Anaeróbia

    Directory of Open Access Journals (Sweden)

    Amaral LA1

    2000-01-01

    Full Text Available A digestão anaeróbia pode auxiliar na redução de patógenos e poluição ambiental pela redução dos sólidos e microrganismos de presença indesejável nos efluentes. No presente trabalho objetivou-se a avaliação da redução de microorganismos indicadores de contaminação fecal através do processo de biodigestão anaeróbica de dejetos de aves de postura em biodigestores contínuos, operados em diferentes tempos de retenção hidráulica (TRH: 40, 30, 25, 20 e 15 dias, e biodigestores de batelada com e sem a utilização de inóculo. Foi observada nos dois tipos de biodigestores uma redução acima de 99,0% para os coliformes totais e fecais, mostrando a eficiência do processo. Os resultados obtidos no presente trabalho mostram que o processo de biodigestão anaeróbia melhora a qualidade microbiológica do estrume, constituindo-se uma medida preventiva importante para se preservar a qualidade do solo e dos mananciais de água, quando da sua aplicação como biofertilizante.

  2. Modelagem do efeito do pH na biossorção de metais pela alga marinha Sargassum filipendula - doi: 10.4025/actascitechnol.v33i4.7605

    Directory of Open Access Journals (Sweden)

    Márcia Regina Fagundes-Klen

    2011-09-01

    Full Text Available Neste trabalho foi estudada a biossorção, em solução monocomponente, dos íons Cu2+, Cd2+ e Zn2+ pela alga marinha Sargassm filipendula pré-tratada com CaCl2 0,5 M. Os experimentos foram realizados em reator batelada, em diferentes pHs fixos (3,0; 4,0; 5,0 e 6,0 e 30ºC. Todos os dados de equilíbrio obtidos foram representados empregando dois modelos de isotermas de adsorção dependentes do pH, baseados na isoterma de Langmuir. Redes neurais artificiais também foram utilizadas para representar o efeito do pH sobre o equilíbrio da biossorção, sendo as variáveis de entrada da rede a concentração de equilíbrio do metal e o respectivo pH e, como variável de saída, a quantidade adsorvida pela biomassa. Os resultados mostraram que a modelagem utilizando as redes neurais artificiais foi mais eficiente do que a modelagem através das isotermas de adsorção.

  3. Sorção e mobilidade do lítio em solos de áreas de disposição final de resíduos sólidos urbanos

    Directory of Open Access Journals (Sweden)

    Luiz Fernando Coutinho de Oliveira

    2013-06-01

    Full Text Available Um dos grandes problemas da atualidade é a disposição inadequada dos resíduos sólidos urbanos no solo, e seus efeitos recaem, principalmente, na contaminação das águas e do solo. Este trabalho objetivou o estudo da sorção e da mobilidade do Lítio nos solos das áreas de disposição de resíduos sólidos urbanos dos municípios de Lavras, Campo Belo e Pouso Alegre, MG. A partir dos ensaios de sorção em batelada e mobilidade do Li em colunas de solo, ajustaram-se os parâmetros das isotermas de Freundlich e da equação de transporte de solutos no solo. Pelos resultados obtidos verificou-se que, dentre os solos avaliados, o do município de Lavras foi o que apresentou a maior mobilidade do Li seguido dos solos de Pouso Alegre e Campo Belo, sendo, portanto, mais vulnerável à contaminação das águas subterrâneas.

  4. Descoloração do corante Azul Brilhante de Remazol R por leveduras isoladas de moluscos do Rio Subaé, no estado da Bahia, Brasil

    Directory of Open Access Journals (Sweden)

    Liliane Andrade Sande da Silva

    2017-08-01

    Full Text Available RESUMO Os objetivos deste trabalho foram estudar o potencial de descoloração do corante Azul Brilhante de Remazol R (RBBR por cinco isolados de leveduras identificados como OJU2, SJL6, SF5, SJ10 e SJU5, otimizar as condições de crescimento das leveduras e verificar a toxicidade do produto obtido após a descoloração. Para isso, foram realizados ensaios em batelada variando os seguintes parâmetros: pH (2 a 8, concentração de glicose (0 a 3%, concentração do corante (25 a 100 ppm e temperatura (20 a 40ºC. As leveduras mostraram capacidade de descolorir o RBBR com eficiência entre 80 e 93%, depois de 24 horas. A melhor condição para descoloração do RBBR ocorreu em pH ácido, 2% de glicose, 25 ppm do corante e 25ºC. Com os ensaios com Artemia salina, foi observado diminuição da toxicidade após tratamento com os isolados SJ10 e SJU5, depois de 120 horas de incubação.

  5. Estratégia de análise da qualidade de madeira de Eucalyptus sp. para produção de celulose A laboratory technique to establish Eucalyptus sp. wood quality for kraft pulp production

    Directory of Open Access Journals (Sweden)

    José Lívio Gomide

    2004-06-01

    Full Text Available Estudou-se uma nova técnica laboratorial de análise de qualidade da madeira de Eucalyptus sp. para produção de polpa celulósica kraft. A técnica consiste em realizar, simultaneamente, quatro cozimentos de cavacos utilizando diferentes cargas de álcali ativo para estabelecer a característica de deslignificação da madeira. Pelo uso de equações de regressão, calcula-se o álcali ativo necessário para obter o número kappa desejado, o rendimento, a viscosidade e álcali consumido para o kappa objetivo. Os estudos estatísticos evidenciaram que uma única batelada de quatro cozimentos é suficiente, não sendo necessário realizar repetições.A new laboratory technique was tested to determine Eucalyptus sp. wood quality for kraft pulp production. This technique consists in performing four cooks simultaneously using different active alkali charges to establish the wood delignification characteristics. Based on regression equation it is possible to determine the alkali charge necessary to obtain a desired kappa number and the yield, viscosity and the alkali consumed for the target kappa. Statistical analysis demonstrated that a set of four cooks without replication is sufficient to determine the wood quality characteristics.

  6. Alternativas De Comercialização Cinematográfica: novas janelas e o caso 3 efes

    Directory of Open Access Journals (Sweden)

    Maria Cristina Couto Melo

    2012-12-01

    Full Text Available O modelo industrial de produção cinematográfica estrutura-se a partir da divisão da realização de um filme entre os setores de produção, distribuição e exibição, e da oferta gradual e sequencial de conteúdos nas janelas de exibição. Em contrapartida, o desenvolvimento das novas mídias e da convergência dos meios comunicacionais resultou em um modelo que propõe a exibição de conteúdos em múltiplas janelas e produção por demanda de nichos. O presente artigo propõe a discussão e compreensão do papel das novas janelas de exibição, potencializadas pela convergência dos veículos midiáticos, enquanto alternativas de difusão de conteúdo audiovisual.

  7. Narrar, mostrar, ver: como analisar um álbum de fotos de família em conexão com uma entrevista narrativa = Narrating, showing, seeing: how to analyze a family photo album in connection with a narrative interview

    Directory of Open Access Journals (Sweden)

    Breckner, Roswitha

    2014-01-01

    Full Text Available Álbuns de fotos de família são lugares onde memórias são criadas e fixadas (Chalfen, 1987. Eles consistem principalmente de fotografias e outros tipos de material visual (cartões postais, bilhetes ou ingressos etc. , bem como de legendas e comentários mais ou menos extensos. Tradicionalmente, os retratos são organizados em um livreto, isto é, em uma ordem sequencial que se baseia implicitamente em uma estrutura pictórica e narrativa de apresentação e criação de uma “moldura familiar” (Hirsch, 1997[2002]. Como emerge uma imagem específica de “família”, fundamentada em experiências e convenções, quando se cria e olha um álbum de fotos de família? Enfocando esta pergunta geral, neste artigo se apresenta a análise de um álbum de família. Com isso, tornar-se-á visível a maneira metodológica de interpretar uma autoapresentação pictórica. Os resultados desta análise são combinados e contextualizados por uma entrevista narrativa biográfica

  8. Consciência fonológica de vinte e três disléxicos falantes do Português

    Directory of Open Access Journals (Sweden)

    Vera Pedreira dos Santos Pepe

    2017-12-01

    Full Text Available O presente estudo, com recorte transversal, investiga o desempenho de sujeitos disléxicos em tarefas de consciência fonológica, a partir do enfoque teórico do déficit de processamento fonológico da dislexia. A amostra é composta por 23 sujeitos disléxicos, falantes do português brasileiro, nas faixas etárias entre 8;0 e 14;11. O instrumento utilizado para a coleta de dados foi o CONFIAS, Consciência Fonológica: Instrumento de Avaliação Sequencial (MOOJEN et alii, 2003, que avalia a consciência fonológica nos níveis da sílaba e do fonema. Os resultados mostraram que, no nível da sílaba, a tarefa mais difícil foi a Produção de Rima; no nível do fonema, foi a Transposição. Os resultados evidenciaram, também, o uso de estratégias linguísticas, a exemplo de Associação Fonológica, Associação Semântica, entre outras.

  9. Primeiro caso de febre maculosa brasileira branda associada à artrite

    Directory of Open Access Journals (Sweden)

    Virgínia Lucia Nazario Bonoldi

    2014-06-01

    Full Text Available Descrevemos o primeiro caso brasileiro de Riquetsiose branda, agravada por monoartrite em joelho, em adulto jovem picado por carrapato na perna esquerda na região de Camburi, localizada no município de São Sebastião, sul da região costeira do estado de São Paulo, Mata Atlântica, Brasil. O paciente apresentou uma escara de inoculação no local da picada do carrapato, associada ao aumento ganglionar em virilha esquerda, febre, poliartralgia, cefaleia e erupção macular. Vinte dias após o episódio da picada de carrapato, o paciente apresentou monoartrite em joelho direito. O diagnóstico de Riquetsiose branda foi estabelecido pela análise imunológica sequencial em amostras de soro e líquido sinovial, tendo sido empregada a técnica de imunofluorescência (IF indireta para anticorpos reativos contra Rickettsia parkeri e Rickettsia rickettsii. A Riquetsiose branda é uma zoonose emergente, que deve ser investigada pelos médicos, incluindo reumatologistas, em pacientes que apresentem erupção macular, febre e, eventualmente, artrite, após visita ao sul da região costeira da Mata Atlântica no Brasil.

  10. Literatura e Quadrinhos: A Experiência da Visualidade em O Ateneu

    Directory of Open Access Journals (Sweden)

    Benedito Teixeira de Sousa

    2017-10-01

    Full Text Available O romance O Ateneu, de Raul Pompéia, ainda provoca discussões quanto à sua filiação estética. Publicado no auge do realismo/naturalismo no Brasil, o texto apresenta um estilo predominantemente impressionista, com uma força visual que impressiona e denuncia, enfocando aspectos sociais e afetivo-sexuais no contexto de um internato. Com foco na personagem infantil Sérgio, o protagonista e narrador-personagem, pretendemos verificar neste artigo como o texto escrito é recriado pela versão em arte sequencial (história em quadrinhos, publicada por Marcelo Quintanilla, em 2012. O objetivo principal é tentar entender como o artista/roteirista conseguiu captar o olhar do narrador-personagem sobre o mundo do internato, e, em especial, os episódios que evidenciam as relações de cunho homoafetivo vividas por Sérgio, e materializar esta visualidade.

  11. Potências animadas do traço: fixidez e animação da caricatura no humor gráfico

    Directory of Open Access Journals (Sweden)

    Benjamim Picado

    2012-06-01

    Full Text Available Este artigo pretende examinar certos aspectos das relações entre o desenho e a representação de ações, a partir de um exame sobre tirinhas diárias. Estamos especialmente preocupados com a complementaridade entre os traços estilísticos da caricatura e a questão da compreensão sobre a animação potencial de sua apresentação plástica. Trabalhada a partir do sentido de mudança e de expressividade de seus motivos, a representação fisionômica na caricatura cumpre funções preparatórias para os regimes de significação narrativa na arte sequencial. Numa tal perspectiva, a morfologia dos caracteres do humor gráfico seria mais bem explanada se sua graça cômica fosse considerada como parte do problema geral de um estilo “lacunar” ou “expressivo” da caricatura.

  12. Adaptação cultural e propriedades psicométricas iniciais do instrumento DISABKIDS ® – Cystic Fibrosis Module – versão brasileira

    Directory of Open Access Journals (Sweden)

    Danielle Maria de Souza Serio dos Santos

    2013-12-01

    Full Text Available Este estudo objetivou adaptar culturalmente e descrever as propriedades psicométricas iniciais do instrumento de mensuração de qualidade de vida relacionada à saúde DISABKIDS® − Cystic Fibrosis Module para crianças e adolescentes e seus pais/cuidadores. Estudo metodológico de desenvolvimento sequencial, incluindo 126 participantes em quatro estados brasileiros. Envolveu tradução e retrotradução dos itens, equivalência conceitual e semântica, validade de face e descrição das propriedades psicométricas iniciais relacionadas ao construto e fidedignidade . Para equivalência semântica da versão adaptada houve ajustes na redação de um item. O instrumento apresentou consistência interna satisfatória com valores de alfa de Cronbach entre 0,70 e 0,85, validade convergente com valores de correlação acima 0,40 em 85% dos itens e validade divergente com valores de ajuste superiores a 75%. A versão brasileira do DISABKIDS® - CFM certamente se constituirá em um instrumento válido e confiável para a mensuração da qualidade de vida de crianças e adolescentes brasileiros com fibrose cística.

  13. Seletividade de herbicidas pós-emergentes aplicados na soja geneticamente modificada Selectivity of post-emergence herbicides applied on genetically modified soybeans

    Directory of Open Access Journals (Sweden)

    M.E.F. Neto

    2009-06-01

    Full Text Available O experimento foi instalado em área de plantio comercial de soja Roundup Ready®, na região do Pontal do Paranapanema, no município de Euclides da Cunha Paulista-SP, localizada a 20º 43' 11'' S e 50º 10' 20'' W, com uma altitude de 270 m. A fase experimental foi conduzida de dezembro de 2006 a abril de 2007, sob sistema plantio direto, com uma temperatura média de 25 ºC e índice pluviométrico de 800 mm. O solo da área experimental apresenta classe textural franco-argilo arenosa. Objetivou-se com este trabalho avaliar a eficácia e seletividade de glyphosate na formulação Roundup Transorb®, associado aos herbicidas diclosulam, cloransulam-methyl, flumioxazina e S-metolachlor em duas modalidades de aplicação: única, com associação do glyphosate aos herbicidas; e uma sequencial apenas com glyphosate aos 15 DAA, no manejo das plantas daninhas trapoeraba (Commelina benghalensis e corda-de-viola (Ipomoea triloba durante o cultivo da soja. O experimento foi instalado no delineamento de blocos ao acaso, com 12 tratamentos e quatro repetições. Os tratamentos foram distribuídos em arranjo fatorial acrescido de duas testemunhas: sem capina manual e com capina manual. O arranjo fatorial 2 x 5 contemplou duas condições de aplicação dos herbicidas (única e sequencial e cinco herbicidas (glyphosate, glyphosate + diclosulam, glyphosate + cloransulam-methyl, glyphosate + flumioxazin e glyphosate + S-metolachlor. Nas condições de produtos, épocas de aplicação e doses, os resultados mostraram que o herbicida glyphosate aplicado em dose única ou sequencial e suas combinações com diclosulam e cloransulam-methyl na primeira aplicação não promovem fitointoxicação nas plantas de soja. A combinação com flumioxazin e S-metolachlor promoveu atraso no crescimento das plantas e no fechamento da cultura, em razão do efeito na altura dos indivíduos e comprimento dos ramos. No tratamento com o S-metolachlor, isso pode ser explicado

  14. Dispersão geopolítica da ocorrência de Fasciola hepatica no Estado de Santa Catarina, Brasil Geopolitical dispersion of the occurence of Fasciola hepatica in the State of Santa Catarina, Brazil

    Directory of Open Access Journals (Sweden)

    Nicolau Maués da Serra-Freire

    1992-01-01

    Full Text Available During 12 years feces samples from cows, water buffaloes, sheeps and goats were examined by sequencial tamis filtration to show the occurence of Fasciola hepatica eggs. The material came from 129 municipalities of Santa Catarina State, and 5 g of feces per animal were examined. The occurrence of F. hepatica was confirmed in 64.82% of the municipalities. Considering the host, F. hepatica was confirmed in goats from Florianópolis, São José, São João Batista and Guaramirim municipalities; in sheeps from Brusque, Pomerode, Palhoça and São José; in water buffaloes from 9 and in cows from 86 municipalities. For this study, 13,762 feces samples were examined and in 3,814 the presence of eggs of F. hepatica was demonstrated. The percentage of occurence for host species was 27.86 in cows, 24.72 in water buffaloes, 16.92 in sheeps and 15.66 in goats. By the results it was demonstrated that Itajaí Valley at Southest Hidrographic Basin, in Santa Catarina State is an endemic area of F. hepatica, even though Uruguai Hidrographic Basin was not referred as a geographical record for this parasite.

  15. Combinatorial biosynthesis of cyclic lipopeptide antibiotics: a model for synthetic biology to accelerate the evolution of secondary metabolite biosynthetic pathways.

    Science.gov (United States)

    Baltz, Richard H

    2014-10-17

    Nonribosomal peptide synthetases (NRPSs) are giant multi-enzymes that carry out sequencial assembly line couplings of amino acids to generate linear or cyclic peptides. NRPSs are composed of repeating enzyme domains with modular organization to activate and couple specific amino acids in a particular order. From a synthetic biology perspective, they can be considered as peptide assembly machines composed of devices to couple fatty acids to l-amino acids, l-amino acids to l-amino acids, and d-amino acids to l-amino acids. The coupling devices are composed of specific parts that contain two or more enzyme domains that can be exchanged combinatorially to generate novel peptide assembly machines to produce novel peptides. The potent lipopeptide antibiotics daptomycin and A54145E have identical cyclic depsipeptide ring structures and stereochemistry but have divergent amino acid sequences. As their biosynthetic gene clusters are derived from an ancient ancestral lipopetide pathway, these lipopeptides provided an attractive model to develop combinatorial biosynthesis to generate antibiotics superior to daptomycin. These studies on combinatorial biosynthesis have helped generate guidelines for the successful assembly of NRPS parts and devices that can be used to generate novel lipopeptide structures and have established a basis for future synthetic biology studies to further develop combinatorial biosynthesis as a robust approach to natural product drug discovery.

  16. ANALISA WHAT IF SEBAGAI METODE ANTISIPASI KETERLAMBATAN DURASI PROYEK

    Directory of Open Access Journals (Sweden)

    Ratna S Alifen

    1999-01-01

    Full Text Available A project network is composed of various activities interrelated in a sequencial relationship. If delay occurs on one activity, it will eventually cause the project overall duration to delay. To anticipate the project delays one could accelarate the succeeding activity in the network. Critical Path Method (CPM is a management tool which is widely used in the construction project. In this study “what if” analysis is used to anticipate project delays by accelarating the activities on CPM schedule. The accelaration actions are treated in accordance with additional working hours and man-power in the succeeding activities Abstract in Bahasa Indonesia : Jaringan kerja proyek terdiri dari berbagai jenis aktivitas yang saling berkaitan antara satu dengan yang lain. Bila terjadi keterlambatan pada salah satu jenis aktivitas, sering kali akan menyebabkan keterlambatan durasi proyek secara keseluruhan. Salah satu usaha untuk mengantisipasi keterlambatan durasi proyek adalah dengan melakukan percepatan durasi aktivitas pengikut. Metode Jalur Kritis atau Critical Path Method (CPM merupakan suatu metode penjadwalan proyek yang sudah dikenal dan sering digunakan sebagai sarana manajemen dalam pelaksanaan proyek. Sebuah studi telah dilakukan untuk mengatasi masalah percepatan durasi aktivitas sebagai langkah antisipasi keterlambatan proyek, dengan analisa “what if” yang diterapkan pada jadwal CPM. Percepatan durasi dilakukan pada aktivitas-aktivitas pengikut dengan menambah jumlah jam kerja dan jumlah pekerja pada aktivitas percepatan

  17. Percurso das ações de promoção da saúde na residência multiprofissional: Análise à luz de um referencial europeu.

    Directory of Open Access Journals (Sweden)

    Solange Castro Evangelista

    2017-07-01

    Full Text Available Este estudo objetivou descrever o percurso das ações de Promoção da Saúde na Residência Multiprofissional em Saúde a partir do referencial teórico do CompHP. Trata-se de um estudo descritivo, com abordagem qualitativa, realizado em Brejo Santo, Ceará, no contexto da Residência Multiprofissional, com participação de 16 profissionais residentes. Os dados foram coletados por meio de entrevista semiestruturada e os dados foram organizados conforme Análise de Conteúdo e analisados com base na literatura e referencial teórico do CompHP. Foram construídas quatro categorias que representam os domínios de competências em promoção da saúde que caracterizam um processo sequencial e organizacional das ações de promoção da saúde: a Diagnóstico; b Planejamento; c Implementação; e d Avaliação e Pesquisa. As ações de promoção da saúde na Residência Multiprofissionais demonstraram seguir uma sequência lógica e estruturada condizente com os domínios de competências e etapas processuais de Diagnóstico, Planejamento, Implementação e Avaliação e Pesquisa.

  18. Protective immunity induced in mice by F8.1 and F8.2 antigens purified from Schistosoma mansoni eggs

    Directory of Open Access Journals (Sweden)

    Claudia Campra Ferreira

    1998-01-01

    Full Text Available Schistosoma mansoni soluble egg antigens (SEA were fractionated by isoelectric focusing, resulting in 20 components, characterized by pH, absorbance and protein concentration. The higher absorbance fractions were submitted to electrophoresis, and fraction 8 (F8 presented a specific pattern of bands on its isoelectric point. Protein 3 was observed only on F8, and so, it was utilized to rabbit immunization, in order to evaluate its capacity of inducing protective immunity. IgG antibodies from rabbit anti-F8 serum were coupled to Sepharose, and used to obtain the specific antigen by affinity chromatography. This antigen, submitted to electrophoresis, presented two proteic bands (F8.1 and F8.2, which were transferred to nitrocellulose membrane (PVDF and sequenciated. The homology of F8.2 to known proteins was determined using the Basic Local Alignment Search Tool program (BLASTp. Significant homologies were obtained for the rabbit cytosolic Ca2+ uptake inhibitor, and for the bird a1-proteinase inhibitor. Immunization of mice with F8.1 and F8.2, in the presence of Corynebacterium parvum and Al(OH3 as adjuvant, induced a significant protection degree against challenge infection, as observed by the decrease on worm burden recovered from portal system.

  19. New Insights into Autoinducer-2 Signaling as a Virulence Regulator in a Mouse Model of Pneumonic Plague

    Science.gov (United States)

    Fitts, Eric C.; Andersson, Jourdan A.; Kirtley, Michelle L.; Sha, Jian; Erova, Tatiana E.; Chauhan, Sadhana; Motin, Vladimir L.

    2016-01-01

    ABSTRACT The Enterobacteriaceae family members, including the infamous Yersinia pestis, the causative agent of plague, have a highly conserved interbacterial signaling system that is mediated by the autoinducer-2 (AI-2) quorum-sensing molecule. The AI-2 system is implicated in regulating various bacterial virulence genes in diverse environmental niches. Deletion of the gene encoding the synthetic enzyme for the AI-2 substrate, luxS, leads to either no significant change or, paradoxically, an increase in in vivo bacterial virulence. We showed that deletion of the rbsA and lsrA genes, components of ABC transport systems that interact with AI-2, synergistically disrupted AI-2 signaling patterns and resulted in a more-than-50-fold decrease in Y. pestis strain CO92 virulence in a stringent pneumonic plague mouse model. Deletion of luxS or lsrK (encoding AI-2 kinase) from the ΔrbsA ΔlsrA background strain or complementation of the ΔrbsA ΔlsrA mutant with the corresponding gene(s) reverted the virulence phenotype to that of the wild-type Y. pestis CO92. Furthermore, the administration of synthetic AI-2 in mice infected with the ΔrbsA ΔlsrA ΔluxS mutant strain attenuated this triple mutant to a virulence phenotype similar to that of the ΔrbsA ΔlsrA strain in a pneumonic plague model. Conversely, the administration of AI-2 to mice infected with the ΔrbsA ΔlsrA ΔluxS ΔlsrK mutant did not rescue animals from lethality, indicating the importance of the AI-2–LsrK axis in regulating bacterial virulence. By performing high-throughput RNA sequencing, the potential role of some AI-2-signaling-regulated genes that modulated bacterial virulence was determined. We anticipate that the characterization of AI-2 signaling in Y. pestis will lead to reexamination of AI-2 systems in other pathogens and that AI-2 signaling may represent a broad-spectrum therapeutic target to combat antibiotic-resistant bacteria, which represent a global crisis of the 21st century. IMPORTANCE

  20. How frequent are cardiovascular risk factors in lawyers

    International Nuclear Information System (INIS)

    Ali, J.; Gul, A.M.; Irfan, M.; Querishi, M.S.; Faheem, M.; Khan, S.B.; Shah, S.F.A.; Hifizullah, M.

    2012-01-01

    Objective: The aim of this study was to know the frequency of CVD risk factors in lawyers of Peshawar. Methodology: Data for this study was derived from Peshawar Heart study (PHS). PHS is big trial which is being conducted by Cardiology Department Lady Reading Hospital, Peshawar to determine various cardiovascular risk factors in various occupational groups of Peshawar. Results: A total of 252 lawyers from district Peshawar were recruited in PHS. Male were 249(98.6%) while 03(1.2%) were female. Mean age was 41.37+-9.93 years (range 25 to 79 years). Mean duration of practicing was 13.09 +-10.95 years. Mean duration of regular exercise was 17.02 +- 29.30 minutes and 84 (33.3%) were doing regular exercise and 168(66.7%) were not performing exercise. Out of 252 lawyers 57(22.6%) were cigarette smokers, 12(4.6%) were 2 naswar addicts. Mean BMI was 27.86 +- 4.1 Kg/m and 64.3 %(162) had their BMI 2=27 kg/m. Mean cholesterol was 182.38+-28.70 mg/dl and 42.5 %(107) had their cholesterol =180 mg/dl. Mean RBS of lawyers was 113.78 +- 48.74 mg/dl and 16.7 %( 42) had their RBS of =140 mg/dl. Mean systolic blood pressure and mean diastolic blood pressure were 134.09 +- 19.05 mmHg and 87.66 +- 11.71 mmHg respectively and 38.5%(97) had their systolic =140 mmHg and 58.7(148) had their diastolic blood pressure = 90 mmHg respectively. Out 252 lawyers 24.6%(62) had positive family history of (CAD). Conclusion: Most of the lawyers were obese, indulged in tobacco use, had their RBS and total cholesterol elevated, as well as high systolic and diastolic blood pressure. (author)

  1. Growth of ordered silver nanoparticles in silica film mesostructured with a triblock copolymer PEO-PPO-PEO

    International Nuclear Information System (INIS)

    Bois, L.; Chassagneux, F.; Parola, S.; Bessueille, F.; Battie, Y.; Destouches, N.; Boukenter, A.; Moncoffre, N.; Toulhoat, N.

    2009-01-01

    Elaboration of mesostructured silica films with a triblock copolymer polyethylene oxide-polypropylene oxide-polyethylene oxide, (PEO-PPO-PEO) and controlled growth of silver nanoparticles in the mesostructure are described. The films are characterized using UV-visible optical absorption spectroscopy, TEM, AFM, SEM, X-ray diffraction (XRD) and Rutherford backscattering spectrometry (RBS). Organized arrays of spherical silver nanoparticles with diameter between 5 and 8 nm have been obtained by NaBH 4 reduction. The size and the repartition of silver nanoparticles are controlled by the film mesostructure. The localization of silver nanoparticles exclusively in the upper-side part of the silica-block copolymer film is evidenced by RBS experiment. On the other hand, by using a thermal method, 40 nm long silver sticks can be obtained, by diffusion and coalescence of spherical particles in the silica-block copolymer layer. In this case, migration of silver particles toward the glass substrate-film interface is shown by the RBS experiment. - Graphical abstract: Growth of silver nanoparticles in a mesostructured block copolymer F127-silica film is performed either by a chemical route involving NaBH 4 reduction or by a thermal method. An array of spherical silver nanoparticles with 10 nm diameter on the upper-side of the mesostructured film or silver sticks long of 40 nm with a preferential orientation are obtained according to the method used. a: TEM image of the Fag5SiNB sample illustrating the silver nanoparticles array obtained by the chemical process; b: HR-TEM image of the Fag20Sid2 sample illustrating the silver nanosticks obtained by the thermal process.

  2. Application of the Repetitive Behavior Scale-Revised--Italian version--in preschoolers with autism spectrum disorder.

    Science.gov (United States)

    Fulceri, Francesca; Narzisi, Antonio; Apicella, Fabio; Balboni, Giulia; Baldini, Sara; Brocchini, Jenny; Domenici, Ilaria; Cerullo, Sonia; Igliozzi, Roberta; Cosenza, Angela; Tancredi, Raffaella; Muratori, Filippo; Calderoni, Sara

    2016-01-01

    Restricted repetitive and stereotyped patterns of behavior, interests, and activities (RRB) are mandatory features for a diagnosis of Autism Spectrum Disorder (ASD) according to the Diagnostic and Statistical Manual of mental disorders-fifth edition (DSM-5). Despite the strong diagnostic role of RRB, their expressiveness and their relationship with other clinical/demographic features in ASD is not fully elucidated. The Italian version of the Repetitive Behavior Scale-Revised (RBS-R) was applied to a relatively large sample of preschool-aged children with ASD who underwent a comprehensive clinical assessment. The relationship between RRB and sex, age, non-verbal IQ, autism severity, as well as the diagnostic accuracy of the RBS-R were explored. Stereotyped and Ritualistic/Sameness behaviors were the most common RRB in preschoolers with ASD, without widespread differences between males and females. No significant correlations between RRB and chronological age, or non-verbal IQ were detected. The expressiveness of ritualistic/sameness behaviors positively correlated with autism severity, assessed through the Calibrated Severity Score (CSS) derived from the Autism Diagnostic Observation Schedule (ADOS). Receiver Operator Characteristic (ROC) analysis showed high diagnostic accuracy using the Global Rating Score, which represents the judgment of the parents of as the RRB affect the child's life. However, while the Global Rating Score performed well, the remaining subscales did not. This investigation extends the limited research on early pattern and associated features of RRB in young children with ASD. The use of the RBS-R may increase the knowledge of the RRB complexity and variability and in turn improve the diagnostic and therapeutic procedures within the autistic spectrum. Copyright © 2015 Elsevier Ltd. All rights reserved.

  3. Consequences of phosphate application on glyphosate uptake by roots: Impacts for environmental management practices.

    Science.gov (United States)

    Gomes, Marcelo Pedrosa; Maccario, Sophie; Lucotte, Marc; Labrecque, Michel; Juneau, Philippe

    2015-12-15

    Phosphate (PO4(3-)) fertilization is a common practice in agricultural fields also targets for glyphosate application. Due to their chemical similarities, PO4(3-) and glyphosate compete for soil adsorbing sites, with PO4(3-) fertilization increasing glyphosate bioavailability in the soil solution. After PO4(3-) fertilization, its concentration will be elevated in the soil solution and both PO4(3-) and glyphosate will be readily available for runoff into aquatic ecosystems. In this context, man-made riparian buffer strips (RBS) at the interface of agricultural lands and waterways can be used as a green technology to mitigate water contamination. The plants used in RBS form a barrier to agricultural wastes that can limit runoff, and the ability of these plants to take up these compounds through their roots plays an important role in RBS efficacy. However, the implications of PO4(3-) for glyphosate uptake by roots are not yet clearly demonstrated. Here, we addressed this problem by hydroponically cultivating willow plants in nutrient solutions amended with glyphosate and different concentrations of PO4(3-), assuring full availability of both chemicals to the roots. Using a phosphate carrier inhibitor (phosphonophormic acid-PFA), we found that part of the glyphosate uptake is mediated by PO4(3-) transporters. We observed, however, that PO4(3-) increased glyphosate uptake by roots, an effect that was related to increased root cell membrane stability. Our results indicate that PO4(3-) has an important role in glyphosate physiological effects. Under agricultural conditions, PO4(3-) fertilization can amplify glyphosate efficiency by increasing its uptake by the roots of undesired plants. On the other hand, since simultaneous phosphate and glyphosate runoffs are common, non-target species found near agricultural fields can be affected. Copyright © 2015. Published by Elsevier B.V.

  4. Tapak Perlekatan Reseptor Virus Flu Burung yang Diisolasi dari Berbagai Unggas Sejak tahun 2003 sampai 2008 (RECEPTOR BINDING SITE OF AVIAN INFLUENZA VIRUS H5N1 ISOLATED FROM VARIOUS POULTRIES SINCE 2003 TO 2008

    Directory of Open Access Journals (Sweden)

    Michael Haryadi Wibowo

    2014-08-01

    Full Text Available Avian Influenza (AI is an infectious disease in poultry, caused by type A of avian influenza virus(AIV, in the family of Orthomyxoviridae. Almost all birds’ species are sensitive to the AI. Beside theability to infect various species of poultry. AIV type A has a wide range of host including all bird species,mammals, dan human. Today some scientists reported that the cases of AI in mammals, including humansare increasing. This condition suggests that the AI virus circulated in the field may have some mutationsin the amino acid determinants responsible receptor binding site (RBS. A research was therefore designedto investigate the molecular level of HA gen fragment responsible for receptor binding site of AIV isolatedfrom various poultry since 2003 to 2008. Molecular characterization was based on the amplification ofreceptor binding site of HA gene by reverse transcriptase polymerase chain reaction (RT-PCR. All RTPCRof HA gene positive products were sequenced to determine the nucleotide composition at the targetedfragment. Sequences yielded were analyzed by program Mega 4.0 versions, including multiple alignment,deductive amino acid prediction, and establishment of phylogenetic tree. The results show that all AIVisolates could be determined of some conserved amino acids residues responsible for RBS which indicatethe binding preference of avian like receptor, sialic acid ? 2, 3 galactose except isolate A/Layer/Jabar/MHW-RBS-02/2008 which could be found a deletion of amino acid at position of 129 dan mutation of 151isoleucine into threonine. Phylogenetic study showed that clustering of AIV did not base on species of birdor geographic origin of AI viruses which were studied.

  5. Ion beam analyses of particulate matter in exhaust gas of a ship diesel engine

    Science.gov (United States)

    Furuyama, Yuichi; Fujita, Hirotsugu; Taniike, Akira; Kitamura, Akira

    2011-12-01

    There is an urgent need to reduce emission of the particulate matter (PM) in the exhaust gas from ship diesel engines causing various health hazards and serious environmental pollution. Usually the heavy fuel oil (HFO) for ships is of low quality, and contains various kinds of impurities. Therefore, the emission of PM along with exhaust gas from ship diesel engines is one of the most serious environmental issues. However, the PM fundamental properties are not well known. Therefore, it is important to perform elemental analysis of the PM. The HFO contains sulfur with a relatively high concentration of a few percent. It is important to make quantitative measurements of sulfur in the PM, because this element is poisonous for the human body. In the present work, PM samples were collected from exhaust gas of a test engine, and RBS and PIXE analyses were applied successfully to quantitative analysis of the PM samples. The RBS analysis enabled quantitative analysis of sulfur and carbon in the collected PM, while heavier elements such as vanadium and iron were analyzed quantitatively with the PIXE analysis. It has been found that the concentration ratio of sulfur to carbon was between 0.007 and 0.012, and did not strongly depend on the output power of the engine. The S/ C ratio is approximately equal to the original composition of the HFO used in the present work, 0.01. From the known conversion ratio 0.015 of sulfur in the HFO to sulfates, the conversion ratio of carbon in the HFO to the PM is found to be 0.01-0.02 by the RBS measurements. On the other hand, the PIXE analysis revealed a vanadium enrichment of one order of magnitude in the PM.

  6. Applying Distributed Constraint Optimization Approach to the User Association Problem in Heterogeneous Networks.

    Science.gov (United States)

    Duan, Peibo; Zhang, Changsheng; Mao, Guoqiang; Zhang, Bin

    2017-09-22

    User association has emerged as a distributed resource allocation problem in the heterogeneous networks (HetNets). Although an approximate solution is obtainable using the approaches like combinatorial optimization and game theory-based schemes, these techniques can be easily trapped in local optima. Furthermore, the lack of exploring the relation between the quality of the solution and the parameters in the HetNet [e.g., the number of users and base stations (BSs)], at what levels, impairs the practicability of deploying these approaches in a real world environment. To address these issues, this paper investigates how to model the problem as a distributed constraint optimization problem (DCOP) from the point of the view of the multiagent system. More specifically, we develop two models named each connection as variable (ECAV) and each BS and user as variable (EBUAV). Hereinafter, we propose a DCOP solver which not only sets up the model in a distributed way but also enables us to efficiently obtain the solution by means of a complete DCOP algorithm based on distributed message-passing. Naturally, both theoretical analysis and simulation show that different qualitative solutions can be obtained in terms of an introduced parameter η which has a close relation with the parameters in the HetNet. It is also apparent that there is 6% improvement on the throughput by the DCOP solver comparing with other counterparts when η=3. Particularly, it demonstrates up to 18% increase in the ability to make BSs service more users when the number of users is above 200 while the available resource blocks (RBs) are limited. In addition, it appears that the distribution of RBs allocated to users by BSs is better with the variation of the volume of RBs at the macro BS.

  7. Ethylene production with engineered Synechocystis sp PCC 6803 strains.

    Science.gov (United States)

    Veetil, Vinod Puthan; Angermayr, S Andreas; Hellingwerf, Klaas J

    2017-02-23

    Metabolic engineering and synthetic biology of cyanobacteria offer a promising sustainable alternative approach for fossil-based ethylene production, by using sunlight via oxygenic photosynthesis, to convert carbon dioxide directly into ethylene. Towards this, both well-studied cyanobacteria, i.e., Synechocystis sp PCC 6803 and Synechococcus elongatus PCC 7942, have been engineered to produce ethylene by introducing the ethylene-forming enzyme (Efe) from Pseudomonas syringae pv. phaseolicola PK2 (the Kudzu strain), which catalyzes the conversion of the ubiquitous tricarboxylic acid cycle intermediate 2-oxoglutarate into ethylene. This study focuses on Synechocystis sp PCC 6803 and shows stable ethylene production through the integration of a codon-optimized version of the efe gene under control of the Ptrc promoter and the core Shine-Dalgarno sequence (5'-AGGAGG-3') as the ribosome-binding site (RBS), at the slr0168 neutral site. We have increased ethylene production twofold by RBS screening and further investigated improving ethylene production from a single gene copy of efe, using multiple tandem promoters and by putting our best construct on an RSF1010-based broad-host-self-replicating plasmid, which has a higher copy number than the genome. Moreover, to raise the intracellular amounts of the key Efe substrate, 2-oxoglutarate, from which ethylene is formed, we constructed a glycogen-synthesis knockout mutant (ΔglgC) and introduced the ethylene biosynthetic pathway in it. Under nitrogen limiting conditions, the glycogen knockout strain has increased intracellular 2-oxoglutarate levels; however, surprisingly, ethylene production was lower in this strain than in the wild-type background. Making use of different RBS sequences, production of ethylene ranging over a 20-fold difference has been achieved. However, a further increase of production through multiple tandem promoters and a broad-host plasmid was not achieved speculating that the transcription strength and

  8. Electron tomography and cryo-SEM characterization reveals novel ultrastructural features of host-parasite interaction during Chlamydia abortus infection.

    Science.gov (United States)

    Wilkat, M; Herdoiza, E; Forsbach-Birk, V; Walther, P; Essig, A

    2014-08-01

    Chlamydia (C.) abortus is a widely spread pathogen among ruminants that can be transmitted to women during pregnancy leading to severe systemic infection with consecutive abortion. As a member of the Chlamydiaceae, C. abortus shares the characteristic feature of an obligate intracellular biphasic developmental cycle with two morphological forms including elementary bodies (EBs) and reticulate bodies (RBs). In contrast to other chlamydial species, C. abortus ultrastructure has not been investigated yet. To do so, samples were fixed by high-pressure freezing and processed by different electron microscopic methods. Freeze-substituted samples were analysed by transmission electron microscopy, scanning transmission electron microscopical tomography and immuno-electron microscopy, and freeze-fractured samples were analysed by cryo-scanning electron microscopy. Here, we present three ultrastructural features of C. abortus that have not been reported up to now. Firstly, the morphological evidence that C. abortus is equipped with the type three secretion system. Secondly, the accumulation and even coating of whole inclusion bodies by membrane complexes consisting of multiple closely adjacent membranes which seems to be a C. abortus specific feature. Thirdly, the formation of small vesicles in the periplasmic space of RBs in the second half of the developmental cycle. Concerning the time point of their formation and the fact that they harbour chlamydial components, these vesicles might be morphological correlates of an intermediate step during the process of redifferentiation of RBs into EBs. As this feature has also been shown for C. trachomatis and C. pneumoniae, it might be a common characteristic of the family of Chlamydiaceae.

  9. SINP MSU accelerator facility and applied research

    International Nuclear Information System (INIS)

    Chechenin, N.G.; Ishkhanov, B.S.; Kulikauskas, V.S.; Novikov, L.S.; Pokhil, G.P.; Romanovskii, E.A.; Shvedunov, V.I.; Spasskii, A.V.

    2004-01-01

    Full text: SINP accelerator facility includes 120 cm cyclotron, electrostatic generator with the upper voltage 3.0 MeV, electrostatic generator with the upper voltage 2.5 MeV, Cocroft -Walton generator with the upper voltage 500 keV, 150 keV accelerator for solid microparticles. A new generation of electron beam accelerators has been developed during the last decade. The SINP accelerator facility will be shortly described in the report. A wide range of basic research in nuclear and atomic physics, physics of ion-beam interactions with condensed matter is currently carried out. SINP activity in the applied research is concentrated in the following areas of materials science: - Materials diagnostics with the Rutherford backscattering techniques (RBS) and channeling of ions (RBS/C). A large number of surface ad-layers and multilayer systems for advanced micro- and nano-electronic technology have been investigated. A selected series of examples will be illustrated. - Concentration depth profiles of hydrogen by the elastic recoils detection techniques (ERD). Primarily, the hydrogen depth profiles in perspective materials for thermonuclear reactors have been investigated. - Lattice site locations of hydrogen by a combination of ERD and channeling techniques. This is a new technique which was successfully applied for investigation of hydrogen and hydrogen-defect complexes in silicon for the smart-cut technology. - Light element diagnostics by RBS and nuclear backscattering techniques (NBS). The technique is illustrated by applications for nitrogen concentration profiling in steels. Nitrogen take-up and release, nitrides precipitate formation will be illustrated. - New medium energy ion scattering (MEIS) facility and applications. Ultra-high vacuum and superior energy resolution electrostatic toroidal analyzer is designed to be applied for characterization of composition and structure of several upper atomic layers of materials

  10. Organic pollutant levels in an agricultural watershed: the importance of analyzing multiple matrices for assessing stream water pollution.

    Science.gov (United States)

    Gonzalez, Mariana; Miglioranza, Karina S B; Grondona, Sebastían I; Silva Barni, Maria Florencia; Martinez, Daniel E; Peña, Aránzazu

    2013-04-01

    This study is aimed at analyzing the occurrence and transport of organochlorine pesticides (OCPs), polychlorinated biphenyls (PCBs) and polybrominated diphenyl ethers (PBDEs) in the Quequén Grande river basin, as representative of a catchment under diffuse pollution sources. Pollutant levels in soils, river bottom sediments (RBS), streamwater (Sw), suspended particle materials (SPMs), macrophytes and muscle of silverside were determined by GC-ECD. Soil K(d) values for the current-used insecticides, endosulfans and cypermethrin, were established. Total levels (ng g(-1) dry weight) in soil ranged between 0.07–0.9 for OCPs, 0.03–0.37 for PCBs and 0.01–0.05 for PBDEs. Endosulfan insecticide (α- + b- + sulfate metabolite) represented up to 72.5% of OCPs. The low soil retention for α-endosulfan (K(d): 77) and endosulfan sulfate (K(d): 100) allows their transport to Sw, SPM and RBS. Levels of endosulfan in Sw in some cases exceeded the value postulated by international guidelines for aquatic biota protection (3 ng L(-1)). PCB and PBDE pollution was related to harbour, dumping sites and pile tire burning. Tri and hexa PCB congeners predominated in all matrices and exceeded the quality guideline value of 0.04 ng L(-1) in Sw. Considering levels in silverside muscle, none of the oral reference doses were exceeded, however, PCBs accounted for 18.6% of the total daily allowed ingest for a 70 kg individual. Although the levels of PCBs and OCPs in soil and RBS were low and did not go beyond quality guidelines, these compounds could still represent a risk to aquatic biota and humanbeings, and thus actions towards preventing this situation should be undertaken.

  11. G-paq: a motion control and data acquisition package for ion beam analysis

    International Nuclear Information System (INIS)

    Spizzirri, P.G.; Den Besten, J.L.; Jamieson, D.N.

    1999-01-01

    The analysis of crystalline materials using nuclear microprobe techniques is now commonplace. Channeling contrast microscopy (CCM) and Rutherford Backscattering (RBS) angular two-dimensional scans, which are used to study defects, strain, surface effects and the presence of impurity atoms in crystalline materials, can benefit from automation through computer control. Important criteria for a computer controlled instrument such as this are: suitable operating system (eg. Microsoft Windows), a graphical user interface (GUI), readily available components, cost effectiveness, ease of use, flexibility and scalability. While there are a number of effective RBS channeling angular scanning solutions in use throughout the microprobe community, few can provide this level of application abstraction. Recent trends in software and hardware development have seen the emergence of desktop/laptop personal computer-based virtual instruments. It has been said that the PC is now the most powerful and cost effective approach to building instruments because they can outperform 'blackbox' solutions in computing power, data transfer rates, memory, data storage, graphics, ease of use and familiarity. Other benefits stem from the availability of commercial-off-the-shelf (COTS) components (hardware) that can often provide complex functionality and third party analysis software that can extend the instrument's use beyond the vendor defined limits. This paper discusses a general purpose, data acquisition and motion control solution, G-Paq, based upon the National Instruments LabVIEW hardware and software development environment. Locally developed, this solution uses a minimum of customised components, is compatible with the principals of Good Laboratory Practice (GLP), is easy to use, has a graphical user interface and is flexible. While it has been developed for nuclear microprobe based channeling contrast microscopy using a specimen stage goniometer, its application to general motion control

  12. Unusual Application Of Ion Beam Analysis For The Study Of Surface Layers On Materials Relevant To Cultural Heritage

    International Nuclear Information System (INIS)

    Mathis, F.; Salomon, J.; Aucouturier, M.; Trocellier, P.

    2006-01-01

    Recently a new thematic of research -- intentional patinas on antic copper-base objects -- lead the AGLAE (Accelerateur Grand Louvre pour l'Analyse Elementaire) team of the C2RMF (Centre de Recherche et de Restauration des Musees de France) to improve its methods of analyzing thin surface layers both in their elemental composition and in-depth elemental distribution. A new beam extraction set-up containing a particle detector has been developed in order to use a 6 MeV alpha beam both in PIXE and RBS mode and to monitor precisely the ion dose received by the sample. Both RBS and ionization cross sections were assessed in order to make sure that the analysis can be quantitative. This set up allows great progresses in the understanding of both nature and structure of this very particular oxide layer obtained in the antiquity by chemical treatment on copper alloys, containing gold and/or silver and presenting very interesting properties of color and stability.Besides the non destructive properties of the IBA in external beam mode, this method of analyzing allows the study of samples in interaction with its environment. This was used to study the high temperature oxidation of Cu-Sn alloys using a furnace developed in order to heat a sample and analyze it in RBS mode at the same time. This new way of studying the growth of oxide layers permits to understand the oxidation mechanism of this system and to propose an experimental model for the identification of oxide layers due to an exposition to a high temperature, model needed for a long time by curators in charge of the study and the conservation of archaeological bronzes

  13. Investigation of fish otoliths by combined ion beam analysis

    International Nuclear Information System (INIS)

    Huszank, R.; Simon, A.; Keresztessy, K.

    2008-01-01

    Complete text of publication follows. This work was implemented within the framework of the Hungarian Ion beam Physics Platform (http://hipp.atomki.hu/). Otoliths are small structures, 'the ear stones' of a fish, and are used to detect acceleration and orientation. They are composed of a combination of protein matrix and calcium carbonate (CaCO 3 ) forming aragonite micro crystals. They have an annually deposited layered conformation with a microstructure corresponding to the seasonal and daily increments. Trace elements, such as Sr, Zn, Fe etc., are also incorporated into the otolith from the environment and the nutrition. The elemental distribution of the otolith of fresh water fish burbot (Lota lota L.) collected in Hungary was measured with Elastic Recoil Detection Analysis (ERDA), Rutherford backscattering spectrometry (RBS) and Particle Induced X-ray Emission (PIXE) at the Nuclear Microprobe Facility of HAS ATOMKI. The spatial 3D structure of the otolith could be observed with a sub-micrometer resolution. It is confirmed that the aragonite micro-crystals are covered by an organic layer and there are some protein rich regions in the otolith, too. By applying the RBSMAST code developed for RBS on macroscopic structure, it was proven that the orientation of the needle shaped aragonite crystals is considerably different at adjacent locations in the otolith. The organic and inorganic component of the otolith could be set apart in the depth selective hydrogen and calcium maps derived by micro- ERDA and micro-RBS. Similar structural analysis could be done near the surface by combining the C, O and Ca elemental maps determined by micro-PIXE measurements. It was observed that the trace metal Zn is bound to the protein component. Acknowledgements This work was partially supported by the Hungarian OTKA Grant No. T046238 and the EU cofunded Economic Competitiveness Operative Programme (GVOP-3.2.1.-2004-04-0402/3.0)

  14. Dense and nanometric electronic excitations induced by swift heavy ions in an ionic CaF2 crystal: Evidence for two thresholds of damage creation

    Science.gov (United States)

    Toulemonde, M.; Benyagoub, A.; Trautmann, C.; Khalfaoui, N.; Boccanfuso, M.; Dufour, C.; Gourbilleau, F.; Grob, J. J.; Stoquert, J. P.; Costantini, J. M.; Haas, F.; Jacquet, E.; Voss, K.-O.; Meftah, A.

    2012-02-01

    CaF2 crystals as representatives of the class of ionic nonamorphizable insulators were irradiated with many different swift heavy ions of energy above 0.5 MeV/u providing a broad range of electronic energy losses (Se). Beam-induced modifications were characterized by Channeling Rutherford Backscattering Spectrometry (C-RBS) and x-ray diffraction (XRD), complemented by transmission electron microscopy (TEM). Results from C-RBS give evidence of significant damage appearing above a Se threshold of 5 ± 2 keV/nm. A second critical Se appears around 18 ± 3 keV/nm; below this value the damage as function of ion fluence saturates at 20%, while above this the damage saturation level increases with Se, reaching ˜60% for ions of Se = 30 keV/nm. XRD measurements also show effects indicating two threshold values. Above 5 keV/nm, the widths of the XRD reflection peaks increase due to the formation of nanograins, as seen by TEM, while a significant decrease of the peak areas only occurs above 18 keV/nm. The track radii deduced from C-RBS measurements are in agreement with those extracted from the fluence evolution of the widths of the XRD peaks. Moreover, track radii deduced from the peak area analysis are slightly smaller but in agreement with previous track observations by high resolution electron microscopy. Calculations based on the inelastic thermal spike model suggest that the lower threshold at 5 keV/nm is linked to the quenching of the molten phase, whereas the threshold at 18 keV/nm can be interpreted as quenching of the boiling phase. The results of CaF2 are compared with other nonamorphizable materials such as LiF and UO2.

  15. Influenza human monoclonal antibody 1F1 interacts with three major antigenic sites and residues mediating human receptor specificity in H1N1 viruses.

    Directory of Open Access Journals (Sweden)

    Tshidi Tsibane

    Full Text Available Most monoclonal antibodies (mAbs to the influenza A virus hemagglutinin (HA head domain exhibit very limited breadth of inhibitory activity due to antigenic drift in field strains. However, mAb 1F1, isolated from a 1918 influenza pandemic survivor, inhibits select human H1 viruses (1918, 1943, 1947, and 1977 isolates. The crystal structure of 1F1 in complex with the 1918 HA shows that 1F1 contacts residues that are classically defined as belonging to three distinct antigenic sites, Sa, Sb and Ca(2. The 1F1 heavy chain also reaches into the receptor binding site (RBS and interacts with residues that contact sialoglycan receptors and determine HA receptor specificity. The 1F1 epitope is remarkably similar to the previously described murine HC63 H3 epitope, despite significant sequence differences between H1 and H3 HAs. Both antibodies potently inhibit receptor binding, but only HC63 can block the pH-induced conformational changes in HA that drive membrane fusion. Contacts within the RBS suggested that 1F1 may be sensitive to changes that alter HA receptor binding activity. Affinity assays confirmed that sequence changes that switch the HA to avian receptor specificity affect binding of 1F1 and a mAb possessing a closely related heavy chain, 1I20. To characterize 1F1 cross-reactivity, additional escape mutant selection and site-directed mutagenesis were performed. Residues 190 and 227 in the 1F1 epitope were found to be critical for 1F1 reactivity towards 1918, 1943 and 1977 HAs, as well as for 1I20 reactivity towards the 1918 HA. Therefore, 1F1 heavy-chain interactions with conserved RBS residues likely contribute to its ability to inhibit divergent HAs.

  16. Physical properties and interface studies of YBa sub 2 Cu sub 3 O sub 7 thin films deposited by laser ablation on Si (111) with buffer layer

    Energy Technology Data Exchange (ETDEWEB)

    Blank, D.H.A.; Aarnink, W.A.M.; Flokstra, J.; Rogalla, H.; Silfhout, A. van (Univ. of Twente, Dept. of Applied Physics, Enschede (Netherlands))

    1990-10-15

    The physical properties of laser-deposited YBaCuO on Si using a single buffer layer of ZrO{sub 2} and a double layer of NiSi{sub 2} and ZrO{sub 2} have been studied. The influence of the deposition temperature has been investigated. Interface studies were performed by RBS and SAM. SEM pictures, resistivity and critical current measurements complete this study. The granularity of the films is very important for the diffusion of the Si. (orig.).

  17. Characterization of a Minimal pKW2124 Replicon from Weissella cibaria KLC140 and Its Application for the Construction of the Weissella Expression Vector pKUCm1

    Directory of Open Access Journals (Sweden)

    Hye-Jin eKu

    2015-02-01

    Full Text Available A 2.1-kb plasmid was previously isolated from Weissella cibaria KLC140 in kimchi and cloned into pUC19 along with the slpA and gfp genes, resulting in an 8.6-kb pKWCSLGFP construct for use as a novel surface display vector. To reduce the size of the vector, the minimal replicon of pKW2124 was determined. The pKW2124 plasmid contains a putative origin of replication (ori, a potential ribosomal binding site (RBS, and the repA gene encoding a plasmid replication protein. To conduct the minimal replicon experiment, three different PCR products (MR1, ori + RBS + repA; MR2, RBS + repA; MR2’, repA; MR3, fragment of repA were obtained and cloned into pUC19 (pKUCm1, pKUCm2, and pKUCm3, respectively containing the chloramphenicol acetyltransferase (CAT gene. These three constructed vectors were electroporated into W. confusa ATCC 10881 with different transformation efficiencies of 1.5×105 CFU/μg, 1.3×101 CFU/μg, and no transformation, respectively, suggesting that the putative ori, RBS, and repA gene are essential for optimum plasmid replication. Subsequent segregational plasmid stability testing of pKUCm1 and pKUCm2 showed that the vector pKUCm1 is highly stable up to 100 generations but pKUCm2 was completely lost after 60 generations, suggesting that the putative ori may be important for plasmid stability in the host strain. In addition, a host range test of pKUCm1 revealed that it has a broad host range spectrum including Weissella, Lactococcus, Leuconostoc, and even Lactobacillus. To verify the application of pKUCm1, the β-galactosidase gene and its promoter region from W. cibaria KSD1 were cloned in the vector, resulting in pKUGal. Expression of the β-galactosidase gene was confirmed using blue-white screening after IPTG induction. The small and stable pKUGal vector will be useful for gene transfer, expression, and manipulation in the Weissella genome and in other lactic acid bacteria.

  18. Density measurement of amorphous SixGe1-x alloys

    International Nuclear Information System (INIS)

    Laaziri, K.; Roorda, S.; Cliche, L.

    1994-01-01

    The atomic density of amorphous Si x Ge 1-x alloys (x = 1, 0.85, 0.67, 0.50, 0.20 and 0) has been measured. Mono-crystalline Si x Ge 1-x layers were implanted with 1.50-2.75 MeV Si 2+ and Ge 2+ ions to produce the amorphous material. Using surface profilometry and RBS/channeling, it was found that amorphous alloys are less dense than the crystalline alloys, and that Vegard's law underestimates the a-Si x Ge 1-x density. (orig.)

  19. Stagnant or growing: Can management sciences evolve beyond known business challenges?

    Directory of Open Access Journals (Sweden)

    Geoff Goldman

    2011-12-01

    Full Text Available As global markets embark on some serious introspection after the global crisis of 2008, many business decision makers are asking "How did this happen?" What has become clear, however, is that we are stumbling from one business crisis to another. First it was corporate scandals such as Enron, Parmalat and Fidentia. Then came the financial crisis and the dire straits of, inter alia, Merrill Lynch, RBS, and Lehmann Brothers. Luckily, perhaps, it is not known what and when the next crisis will be. What is certain is that it will come. This begs the question: does business ever learn from what has gone before?

  20. Study of Cu+, Ag+ and Au+ ion implantation into silicate glasses

    Czech Academy of Sciences Publication Activity Database

    Švecová, B.; Nekvindová, P.; Macková, Anna; Malinský, Petr; Kolitsch, A.; Machovič, V.; Stara, S.; Míka, M.; Špirková, J.

    2010-01-01

    Roč. 356, 44-49 (2010), s. 2468-2472 ISSN 0022-3093. [XII International Conference on the Physics of Non-Crystalline Solids. Foz do Iguaçu, PR, Brazil, 06.09.-09.09.2009] R&D Projects: GA MŠk(CZ) LC06041; GA ČR GA106/09/0125 Institutional research plan: CEZ:AV0Z10480505 Keywords : Ion implantation * Silicate glass es * Metal nanoparticles * RBS Subject RIV: BG - Nuclear, Atomic and Molecular Physics, Colliders Impact factor: 1.483, year: 2010